F491503
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1194 | 539 | 2388 | 153 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2791355199|2793077974 |
| Length | 186 |
| Sequence | AIRDNFSRCEAAPGCAALHPGYDALQSEINGGPMTPQLETRYVFTITARIGEVTSAGEIGTGVRRIIPIIGGEVRGEQVNGKVLPFGADFQIIRPNELIELEAKYAFETDDGAVVYVENKGLRFGPVELLQKLKRGEPVDPKLIYFRTVPKFETGAPKYRWLMENLFIASAARHADRVVIDVHQVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 87 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 88 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 89 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 192 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 201 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 202 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 203 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 219 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 220 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 221 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 222 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 223 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 225 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 234 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 240 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 250 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 257 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 258 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 259 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 260 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 261 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 262 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 263 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 264 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 265 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 266 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 269 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 270 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 271 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 351 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 352 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 353 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 354 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 355 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 356 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 359 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 360 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 361 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 365 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 366 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 367 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 368 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 369 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 370 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 371 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 372 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 373 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 374 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 375 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 405 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 406 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 409 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 412 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 419 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 422 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 423 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 426 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 427 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 428 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 429 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 430 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 431 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 432 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 433 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 434 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 435 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 436 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 437 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 438 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 439 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 440 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 441 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 442 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 443 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 444 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 445 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 446 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 447 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 448 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 449 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 450 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 451 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 452 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 453 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 454 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 455 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 456 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 457 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 458 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 459 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 460 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 461 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 462 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 463 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 464 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 465 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 466 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 467 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 468 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 469 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 470 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 471 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 473 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 2791355199 | |||
| 475 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 476 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 477 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 478 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 479 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 480 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 481 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 482 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 483 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 484 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 485 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 486 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 487 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 488 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 489 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 490 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 491 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 492 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 493 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 494 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 495 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 496 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 497 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 498 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 499 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 500 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 501 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 502 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 503 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 504 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 505 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 506 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 507 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 508 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 509 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 510 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 511 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 512 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 513 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 514 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 515 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 516 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 517 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 518 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 519 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 520 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 521 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 522 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 523 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 524 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 525 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 526 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 527 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 528 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 529 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 530 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 531 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 532 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 533 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 534 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 535 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 536 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 537 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 538 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 539 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.47 |
| Metatranscriptomes | 0.08 |
| Isolates | 5.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.33 |
| Nodule | 5.28 |
| Rhizoplane | 5.86 |
| Rhizosphere | 67.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10006399 | 3300001989 | Bacteria | 4447 |
| 2 | JGI25406J46586_10022537 | 3300003203 | Bacteria | 2506 |
| 3 | JGI25153J46596_10003608 | 3300003215 | Bacteria | 8589 |
| 4 | JGI25153J46596_10004959 | 3300003215 | Bacteria | 7069 |
| 5 | JGI25153J46596_10006371 | 3300003215 | Bacteria | 5987 |
| 6 | JGI25160J50197_1018792 | 3300003354 | Bacteria | 2141 |
| 7 | JGI25404J52841_10016499 | 3300003659 | Bacteria | 1602 |
| 8 | JGI25404J52841_10023848 | 3300003659 | Bacteria | 1319 |
| 9 | JGI25404J52841_10024822 | 3300003659 | Bacteria | 1291 |
| 10 | Ga0055543_1052251 | 3300004625 | Bacteria | 668 |
| 11 | Ga0065165_1001167 | 3300005262 | Bacteria | 30545 |
| 12 | Ga0070658_10196084 | 3300005327 | Bacteria | 1703 |
| 13 | Ga0070658_10283368 | 3300005327 | Bacteria | 1411 |
| 14 | Ga0070658_10381761 | 3300005327 | Bacteria | 1209 |
| 15 | Ga0070658_10396113 | 3300005327 | Bacteria | 1186 |
| 16 | Ga0070658_11209812 | 3300005327 | Bacteria | 657 |
| 17 | Ga0070676_10079748 | 3300005328 | Bacteria | 1983 |
| 18 | Ga0070676_10379389 | 3300005328 | Bacteria | 979 |
| 19 | Ga0070690_100560287 | 3300005330 | Bacteria | 863 |
| 20 | Ga0070670_100153306 | 3300005331 | Bacteria | 1995 |
| 21 | Ga0070677_10611733 | 3300005333 | Bacteria | 605 |
| 22 | Ga0068869_100039611 | 3300005334 | Bacteria | 3365 |
| 23 | Ga0068869_100237260 | 3300005334 | Bacteria | 1451 |
| 24 | Ga0068869_100240733 | 3300005334 | Bacteria | 1442 |
| 25 | Ga0068869_100316965 | 3300005334 | Bacteria | 1263 |
| 26 | Ga0070666_10151911 | 3300005335 | Bacteria | 1616 |
| 27 | Ga0070666_10198061 | 3300005335 | Bacteria | 1413 |
| 28 | Ga0070680_100469175 | 3300005336 | Bacteria | 1076 |
| 29 | Ga0070682_101517579 | 3300005337 | Bacteria | 577 |
| 30 | Ga0068868_100040865 | 3300005338 | Bacteria | 3611 |
| 31 | Ga0068868_100483032 | 3300005338 | Bacteria | 1082 |
| 32 | Ga0068868_101014153 | 3300005338 | Bacteria | 760 |
| 33 | Ga0068868_101140663 | 3300005338 | Bacteria | 719 |
| 34 | Ga0070661_100058873 | 3300005344 | Bacteria | 2816 |
| 35 | Ga0070661_100165332 | 3300005344 | Bacteria | 1678 |
| 36 | Ga0070668_100362475 | 3300005347 | Bacteria | 1229 |
| 37 | Ga0070668_100616553 | 3300005347 | Bacteria | 950 |
| 38 | Ga0070668_100910678 | 3300005347 | Bacteria | 786 |
| 39 | Ga0070668_101351939 | 3300005347 | Bacteria | 648 |
| 40 | Ga0070669_100095141 | 3300005353 | Bacteria | 2239 |
| 41 | Ga0070669_100385403 | 3300005353 | Bacteria | 1144 |
| 42 | Ga0070675_100211821 | 3300005354 | Bacteria | 1684 |
| 43 | Ga0070671_100116309 | 3300005355 | Bacteria | 2248 |
| 44 | Ga0070671_100425391 | 3300005355 | Bacteria | 1138 |
| 45 | Ga0070671_100565108 | 3300005355 | Bacteria | 981 |
| 46 | Ga0070671_100581789 | 3300005355 | Bacteria | 967 |
| 47 | Ga0070671_100632877 | 3300005355 | Bacteria | 926 |
| 48 | Ga0070671_101352816 | 3300005355 | Bacteria | 629 |
| 49 | Ga0070674_100617891 | 3300005356 | Bacteria | 918 |
| 50 | Ga0070674_101096692 | 3300005356 | Bacteria | 703 |
| 51 | Ga0070673_100247812 | 3300005364 | Bacteria | 1551 |
| 52 | Ga0070667_100706940 | 3300005367 | Bacteria | 933 |
| 53 | Ga0070667_100932570 | 3300005367 | Bacteria | 809 |
| 54 | Ga0070709_10001520 | 3300005434 | Bacteria | 12532 |
| 55 | Ga0070709_10008885 | 3300005434 | Bacteria | 5530 |
| 56 | Ga0070714_100005907 | 3300005435 | Bacteria | 9391 |
| 57 | Ga0070714_101141603 | 3300005435 | Bacteria | 760 |
| 58 | Ga0070713_100331509 | 3300005436 | Bacteria | 1408 |
| 59 | Ga0070713_100886729 | 3300005436 | Bacteria | 858 |
| 60 | Ga0070710_10000733 | 3300005437 | Bacteria | 15629 |
| 61 | Ga0070710_10014290 | 3300005437 | Bacteria | 3994 |
| 62 | Ga0070710_10342128 | 3300005437 | Bacteria | 988 |
| 63 | Ga0070711_100001130 | 3300005439 | Bacteria | 14272 |
| 64 | Ga0070711_100005326 | 3300005439 | Bacteria | 7689 |
| 65 | Ga0070711_100558104 | 3300005439 | Bacteria | 951 |
| 66 | Ga0070700_100054382 | 3300005441 | Bacteria | 2501 |
| 67 | Ga0070663_100148671 | 3300005455 | Bacteria | 1795 |
| 68 | Ga0070663_100168859 | 3300005455 | Bacteria | 1689 |
| 69 | Ga0070663_100390385 | 3300005455 | Bacteria | 1135 |
| 70 | Ga0070678_100024391 | 3300005456 | Bacteria | 4048 |
| 71 | Ga0070678_100115610 | 3300005456 | Bacteria | 2106 |
| 72 | Ga0070678_101261298 | 3300005456 | Bacteria | 687 |
| 73 | Ga0070662_100052852 | 3300005457 | Bacteria | 2939 |
| 74 | Ga0070662_100081245 | 3300005457 | Bacteria | 2414 |
| 75 | Ga0070662_100182385 | 3300005457 | Bacteria | 1655 |
| 76 | Ga0070662_100285527 | 3300005457 | Bacteria | 1336 |
| 77 | Ga0070681_10211895 | 3300005458 | Bacteria | 1853 |
| 78 | Ga0070681_10569120 | 3300005458 | Bacteria | 1047 |
| 79 | Ga0070681_10921359 | 3300005458 | Bacteria | 792 |
| 80 | Ga0068867_100244819 | 3300005459 | Bacteria | 1456 |
| 81 | Ga0068867_100274201 | 3300005459 | Bacteria | 1381 |
| 82 | Ga0068867_100369011 | 3300005459 | Bacteria | 1203 |
| 83 | Ga0070706_100740746 | 3300005467 | Bacteria | 911 |
| 84 | Ga0070707_100452275 | 3300005468 | Bacteria | 1245 |
| 85 | Ga0070698_100427261 | 3300005471 | Bacteria | 1259 |
| 86 | Ga0070698_100430652 | 3300005471 | Bacteria | 1254 |
| 87 | Ga0070698_100483081 | 3300005471 | Bacteria | 1176 |
| 88 | Ga0070699_101088599 | 3300005518 | Bacteria | 733 |
| 89 | Ga0070679_100080757 | 3300005530 | Bacteria | 3241 |
| 90 | Ga0070679_100126592 | 3300005530 | Bacteria | 2537 |
| 91 | Ga0070697_100096466 | 3300005536 | Bacteria | 2453 |
| 92 | Ga0068853_100037982 | 3300005539 | Bacteria | 4100 |
| 93 | Ga0068853_100407464 | 3300005539 | Bacteria | 1273 |
| 94 | Ga0068853_100824905 | 3300005539 | Bacteria | 889 |
| 95 | Ga0070672_101310748 | 3300005543 | Bacteria | 647 |
| 96 | Ga0070696_100171166 | 3300005546 | Bacteria | 1606 |
| 97 | Ga0070693_100107854 | 3300005547 | Bacteria | 1707 |
| 98 | Ga0070693_100591800 | 3300005547 | Bacteria | 800 |
| 99 | Ga0070665_100004629 | 3300005548 | Bacteria | 14379 |
| 100 | Ga0070665_100090496 | 3300005548 | Bacteria | 3065 |
| 101 | Ga0070665_100105979 | 3300005548 | Bacteria | 2813 |
| 102 | Ga0070665_100201348 | 3300005548 | Bacteria | 1991 |
| 103 | Ga0070665_100505908 | 3300005548 | Bacteria | 1219 |
| 104 | Ga0070665_100744167 | 3300005548 | Bacteria | 993 |
| 105 | Ga0070665_100829596 | 3300005548 | Bacteria | 938 |
| 106 | Ga0070665_101263734 | 3300005548 | Bacteria | 748 |
| 107 | Ga0068855_100077128 | 3300005563 | Bacteria | 3866 |
| 108 | Ga0068855_100099019 | 3300005563 | Bacteria | 3358 |
| 109 | Ga0068855_100236674 | 3300005563 | Bacteria | 2042 |
| 110 | Ga0068855_100817199 | 3300005563 | Bacteria | 990 |
| 111 | Ga0070664_100087892 | 3300005564 | Bacteria | 2687 |
| 112 | Ga0070664_100513061 | 3300005564 | Bacteria | 1106 |
| 113 | Ga0068854_100902723 | 3300005578 | Bacteria | 777 |
| 114 | Ga0068854_101024358 | 3300005578 | Bacteria | 732 |
| 115 | Ga0068856_100205397 | 3300005614 | Bacteria | 1985 |
| 116 | Ga0070702_100282790 | 3300005615 | Bacteria | 1140 |
| 117 | Ga0070702_100426556 | 3300005615 | Bacteria | 956 |
| 118 | Ga0068852_100067797 | 3300005616 | Bacteria | 3120 |
| 119 | Ga0068852_100156188 | 3300005616 | Bacteria | 2125 |
| 120 | Ga0068852_100301187 | 3300005616 | Bacteria | 1552 |
| 121 | Ga0068852_101141836 | 3300005616 | Bacteria | 800 |
| 122 | Ga0068852_101418258 | 3300005616 | Bacteria | 717 |
| 123 | Ga0068852_101606654 | 3300005616 | Bacteria | 673 |
| 124 | Ga0068859_100273153 | 3300005617 | Bacteria | 1782 |
| 125 | Ga0068859_100719402 | 3300005617 | Bacteria | 1088 |
| 126 | Ga0068859_101111325 | 3300005617 | Bacteria | 869 |
| 127 | Ga0068859_101763055 | 3300005617 | Bacteria | 684 |
| 128 | Ga0068864_100264613 | 3300005618 | Bacteria | 1600 |
| 129 | Ga0068864_101421818 | 3300005618 | Bacteria | 696 |
| 130 | Ga0068866_10039340 | 3300005718 | Bacteria | 2335 |
| 131 | Ga0068861_100076821 | 3300005719 | Bacteria | 2603 |
| 132 | Ga0068861_100119779 | 3300005719 | Bacteria | 2121 |
| 133 | Ga0068861_100707850 | 3300005719 | Bacteria | 936 |
| 134 | Ga0068861_100724546 | 3300005719 | Bacteria | 926 |
| 135 | Ga0068861_100836656 | 3300005719 | Bacteria | 867 |
| 136 | Ga0068861_101507593 | 3300005719 | Bacteria | 660 |
| 137 | Ga0068870_10281582 | 3300005840 | Bacteria | 1043 |
| 138 | Ga0068870_10324289 | 3300005840 | Bacteria | 979 |
| 139 | Ga0068863_100339344 | 3300005841 | Bacteria | 1462 |
| 140 | Ga0068863_101413576 | 3300005841 | Bacteria | 704 |
| 141 | Ga0068858_100060026 | 3300005842 | Bacteria | 3515 |
| 142 | Ga0068858_100317108 | 3300005842 | Bacteria | 1489 |
| 143 | Ga0068858_101242336 | 3300005842 | Bacteria | 733 |
| 144 | Ga0068860_100141032 | 3300005843 | Bacteria | 2316 |
| 145 | Ga0068860_100421243 | 3300005843 | Bacteria | 1323 |
| 146 | Ga0068862_100196039 | 3300005844 | Bacteria | 1819 |
| 147 | Ga0068862_100212955 | 3300005844 | Bacteria | 1746 |
| 148 | Ga0068862_100260305 | 3300005844 | Bacteria | 1583 |
| 149 | Ga0068862_100309934 | 3300005844 | Bacteria | 1454 |
| 150 | Ga0068862_101124046 | 3300005844 | Bacteria | 781 |
| 151 | Ga0081455_10080519 | 3300005937 | Bacteria | 2670 |
| 152 | Ga0081455_10127351 | 3300005937 | Bacteria | 1996 |
| 153 | Ga0081455_10157722 | 3300005937 | Bacteria | 1742 |
| 154 | Ga0081540_1002866 | 3300005983 | Bacteria | 13942 |
| 155 | Ga0081540_1005656 | 3300005983 | Bacteria | 9295 |
| 156 | Ga0081540_1016160 | 3300005983 | Bacteria | 4686 |
| 157 | Ga0081540_1021799 | 3300005983 | Bacteria | 3801 |
| 158 | Ga0081540_1024467 | 3300005983 | Bacteria | 3504 |
| 159 | Ga0081540_1027780 | 3300005983 | Bacteria | 3196 |
| 160 | Ga0081540_1039864 | 3300005983 | Bacteria | 2457 |
| 161 | Ga0081540_1074197 | 3300005983 | Bacteria | 1560 |
| 162 | Ga0081540_1160389 | 3300005983 | Bacteria | 873 |
| 163 | Ga0081539_10000157 | 3300005985 | Bacteria | 158278 |
| 164 | Ga0081539_10037110 | 3300005985 | Bacteria | 2906 |
| 165 | Ga0070717_10008111 | 3300006028 | Bacteria | 7834 |
| 166 | Ga0075365_10070542 | 3300006038 | Bacteria | 2350 |
| 167 | Ga0075365_10085860 | 3300006038 | Bacteria | 2138 |
| 168 | Ga0075365_10125077 | 3300006038 | Bacteria | 1776 |
| 169 | Ga0075365_10131480 | 3300006038 | Bacteria | 1732 |
| 170 | Ga0075365_10132947 | 3300006038 | Bacteria | 1723 |
| 171 | Ga0075365_10227586 | 3300006038 | Bacteria | 1309 |
| 172 | Ga0075368_10092765 | 3300006042 | Bacteria | 1235 |
| 173 | Ga0075368_10256249 | 3300006042 | Bacteria | 748 |
| 174 | Ga0075363_100002704 | 3300006048 | Bacteria | 7338 |
| 175 | Ga0075363_100125558 | 3300006048 | Bacteria | 1436 |
| 176 | Ga0075364_10035757 | 3300006051 | Bacteria | 3210 |
| 177 | Ga0075364_10144996 | 3300006051 | Bacteria | 1598 |
| 178 | Ga0075364_10176908 | 3300006051 | Bacteria | 1443 |
| 179 | Ga0075364_10270559 | 3300006051 | Bacteria | 1155 |
| 180 | Ga0075364_10930453 | 3300006051 | Bacteria | 591 |
| 181 | Ga0070715_10278916 | 3300006163 | Bacteria | 885 |
| 182 | Ga0070716_100268189 | 3300006173 | Bacteria | 1172 |
| 183 | Ga0070716_100556967 | 3300006173 | Bacteria | 856 |
| 184 | Ga0070716_100763611 | 3300006173 | Bacteria | 745 |
| 185 | Ga0070712_100002371 | 3300006175 | Bacteria | 11602 |
| 186 | Ga0070712_100556936 | 3300006175 | Bacteria | 966 |
| 187 | Ga0075362_10047780 | 3300006177 | Bacteria | 1907 |
| 188 | Ga0075362_10113141 | 3300006177 | Bacteria | 1279 |
| 189 | Ga0075362_10175993 | 3300006177 | Bacteria | 1035 |
| 190 | Ga0075362_10400758 | 3300006177 | Bacteria | 692 |
| 191 | Ga0075367_10005584 | 3300006178 | Bacteria | 6264 |
| 192 | Ga0075367_10076759 | 3300006178 | Bacteria | 2016 |
| 193 | Ga0075367_10105118 | 3300006178 | Bacteria | 1729 |
| 194 | Ga0075367_10208934 | 3300006178 | Bacteria | 1220 |
| 195 | Ga0075367_10352705 | 3300006178 | Bacteria | 929 |
| 196 | Ga0075369_10004189 | 3300006186 | Bacteria | 5315 |
| 197 | Ga0075369_10058287 | 3300006186 | Bacteria | 1681 |
| 198 | Ga0075369_10186833 | 3300006186 | Bacteria | 954 |
| 199 | Ga0075369_10190255 | 3300006186 | Bacteria | 946 |
| 200 | Ga0075366_10067116 | 3300006195 | Bacteria | 2134 |
| 201 | Ga0075366_10140574 | 3300006195 | Bacteria | 1459 |
| 202 | Ga0075366_10410474 | 3300006195 | Bacteria | 834 |
| 203 | Ga0097621_100220287 | 3300006237 | Bacteria | 1653 |
| 204 | Ga0075370_10001262 | 3300006353 | Bacteria | 10776 |
| 205 | Ga0075370_10066034 | 3300006353 | Bacteria | 2064 |
| 206 | Ga0075370_10135157 | 3300006353 | Bacteria | 1440 |
| 207 | Ga0075370_10183674 | 3300006353 | Bacteria | 1231 |
| 208 | Ga0068871_100100889 | 3300006358 | Bacteria | 2418 |
| 209 | Ga0068871_100517093 | 3300006358 | Bacteria | 1077 |
| 210 | Ga0068871_100665344 | 3300006358 | Bacteria | 952 |
| 211 | Ga0068871_100829921 | 3300006358 | Bacteria | 854 |
| 212 | Ga0075428_100074682 | 3300006844 | Bacteria | 3703 |
| 213 | Ga0075428_100871338 | 3300006844 | Bacteria | 956 |
| 214 | Ga0075433_10857647 | 3300006852 | Bacteria | 793 |
| 215 | Ga0075434_100087493 | 3300006871 | Bacteria | 3116 |
| 216 | Ga0075434_100469416 | 3300006871 | Bacteria | 1280 |
| 217 | Ga0068865_100008510 | 3300006881 | Bacteria | 6343 |
| 218 | Ga0097620_100273166 | 3300006931 | Bacteria | 1782 |
| 219 | Ga0097620_100719387 | 3300006931 | Bacteria | 1088 |
| 220 | Ga0097620_101111300 | 3300006931 | Bacteria | 869 |
| 221 | Ga0097620_101763323 | 3300006931 | Bacteria | 684 |
| 222 | Ga0099825_1025612 | 3300006941 | Bacteria | 3257 |
| 223 | Ga0099824_1008303 | 3300006942 | Bacteria | 13338 |
| 224 | Ga0099822_1000541 | 3300006943 | Bacteria | 35996 |
| 225 | Ga0099823_1031325 | 3300006944 | Bacteria | 4394 |
| 226 | Ga0075435_100571611 | 3300007076 | Bacteria | 979 |
| 227 | Ga0099794_10118262 | 3300007265 | Bacteria | 1332 |
| 228 | Ga0099794_10166703 | 3300007265 | Bacteria | 1122 |
| 229 | Ga0099795_10078154 | 3300007788 | Bacteria | 1261 |
| 230 | Ga0099795_10146250 | 3300007788 | Bacteria | 965 |
| 231 | Ga0099795_10254010 | 3300007788 | Bacteria | 759 |
| 232 | Ga0105250_10309503 | 3300009092 | Bacteria | 685 |
| 233 | Ga0105250_10394331 | 3300009092 | Bacteria | 613 |
| 234 | Ga0105240_10013303 | 3300009093 | Bacteria | 11310 |
| 235 | Ga0105240_10362741 | 3300009093 | Bacteria | 1640 |
| 236 | Ga0105240_11000465 | 3300009093 | Bacteria | 894 |
| 237 | Ga0105240_11470620 | 3300009093 | Bacteria | 715 |
| 238 | Ga0111539_10456176 | 3300009094 | Bacteria | 1489 |
| 239 | Ga0111539_10657793 | 3300009094 | Bacteria | 1220 |
| 240 | Ga0111539_11471018 | 3300009094 | Bacteria | 790 |
| 241 | Ga0105245_10042563 | 3300009098 | Bacteria | 4053 |
| 242 | Ga0105245_10089665 | 3300009098 | Bacteria | 2827 |
| 243 | Ga0105245_10492023 | 3300009098 | Bacteria | 1241 |
| 244 | Ga0105247_10067424 | 3300009101 | Bacteria | 2230 |
| 245 | Ga0105247_10159213 | 3300009101 | Bacteria | 1493 |
| 246 | Ga0105247_10171621 | 3300009101 | Bacteria | 1442 |
| 247 | Ga0105247_10232180 | 3300009101 | Bacteria | 1253 |
| 248 | Ga0114129_10172553 | 3300009147 | Bacteria | 2947 |
| 249 | Ga0114129_11556122 | 3300009147 | Bacteria | 811 |
| 250 | Ga0105243_10760555 | 3300009148 | Bacteria | 951 |
| 251 | Ga0105243_10816378 | 3300009148 | Bacteria | 921 |
| 252 | Ga0105243_11861817 | 3300009148 | Bacteria | 634 |
| 253 | Ga0105241_10004267 | 3300009174 | Bacteria | 10572 |
| 254 | Ga0105241_10024156 | 3300009174 | Bacteria | 4514 |
| 255 | Ga0105241_10036215 | 3300009174 | Bacteria | 3713 |
| 256 | Ga0105242_10042608 | 3300009176 | Bacteria | 3667 |
| 257 | Ga0105242_10274728 | 3300009176 | Bacteria | 1528 |
| 258 | Ga0105248_10046362 | 3300009177 | Bacteria | 4871 |
| 259 | Ga0105248_10401747 | 3300009177 | Bacteria | 1543 |
| 260 | Ga0105248_10532904 | 3300009177 | Bacteria | 1324 |
| 261 | Ga0105248_11549125 | 3300009177 | Bacteria | 751 |
| 262 | Ga0105248_12285696 | 3300009177 | Bacteria | 616 |
| 263 | Ga0105237_10017841 | 3300009545 | Bacteria | 7357 |
| 264 | Ga0105237_10082678 | 3300009545 | Bacteria | 3202 |
| 265 | Ga0105237_10323997 | 3300009545 | Bacteria | 1545 |
| 266 | Ga0105237_10483707 | 3300009545 | Bacteria | 1244 |
| 267 | Ga0105237_10684936 | 3300009545 | Bacteria | 1032 |
| 268 | Ga0105238_11066560 | 3300009551 | Bacteria | 830 |
| 269 | Ga0105238_12971070 | 3300009551 | Bacteria | 510 |
| 270 | Ga0105249_10231397 | 3300009553 | Bacteria | 1823 |
| 271 | Ga0105249_10750143 | 3300009553 | Bacteria | 1038 |
| 272 | Ga0105249_11861447 | 3300009553 | Bacteria | 674 |
| 273 | Ga0099796_10154143 | 3300010159 | Bacteria | 906 |
| 274 | Ga0105239_10072795 | 3300010375 | Bacteria | 3778 |
| 275 | Ga0105239_10134403 | 3300010375 | Bacteria | 2753 |
| 276 | Ga0105239_10759835 | 3300010375 | Bacteria | 1110 |
| 277 | Ga0105239_11441313 | 3300010375 | Bacteria | 795 |
| 278 | Ga0105246_10151873 | 3300011119 | Bacteria | 1754 |
| 279 | Ga0105246_10411645 | 3300011119 | Bacteria | 1126 |
| 280 | Ga0105246_10524800 | 3300011119 | Bacteria | 1010 |
| 281 | Ga0105246_10538567 | 3300011119 | Bacteria | 998 |
| 282 | Ga0105246_10612107 | 3300011119 | Bacteria | 943 |
| 283 | Ga0105246_10780316 | 3300011119 | Bacteria | 846 |
| 284 | Ga0157370_10115958 | 3300013104 | Bacteria | 2502 |
| 285 | Ga0157370_10267710 | 3300013104 | Bacteria | 1579 |
| 286 | Ga0157369_10580485 | 3300013105 | Bacteria | 1158 |
| 287 | Ga0157369_10630574 | 3300013105 | Bacteria | 1106 |
| 288 | Ga0157369_10645994 | 3300013105 | Bacteria | 1091 |
| 289 | Ga0157374_10156652 | 3300013296 | Bacteria | 2217 |
| 290 | Ga0157374_10516010 | 3300013296 | Bacteria | 1201 |
| 291 | Ga0157374_10641331 | 3300013296 | Bacteria | 1074 |
| 292 | Ga0157378_10091042 | 3300013297 | Bacteria | 2773 |
| 293 | Ga0157378_11737268 | 3300013297 | Bacteria | 671 |
| 294 | Ga0163162_10201665 | 3300013306 | Bacteria | 2118 |
| 295 | Ga0157372_10154292 | 3300013307 | Bacteria | 2652 |
| 296 | Ga0157372_10495804 | 3300013307 | Bacteria | 1424 |
| 297 | Ga0157375_10407254 | 3300013308 | Bacteria | 1526 |
| 298 | Ga0157375_11192575 | 3300013308 | Bacteria | 893 |
| 299 | Ga0163163_10010769 | 3300014325 | Bacteria | 8250 |
| 300 | Ga0163163_10633800 | 3300014325 | Bacteria | 1132 |
| 301 | Ga0163163_10845293 | 3300014325 | Bacteria | 979 |
| 302 | Ga0163163_10878787 | 3300014325 | Bacteria | 960 |
| 303 | Ga0157380_10109852 | 3300014326 | Bacteria | 2315 |
| 304 | Ga0157380_13021209 | 3300014326 | Bacteria | 536 |
| 305 | Ga0182008_10711944 | 3300014497 | Bacteria | 575 |
| 306 | Ga0157377_10362097 | 3300014745 | Bacteria | 976 |
| 307 | Ga0157379_10381576 | 3300014968 | Bacteria | 1293 |
| 308 | Ga0157379_10502781 | 3300014968 | Bacteria | 1124 |
| 309 | Ga0157379_10688993 | 3300014968 | Bacteria | 959 |
| 310 | Ga0157376_10279832 | 3300014969 | Bacteria | 1571 |
| 311 | Ga0157376_11327521 | 3300014969 | Bacteria | 750 |
| 312 | Ga0157376_12293560 | 3300014969 | Bacteria | 579 |
| 313 | Ga0163161_10090485 | 3300017792 | Bacteria | 2264 |
| 314 | Ga0163161_11269528 | 3300017792 | Bacteria | 639 |
| 315 | Ga0209233_1024790 | 3300025261 | Bacteria | 1494 |
| 316 | Ga0209233_1040219 | 3300025261 | Bacteria | 1019 |
| 317 | Ga0209564_1005249 | 3300025295 | Bacteria | 7481 |
| 318 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 319 | Ga0209758_1000711 | 3300025297 | Bacteria | 49164 |
| 320 | Ga0209758_1000764 | 3300025297 | Bacteria | 46385 |
| 321 | Ga0209758_1001468 | 3300025297 | Bacteria | 27665 |
| 322 | Ga0209758_1004096 | 3300025297 | Bacteria | 12498 |
| 323 | Ga0209758_1020867 | 3300025297 | Bacteria | 3078 |
| 324 | Ga0209758_1023868 | 3300025297 | Bacteria | 2748 |
| 325 | Ga0209758_1120108 | 3300025297 | Bacteria | 711 |
| 326 | Ga0207426_1000368 | 3300025302 | Bacteria | 79715 |
| 327 | Ga0207426_1005258 | 3300025302 | Bacteria | 5970 |
| 328 | Ga0209257_1001688 | 3300025304 | Bacteria | 24840 |
| 329 | Ga0209257_1046246 | 3300025304 | Bacteria | 1258 |
| 330 | Ga0207656_10228227 | 3300025321 | Bacteria | 907 |
| 331 | Ga0207696_1074971 | 3300025711 | Bacteria | 938 |
| 332 | Ga0207653_10113249 | 3300025885 | Bacteria | 970 |
| 333 | Ga0207692_10015137 | 3300025898 | Bacteria | 3387 |
| 334 | Ga0207642_10090991 | 3300025899 | Bacteria | 1507 |
| 335 | Ga0207710_10030533 | 3300025900 | Bacteria | 2352 |
| 336 | Ga0207710_10062253 | 3300025900 | Bacteria | 1695 |
| 337 | Ga0207710_10364493 | 3300025900 | Bacteria | 738 |
| 338 | Ga0207688_10044786 | 3300025901 | Bacteria | 2466 |
| 339 | Ga0207688_10243807 | 3300025901 | Bacteria | 1087 |
| 340 | Ga0207680_10082706 | 3300025903 | Bacteria | 2021 |
| 341 | Ga0207680_10151823 | 3300025903 | Bacteria | 1545 |
| 342 | Ga0207685_10115210 | 3300025905 | Bacteria | 1171 |
| 343 | Ga0207699_10001435 | 3300025906 | Bacteria | 11313 |
| 344 | Ga0207699_10014909 | 3300025906 | Bacteria | 4024 |
| 345 | Ga0207645_10093050 | 3300025907 | Bacteria | 1939 |
| 346 | Ga0207645_10226471 | 3300025907 | Bacteria | 1233 |
| 347 | Ga0207645_10536081 | 3300025907 | Bacteria | 794 |
| 348 | Ga0207643_10282726 | 3300025908 | Bacteria | 1029 |
| 349 | Ga0207705_10092997 | 3300025909 | Bacteria | 2210 |
| 350 | Ga0207705_10437836 | 3300025909 | Bacteria | 1013 |
| 351 | Ga0207684_10175591 | 3300025910 | Bacteria | 1847 |
| 352 | Ga0207684_10242516 | 3300025910 | Bacteria | 1555 |
| 353 | Ga0207654_10007028 | 3300025911 | Bacteria | 5670 |
| 354 | Ga0207654_10014303 | 3300025911 | Bacteria | 4099 |
| 355 | Ga0207654_10033366 | 3300025911 | Bacteria | 2853 |
| 356 | Ga0207654_10343487 | 3300025911 | Bacteria | 1026 |
| 357 | Ga0207707_10329438 | 3300025912 | Bacteria | 1317 |
| 358 | Ga0207707_11086164 | 3300025912 | Bacteria | 653 |
| 359 | Ga0207707_11235162 | 3300025912 | Bacteria | 603 |
| 360 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 361 | Ga0207671_10069543 | 3300025914 | Bacteria | 2624 |
| 362 | Ga0207671_10070718 | 3300025914 | Bacteria | 2602 |
| 363 | Ga0207693_10031785 | 3300025915 | Bacteria | 4171 |
| 364 | Ga0207693_10055562 | 3300025915 | Bacteria | 3106 |
| 365 | Ga0207693_10529038 | 3300025915 | Bacteria | 920 |
| 366 | Ga0207663_10010613 | 3300025916 | Bacteria | 4911 |
| 367 | Ga0207663_10157663 | 3300025916 | Bacteria | 1598 |
| 368 | Ga0207663_11013254 | 3300025916 | Bacteria | 666 |
| 369 | Ga0207660_10126351 | 3300025917 | Bacteria | 1942 |
| 370 | Ga0207660_10215862 | 3300025917 | Bacteria | 1504 |
| 371 | Ga0207662_10311038 | 3300025918 | Bacteria | 1049 |
| 372 | Ga0207657_10335838 | 3300025919 | Bacteria | 1193 |
| 373 | Ga0207657_10414767 | 3300025919 | Bacteria | 1059 |
| 374 | Ga0207649_10582023 | 3300025920 | Bacteria | 859 |
| 375 | Ga0207649_10856645 | 3300025920 | Bacteria | 711 |
| 376 | Ga0207649_11020206 | 3300025920 | Bacteria | 651 |
| 377 | Ga0207652_10080629 | 3300025921 | Bacteria | 2846 |
| 378 | Ga0207652_10097186 | 3300025921 | Bacteria | 2595 |
| 379 | Ga0207652_10462534 | 3300025921 | Bacteria | 1143 |
| 380 | Ga0207646_10679543 | 3300025922 | Bacteria | 921 |
| 381 | Ga0207646_11679166 | 3300025922 | Bacteria | 546 |
| 382 | Ga0207681_10298305 | 3300025923 | Bacteria | 1274 |
| 383 | Ga0207681_10372841 | 3300025923 | Bacteria | 1147 |
| 384 | Ga0207681_10445951 | 3300025923 | Bacteria | 1052 |
| 385 | Ga0207681_11336926 | 3300025923 | Bacteria | 602 |
| 386 | Ga0207694_10702565 | 3300025924 | Bacteria | 853 |
| 387 | Ga0207659_10161582 | 3300025926 | Bacteria | 1759 |
| 388 | Ga0207687_10007517 | 3300025927 | Bacteria | 7164 |
| 389 | Ga0207687_10119132 | 3300025927 | Bacteria | 1971 |
| 390 | Ga0207687_10121735 | 3300025927 | Bacteria | 1952 |
| 391 | Ga0207687_10151728 | 3300025927 | Bacteria | 1769 |
| 392 | Ga0207687_11273632 | 3300025927 | Bacteria | 632 |
| 393 | Ga0207700_10057510 | 3300025928 | Bacteria | 2933 |
| 394 | Ga0207700_10140200 | 3300025928 | Bacteria | 1986 |
| 395 | Ga0207664_10006581 | 3300025929 | Bacteria | 8002 |
| 396 | Ga0207664_10841798 | 3300025929 | Bacteria | 825 |
| 397 | Ga0207664_11068265 | 3300025929 | Bacteria | 722 |
| 398 | Ga0207644_10250191 | 3300025931 | Bacteria | 1414 |
| 399 | Ga0207644_10464983 | 3300025931 | Bacteria | 1040 |
| 400 | Ga0207644_10903355 | 3300025931 | Bacteria | 740 |
| 401 | Ga0207644_10912867 | 3300025931 | Bacteria | 736 |
| 402 | Ga0207690_10490569 | 3300025932 | Bacteria | 992 |
| 403 | Ga0207706_10109499 | 3300025933 | Bacteria | 2431 |
| 404 | Ga0207706_10287563 | 3300025933 | Bacteria | 1433 |
| 405 | Ga0207706_10356857 | 3300025933 | Bacteria | 1270 |
| 406 | Ga0207686_10208175 | 3300025934 | Bacteria | 1405 |
| 407 | Ga0207709_10095190 | 3300025935 | Bacteria | 1956 |
| 408 | Ga0207709_10638257 | 3300025935 | Bacteria | 847 |
| 409 | Ga0207669_10016439 | 3300025937 | Bacteria | 3759 |
| 410 | Ga0207669_10479684 | 3300025937 | Bacteria | 991 |
| 411 | Ga0207704_10131029 | 3300025938 | Bacteria | 1736 |
| 412 | Ga0207704_10796728 | 3300025938 | Bacteria | 789 |
| 413 | Ga0207704_10986212 | 3300025938 | Bacteria | 712 |
| 414 | Ga0207665_10006088 | 3300025939 | Bacteria | 8010 |
| 415 | Ga0207665_10227470 | 3300025939 | Bacteria | 1369 |
| 416 | Ga0207665_10454280 | 3300025939 | Bacteria | 984 |
| 417 | Ga0207665_10728701 | 3300025939 | Bacteria | 781 |
| 418 | Ga0207665_10991492 | 3300025939 | Bacteria | 668 |
| 419 | Ga0207691_10162687 | 3300025940 | Bacteria | 1957 |
| 420 | Ga0207691_10309795 | 3300025940 | Bacteria | 1355 |
| 421 | Ga0207711_10146825 | 3300025941 | Bacteria | 2125 |
| 422 | Ga0207711_10422082 | 3300025941 | Bacteria | 1241 |
| 423 | Ga0207711_10727953 | 3300025941 | Bacteria | 925 |
| 424 | Ga0207689_10131954 | 3300025942 | Bacteria | 2056 |
| 425 | Ga0207689_10224110 | 3300025942 | Bacteria | 1554 |
| 426 | Ga0207689_10228549 | 3300025942 | Bacteria | 1538 |
| 427 | Ga0207689_10239009 | 3300025942 | Bacteria | 1501 |
| 428 | Ga0207689_10649416 | 3300025942 | Bacteria | 889 |
| 429 | Ga0207689_10719062 | 3300025942 | Bacteria | 842 |
| 430 | Ga0207661_10253616 | 3300025944 | Bacteria | 1565 |
| 431 | Ga0207679_10134361 | 3300025945 | Bacteria | 1990 |
| 432 | Ga0207667_10071740 | 3300025949 | Bacteria | 3600 |
| 433 | Ga0207667_10282055 | 3300025949 | Bacteria | 1697 |
| 434 | Ga0207651_10311346 | 3300025960 | Bacteria | 1313 |
| 435 | Ga0207651_11011749 | 3300025960 | Bacteria | 743 |
| 436 | Ga0207651_11072339 | 3300025960 | Bacteria | 721 |
| 437 | Ga0207712_10084145 | 3300025961 | Bacteria | 2324 |
| 438 | Ga0207668_10064617 | 3300025972 | Bacteria | 2586 |
| 439 | Ga0207668_10065243 | 3300025972 | Bacteria | 2576 |
| 440 | Ga0207668_10080782 | 3300025972 | Bacteria | 2356 |
| 441 | Ga0207668_10378129 | 3300025972 | Bacteria | 1191 |
| 442 | Ga0207668_10703504 | 3300025972 | Bacteria | 888 |
| 443 | Ga0207668_10877529 | 3300025972 | Bacteria | 797 |
| 444 | Ga0207640_11108375 | 3300025981 | Bacteria | 700 |
| 445 | Ga0207640_11146691 | 3300025981 | Bacteria | 689 |
| 446 | Ga0207658_11764203 | 3300025986 | Bacteria | 565 |
| 447 | Ga0207677_10020036 | 3300026023 | Bacteria | 4052 |
| 448 | Ga0207677_10385154 | 3300026023 | Bacteria | 1184 |
| 449 | Ga0207677_11065326 | 3300026023 | Bacteria | 736 |
| 450 | Ga0207703_10319032 | 3300026035 | Bacteria | 1422 |
| 451 | Ga0207703_10997110 | 3300026035 | Bacteria | 803 |
| 452 | Ga0207703_11303432 | 3300026035 | Bacteria | 698 |
| 453 | Ga0207639_10056817 | 3300026041 | Bacteria | 3001 |
| 454 | Ga0207639_10127047 | 3300026041 | Bacteria | 2105 |
| 455 | Ga0207639_10168537 | 3300026041 | Bacteria | 1852 |
| 456 | Ga0207639_10826691 | 3300026041 | Bacteria | 864 |
| 457 | Ga0207639_10853308 | 3300026041 | Bacteria | 850 |
| 458 | Ga0207639_10983079 | 3300026041 | Bacteria | 790 |
| 459 | Ga0207678_10015293 | 3300026067 | Bacteria | 6749 |
| 460 | Ga0207678_10025317 | 3300026067 | Bacteria | 5180 |
| 461 | Ga0207678_10056561 | 3300026067 | Bacteria | 3376 |
| 462 | Ga0207678_10065075 | 3300026067 | Bacteria | 3131 |
| 463 | Ga0207678_10067421 | 3300026067 | Bacteria | 3072 |
| 464 | Ga0207678_10085166 | 3300026067 | Bacteria | 2702 |
| 465 | Ga0207678_10120473 | 3300026067 | Bacteria | 2239 |
| 466 | Ga0207678_10269220 | 3300026067 | Bacteria | 1461 |
| 467 | Ga0207708_10120227 | 3300026075 | Bacteria | 2046 |
| 468 | Ga0207708_11225937 | 3300026075 | Bacteria | 656 |
| 469 | Ga0207702_10073535 | 3300026078 | Bacteria | 2948 |
| 470 | Ga0207702_11696247 | 3300026078 | Bacteria | 625 |
| 471 | Ga0207641_10147876 | 3300026088 | Bacteria | 2126 |
| 472 | Ga0207641_10190911 | 3300026088 | Bacteria | 1883 |
| 473 | Ga0207641_10778498 | 3300026088 | Bacteria | 946 |
| 474 | Ga0207641_11281438 | 3300026088 | Bacteria | 733 |
| 475 | Ga0207641_11681042 | 3300026088 | Bacteria | 637 |
| 476 | Ga0207648_10531033 | 3300026089 | Bacteria | 1079 |
| 477 | Ga0207676_10146696 | 3300026095 | Bacteria | 2027 |
| 478 | Ga0207676_10583607 | 3300026095 | Bacteria | 1072 |
| 479 | Ga0207675_100032142 | 3300026118 | Bacteria | 4889 |
| 480 | Ga0207675_100062464 | 3300026118 | Bacteria | 3478 |
| 481 | Ga0207675_100561650 | 3300026118 | Bacteria | 1141 |
| 482 | Ga0207683_10032945 | 3300026121 | Bacteria | 4501 |
| 483 | Ga0207683_10157927 | 3300026121 | Bacteria | 2049 |
| 484 | Ga0207683_10185954 | 3300026121 | Bacteria | 1885 |
| 485 | Ga0207683_10249214 | 3300026121 | Bacteria | 1621 |
| 486 | Ga0207683_10397770 | 3300026121 | Bacteria | 1267 |
| 487 | Ga0207683_10745295 | 3300026121 | Bacteria | 909 |
| 488 | Ga0207683_10964213 | 3300026121 | Bacteria | 792 |
| 489 | Ga0207698_10120617 | 3300026142 | Bacteria | 2218 |
| 490 | Ga0207698_10138313 | 3300026142 | Bacteria | 2093 |
| 491 | Ga0207698_10190731 | 3300026142 | Bacteria | 1825 |
| 492 | Ga0207698_10673807 | 3300026142 | Bacteria | 1027 |
| 493 | Ga0207698_10706092 | 3300026142 | Bacteria | 1004 |
| 494 | Ga0207698_10992837 | 3300026142 | Bacteria | 850 |
| 495 | Ga0207698_11081931 | 3300026142 | Bacteria | 814 |
| 496 | Ga0209389_1000012 | 3300027296 | Bacteria | 213243 |
| 497 | Ga0209589_1000015 | 3300027357 | Bacteria | 225913 |
| 498 | Ga0209489_100015 | 3300027361 | Bacteria | 225913 |
| 499 | Ga0209489_100019 | 3300027361 | Bacteria | 213243 |
| 500 | Ga0209700_100018 | 3300027363 | Bacteria | 238200 |
| 501 | Ga0209700_100025 | 3300027363 | Bacteria | 225913 |
| 502 | Ga0209813_10018990 | 3300027866 | Bacteria | 1906 |
| 503 | Ga0209813_10067524 | 3300027866 | Bacteria | 1156 |
| 504 | Ga0209813_10194350 | 3300027866 | Bacteria | 748 |
| 505 | Ga0207428_10354871 | 3300027907 | Bacteria | 1078 |
| 506 | Ga0268266_10003191 | 3300028379 | Bacteria | 16594 |
| 507 | Ga0268266_10003840 | 3300028379 | Bacteria | 14672 |
| 508 | Ga0268266_10021532 | 3300028379 | Bacteria | 5492 |
| 509 | Ga0268266_10081383 | 3300028379 | Bacteria | 2823 |
| 510 | Ga0268266_10212237 | 3300028379 | Bacteria | 1776 |
| 511 | Ga0268266_10329679 | 3300028379 | Bacteria | 1430 |
| 512 | Ga0268266_10392100 | 3300028379 | Bacteria | 1311 |
| 513 | Ga0268266_11612031 | 3300028379 | Bacteria | 624 |
| 514 | Ga0268266_12091799 | 3300028379 | Bacteria | 539 |
| 515 | Ga0268265_10099262 | 3300028380 | Bacteria | 2347 |
| 516 | Ga0268265_10188787 | 3300028380 | Bacteria | 1777 |
| 517 | Ga0268265_10238970 | 3300028380 | Bacteria | 1601 |
| 518 | Ga0268265_10554591 | 3300028380 | Bacteria | 1091 |
| 519 | Ga0268265_10799106 | 3300028380 | Bacteria | 919 |
| 520 | Ga0268264_10166142 | 3300028381 | Bacteria | 1992 |
| 521 | Ga0268264_10727311 | 3300028381 | Bacteria | 987 |
| 522 | Ga0268264_11147903 | 3300028381 | Bacteria | 786 |
| 523 | Ga0307517_10010277 | 3300028786 | Bacteria | 13120 |
| 524 | Ga0307517_10104578 | 3300028786 | Bacteria | 2204 |
| 525 | Ga0307517_10492427 | 3300028786 | Bacteria | 626 |
| 526 | Ga0307515_10150736 | 3300028794 | Bacteria | 2432 |
| 527 | Ga0307511_10239206 | 3300030521 | Bacteria | 888 |
| 528 | Ga0307509_10086316 | 3300031507 | Bacteria | 3227 |
| 529 | Ga0307508_10000012 | 3300031616 | Bacteria | 243167 |
| 530 | Ga0265314_10031058 | 3300031711 | Bacteria | 3948 |
| 531 | Ga0265314_10035228 | 3300031711 | Bacteria | 3650 |
| 532 | Ga0265342_10284576 | 3300031712 | Bacteria | 874 |
| 533 | Ga0307516_10154357 | 3300031730 | Bacteria | 2053 |
| 534 | Ga0307516_10420812 | 3300031730 | Bacteria | 994 |
| 535 | Ga0307516_10769411 | 3300031730 | Bacteria | 623 |
| 536 | Ga0307405_10238070 | 3300031731 | Bacteria | 1346 |
| 537 | Ga0307405_11279955 | 3300031731 | Bacteria | 637 |
| 538 | Ga0307413_10444453 | 3300031824 | Bacteria | 1027 |
| 539 | Ga0307410_10362065 | 3300031852 | Bacteria | 1162 |
| 540 | Ga0307406_10229561 | 3300031901 | Bacteria | 1385 |
| 541 | Ga0307406_10301802 | 3300031901 | Bacteria | 1231 |
| 542 | Ga0307407_10198331 | 3300031903 | Bacteria | 1343 |
| 543 | Ga0307409_100021182 | 3300031995 | Bacteria | 4451 |
| 544 | Ga0307416_101043225 | 3300032002 | Bacteria | 921 |
| 545 | Ga0307416_103126773 | 3300032002 | Bacteria | 554 |
| 546 | Ga0307414_10089285 | 3300032004 | Bacteria | 2284 |
| 547 | Ga0307411_10034698 | 3300032005 | Bacteria | 3142 |
| 548 | Ga0307411_10110407 | 3300032005 | Bacteria | 1966 |
| 549 | Ga0307415_100715251 | 3300032126 | Bacteria | 905 |
| 550 | Ga0307415_100716156 | 3300032126 | Bacteria | 905 |
| 551 | Ga0307510_10015377 | 3300033180 | Bacteria | 9047 |
| 552 | Ga0307510_10023362 | 3300033180 | Bacteria | 7168 |
| 553 | Ga0307510_10104600 | 3300033180 | Bacteria | 2603 |
| 554 | Ga0315911_1000021 | 3300033442 | Bacteria | 124874 |
| 555 | Ga0316215_1003776 | 3300033544 | Bacteria | 1450 |
| 556 | Ga0373938_0016509 | 3300034957 | Bacteria | 1443 |
| 557 | Ga0373926_0384712 | 3300035083 | Bacteria | 553 |
| 558 | Ga0373928_0065155 | 3300035084 | Bacteria | 889 |
| 559 | Ga0373929_0039749 | 3300035085 | Bacteria | 1040 |
| 560 | Ga0373934_0002532 | 3300035086 | Bacteria | 6723 |
| 561 | Ga0373934_0025001 | 3300035086 | Bacteria | 2311 |
| 562 | Ga0373940_0106914 | 3300035088 | Bacteria | 855 |
| 563 | Ga0373923_0001264 | 3300035111 | Bacteria | 7120 |
| 564 | Ga0373932_0031046 | 3300035112 | Bacteria | 1486 |
| 565 | Ga0373936_0019784 | 3300035113 | Bacteria | 2611 |
| 566 | Ga0373936_0054802 | 3300035113 | Bacteria | 1618 |
| 567 | Ga0373936_0175662 | 3300035113 | Bacteria | 938 |
| 568 | Ga0373953_0001769 | 3300035117 | Bacteria | 6378 |
| 569 | Ga0373953_0024250 | 3300035117 | Bacteria | 2305 |
| 570 | Ga0373953_0182785 | 3300035117 | Bacteria | 905 |
| 571 | Ga0373954_0001440 | 3300035118 | Bacteria | 9662 |
| 572 | Ga0373954_0018385 | 3300035118 | Bacteria | 3146 |
| 573 | Ga0373954_0346040 | 3300035118 | Bacteria | 734 |
| 574 | Ga0373956_0000376 | 3300035119 | Bacteria | 18268 |
| 575 | Ga0373957_0020605 | 3300035120 | Bacteria | 2331 |
| 576 | Ga0373943_0088008 | 3300035170 | Bacteria | 1604 |
| 577 | Ga0373943_0574848 | 3300035170 | Bacteria | 662 |
| 578 | Ga0373946_0030372 | 3300035171 | Bacteria | 2157 |
| 579 | Ga0373946_0358732 | 3300035171 | Bacteria | 730 |
| 580 | Ga0373955_0000325 | 3300035172 | Bacteria | 19823 |
| 581 | Ga0373924_0004645 | 3300035410 | Bacteria | 4813 |
| 582 | Ga0373924_0034842 | 3300035410 | Bacteria | 2040 |
| 583 | Ga0373931_0231505 | 3300035691 | Bacteria | 1116 |
| 584 | Ga0373927_0005689 | 3300035695 | Bacteria | 8558 |
| 585 | Ga0373927_0043271 | 3300035695 | Bacteria | 2916 |
| 586 | Ga0373927_0127315 | 3300035695 | Bacteria | 1663 |
| 587 | Ga0373927_0365934 | 3300035695 | Bacteria | 950 |
| 588 | Ga0373927_0477611 | 3300035695 | Bacteria | 824 |
| 589 | Ga0373933_0005894 | 3300035724 | Bacteria | 6664 |
| 590 | Ga0373933_0066591 | 3300035724 | Bacteria | 2183 |
| 591 | Ga0373947_0010663 | 3300035725 | Bacteria | 5275 |
| 592 | Ga0373947_0381697 | 3300035725 | Bacteria | 949 |
| 593 | Ga0373937_0007855 | 3300036401 | Bacteria | 9247 |
| 594 | Ga0373937_0041689 | 3300036401 | Bacteria | 4187 |
| 595 | Ga0372808_043016 | 3300036459 | Bacteria | 647 |
| 596 | Ga0373925_0240302 | 3300037068 | Bacteria | 1450 |
| 597 | Ga0373925_0491280 | 3300037068 | Bacteria | 1007 |
| 598 | Ga0395899_0038874 | 3300037312 | Bacteria | 3563 |
| 599 | Ga0395900_0001756 | 3300037418 | Bacteria | 24872 |
| 600 | Ga0395900_0285802 | 3300037418 | Bacteria | 1640 |
| 601 | Ga0395900_0496477 | 3300037418 | Bacteria | 1171 |
| 602 | Ga0395898_0023431 | 3300037466 | Bacteria | 6239 |
| 603 | Ga0395898_0175732 | 3300037466 | Bacteria | 2047 |
| 604 | Ga0395898_0517680 | 3300037466 | Bacteria | 1134 |
| 605 | Ga0395905_0131973 | 3300037471 | Bacteria | 2349 |
| 606 | Ga0395905_0212851 | 3300037471 | Bacteria | 1810 |
| 607 | Ga0395905_0219176 | 3300037471 | Bacteria | 1781 |
| 608 | Ga0395905_1069562 | 3300037471 | Bacteria | 710 |
| 609 | Ga0395901_0237445 | 3300038443 | Bacteria | 1902 |
| 610 | Ga0451791_1154616 | 3300041451 | Bacteria | 1126 |
| 611 | Ga0451793_0680179 | 3300041452 | Bacteria | 509 |
| 612 | Ga0451793_1462621 | 3300041452 | Bacteria | 708 |
| 613 | Ga0451797_0708742 | 3300041453 | Bacteria | 569 |
| 614 | Ga0451795_0001015 | 3300041456 | Bacteria | 775 |
| 615 | Ga0451795_1592328 | 3300041456 | Bacteria | 683 |
| 616 | Ga0451798_0463913 | 3300041458 | Bacteria | 998 |
| 617 | Ga0451807_2142046 | 3300041486 | Bacteria | 1114 |
| 618 | Ga0451835_1074072 | 3300041492 | Bacteria | 547 |
| 619 | Ga0451841_1265539 | 3300041498 | Bacteria | 681 |
| 620 | Ga0451843_0523243 | 3300041509 | Bacteria | 623 |
| 621 | Ga0451843_0551884 | 3300041509 | Bacteria | 553 |
| 622 | Ga0451853_3149176 | 3300041512 | Bacteria | 1525 |
| 623 | Ga0439431_0108654 | 3300041997 | Bacteria | 767 |
| 624 | Ga0439458_0005013 | 3300042157 | Bacteria | 2995 |
| 625 | Ga0466969_0150312 | 3300044656 | Bacteria | 1073 |
| 626 | Ga0466972_0099302 | 3300044658 | Bacteria | 1378 |
| 627 | Ga0466966_0001463 | 3300044684 | Bacteria | 15199 |
| 628 | Ga0466961_0000065 | 3300044693 | Bacteria | 63259 |
| 629 | Ga0466963_0235852 | 3300044694 | Bacteria | 1282 |
| 630 | Ga0466957_0197417 | 3300044842 | Bacteria | 1320 |
| 631 | Ga0466960_0009188 | 3300044901 | Bacteria | 4069 |
| 632 | Ga0466959_0000634 | 3300045049 | Bacteria | 20407 |
| 633 | Ga0466967_0267715 | 3300045976 | Bacteria | 1636 |
| 634 | Ga0466967_0412491 | 3300045976 | Bacteria | 1315 |
| 635 | Ga0495617_140332 | 3300046452 | Bacteria | 772 |
| 636 | Ga0495617_150273 | 3300046452 | Bacteria | 741 |
| 637 | Ga0495592_0000339 | 3300046454 | Bacteria | 38389 |
| 638 | Ga0495592_0083745 | 3300046454 | Bacteria | 2302 |
| 639 | Ga0495592_0127004 | 3300046454 | Bacteria | 1788 |
| 640 | Ga0495603_0043528 | 3300046455 | Bacteria | 2680 |
| 641 | Ga0495603_0050828 | 3300046455 | Bacteria | 2464 |
| 642 | Ga0495603_0052048 | 3300046455 | Bacteria | 2432 |
| 643 | Ga0495603_0115547 | 3300046455 | Bacteria | 1565 |
| 644 | Ga0495603_0118466 | 3300046455 | Bacteria | 1543 |
| 645 | Ga0495603_0141413 | 3300046455 | Bacteria | 1400 |
| 646 | Ga0495603_0190931 | 3300046455 | Bacteria | 1184 |
| 647 | Ga0495629_0001483 | 3300046459 | Bacteria | 18494 |
| 648 | Ga0495629_0006648 | 3300046459 | Bacteria | 8555 |
| 649 | Ga0495629_0222645 | 3300046459 | Bacteria | 1301 |
| 650 | Ga0495638_0022821 | 3300046460 | Bacteria | 4102 |
| 651 | Ga0495638_0077199 | 3300046460 | Bacteria | 2028 |
| 652 | Ga0495638_0117441 | 3300046460 | Bacteria | 1574 |
| 653 | Ga0495638_0188711 | 3300046460 | Bacteria | 1171 |
| 654 | Ga0495638_0224123 | 3300046460 | Bacteria | 1049 |
| 655 | Ga0495638_0290946 | 3300046460 | Bacteria | 884 |
| 656 | Ga0495641_0151578 | 3300046461 | Bacteria | 1036 |
| 657 | Ga0495651_0015606 | 3300046462 | Bacteria | 5879 |
| 658 | Ga0495651_0017638 | 3300046462 | Bacteria | 5524 |
| 659 | Ga0495651_0112213 | 3300046462 | Bacteria | 2014 |
| 660 | Ga0495651_0278941 | 3300046462 | Bacteria | 1130 |
| 661 | Ga0495653_0001063 | 3300046463 | Bacteria | 21155 |
| 662 | Ga0495653_0281852 | 3300046463 | Bacteria | 1090 |
| 663 | Ga0495650_0071255 | 3300046471 | Bacteria | 1363 |
| 664 | Ga0495650_0149314 | 3300046471 | Bacteria | 840 |
| 665 | Ga0495580_0317654 | 3300046472 | Bacteria | 1059 |
| 666 | Ga0495605_0238287 | 3300046474 | Bacteria | 782 |
| 667 | Ga0495639_0080160 | 3300046475 | Bacteria | 1519 |
| 668 | Ga0495639_0103420 | 3300046475 | Bacteria | 1347 |
| 669 | Ga0495639_0159612 | 3300046475 | Bacteria | 1091 |
| 670 | Ga0495639_0175459 | 3300046475 | Bacteria | 1042 |
| 671 | Ga0495664_0221848 | 3300046477 | Bacteria | 1144 |
| 672 | Ga0495664_0234375 | 3300046477 | Bacteria | 1110 |
| 673 | Ga0495664_0484171 | 3300046477 | Bacteria | 740 |
| 674 | Ga0495584_0238821 | 3300046491 | Bacteria | 924 |
| 675 | Ga0495584_0293954 | 3300046491 | Bacteria | 825 |
| 676 | Ga0495584_0526588 | 3300046491 | Bacteria | 602 |
| 677 | Ga0495585_0084268 | 3300046492 | Bacteria | 1719 |
| 678 | Ga0495585_0354893 | 3300046492 | Bacteria | 712 |
| 679 | Ga0495594_0210577 | 3300046499 | Bacteria | 1108 |
| 680 | Ga0495596_0180146 | 3300046500 | Bacteria | 821 |
| 681 | Ga0495583_0136697 | 3300046506 | Bacteria | 1023 |
| 682 | Ga0495583_0141772 | 3300046506 | Bacteria | 1000 |
| 683 | Ga0495583_0288084 | 3300046506 | Bacteria | 654 |
| 684 | Ga0495606_0011270 | 3300046507 | Bacteria | 7313 |
| 685 | Ga0495606_0174337 | 3300046507 | Bacteria | 1245 |
| 686 | Ga0495606_0184517 | 3300046507 | Bacteria | 1200 |
| 687 | Ga0495606_0209119 | 3300046507 | Bacteria | 1106 |
| 688 | Ga0495606_0343491 | 3300046507 | Bacteria | 794 |
| 689 | Ga0495608_0002749 | 3300046511 | Bacteria | 12636 |
| 690 | Ga0495608_0015906 | 3300046511 | Bacteria | 5207 |
| 691 | Ga0495608_0016049 | 3300046511 | Bacteria | 5182 |
| 692 | Ga0495608_0165818 | 3300046511 | Bacteria | 1403 |
| 693 | Ga0495616_0182488 | 3300046513 | Bacteria | 932 |
| 694 | Ga0495616_0196151 | 3300046513 | Bacteria | 890 |
| 695 | Ga0495616_0412072 | 3300046513 | Bacteria | 553 |
| 696 | Ga0495628_0010789 | 3300046516 | Bacteria | 7737 |
| 697 | Ga0495628_0464198 | 3300046516 | Bacteria | 918 |
| 698 | Ga0495630_0364281 | 3300046517 | Bacteria | 1107 |
| 699 | Ga0495631_0049616 | 3300046518 | Bacteria | 1837 |
| 700 | Ga0495631_0120207 | 3300046518 | Bacteria | 1130 |
| 701 | Ga0495631_0324867 | 3300046518 | Bacteria | 655 |
| 702 | Ga0495631_0434180 | 3300046518 | Bacteria | 559 |
| 703 | Ga0495632_0027499 | 3300046519 | Bacteria | 2979 |
| 704 | Ga0495632_0042897 | 3300046519 | Bacteria | 2265 |
| 705 | Ga0495637_0024893 | 3300046520 | Bacteria | 2705 |
| 706 | Ga0495637_0310393 | 3300046520 | Bacteria | 558 |
| 707 | Ga0495643_0145135 | 3300046522 | Bacteria | 1180 |
| 708 | Ga0495643_0534814 | 3300046522 | Bacteria | 501 |
| 709 | Ga0495644_0180538 | 3300046523 | Bacteria | 811 |
| 710 | Ga0495644_0287436 | 3300046523 | Bacteria | 642 |
| 711 | Ga0495648_0252535 | 3300046524 | Bacteria | 850 |
| 712 | Ga0495648_0264290 | 3300046524 | Bacteria | 824 |
| 713 | Ga0495652_0005458 | 3300046529 | Bacteria | 11981 |
| 714 | Ga0495652_0022492 | 3300046529 | Bacteria | 5594 |
| 715 | Ga0495652_0025147 | 3300046529 | Bacteria | 5271 |
| 716 | Ga0495652_0026600 | 3300046529 | Bacteria | 5108 |
| 717 | Ga0495652_0171306 | 3300046529 | Bacteria | 1675 |
| 718 | Ga0495640_0008433 | 3300046533 | Bacteria | 8084 |
| 719 | Ga0495640_0022764 | 3300046533 | Bacteria | 4576 |
| 720 | Ga0495640_0052678 | 3300046533 | Bacteria | 2793 |
| 721 | Ga0495640_0145276 | 3300046533 | Bacteria | 1526 |
| 722 | Ga0495640_0217847 | 3300046533 | Bacteria | 1205 |
| 723 | Ga0495587_0010898 | 3300046536 | Bacteria | 5768 |
| 724 | Ga0495587_0027904 | 3300046536 | Bacteria | 3437 |
| 725 | Ga0495587_0093759 | 3300046536 | Bacteria | 1733 |
| 726 | Ga0495609_0109021 | 3300046538 | Bacteria | 1196 |
| 727 | Ga0495609_0141808 | 3300046538 | Bacteria | 1025 |
| 728 | Ga0495621_0391448 | 3300046539 | Bacteria | 588 |
| 729 | Ga0495597_0214762 | 3300046542 | Bacteria | 766 |
| 730 | Ga0495645_0028867 | 3300046543 | Bacteria | 4032 |
| 731 | Ga0495645_0052929 | 3300046543 | Bacteria | 2952 |
| 732 | Ga0495645_0060101 | 3300046543 | Bacteria | 2755 |
| 733 | Ga0495622_0010744 | 3300046557 | Bacteria | 4224 |
| 734 | Ga0495622_0105852 | 3300046557 | Bacteria | 1289 |
| 735 | Ga0495622_0136431 | 3300046557 | Bacteria | 1115 |
| 736 | Ga0495622_0289776 | 3300046557 | Bacteria | 715 |
| 737 | Ga0495633_0542477 | 3300046558 | Bacteria | 524 |
| 738 | Ga0495667_0011132 | 3300046559 | Bacteria | 6087 |
| 739 | Ga0495667_0021611 | 3300046559 | Bacteria | 4342 |
| 740 | Ga0495667_0062012 | 3300046559 | Bacteria | 2450 |
| 741 | Ga0495667_0236235 | 3300046559 | Bacteria | 1165 |
| 742 | Ga0495656_0006097 | 3300046615 | Bacteria | 4206 |
| 743 | Ga0495656_0109117 | 3300046615 | Bacteria | 1291 |
| 744 | Ga0495668_0251860 | 3300046616 | Bacteria | 967 |
| 745 | Ga0495634_0002330 | 3300046642 | Bacteria | 15886 |
| 746 | Ga0495634_0496723 | 3300046642 | Bacteria | 715 |
| 747 | Ga0495611_0021976 | 3300046648 | Bacteria | 2758 |
| 748 | Ga0495625_0071860 | 3300046660 | Bacteria | 2427 |
| 749 | Ga0495625_0674558 | 3300046660 | Bacteria | 613 |
| 750 | Ga0495635_0000917 | 3300046663 | Bacteria | 19365 |
| 751 | Ga0495635_0002291 | 3300046663 | Bacteria | 13017 |
| 752 | Ga0495635_0039894 | 3300046663 | Bacteria | 3247 |
| 753 | Ga0495635_0301041 | 3300046663 | Bacteria | 1075 |
| 754 | Ga0495635_0465298 | 3300046663 | Bacteria | 835 |
| 755 | Ga0495659_0121879 | 3300046664 | Bacteria | 1027 |
| 756 | Ga0495659_0314819 | 3300046664 | Bacteria | 663 |
| 757 | Ga0495661_0100123 | 3300046665 | Bacteria | 1633 |
| 758 | Ga0495661_0419024 | 3300046665 | Bacteria | 649 |
| 759 | Ga0495661_0474834 | 3300046665 | Bacteria | 599 |
| 760 | Ga0495588_0080246 | 3300046674 | Bacteria | 1703 |
| 761 | Ga0495588_0131640 | 3300046674 | Bacteria | 1319 |
| 762 | Ga0495588_0259417 | 3300046674 | Bacteria | 916 |
| 763 | Ga0495588_0358089 | 3300046674 | Bacteria | 767 |
| 764 | Ga0495657_0003543 | 3300046675 | Bacteria | 12725 |
| 765 | Ga0495657_0026551 | 3300046675 | Bacteria | 4100 |
| 766 | Ga0495657_0101888 | 3300046675 | Bacteria | 1828 |
| 767 | Ga0495599_0001780 | 3300046678 | Bacteria | 12490 |
| 768 | Ga0495599_0170003 | 3300046678 | Bacteria | 1345 |
| 769 | Ga0495599_0270213 | 3300046678 | Bacteria | 1032 |
| 770 | Ga0495623_0020263 | 3300046679 | Bacteria | 4298 |
| 771 | Ga0495623_0024146 | 3300046679 | Bacteria | 3921 |
| 772 | Ga0495623_0058222 | 3300046679 | Bacteria | 2429 |
| 773 | Ga0495646_0025247 | 3300046680 | Bacteria | 3739 |
| 774 | Ga0495646_0057432 | 3300046680 | Bacteria | 2329 |
| 775 | Ga0495646_0294624 | 3300046680 | Bacteria | 859 |
| 776 | Ga0495647_0056602 | 3300046681 | Bacteria | 1538 |
| 777 | Ga0495647_0185565 | 3300046681 | Bacteria | 907 |
| 778 | Ga0495658_0119099 | 3300046683 | Bacteria | 1595 |
| 779 | Ga0495658_0241851 | 3300046683 | Bacteria | 1134 |
| 780 | Ga0495669_0039242 | 3300046684 | Bacteria | 2096 |
| 781 | Ga0495669_0057752 | 3300046684 | Bacteria | 1751 |
| 782 | Ga0495613_0012318 | 3300046689 | Bacteria | 6353 |
| 783 | Ga0495613_0027022 | 3300046689 | Bacteria | 4272 |
| 784 | Ga0495624_0011428 | 3300046690 | Bacteria | 6100 |
| 785 | Ga0495670_0029527 | 3300046691 | Bacteria | 2721 |
| 786 | Ga0495649_0191678 | 3300046694 | Bacteria | 1064 |
| 787 | Ga0495589_0161598 | 3300046794 | Bacteria | 1067 |
| 788 | Ga0495589_0585228 | 3300046794 | Bacteria | 508 |
| 789 | Ga0495600_0002741 | 3300046809 | Bacteria | 10203 |
| 790 | Ga0495600_0017271 | 3300046809 | Bacteria | 4587 |
| 791 | Ga0495600_0019437 | 3300046809 | Bacteria | 4338 |
| 792 | Ga0495600_0186219 | 3300046809 | Bacteria | 1336 |
| 793 | Ga0495581_0040506 | 3300047315 | Bacteria | 2696 |
| 794 | Ga0495581_0320880 | 3300047315 | Bacteria | 905 |
| 795 | Ga0495604_0002741 | 3300047317 | Bacteria | 14128 |
| 796 | Ga0495604_0007541 | 3300047317 | Bacteria | 8607 |
| 797 | Ga0495604_0007941 | 3300047317 | Bacteria | 8404 |
| 798 | Ga0495674_0007236 | 3300047319 | Bacteria | 10620 |
| 799 | Ga0495674_0077634 | 3300047319 | Bacteria | 2855 |
| 800 | Ga0495672_0014087 | 3300047320 | Bacteria | 5489 |
| 801 | Ga0495672_0343969 | 3300047320 | Bacteria | 694 |
| 802 | Ga0495676_0014630 | 3300047321 | Bacteria | 7017 |
| 803 | Ga0495680_0001065 | 3300047322 | Bacteria | 30372 |
| 804 | Ga0495680_0001876 | 3300047322 | Bacteria | 22116 |
| 805 | Ga0495680_0069818 | 3300047322 | Bacteria | 2679 |
| 806 | Ga0495683_0349466 | 3300047323 | Bacteria | 624 |
| 807 | Ga0495675_0000901 | 3300047444 | Bacteria | 18140 |
| 808 | Ga0495675_0045446 | 3300047444 | Bacteria | 2796 |
| 809 | Ga0495675_0440305 | 3300047444 | Bacteria | 755 |
| 810 | Ga0495677_0175682 | 3300047445 | Bacteria | 829 |
| 811 | Ga0495677_0366596 | 3300047445 | Bacteria | 569 |
| 812 | Ga0495679_191402 | 3300047446 | Bacteria | 540 |
| 813 | Ga0495673_0035084 | 3300047469 | Bacteria | 2314 |
| 814 | Ga0495673_0231847 | 3300047469 | Bacteria | 680 |
| 815 | Ga0495673_0250519 | 3300047469 | Bacteria | 647 |
| 816 | Ga0495681_0120855 | 3300047470 | Bacteria | 1124 |
| 817 | Ga0495684_0000721 | 3300047471 | Bacteria | 26637 |
| 818 | Ga0495684_0107418 | 3300047471 | Bacteria | 2108 |
| 819 | Ga0495686_0022393 | 3300047472 | Bacteria | 4182 |
| 820 | Ga0495686_0153380 | 3300047472 | Bacteria | 1351 |
| 821 | Ga0495686_0356459 | 3300047472 | Bacteria | 794 |
| 822 | Ga0495686_0560971 | 3300047472 | Bacteria | 595 |
| 823 | Ga0495686_0581437 | 3300047472 | Bacteria | 582 |
| 824 | Ga0495686_0707315 | 3300047472 | Bacteria | 514 |
| 825 | Ga0495593_0003019 | 3300047673 | Bacteria | 10137 |
| 826 | Ga0495602_0029916 | 3300048088 | Bacteria | 5175 |
| 827 | Ga0495602_0084544 | 3300048088 | Bacteria | 2654 |
| 828 | Ga0495602_0327374 | 3300048088 | Bacteria | 1112 |
| 829 | Ga0495602_0819925 | 3300048088 | Bacteria | 624 |
| 830 | Ga0496100_0146278 | 3300048903 | Bacteria | 1681 |
| 831 | Ga0496100_0356976 | 3300048903 | Bacteria | 1105 |
| 832 | Ga0496100_1137280 | 3300048903 | Bacteria | 615 |
| 833 | Ga0496101_0041950 | 3300048904 | Bacteria | 3265 |
| 834 | Ga0496101_0274945 | 3300048904 | Bacteria | 1315 |
| 835 | Ga0496101_0302264 | 3300048904 | Bacteria | 1253 |
| 836 | Ga0496101_0458362 | 3300048904 | Bacteria | 1006 |
| 837 | Ga0496101_0506190 | 3300048904 | Bacteria | 954 |
| 838 | Ga0496101_0540478 | 3300048904 | Bacteria | 921 |
| 839 | Ga0496102_0013853 | 3300048905 | Bacteria | 6997 |
| 840 | Ga0496102_0084587 | 3300048905 | Bacteria | 2928 |
| 841 | Ga0496102_0121931 | 3300048905 | Bacteria | 2435 |
| 842 | Ga0496102_0537020 | 3300048905 | Bacteria | 1092 |
| 843 | Ga0496102_0582110 | 3300048905 | Bacteria | 1042 |
| 844 | Ga0496102_0659030 | 3300048905 | Bacteria | 970 |
| 845 | Ga0496102_0748320 | 3300048905 | Bacteria | 900 |
| 846 | Ga0496102_0868540 | 3300048905 | Bacteria | 824 |
| 847 | Ga0496102_1727856 | 3300048905 | Bacteria | 543 |
| 848 | Ga0496103_0269023 | 3300048906 | Bacteria | 1096 |
| 849 | Ga0496104_0044882 | 3300048907 | Bacteria | 4154 |
| 850 | Ga0496104_0615082 | 3300048907 | Bacteria | 996 |
| 851 | Ga0496104_0938932 | 3300048907 | Bacteria | 770 |
| 852 | Ga0496104_1473436 | 3300048907 | Bacteria | 583 |
| 853 | Ga0496105_0004094 | 3300048908 | Bacteria | 10925 |
| 854 | Ga0496105_0179579 | 3300048908 | Bacteria | 1733 |
| 855 | Ga0496105_0800765 | 3300048908 | Bacteria | 716 |
| 856 | Ga0496105_1315901 | 3300048908 | Bacteria | 527 |
| 857 | Ga0496106_0005142 | 3300048909 | Bacteria | 9697 |
| 858 | Ga0496106_0008314 | 3300048909 | Bacteria | 7679 |
| 859 | Ga0496106_0587477 | 3300048909 | Bacteria | 892 |
| 860 | Ga0496106_0863908 | 3300048909 | Bacteria | 715 |
| 861 | Ga0496107_0127229 | 3300048910 | Bacteria | 1880 |
| 862 | Ga0496107_0127812 | 3300048910 | Bacteria | 1875 |
| 863 | Ga0496107_0270960 | 3300048910 | Bacteria | 1263 |
| 864 | Ga0496108_0068160 | 3300048911 | Bacteria | 3001 |
| 865 | Ga0496108_0081616 | 3300048911 | Bacteria | 2740 |
| 866 | Ga0496108_0201916 | 3300048911 | Bacteria | 1725 |
| 867 | Ga0496109_0109385 | 3300048912 | Bacteria | 2569 |
| 868 | Ga0496109_0131055 | 3300048912 | Bacteria | 2340 |
| 869 | Ga0496109_0335316 | 3300048912 | Bacteria | 1428 |
| 870 | Ga0496109_0810869 | 3300048912 | Bacteria | 874 |
| 871 | Ga0496109_1146448 | 3300048912 | Bacteria | 714 |
| 872 | Ga0496110_0431333 | 3300048913 | Bacteria | 1201 |
| 873 | Ga0496110_0433957 | 3300048913 | Bacteria | 1197 |
| 874 | Ga0496110_0473800 | 3300048913 | Bacteria | 1140 |
| 875 | Ga0496110_0847219 | 3300048913 | Bacteria | 819 |
| 876 | Ga0496111_0011220 | 3300048914 | Bacteria | 6030 |
| 877 | Ga0496111_0265190 | 3300048914 | Bacteria | 1274 |
| 878 | Ga0496112_0000035 | 3300048915 | Bacteria | 106983 |
| 879 | Ga0496112_0069768 | 3300048915 | Bacteria | 3471 |
| 880 | Ga0496112_0241886 | 3300048915 | Bacteria | 1757 |
| 881 | Ga0496112_0874933 | 3300048915 | Bacteria | 821 |
| 882 | Ga0496112_0893636 | 3300048915 | Bacteria | 810 |
| 883 | Ga0496112_1068731 | 3300048915 | Bacteria | 726 |
| 884 | Ga0496113_0139537 | 3300048916 | Bacteria | 1906 |
| 885 | Ga0496113_0390894 | 3300048916 | Bacteria | 1116 |
| 886 | Ga0496113_0780975 | 3300048916 | Bacteria | 759 |
| 887 | Ga0496114_0024694 | 3300048917 | Bacteria | 4906 |
| 888 | Ga0496114_0975256 | 3300048917 | Bacteria | 730 |
| 889 | Ga0496115_0004493 | 3300048918 | Bacteria | 10094 |
| 890 | Ga0496116_0000965 | 3300048919 | Bacteria | 35491 |
| 891 | Ga0496117_0007318 | 3300048920 | Bacteria | 10829 |
| 892 | Ga0496117_0099761 | 3300048920 | Bacteria | 1841 |
| 893 | Ga0496117_0191671 | 3300048920 | Bacteria | 1163 |
| 894 | Ga0496118_0010242 | 3300048921 | Bacteria | 9306 |
| 895 | Ga0496118_0042994 | 3300048921 | Bacteria | 3557 |
| 896 | Ga0496118_0388921 | 3300048921 | Bacteria | 729 |
| 897 | Ga0496118_0470174 | 3300048921 | Bacteria | 633 |
| 898 | Ga0496119_0007397 | 3300048922 | Bacteria | 9903 |
| 899 | Ga0496119_0057355 | 3300048922 | Bacteria | 2353 |
| 900 | Ga0496119_0392004 | 3300048922 | Bacteria | 664 |
| 901 | Ga0496120_0003365 | 3300048923 | Bacteria | 14668 |
| 902 | Ga0496120_0086329 | 3300048923 | Bacteria | 1687 |
| 903 | Ga0496120_0120536 | 3300048923 | Bacteria | 1357 |
| 904 | Ga0496120_0337294 | 3300048923 | Bacteria | 680 |
| 905 | Ga0496121_0017077 | 3300048924 | Bacteria | 7442 |
| 906 | Ga0496121_0017170 | 3300048924 | Bacteria | 7411 |
| 907 | Ga0496121_0066269 | 3300048924 | Bacteria | 2933 |
| 908 | Ga0496121_0197139 | 3300048924 | Bacteria | 1438 |
| 909 | Ga0496121_0199297 | 3300048924 | Bacteria | 1428 |
| 910 | Ga0496121_0599127 | 3300048924 | Bacteria | 680 |
| 911 | Ga0496122_0033148 | 3300048925 | Bacteria | 4255 |
| 912 | Ga0496122_0053150 | 3300048925 | Bacteria | 3057 |
| 913 | Ga0496122_0086448 | 3300048925 | Bacteria | 2158 |
| 914 | Ga0496123_0006724 | 3300048926 | Bacteria | 11061 |
| 915 | Ga0496123_0054779 | 3300048926 | Bacteria | 2622 |
| 916 | Ga0496123_0225183 | 3300048926 | Bacteria | 943 |
| 917 | Ga0496124_0097640 | 3300048927 | Bacteria | 2385 |
| 918 | Ga0496124_0195416 | 3300048927 | Bacteria | 1544 |
| 919 | Ga0496124_0632778 | 3300048927 | Bacteria | 690 |
| 920 | Ga0496125_0001630 | 3300048928 | Bacteria | 31638 |
| 921 | Ga0496125_0010481 | 3300048928 | Bacteria | 9373 |
| 922 | Ga0496125_0048905 | 3300048928 | Bacteria | 3520 |
| 923 | Ga0496125_0095013 | 3300048928 | Bacteria | 2219 |
| 924 | Ga0496126_0003472 | 3300048929 | Bacteria | 19892 |
| 925 | Ga0496126_0018186 | 3300048929 | Bacteria | 6973 |
| 926 | Ga0496126_0055280 | 3300048929 | Bacteria | 3592 |
| 927 | Ga0496126_0072841 | 3300048929 | Bacteria | 3055 |
| 928 | Ga0496126_0075361 | 3300048929 | Bacteria | 2994 |
| 929 | Ga0496126_0132356 | 3300048929 | Bacteria | 2154 |
| 930 | Ga0496126_0269499 | 3300048929 | Bacteria | 1413 |
| 931 | Ga0496126_0541267 | 3300048929 | Bacteria | 925 |
| 932 | Ga0496126_0622125 | 3300048929 | Bacteria | 848 |
| 933 | Ga0496126_0704132 | 3300048929 | Bacteria | 784 |
| 934 | Ga0501031_0001791 | 3300049568 | Bacteria | 13478 |
| 935 | Ga0501031_0093802 | 3300049568 | Bacteria | 1959 |
| 936 | Ga0501032_0000762 | 3300049569 | Bacteria | 26183 |
| 937 | Ga0501033_0000136 | 3300049570 | Bacteria | 70952 |
| 938 | Ga0501033_0182365 | 3300049570 | Bacteria | 1504 |
| 939 | Ga0501034_0000251 | 3300049571 | Bacteria | 99406 |
| 940 | Ga0501036_0000036 | 3300049572 | Bacteria | 87244 |
| 941 | Ga0501037_0000867 | 3300049573 | Bacteria | 22596 |
| 942 | Ga0501037_0140096 | 3300049573 | Bacteria | 1731 |
| 943 | Ga0501037_0292848 | 3300049573 | Bacteria | 1132 |
| 944 | Ga0501038_0000428 | 3300049574 | Bacteria | 36623 |
| 945 | Ga0501038_0049185 | 3300049574 | Bacteria | 3646 |
| 946 | Ga0501039_0219064 | 3300049575 | Bacteria | 1496 |
| 947 | Ga0501040_0603753 | 3300049576 | Bacteria | 793 |
| 948 | Ga0501041_0170512 | 3300049577 | Bacteria | 1362 |
| 949 | Ga0501042_0025922 | 3300049578 | Bacteria | 4120 |
| 950 | Ga0501043_0000165 | 3300049579 | Bacteria | 59980 |
| 951 | Ga0501043_0351129 | 3300049579 | Bacteria | 1120 |
| 952 | Ga0501046_0000839 | 3300049580 | Bacteria | 29959 |
| 953 | Ga0501046_0320277 | 3300049580 | Bacteria | 1130 |
| 954 | Ga0501047_0000340 | 3300049581 | Bacteria | 53278 |
| 955 | Ga0501047_1232007 | 3300049581 | Bacteria | 562 |
| 956 | Ga0501048_0004509 | 3300049582 | Bacteria | 10606 |
| 957 | Ga0501048_0522818 | 3300049582 | Bacteria | 851 |
| 958 | Ga0501067_0007630 | 3300049583 | Bacteria | 6013 |
| 959 | Ga0501067_0486136 | 3300049583 | Bacteria | 690 |
| 960 | Ga0501068_0003807 | 3300049584 | Bacteria | 8179 |
| 961 | Ga0501068_0945089 | 3300049584 | Bacteria | 568 |
| 962 | Ga0501069_0007026 | 3300049585 | Bacteria | 5893 |
| 963 | Ga0501070_0006502 | 3300049586 | Bacteria | 9938 |
| 964 | Ga0501070_0188830 | 3300049586 | Bacteria | 1694 |
| 965 | Ga0501072_0007916 | 3300049588 | Bacteria | 8069 |
| 966 | Ga0501072_0184865 | 3300049588 | Bacteria | 1663 |
| 967 | Ga0501073_0000037 | 3300049589 | Bacteria | 87345 |
| 968 | Ga0501073_0589554 | 3300049589 | Bacteria | 768 |
| 969 | Ga0501074_0000167 | 3300049590 | Bacteria | 35108 |
| 970 | Ga0501074_0078814 | 3300049590 | Bacteria | 2364 |
| 971 | Ga0501076_0225653 | 3300049592 | Bacteria | 1531 |
| 972 | Ga0501076_0922858 | 3300049592 | Bacteria | 720 |
| 973 | Ga0501079_0001057 | 3300049741 | Bacteria | 19118 |
| 974 | Ga0501080_0003259 | 3300049742 | Bacteria | 14325 |
| 975 | Ga0501080_0500984 | 3300049742 | Bacteria | 1085 |
| 976 | Ga0501080_0595495 | 3300049742 | Bacteria | 982 |
| 977 | Ga0501083_0001812 | 3300049744 | Bacteria | 14636 |
| 978 | Ga0501035_0000142 | 3300049822 | Bacteria | 87561 |
| 979 | Ga0501035_0197984 | 3300049822 | Bacteria | 1724 |
| 980 | Ga0501044_0000414 | 3300049823 | Bacteria | 52784 |
| 981 | Ga0501044_0162165 | 3300049823 | Bacteria | 2211 |
| 982 | Ga0501044_0249253 | 3300049823 | Bacteria | 1717 |
| 983 | Ga0501045_0036286 | 3300049824 | Bacteria | 3579 |
| 984 | nmdc:mga03683_119060_c1 | 3300050489 | Bacteria | 1173 |
| 985 | nmdc:mga03683_144094_c1 | 3300050489 | Bacteria | 1072 |
| 986 | nmdc:mga03683_209617_c1 | 3300050489 | Bacteria | 896 |
| 987 | nmdc:mga03683_415109_c1 | 3300050489 | Bacteria | 644 |
| 988 | nmdc:mga03n38_303412_c1 | 3300050490 | Bacteria | 858 |
| 989 | nmdc:mga03n38_3607_c1 | 3300050490 | Bacteria | 5004 |
| 990 | nmdc:mga03n38_544897_c1 | 3300050490 | Bacteria | 656 |
| 991 | nmdc:mga00v17_15862_c1 | 3300050491 | Bacteria | 4238 |
| 992 | nmdc:mga00v17_254121_c1 | 3300050491 | Bacteria | 1140 |
| 993 | nmdc:mga00v17_33928_c1 | 3300050491 | Bacteria | 3028 |
| 994 | nmdc:mga00v17_43108_c1 | 3300050491 | Bacteria | 2716 |
| 995 | nmdc:mga0yw44_17100_c1 | 3300050492 | Bacteria | 3937 |
| 996 | nmdc:mga0yw44_18813_c1 | 3300050492 | Bacteria | 3793 |
| 997 | nmdc:mga0yw44_200253_c1 | 3300050492 | Bacteria | 1319 |
| 998 | nmdc:mga0yw44_251604_c1 | 3300050492 | Bacteria | 1176 |
| 999 | nmdc:mga0yw44_502646_c1 | 3300050492 | Bacteria | 823 |
| 1000 | nmdc:mga0yw44_9428_c1 | 3300050492 | Bacteria | 4936 |
| 1001 | nmdc:mga0k408_120585_c1 | 3300050493 | Bacteria | 1553 |
| 1002 | nmdc:mga0k408_214900_c1 | 3300050493 | Bacteria | 1148 |
| 1003 | nmdc:mga0k408_233594_c1 | 3300050493 | Bacteria | 1098 |
| 1004 | nmdc:mga0k408_302298_c1 | 3300050493 | Bacteria | 955 |
| 1005 | nmdc:mga06z11_114580_c1 | 3300050494 | Bacteria | 1497 |
| 1006 | nmdc:mga06z11_214115_c1 | 3300050494 | Bacteria | 1124 |
| 1007 | nmdc:mga06z11_25604_c1 | 3300050494 | Bacteria | 2799 |
| 1008 | nmdc:mga06z11_35146_c1 | 3300050494 | Bacteria | 2465 |
| 1009 | nmdc:mga06z11_84907_c1 | 3300050494 | Bacteria | 1707 |
| 1010 | nmdc:mga06z11_93465_c1 | 3300050494 | Bacteria | 1637 |
| 1011 | nmdc:mga04h51_113795_c1 | 3300050495 | Bacteria | 1001 |
| 1012 | nmdc:mga04h51_22600_c1 | 3300050495 | Bacteria | 1905 |
| 1013 | nmdc:mga07m45_26680_c1 | 3300050496 | Bacteria | 3176 |
| 1014 | nmdc:mga07m45_280075_c1 | 3300050496 | Bacteria | 970 |
| 1015 | nmdc:mga07m45_495697_c1 | 3300050496 | Bacteria | 707 |
| 1016 | nmdc:mga07m45_532518_c1 | 3300050496 | Bacteria | 680 |
| 1017 | nmdc:mga07m45_74635_c1 | 3300050496 | Bacteria | 1932 |
| 1018 | nmdc:mga05p37_211226_c1 | 3300050507 | Bacteria | 1411 |
| 1019 | nmdc:mga05p37_548580_c1 | 3300050507 | Bacteria | 1316 |
| 1020 | nmdc:mga0qj67_637820_c1 | 3300050509 | Bacteria | 850 |
| 1021 | nmdc:mga08y16_1055738_c1 | 3300050511 | Bacteria | 789 |
| 1022 | nmdc:mga08y16_586043_c1 | 3300050511 | Bacteria | 1125 |
| 1023 | nmdc:mga0n895_783721_c1 | 3300050512 | Bacteria | 945 |
| 1024 | nmdc:mga0rr50_454903_c1 | 3300050513 | Bacteria | 1085 |
| 1025 | nmdc:mga0a205_1100808_c1 | 3300050515 | Bacteria | 642 |
| 1026 | nmdc:mga0sz30_146398_c1 | 3300050516 | Bacteria | 1044 |
| 1027 | nmdc:mga0sz30_166288_c1 | 3300050516 | Bacteria | 978 |
| 1028 | nmdc:mga0sz30_199165_c1 | 3300050516 | Bacteria | 889 |
| 1029 | nmdc:mga0sz30_28823_c1 | 3300050516 | Bacteria | 2286 |
| 1030 | nmdc:mga0sz30_541858_c1 | 3300050516 | Bacteria | 525 |
| 1031 | nmdc:mga0sz30_93353_c1 | 3300050516 | Bacteria | 1311 |
| 1032 | Ga0495601_0216694 | 3300053077 | Bacteria | 1250 |
| 1033 | Ga0495612_0023692 | 3300053078 | Bacteria | 2464 |
| 1034 | Ga0495612_0070558 | 3300053078 | Bacteria | 1456 |
| 1035 | Ga0495612_0130920 | 3300053078 | Bacteria | 1084 |
| 1036 | Ga0495612_0156811 | 3300053078 | Bacteria | 993 |
| 1037 | Ga0500610_0255682 | 3300053079 | Bacteria | 804 |
| 1038 | Ga0500635_0302216 | 3300053080 | Bacteria | 631 |
| 1039 | Ga0495595_0000828 | 3300053084 | Bacteria | 11843 |
| 1040 | Ga0495595_0669471 | 3300053084 | Bacteria | 531 |
| 1041 | Ga0495619_0000912 | 3300053085 | Bacteria | 19381 |
| 1042 | Ga0495619_0102327 | 3300053085 | Bacteria | 1951 |
| 1043 | Ga0495619_0718543 | 3300053085 | Bacteria | 679 |
| 1044 | Ga0495619_0724918 | 3300053085 | Bacteria | 675 |
| 1045 | Ga0500578_0156825 | 3300053086 | Bacteria | 1415 |
| 1046 | Ga0500578_0232065 | 3300053086 | Bacteria | 1118 |
| 1047 | Ga0500643_000048 | 3300053087 | Bacteria | 147879 |
| 1048 | Ga0500643_067043 | 3300053087 | Bacteria | 999 |
| 1049 | Ga0500581_116512 | 3300053089 | Bacteria | 1295 |
| 1050 | Ga0500646_0010979 | 3300053090 | Bacteria | 2326 |
| 1051 | Ga0500646_0017492 | 3300053090 | Bacteria | 1881 |
| 1052 | Ga0500647_0241710 | 3300053091 | Bacteria | 798 |
| 1053 | Ga0500583_0144820 | 3300053092 | Bacteria | 1181 |
| 1054 | Ga0500583_0177472 | 3300053092 | Bacteria | 1061 |
| 1055 | Ga0500651_0037353 | 3300053093 | Bacteria | 3060 |
| 1056 | Ga0500651_0239009 | 3300053093 | Bacteria | 1060 |
| 1057 | Ga0500651_0575009 | 3300053093 | Bacteria | 614 |
| 1058 | Ga0500566_0000126 | 3300053094 | Bacteria | 39286 |
| 1059 | Ga0500566_0004965 | 3300053094 | Bacteria | 7920 |
| 1060 | Ga0500566_0029885 | 3300053094 | Bacteria | 3181 |
| 1061 | Ga0500640_007080 | 3300053095 | Bacteria | 4334 |
| 1062 | Ga0500641_0012056 | 3300053096 | Bacteria | 3150 |
| 1063 | Ga0500554_007778 | 3300053102 | Bacteria | 2483 |
| 1064 | Ga0500555_058884 | 3300053103 | Bacteria | 1037 |
| 1065 | Ga0500556_0036495 | 3300053104 | Bacteria | 1705 |
| 1066 | Ga0500557_000083 | 3300053105 | Bacteria | 32931 |
| 1067 | Ga0500562_027531 | 3300053108 | Bacteria | 1492 |
| 1068 | Ga0500562_049544 | 3300053108 | Bacteria | 1122 |
| 1069 | Ga0500569_002207 | 3300053109 | Bacteria | 3798 |
| 1070 | Ga0500569_020574 | 3300053109 | Bacteria | 1733 |
| 1071 | Ga0500572_004191 | 3300053111 | Bacteria | 3277 |
| 1072 | Ga0500591_250562 | 3300053115 | Bacteria | 547 |
| 1073 | Ga0500594_0169626 | 3300053118 | Bacteria | 708 |
| 1074 | Ga0500594_0219768 | 3300053118 | Bacteria | 628 |
| 1075 | Ga0500595_000333 | 3300053119 | Bacteria | 30925 |
| 1076 | Ga0500595_005544 | 3300053119 | Bacteria | 5498 |
| 1077 | Ga0500595_031641 | 3300053119 | Bacteria | 1773 |
| 1078 | Ga0500595_092253 | 3300053119 | Bacteria | 875 |
| 1079 | Ga0500608_017998 | 3300053122 | Bacteria | 3218 |
| 1080 | Ga0500608_197079 | 3300053122 | Bacteria | 836 |
| 1081 | Ga0500614_070743 | 3300053123 | Bacteria | 957 |
| 1082 | Ga0500614_132923 | 3300053123 | Bacteria | 740 |
| 1083 | Ga0500642_0056130 | 3300053130 | Bacteria | 1754 |
| 1084 | Ga0500642_0141531 | 3300053130 | Bacteria | 1128 |
| 1085 | Ga0500658_0016844 | 3300053134 | Bacteria | 2725 |
| 1086 | Ga0500658_0293632 | 3300053134 | Bacteria | 747 |
| 1087 | Ga0500559_0003961 | 3300053136 | Bacteria | 7132 |
| 1088 | Ga0500559_0327889 | 3300053136 | Bacteria | 717 |
| 1089 | Ga0500568_0066543 | 3300053139 | Bacteria | 1386 |
| 1090 | Ga0500577_0049030 | 3300053142 | Bacteria | 1577 |
| 1091 | Ga0500577_0080669 | 3300053142 | Bacteria | 1297 |
| 1092 | Ga0500577_0242731 | 3300053142 | Bacteria | 782 |
| 1093 | Ga0500588_0051976 | 3300053146 | Bacteria | 1281 |
| 1094 | Ga0500588_0204124 | 3300053146 | Bacteria | 733 |
| 1095 | Ga0500589_094668 | 3300053147 | Bacteria | 1308 |
| 1096 | Ga0500589_166093 | 3300053147 | Bacteria | 882 |
| 1097 | Ga0500603_000178 | 3300053150 | Bacteria | 16265 |
| 1098 | Ga0500603_000304 | 3300053150 | Bacteria | 12869 |
| 1099 | Ga0500603_007176 | 3300053150 | Bacteria | 2442 |
| 1100 | Ga0500604_0083099 | 3300053151 | Bacteria | 1037 |
| 1101 | Ga0500604_0130236 | 3300053151 | Bacteria | 845 |
| 1102 | Ga0500616_0000033 | 3300053153 | Bacteria | 398830 |
| 1103 | Ga0500619_149490 | 3300053154 | Bacteria | 795 |
| 1104 | Ga0500620_136482 | 3300053155 | Bacteria | 858 |
| 1105 | Ga0500622_0005267 | 3300053156 | Bacteria | 7803 |
| 1106 | Ga0500622_0078202 | 3300053156 | Bacteria | 1660 |
| 1107 | Ga0500622_0428744 | 3300053156 | Bacteria | 531 |
| 1108 | Ga0500630_002602 | 3300053159 | Bacteria | 8690 |
| 1109 | Ga0500634_0076256 | 3300053161 | Bacteria | 1741 |
| 1110 | Ga0500638_007384 | 3300053162 | Bacteria | 4593 |
| 1111 | Ga0500638_109121 | 3300053162 | Bacteria | 1280 |
| 1112 | Ga0500638_192821 | 3300053162 | Bacteria | 869 |
| 1113 | Ga0500639_000039 | 3300053163 | Bacteria | 65182 |
| 1114 | Ga0500636_0015443 | 3300053177 | Bacteria | 4500 |
| 1115 | Ga0500636_0032865 | 3300053177 | Bacteria | 3071 |
| 1116 | Ga0500636_0103923 | 3300053177 | Bacteria | 1612 |
| 1117 | Ga0500637_0000060 | 3300053178 | Bacteria | 38881 |
| 1118 | Ga0500637_0003041 | 3300053178 | Bacteria | 7626 |
| 1119 | Ga0500625_007842 | 3300053729 | Bacteria | 4666 |
| 1120 | Ga0500645_041367 | 3300053730 | Bacteria | 1361 |
| 1121 | Ga0500645_127898 | 3300053730 | Bacteria | 707 |
| 1122 | Ga0500609_001859 | 3300053731 | Bacteria | 3062 |
| 1123 | Ga0500599_013831 | 3300053736 | Bacteria | 1095 |
| 1124 | Ga0500601_008730 | 3300053737 | Bacteria | 1128 |
| 1125 | Ga0501084_0041770 | 3300054114 | Bacteria | 3836 |
| 1126 | Ga0500661_003670 | 3300055283 | Bacteria | 2884 |
| 1127 | Ga0500661_032918 | 3300055283 | Bacteria | 915 |
| 1128 | Ga0501082_0002719 | 3300060353 | Bacteria | 15447 |
| 1129 | 2793077974 | |||
| 1130 | 2513659783 | 2513237096 | Bacteria | 8722461 |
| 1131 | 2513704354 | 2513237102 | Bacteria | 7703324 |
| 1132 | 2513857245 | 2513237137 | Bacteria | 9558895 |
| 1133 | 2513918859 | 2513237145 | Bacteria | 8979722 |
| 1134 | 2524468639 | 2524023210 | Bacteria | 9029266 |
| 1135 | 2524533361 | 2524023228 | Bacteria | 10118060 |
| 1136 | 2603860086 | 2602042107 | Bacteria | 6226103 |
| 1137 | 2617347779 | 2617270735 | Bacteria | 9163226 |
| 1138 | 2671119356 | 2667528175 | Bacteria | 7532676 |
| 1139 | 2723842256 | 2721755755 | Bacteria | 8322773 |
| 1140 | 2793061565 | 2791355196 | Bacteria | 7323613 |
| 1141 | 2824775740 | 2824773399 | Bacteria | 8360218 |
| 1142 | 2857513315 | 2857509624 | Bacteria | 7472071 |
| 1143 | 2874620221 | 2874612657 | Bacteria | 8252029 |
| 1144 | 2876815709 | 2876808645 | Bacteria | 8824342 |
| 1145 | 2879106653 | 2879099564 | Bacteria | 10442239 |
| 1146 | 2879117031 | 2879110137 | Bacteria | 8907982 |
| 1147 | 2885380645 | 2885374607 | Bacteria | 8927485 |
| 1148 | 2889036372 | 2889033259 | Bacteria | 9099371 |
| 1149 | 2906643419 | 2906635258 | Bacteria | 8601019 |
| 1150 | 2906666611 | 2906660503 | Bacteria | 8595048 |
| 1151 | 2908746712 | 2908739725 | Bacteria | 8628932 |
| 1152 | 2919078957 | 2919073203 | Bacteria | 6531949 |
| 1153 | 2922389352 | 2922386360 | Bacteria | 7017218 |
| 1154 | 2932800637 | 2932794094 | Bacteria | 7915132 |
| 1155 | 2932808368 | 2932801729 | Bacteria | 7987968 |
| 1156 | 2932813326 | 2932809354 | Bacteria | 9135765 |
| 1157 | 2932820023 | 2932818245 | Bacteria | 9955613 |
| 1158 | 2935687223 | 2935684952 | Bacteria | 9590419 |
| 1159 | 2935716911 | 2935713505 | Bacteria | 9608509 |
| 1160 | 2935722964 | 2935722832 | Bacteria | 9608746 |
| 1161 | 2935734521 | 2935732158 | Bacteria | 9706831 |
| 1162 | 2935744688 | 2935741537 | Bacteria | 9707219 |
| 1163 | 2935753189 | 2935750917 | Bacteria | 9590372 |
| 1164 | 2935767593 | 2935760218 | Bacteria | 9817913 |
| 1165 | 2935770188 | 2935769743 | Bacteria | 7878163 |
| 1166 | 2935777782 | 2935777560 | Bacteria | 8077691 |
| 1167 | 2935786758 | 2935785616 | Bacteria | 7962367 |
| 1168 | 2935794812 | 2935793552 | Bacteria | 8012592 |
| 1169 | 2935883475 | 2935883170 | Bacteria | 7964738 |
| 1170 | 2940559102 | 2940556831 | Bacteria | 9590747 |
| 1171 | 3005475656 | 3005474847 | Bacteria | 9259049 |
| 1172 | 3005601851 | 3005594810 | Bacteria | 8716512 |
| 1173 | 3005717589 | 3005710791 | Bacteria | 7622528 |
| 1174 | 3005724638 | 3005718088 | Bacteria | 8283608 |
| 1175 | 8006936991 | 8006933436 | Bacteria | 10410654 |
| 1176 | 8006966343 | 8006964411 | Bacteria | 8966052 |
| 1177 | 8006976958 | 8006973647 | Bacteria | 10679141 |
| 1178 | 8006993169 | 8006984368 | Bacteria | 9651211 |
| 1179 | 8016526945 | 8016522445 | Bacteria | 8156687 |
| 1180 | 8016545239 | 8016539877 | Bacteria | 8155419 |
| 1181 | 8016556849 | 8016548790 | Bacteria | 8155074 |
| 1182 | 8016565202 | 8016557553 | Bacteria | 8154380 |
| 1183 | 8016570318 | 8016566248 | Bacteria | 8158151 |
| 1184 | 8016582865 | 8016575299 | Bacteria | 8154085 |
| 1185 | 8016602845 | 8016595262 | Bacteria | 8149947 |
| 1186 | 8016605715 | 8016603502 | Bacteria | 8731218 |
| 1187 | 8016617622 | 8016613128 | Bacteria | 8794220 |
| 1188 | 8016623948 | 8016622563 | Bacteria | 7999408 |
| 1189 | 8016634916 | 8016630954 | Bacteria | 9217207 |
| 1190 | 8019531848 | 8019530166 | Bacteria | 8155624 |
| 1191 | 8019539683 | 8019538911 | Bacteria | 7872763 |
| 1192 | 8019550967 | 8019547302 | Bacteria | 7996444 |
| 1193 | 8056678194 | 8056673599 | Bacteria | 7871253 |
| 1194 | 8056975361 | 8056967851 | Bacteria | 9038162 |
| 1195 | JGI24739J22299_10006399 | |||
| 1196 | JGI25406J46586_10022537 | |||
| 1197 | JGI25153J46596_10003608 | |||
| 1198 | JGI25153J46596_10004959 | |||
| 1199 | JGI25153J46596_10006371 | |||
| 1200 | JGI25160J50197_1018792 | |||
| 1201 | JGI25404J52841_10016499 | |||
| 1202 | JGI25404J52841_10023848 | |||
| 1203 | JGI25404J52841_10024822 | |||
| 1204 | Ga0055543_1052251 | |||
| 1205 | Ga0065165_1001167 | |||
| 1206 | Ga0070658_10196084 | |||
| 1207 | Ga0070658_10283368 | |||
| 1208 | Ga0070658_10381761 | |||
| 1209 | Ga0070658_10396113 | |||
| 1210 | Ga0070658_11209812 | |||
| 1211 | Ga0070676_10079748 | |||
| 1212 | Ga0070676_10379389 | |||
| 1213 | Ga0070690_100560287 | |||
| 1214 | Ga0070670_100153306 | |||
| 1215 | Ga0070677_10611733 | |||
| 1216 | Ga0068869_100039611 | |||
| 1217 | Ga0068869_100237260 | |||
| 1218 | Ga0068869_100240733 | |||
| 1219 | Ga0068869_100316965 | |||
| 1220 | Ga0070666_10151911 | |||
| 1221 | Ga0070666_10198061 | |||
| 1222 | Ga0070680_100469175 | |||
| 1223 | Ga0070682_101517579 | |||
| 1224 | Ga0068868_100040865 | |||
| 1225 | Ga0068868_100483032 | |||
| 1226 | Ga0068868_101014153 | |||
| 1227 | Ga0068868_101140663 | |||
| 1228 | Ga0070661_100058873 | |||
| 1229 | Ga0070661_100165332 | |||
| 1230 | Ga0070668_100362475 | |||
| 1231 | Ga0070668_100616553 | |||
| 1232 | Ga0070668_100910678 | |||
| 1233 | Ga0070668_101351939 | |||
| 1234 | Ga0070669_100095141 | |||
| 1235 | Ga0070669_100385403 | |||
| 1236 | Ga0070675_100211821 | |||
| 1237 | Ga0070671_100116309 | |||
| 1238 | Ga0070671_100425391 | |||
| 1239 | Ga0070671_100565108 | |||
| 1240 | Ga0070671_100581789 | |||
| 1241 | Ga0070671_100632877 | |||
| 1242 | Ga0070671_101352816 | |||
| 1243 | Ga0070674_100617891 | |||
| 1244 | Ga0070674_101096692 | |||
| 1245 | Ga0070673_100247812 | |||
| 1246 | Ga0070667_100706940 | |||
| 1247 | Ga0070667_100932570 | |||
| 1248 | Ga0070709_10001520 | |||
| 1249 | Ga0070709_10008885 | |||
| 1250 | Ga0070714_100005907 | |||
| 1251 | Ga0070714_101141603 | |||
| 1252 | Ga0070713_100331509 | |||
| 1253 | Ga0070713_100886729 | |||
| 1254 | Ga0070710_10000733 | |||
| 1255 | Ga0070710_10014290 | |||
| 1256 | Ga0070710_10342128 | |||
| 1257 | Ga0070711_100001130 | |||
| 1258 | Ga0070711_100005326 | |||
| 1259 | Ga0070711_100558104 | |||
| 1260 | Ga0070700_100054382 | |||
| 1261 | Ga0070663_100148671 | |||
| 1262 | Ga0070663_100168859 | |||
| 1263 | Ga0070663_100390385 | |||
| 1264 | Ga0070678_100024391 | |||
| 1265 | Ga0070678_100115610 | |||
| 1266 | Ga0070678_101261298 | |||
| 1267 | Ga0070662_100052852 | |||
| 1268 | Ga0070662_100081245 | |||
| 1269 | Ga0070662_100182385 | |||
| 1270 | Ga0070662_100285527 | |||
| 1271 | Ga0070681_10211895 | |||
| 1272 | Ga0070681_10569120 | |||
| 1273 | Ga0070681_10921359 | |||
| 1274 | Ga0068867_100244819 | |||
| 1275 | Ga0068867_100274201 | |||
| 1276 | Ga0068867_100369011 | |||
| 1277 | Ga0070706_100740746 | |||
| 1278 | Ga0070707_100452275 | |||
| 1279 | Ga0070698_100427261 | |||
| 1280 | Ga0070698_100430652 | |||
| 1281 | Ga0070698_100483081 | |||
| 1282 | Ga0070699_101088599 | |||
| 1283 | Ga0070679_100080757 | |||
| 1284 | Ga0070679_100126592 | |||
| 1285 | Ga0070697_100096466 | |||
| 1286 | Ga0068853_100037982 | |||
| 1287 | Ga0068853_100407464 | |||
| 1288 | Ga0068853_100824905 | |||
| 1289 | Ga0070672_101310748 | |||
| 1290 | Ga0070696_100171166 | |||
| 1291 | Ga0070693_100107854 | |||
| 1292 | Ga0070693_100591800 | |||
| 1293 | Ga0070665_100004629 | |||
| 1294 | Ga0070665_100090496 | |||
| 1295 | Ga0070665_100105979 | |||
| 1296 | Ga0070665_100201348 | |||
| 1297 | Ga0070665_100505908 | |||
| 1298 | Ga0070665_100744167 | |||
| 1299 | Ga0070665_100829596 | |||
| 1300 | Ga0070665_101263734 | |||
| 1301 | Ga0068855_100077128 | |||
| 1302 | Ga0068855_100099019 | |||
| 1303 | Ga0068855_100236674 | |||
| 1304 | Ga0068855_100817199 | |||
| 1305 | Ga0070664_100087892 | |||
| 1306 | Ga0070664_100513061 | |||
| 1307 | Ga0068854_100902723 | |||
| 1308 | Ga0068854_101024358 | |||
| 1309 | Ga0068856_100205397 | |||
| 1310 | Ga0070702_100282790 | |||
| 1311 | Ga0070702_100426556 | |||
| 1312 | Ga0068852_100067797 | |||
| 1313 | Ga0068852_100156188 | |||
| 1314 | Ga0068852_100301187 | |||
| 1315 | Ga0068852_101141836 | |||
| 1316 | Ga0068852_101418258 | |||
| 1317 | Ga0068852_101606654 | |||
| 1318 | Ga0068859_100273153 | |||
| 1319 | Ga0068859_100719402 | |||
| 1320 | Ga0068859_101111325 | |||
| 1321 | Ga0068859_101763055 | |||
| 1322 | Ga0068864_100264613 | |||
| 1323 | Ga0068864_101421818 | |||
| 1324 | Ga0068866_10039340 | |||
| 1325 | Ga0068861_100076821 | |||
| 1326 | Ga0068861_100119779 | |||
| 1327 | Ga0068861_100707850 | |||
| 1328 | Ga0068861_100724546 | |||
| 1329 | Ga0068861_100836656 | |||
| 1330 | Ga0068861_101507593 | |||
| 1331 | Ga0068870_10281582 | |||
| 1332 | Ga0068870_10324289 | |||
| 1333 | Ga0068863_100339344 | |||
| 1334 | Ga0068863_101413576 | |||
| 1335 | Ga0068858_100060026 | |||
| 1336 | Ga0068858_100317108 | |||
| 1337 | Ga0068858_101242336 | |||
| 1338 | Ga0068860_100141032 | |||
| 1339 | Ga0068860_100421243 | |||
| 1340 | Ga0068862_100196039 | |||
| 1341 | Ga0068862_100212955 | |||
| 1342 | Ga0068862_100260305 | |||
| 1343 | Ga0068862_100309934 | |||
| 1344 | Ga0068862_101124046 | |||
| 1345 | Ga0081455_10080519 | |||
| 1346 | Ga0081455_10127351 | |||
| 1347 | Ga0081455_10157722 | |||
| 1348 | Ga0081540_1002866 | |||
| 1349 | Ga0081540_1005656 | |||
| 1350 | Ga0081540_1016160 | |||
| 1351 | Ga0081540_1021799 | |||
| 1352 | Ga0081540_1024467 | |||
| 1353 | Ga0081540_1027780 | |||
| 1354 | Ga0081540_1039864 | |||
| 1355 | Ga0081540_1074197 | |||
| 1356 | Ga0081540_1160389 | |||
| 1357 | Ga0081539_10000157 | |||
| 1358 | Ga0081539_10037110 | |||
| 1359 | Ga0070717_10008111 | |||
| 1360 | Ga0075365_10070542 | |||
| 1361 | Ga0075365_10085860 | |||
| 1362 | Ga0075365_10125077 | |||
| 1363 | Ga0075365_10131480 | |||
| 1364 | Ga0075365_10132947 | |||
| 1365 | Ga0075365_10227586 | |||
| 1366 | Ga0075368_10092765 | |||
| 1367 | Ga0075368_10256249 | |||
| 1368 | Ga0075363_100002704 | |||
| 1369 | Ga0075363_100125558 | |||
| 1370 | Ga0075364_10035757 | |||
| 1371 | Ga0075364_10144996 | |||
| 1372 | Ga0075364_10176908 | |||
| 1373 | Ga0075364_10270559 | |||
| 1374 | Ga0075364_10930453 | |||
| 1375 | Ga0070715_10278916 | |||
| 1376 | Ga0070716_100268189 | |||
| 1377 | Ga0070716_100556967 | |||
| 1378 | Ga0070716_100763611 | |||
| 1379 | Ga0070712_100002371 | |||
| 1380 | Ga0070712_100556936 | |||
| 1381 | Ga0075362_10047780 | |||
| 1382 | Ga0075362_10113141 | |||
| 1383 | Ga0075362_10175993 | |||
| 1384 | Ga0075362_10400758 | |||
| 1385 | Ga0075367_10005584 | |||
| 1386 | Ga0075367_10076759 | |||
| 1387 | Ga0075367_10105118 | |||
| 1388 | Ga0075367_10208934 | |||
| 1389 | Ga0075367_10352705 | |||
| 1390 | Ga0075369_10004189 | |||
| 1391 | Ga0075369_10058287 | |||
| 1392 | Ga0075369_10186833 | |||
| 1393 | Ga0075369_10190255 | |||
| 1394 | Ga0075366_10067116 | |||
| 1395 | Ga0075366_10140574 | |||
| 1396 | Ga0075366_10410474 | |||
| 1397 | Ga0097621_100220287 | |||
| 1398 | Ga0075370_10001262 | |||
| 1399 | Ga0075370_10066034 | |||
| 1400 | Ga0075370_10135157 | |||
| 1401 | Ga0075370_10183674 | |||
| 1402 | Ga0068871_100100889 | |||
| 1403 | Ga0068871_100517093 | |||
| 1404 | Ga0068871_100665344 | |||
| 1405 | Ga0068871_100829921 | |||
| 1406 | Ga0075428_100074682 | |||
| 1407 | Ga0075428_100871338 | |||
| 1408 | Ga0075433_10857647 | |||
| 1409 | Ga0075434_100087493 | |||
| 1410 | Ga0075434_100469416 | |||
| 1411 | Ga0068865_100008510 | |||
| 1412 | Ga0097620_100273166 | |||
| 1413 | Ga0097620_100719387 | |||
| 1414 | Ga0097620_101111300 | |||
| 1415 | Ga0097620_101763323 | |||
| 1416 | Ga0099825_1025612 | |||
| 1417 | Ga0099824_1008303 | |||
| 1418 | Ga0099822_1000541 | |||
| 1419 | Ga0099823_1031325 | |||
| 1420 | Ga0075435_100571611 | |||
| 1421 | Ga0099794_10118262 | |||
| 1422 | Ga0099794_10166703 | |||
| 1423 | Ga0099795_10078154 | |||
| 1424 | Ga0099795_10146250 | |||
| 1425 | Ga0099795_10254010 | |||
| 1426 | Ga0105250_10309503 | |||
| 1427 | Ga0105250_10394331 | |||
| 1428 | Ga0105240_10013303 | |||
| 1429 | Ga0105240_10362741 | |||
| 1430 | Ga0105240_11000465 | |||
| 1431 | Ga0105240_11470620 | |||
| 1432 | Ga0111539_10456176 | |||
| 1433 | Ga0111539_10657793 | |||
| 1434 | Ga0111539_11471018 | |||
| 1435 | Ga0105245_10042563 | |||
| 1436 | Ga0105245_10089665 | |||
| 1437 | Ga0105245_10492023 | |||
| 1438 | Ga0105247_10067424 | |||
| 1439 | Ga0105247_10159213 | |||
| 1440 | Ga0105247_10171621 | |||
| 1441 | Ga0105247_10232180 | |||
| 1442 | Ga0114129_10172553 | |||
| 1443 | Ga0114129_11556122 | |||
| 1444 | Ga0105243_10760555 | |||
| 1445 | Ga0105243_10816378 | |||
| 1446 | Ga0105243_11861817 | |||
| 1447 | Ga0105241_10004267 | |||
| 1448 | Ga0105241_10024156 | |||
| 1449 | Ga0105241_10036215 | |||
| 1450 | Ga0105242_10042608 | |||
| 1451 | Ga0105242_10274728 | |||
| 1452 | Ga0105248_10046362 | |||
| 1453 | Ga0105248_10401747 | |||
| 1454 | Ga0105248_10532904 | |||
| 1455 | Ga0105248_11549125 | |||
| 1456 | Ga0105248_12285696 | |||
| 1457 | Ga0105237_10017841 | |||
| 1458 | Ga0105237_10082678 | |||
| 1459 | Ga0105237_10323997 | |||
| 1460 | Ga0105237_10483707 | |||
| 1461 | Ga0105237_10684936 | |||
| 1462 | Ga0105238_11066560 | |||
| 1463 | Ga0105238_12971070 | |||
| 1464 | Ga0105249_10231397 | |||
| 1465 | Ga0105249_10750143 | |||
| 1466 | Ga0105249_11861447 | |||
| 1467 | Ga0099796_10154143 | |||
| 1468 | Ga0105239_10072795 | |||
| 1469 | Ga0105239_10134403 | |||
| 1470 | Ga0105239_10759835 | |||
| 1471 | Ga0105239_11441313 | |||
| 1472 | Ga0105246_10151873 | |||
| 1473 | Ga0105246_10411645 | |||
| 1474 | Ga0105246_10524800 | |||
| 1475 | Ga0105246_10538567 | |||
| 1476 | Ga0105246_10612107 | |||
| 1477 | Ga0105246_10780316 | |||
| 1478 | Ga0157370_10115958 | |||
| 1479 | Ga0157370_10267710 | |||
| 1480 | Ga0157369_10580485 | |||
| 1481 | Ga0157369_10630574 | |||
| 1482 | Ga0157369_10645994 | |||
| 1483 | Ga0157374_10156652 | |||
| 1484 | Ga0157374_10516010 | |||
| 1485 | Ga0157374_10641331 | |||
| 1486 | Ga0157378_10091042 | |||
| 1487 | Ga0157378_11737268 | |||
| 1488 | Ga0163162_10201665 | |||
| 1489 | Ga0157372_10154292 | |||
| 1490 | Ga0157372_10495804 | |||
| 1491 | Ga0157375_10407254 | |||
| 1492 | Ga0157375_11192575 | |||
| 1493 | Ga0163163_10010769 | |||
| 1494 | Ga0163163_10633800 | |||
| 1495 | Ga0163163_10845293 | |||
| 1496 | Ga0163163_10878787 | |||
| 1497 | Ga0157380_10109852 | |||
| 1498 | Ga0157380_13021209 | |||
| 1499 | Ga0182008_10711944 | |||
| 1500 | Ga0157377_10362097 | |||
| 1501 | Ga0157379_10381576 | |||
| 1502 | Ga0157379_10502781 | |||
| 1503 | Ga0157379_10688993 | |||
| 1504 | Ga0157376_10279832 | |||
| 1505 | Ga0157376_11327521 | |||
| 1506 | Ga0157376_12293560 | |||
| 1507 | Ga0163161_10090485 | |||
| 1508 | Ga0163161_11269528 | |||
| 1509 | Ga0209233_1024790 | |||
| 1510 | Ga0209233_1040219 | |||
| 1511 | Ga0209564_1005249 | |||
| 1512 | Ga0209758_1000015 | |||
| 1513 | Ga0209758_1000711 | |||
| 1514 | Ga0209758_1000764 | |||
| 1515 | Ga0209758_1001468 | |||
| 1516 | Ga0209758_1004096 | |||
| 1517 | Ga0209758_1020867 | |||
| 1518 | Ga0209758_1023868 | |||
| 1519 | Ga0209758_1120108 | |||
| 1520 | Ga0207426_1000368 | |||
| 1521 | Ga0207426_1005258 | |||
| 1522 | Ga0209257_1001688 | |||
| 1523 | Ga0209257_1046246 | |||
| 1524 | Ga0207656_10228227 | |||
| 1525 | Ga0207696_1074971 | |||
| 1526 | Ga0207653_10113249 | |||
| 1527 | Ga0207692_10015137 | |||
| 1528 | Ga0207642_10090991 | |||
| 1529 | Ga0207710_10030533 | |||
| 1530 | Ga0207710_10062253 | |||
| 1531 | Ga0207710_10364493 | |||
| 1532 | Ga0207688_10044786 | |||
| 1533 | Ga0207688_10243807 | |||
| 1534 | Ga0207680_10082706 | |||
| 1535 | Ga0207680_10151823 | |||
| 1536 | Ga0207685_10115210 | |||
| 1537 | Ga0207699_10001435 | |||
| 1538 | Ga0207699_10014909 | |||
| 1539 | Ga0207645_10093050 | |||
| 1540 | Ga0207645_10226471 | |||
| 1541 | Ga0207645_10536081 | |||
| 1542 | Ga0207643_10282726 | |||
| 1543 | Ga0207705_10092997 | |||
| 1544 | Ga0207705_10437836 | |||
| 1545 | Ga0207684_10175591 | |||
| 1546 | Ga0207684_10242516 | |||
| 1547 | Ga0207654_10007028 | |||
| 1548 | Ga0207654_10014303 | |||
| 1549 | Ga0207654_10033366 | |||
| 1550 | Ga0207654_10343487 | |||
| 1551 | Ga0207707_10329438 | |||
| 1552 | Ga0207707_11086164 | |||
| 1553 | Ga0207707_11235162 | |||
| 1554 | Ga0207695_10000059 | |||
| 1555 | Ga0207671_10069543 | |||
| 1556 | Ga0207671_10070718 | |||
| 1557 | Ga0207693_10031785 | |||
| 1558 | Ga0207693_10055562 | |||
| 1559 | Ga0207693_10529038 | |||
| 1560 | Ga0207663_10010613 | |||
| 1561 | Ga0207663_10157663 | |||
| 1562 | Ga0207663_11013254 | |||
| 1563 | Ga0207660_10126351 | |||
| 1564 | Ga0207660_10215862 | |||
| 1565 | Ga0207662_10311038 | |||
| 1566 | Ga0207657_10335838 | |||
| 1567 | Ga0207657_10414767 | |||
| 1568 | Ga0207649_10582023 | |||
| 1569 | Ga0207649_10856645 | |||
| 1570 | Ga0207649_11020206 | |||
| 1571 | Ga0207652_10080629 | |||
| 1572 | Ga0207652_10097186 | |||
| 1573 | Ga0207652_10462534 | |||
| 1574 | Ga0207646_10679543 | |||
| 1575 | Ga0207646_11679166 | |||
| 1576 | Ga0207681_10298305 | |||
| 1577 | Ga0207681_10372841 | |||
| 1578 | Ga0207681_10445951 | |||
| 1579 | Ga0207681_11336926 | |||
| 1580 | Ga0207694_10702565 | |||
| 1581 | Ga0207659_10161582 | |||
| 1582 | Ga0207687_10007517 | |||
| 1583 | Ga0207687_10119132 | |||
| 1584 | Ga0207687_10121735 | |||
| 1585 | Ga0207687_10151728 | |||
| 1586 | Ga0207687_11273632 | |||
| 1587 | Ga0207700_10057510 | |||
| 1588 | Ga0207700_10140200 | |||
| 1589 | Ga0207664_10006581 | |||
| 1590 | Ga0207664_10841798 | |||
| 1591 | Ga0207664_11068265 | |||
| 1592 | Ga0207644_10250191 | |||
| 1593 | Ga0207644_10464983 | |||
| 1594 | Ga0207644_10903355 | |||
| 1595 | Ga0207644_10912867 | |||
| 1596 | Ga0207690_10490569 | |||
| 1597 | Ga0207706_10109499 | |||
| 1598 | Ga0207706_10287563 | |||
| 1599 | Ga0207706_10356857 | |||
| 1600 | Ga0207686_10208175 | |||
| 1601 | Ga0207709_10095190 | |||
| 1602 | Ga0207709_10638257 | |||
| 1603 | Ga0207669_10016439 | |||
| 1604 | Ga0207669_10479684 | |||
| 1605 | Ga0207704_10131029 | |||
| 1606 | Ga0207704_10796728 | |||
| 1607 | Ga0207704_10986212 | |||
| 1608 | Ga0207665_10006088 | |||
| 1609 | Ga0207665_10227470 | |||
| 1610 | Ga0207665_10454280 | |||
| 1611 | Ga0207665_10728701 | |||
| 1612 | Ga0207665_10991492 | |||
| 1613 | Ga0207691_10162687 | |||
| 1614 | Ga0207691_10309795 | |||
| 1615 | Ga0207711_10146825 | |||
| 1616 | Ga0207711_10422082 | |||
| 1617 | Ga0207711_10727953 | |||
| 1618 | Ga0207689_10131954 | |||
| 1619 | Ga0207689_10224110 | |||
| 1620 | Ga0207689_10228549 | |||
| 1621 | Ga0207689_10239009 | |||
| 1622 | Ga0207689_10649416 | |||
| 1623 | Ga0207689_10719062 | |||
| 1624 | Ga0207661_10253616 | |||
| 1625 | Ga0207679_10134361 | |||
| 1626 | Ga0207667_10071740 | |||
| 1627 | Ga0207667_10282055 | |||
| 1628 | Ga0207651_10311346 | |||
| 1629 | Ga0207651_11011749 | |||
| 1630 | Ga0207651_11072339 | |||
| 1631 | Ga0207712_10084145 | |||
| 1632 | Ga0207668_10064617 | |||
| 1633 | Ga0207668_10065243 | |||
| 1634 | Ga0207668_10080782 | |||
| 1635 | Ga0207668_10378129 | |||
| 1636 | Ga0207668_10703504 | |||
| 1637 | Ga0207668_10877529 | |||
| 1638 | Ga0207640_11108375 | |||
| 1639 | Ga0207640_11146691 | |||
| 1640 | Ga0207658_11764203 | |||
| 1641 | Ga0207677_10020036 | |||
| 1642 | Ga0207677_10385154 | |||
| 1643 | Ga0207677_11065326 | |||
| 1644 | Ga0207703_10319032 | |||
| 1645 | Ga0207703_10997110 | |||
| 1646 | Ga0207703_11303432 | |||
| 1647 | Ga0207639_10056817 | |||
| 1648 | Ga0207639_10127047 | |||
| 1649 | Ga0207639_10168537 | |||
| 1650 | Ga0207639_10826691 | |||
| 1651 | Ga0207639_10853308 | |||
| 1652 | Ga0207639_10983079 | |||
| 1653 | Ga0207678_10015293 | |||
| 1654 | Ga0207678_10025317 | |||
| 1655 | Ga0207678_10056561 | |||
| 1656 | Ga0207678_10065075 | |||
| 1657 | Ga0207678_10067421 | |||
| 1658 | Ga0207678_10085166 | |||
| 1659 | Ga0207678_10120473 | |||
| 1660 | Ga0207678_10269220 | |||
| 1661 | Ga0207708_10120227 | |||
| 1662 | Ga0207708_11225937 | |||
| 1663 | Ga0207702_10073535 | |||
| 1664 | Ga0207702_11696247 | |||
| 1665 | Ga0207641_10147876 | |||
| 1666 | Ga0207641_10190911 | |||
| 1667 | Ga0207641_10778498 | |||
| 1668 | Ga0207641_11281438 | |||
| 1669 | Ga0207641_11681042 | |||
| 1670 | Ga0207648_10531033 | |||
| 1671 | Ga0207676_10146696 | |||
| 1672 | Ga0207676_10583607 | |||
| 1673 | Ga0207675_100032142 | |||
| 1674 | Ga0207675_100062464 | |||
| 1675 | Ga0207675_100561650 | |||
| 1676 | Ga0207683_10032945 | |||
| 1677 | Ga0207683_10157927 | |||
| 1678 | Ga0207683_10185954 | |||
| 1679 | Ga0207683_10249214 | |||
| 1680 | Ga0207683_10397770 | |||
| 1681 | Ga0207683_10745295 | |||
| 1682 | Ga0207683_10964213 | |||
| 1683 | Ga0207698_10120617 | |||
| 1684 | Ga0207698_10138313 | |||
| 1685 | Ga0207698_10190731 | |||
| 1686 | Ga0207698_10673807 | |||
| 1687 | Ga0207698_10706092 | |||
| 1688 | Ga0207698_10992837 | |||
| 1689 | Ga0207698_11081931 | |||
| 1690 | Ga0209389_1000012 | |||
| 1691 | Ga0209589_1000015 | |||
| 1692 | Ga0209489_100015 | |||
| 1693 | Ga0209489_100019 | |||
| 1694 | Ga0209700_100018 | |||
| 1695 | Ga0209700_100025 | |||
| 1696 | Ga0209813_10018990 | |||
| 1697 | Ga0209813_10067524 | |||
| 1698 | Ga0209813_10194350 | |||
| 1699 | Ga0207428_10354871 | |||
| 1700 | Ga0268266_10003191 | |||
| 1701 | Ga0268266_10003840 | |||
| 1702 | Ga0268266_10021532 | |||
| 1703 | Ga0268266_10081383 | |||
| 1704 | Ga0268266_10212237 | |||
| 1705 | Ga0268266_10329679 | |||
| 1706 | Ga0268266_10392100 | |||
| 1707 | Ga0268266_11612031 | |||
| 1708 | Ga0268266_12091799 | |||
| 1709 | Ga0268265_10099262 | |||
| 1710 | Ga0268265_10188787 | |||
| 1711 | Ga0268265_10238970 | |||
| 1712 | Ga0268265_10554591 | |||
| 1713 | Ga0268265_10799106 | |||
| 1714 | Ga0268264_10166142 | |||
| 1715 | Ga0268264_10727311 | |||
| 1716 | Ga0268264_11147903 | |||
| 1717 | Ga0307517_10010277 | |||
| 1718 | Ga0307517_10104578 | |||
| 1719 | Ga0307517_10492427 | |||
| 1720 | Ga0307515_10150736 | |||
| 1721 | Ga0307511_10239206 | |||
| 1722 | Ga0307509_10086316 | |||
| 1723 | Ga0307508_10000012 | |||
| 1724 | Ga0265314_10031058 | |||
| 1725 | Ga0265314_10035228 | |||
| 1726 | Ga0265342_10284576 | |||
| 1727 | Ga0307516_10154357 | |||
| 1728 | Ga0307516_10420812 | |||
| 1729 | Ga0307516_10769411 | |||
| 1730 | Ga0307405_10238070 | |||
| 1731 | Ga0307405_11279955 | |||
| 1732 | Ga0307413_10444453 | |||
| 1733 | Ga0307410_10362065 | |||
| 1734 | Ga0307406_10229561 | |||
| 1735 | Ga0307406_10301802 | |||
| 1736 | Ga0307407_10198331 | |||
| 1737 | Ga0307409_100021182 | |||
| 1738 | Ga0307416_101043225 | |||
| 1739 | Ga0307416_103126773 | |||
| 1740 | Ga0307414_10089285 | |||
| 1741 | Ga0307411_10034698 | |||
| 1742 | Ga0307411_10110407 | |||
| 1743 | Ga0307415_100715251 | |||
| 1744 | Ga0307415_100716156 | |||
| 1745 | Ga0307510_10015377 | |||
| 1746 | Ga0307510_10023362 | |||
| 1747 | Ga0307510_10104600 | |||
| 1748 | Ga0315911_1000021 | |||
| 1749 | Ga0316215_1003776 | |||
| 1750 | Ga0373938_0016509 | |||
| 1751 | Ga0373926_0384712 | |||
| 1752 | Ga0373928_0065155 | |||
| 1753 | Ga0373929_0039749 | |||
| 1754 | Ga0373934_0002532 | |||
| 1755 | Ga0373934_0025001 | |||
| 1756 | Ga0373940_0106914 | |||
| 1757 | Ga0373923_0001264 | |||
| 1758 | Ga0373932_0031046 | |||
| 1759 | Ga0373936_0019784 | |||
| 1760 | Ga0373936_0054802 | |||
| 1761 | Ga0373936_0175662 | |||
| 1762 | Ga0373953_0001769 | |||
| 1763 | Ga0373953_0024250 | |||
| 1764 | Ga0373953_0182785 | |||
| 1765 | Ga0373954_0001440 | |||
| 1766 | Ga0373954_0018385 | |||
| 1767 | Ga0373954_0346040 | |||
| 1768 | Ga0373956_0000376 | |||
| 1769 | Ga0373957_0020605 | |||
| 1770 | Ga0373943_0088008 | |||
| 1771 | Ga0373943_0574848 | |||
| 1772 | Ga0373946_0030372 | |||
| 1773 | Ga0373946_0358732 | |||
| 1774 | Ga0373955_0000325 | |||
| 1775 | Ga0373924_0004645 | |||
| 1776 | Ga0373924_0034842 | |||
| 1777 | Ga0373931_0231505 | |||
| 1778 | Ga0373927_0005689 | |||
| 1779 | Ga0373927_0043271 | |||
| 1780 | Ga0373927_0127315 | |||
| 1781 | Ga0373927_0365934 | |||
| 1782 | Ga0373927_0477611 | |||
| 1783 | Ga0373933_0005894 | |||
| 1784 | Ga0373933_0066591 | |||
| 1785 | Ga0373947_0010663 | |||
| 1786 | Ga0373947_0381697 | |||
| 1787 | Ga0373937_0007855 | |||
| 1788 | Ga0373937_0041689 | |||
| 1789 | Ga0372808_043016 | |||
| 1790 | Ga0373925_0240302 | |||
| 1791 | Ga0373925_0491280 | |||
| 1792 | Ga0395899_0038874 | |||
| 1793 | Ga0395900_0001756 | |||
| 1794 | Ga0395900_0285802 | |||
| 1795 | Ga0395900_0496477 | |||
| 1796 | Ga0395898_0023431 | |||
| 1797 | Ga0395898_0175732 | |||
| 1798 | Ga0395898_0517680 | |||
| 1799 | Ga0395905_0131973 | |||
| 1800 | Ga0395905_0212851 | |||
| 1801 | Ga0395905_0219176 | |||
| 1802 | Ga0395905_1069562 | |||
| 1803 | Ga0395901_0237445 | |||
| 1804 | Ga0451791_1154616 | |||
| 1805 | Ga0451793_0680179 | |||
| 1806 | Ga0451793_1462621 | |||
| 1807 | Ga0451797_0708742 | |||
| 1808 | Ga0451795_0001015 | |||
| 1809 | Ga0451795_1592328 | |||
| 1810 | Ga0451798_0463913 | |||
| 1811 | Ga0451807_2142046 | |||
| 1812 | Ga0451835_1074072 | |||
| 1813 | Ga0451841_1265539 | |||
| 1814 | Ga0451843_0523243 | |||
| 1815 | Ga0451843_0551884 | |||
| 1816 | Ga0451853_3149176 | |||
| 1817 | Ga0439431_0108654 | |||
| 1818 | Ga0439458_0005013 | |||
| 1819 | Ga0466969_0150312 | |||
| 1820 | Ga0466972_0099302 | |||
| 1821 | Ga0466966_0001463 | |||
| 1822 | Ga0466961_0000065 | |||
| 1823 | Ga0466963_0235852 | |||
| 1824 | Ga0466957_0197417 | |||
| 1825 | Ga0466960_0009188 | |||
| 1826 | Ga0466959_0000634 | |||
| 1827 | Ga0466967_0267715 | |||
| 1828 | Ga0466967_0412491 | |||
| 1829 | Ga0495617_140332 | |||
| 1830 | Ga0495617_150273 | |||
| 1831 | Ga0495592_0000339 | |||
| 1832 | Ga0495592_0083745 | |||
| 1833 | Ga0495592_0127004 | |||
| 1834 | Ga0495603_0043528 | |||
| 1835 | Ga0495603_0050828 | |||
| 1836 | Ga0495603_0052048 | |||
| 1837 | Ga0495603_0115547 | |||
| 1838 | Ga0495603_0118466 | |||
| 1839 | Ga0495603_0141413 | |||
| 1840 | Ga0495603_0190931 | |||
| 1841 | Ga0495629_0001483 | |||
| 1842 | Ga0495629_0006648 | |||
| 1843 | Ga0495629_0222645 | |||
| 1844 | Ga0495638_0022821 | |||
| 1845 | Ga0495638_0077199 | |||
| 1846 | Ga0495638_0117441 | |||
| 1847 | Ga0495638_0188711 | |||
| 1848 | Ga0495638_0224123 | |||
| 1849 | Ga0495638_0290946 | |||
| 1850 | Ga0495641_0151578 | |||
| 1851 | Ga0495651_0015606 | |||
| 1852 | Ga0495651_0017638 | |||
| 1853 | Ga0495651_0112213 | |||
| 1854 | Ga0495651_0278941 | |||
| 1855 | Ga0495653_0001063 | |||
| 1856 | Ga0495653_0281852 | |||
| 1857 | Ga0495650_0071255 | |||
| 1858 | Ga0495650_0149314 | |||
| 1859 | Ga0495580_0317654 | |||
| 1860 | Ga0495605_0238287 | |||
| 1861 | Ga0495639_0080160 | |||
| 1862 | Ga0495639_0103420 | |||
| 1863 | Ga0495639_0159612 | |||
| 1864 | Ga0495639_0175459 | |||
| 1865 | Ga0495664_0221848 | |||
| 1866 | Ga0495664_0234375 | |||
| 1867 | Ga0495664_0484171 | |||
| 1868 | Ga0495584_0238821 | |||
| 1869 | Ga0495584_0293954 | |||
| 1870 | Ga0495584_0526588 | |||
| 1871 | Ga0495585_0084268 | |||
| 1872 | Ga0495585_0354893 | |||
| 1873 | Ga0495594_0210577 | |||
| 1874 | Ga0495596_0180146 | |||
| 1875 | Ga0495583_0136697 | |||
| 1876 | Ga0495583_0141772 | |||
| 1877 | Ga0495583_0288084 | |||
| 1878 | Ga0495606_0011270 | |||
| 1879 | Ga0495606_0174337 | |||
| 1880 | Ga0495606_0184517 | |||
| 1881 | Ga0495606_0209119 | |||
| 1882 | Ga0495606_0343491 | |||
| 1883 | Ga0495608_0002749 | |||
| 1884 | Ga0495608_0015906 | |||
| 1885 | Ga0495608_0016049 | |||
| 1886 | Ga0495608_0165818 | |||
| 1887 | Ga0495616_0182488 | |||
| 1888 | Ga0495616_0196151 | |||
| 1889 | Ga0495616_0412072 | |||
| 1890 | Ga0495628_0010789 | |||
| 1891 | Ga0495628_0464198 | |||
| 1892 | Ga0495630_0364281 | |||
| 1893 | Ga0495631_0049616 | |||
| 1894 | Ga0495631_0120207 | |||
| 1895 | Ga0495631_0324867 | |||
| 1896 | Ga0495631_0434180 | |||
| 1897 | Ga0495632_0027499 | |||
| 1898 | Ga0495632_0042897 | |||
| 1899 | Ga0495637_0024893 | |||
| 1900 | Ga0495637_0310393 | |||
| 1901 | Ga0495643_0145135 | |||
| 1902 | Ga0495643_0534814 | |||
| 1903 | Ga0495644_0180538 | |||
| 1904 | Ga0495644_0287436 | |||
| 1905 | Ga0495648_0252535 | |||
| 1906 | Ga0495648_0264290 | |||
| 1907 | Ga0495652_0005458 | |||
| 1908 | Ga0495652_0022492 | |||
| 1909 | Ga0495652_0025147 | |||
| 1910 | Ga0495652_0026600 | |||
| 1911 | Ga0495652_0171306 | |||
| 1912 | Ga0495640_0008433 | |||
| 1913 | Ga0495640_0022764 | |||
| 1914 | Ga0495640_0052678 | |||
| 1915 | Ga0495640_0145276 | |||
| 1916 | Ga0495640_0217847 | |||
| 1917 | Ga0495587_0010898 | |||
| 1918 | Ga0495587_0027904 | |||
| 1919 | Ga0495587_0093759 | |||
| 1920 | Ga0495609_0109021 | |||
| 1921 | Ga0495609_0141808 | |||
| 1922 | Ga0495621_0391448 | |||
| 1923 | Ga0495597_0214762 | |||
| 1924 | Ga0495645_0028867 | |||
| 1925 | Ga0495645_0052929 | |||
| 1926 | Ga0495645_0060101 | |||
| 1927 | Ga0495622_0010744 | |||
| 1928 | Ga0495622_0105852 | |||
| 1929 | Ga0495622_0136431 | |||
| 1930 | Ga0495622_0289776 | |||
| 1931 | Ga0495633_0542477 | |||
| 1932 | Ga0495667_0011132 | |||
| 1933 | Ga0495667_0021611 | |||
| 1934 | Ga0495667_0062012 | |||
| 1935 | Ga0495667_0236235 | |||
| 1936 | Ga0495656_0006097 | |||
| 1937 | Ga0495656_0109117 | |||
| 1938 | Ga0495668_0251860 | |||
| 1939 | Ga0495634_0002330 | |||
| 1940 | Ga0495634_0496723 | |||
| 1941 | Ga0495611_0021976 | |||
| 1942 | Ga0495625_0071860 | |||
| 1943 | Ga0495625_0674558 | |||
| 1944 | Ga0495635_0000917 | |||
| 1945 | Ga0495635_0002291 | |||
| 1946 | Ga0495635_0039894 | |||
| 1947 | Ga0495635_0301041 | |||
| 1948 | Ga0495635_0465298 | |||
| 1949 | Ga0495659_0121879 | |||
| 1950 | Ga0495659_0314819 | |||
| 1951 | Ga0495661_0100123 | |||
| 1952 | Ga0495661_0419024 | |||
| 1953 | Ga0495661_0474834 | |||
| 1954 | Ga0495588_0080246 | |||
| 1955 | Ga0495588_0131640 | |||
| 1956 | Ga0495588_0259417 | |||
| 1957 | Ga0495588_0358089 | |||
| 1958 | Ga0495657_0003543 | |||
| 1959 | Ga0495657_0026551 | |||
| 1960 | Ga0495657_0101888 | |||
| 1961 | Ga0495599_0001780 | |||
| 1962 | Ga0495599_0170003 | |||
| 1963 | Ga0495599_0270213 | |||
| 1964 | Ga0495623_0020263 | |||
| 1965 | Ga0495623_0024146 | |||
| 1966 | Ga0495623_0058222 | |||
| 1967 | Ga0495646_0025247 | |||
| 1968 | Ga0495646_0057432 | |||
| 1969 | Ga0495646_0294624 | |||
| 1970 | Ga0495647_0056602 | |||
| 1971 | Ga0495647_0185565 | |||
| 1972 | Ga0495658_0119099 | |||
| 1973 | Ga0495658_0241851 | |||
| 1974 | Ga0495669_0039242 | |||
| 1975 | Ga0495669_0057752 | |||
| 1976 | Ga0495613_0012318 | |||
| 1977 | Ga0495613_0027022 | |||
| 1978 | Ga0495624_0011428 | |||
| 1979 | Ga0495670_0029527 | |||
| 1980 | Ga0495649_0191678 | |||
| 1981 | Ga0495589_0161598 | |||
| 1982 | Ga0495589_0585228 | |||
| 1983 | Ga0495600_0002741 | |||
| 1984 | Ga0495600_0017271 | |||
| 1985 | Ga0495600_0019437 | |||
| 1986 | Ga0495600_0186219 | |||
| 1987 | Ga0495581_0040506 | |||
| 1988 | Ga0495581_0320880 | |||
| 1989 | Ga0495604_0002741 | |||
| 1990 | Ga0495604_0007541 | |||
| 1991 | Ga0495604_0007941 | |||
| 1992 | Ga0495674_0007236 | |||
| 1993 | Ga0495674_0077634 | |||
| 1994 | Ga0495672_0014087 | |||
| 1995 | Ga0495672_0343969 | |||
| 1996 | Ga0495676_0014630 | |||
| 1997 | Ga0495680_0001065 | |||
| 1998 | Ga0495680_0001876 | |||
| 1999 | Ga0495680_0069818 | |||
| 2000 | Ga0495683_0349466 | |||
| 2001 | Ga0495675_0000901 | |||
| 2002 | Ga0495675_0045446 | |||
| 2003 | Ga0495675_0440305 | |||
| 2004 | Ga0495677_0175682 | |||
| 2005 | Ga0495677_0366596 | |||
| 2006 | Ga0495679_191402 | |||
| 2007 | Ga0495673_0035084 | |||
| 2008 | Ga0495673_0231847 | |||
| 2009 | Ga0495673_0250519 | |||
| 2010 | Ga0495681_0120855 | |||
| 2011 | Ga0495684_0000721 | |||
| 2012 | Ga0495684_0107418 | |||
| 2013 | Ga0495686_0022393 | |||
| 2014 | Ga0495686_0153380 | |||
| 2015 | Ga0495686_0356459 | |||
| 2016 | Ga0495686_0560971 | |||
| 2017 | Ga0495686_0581437 | |||
| 2018 | Ga0495686_0707315 | |||
| 2019 | Ga0495593_0003019 | |||
| 2020 | Ga0495602_0029916 | |||
| 2021 | Ga0495602_0084544 | |||
| 2022 | Ga0495602_0327374 | |||
| 2023 | Ga0495602_0819925 | |||
| 2024 | Ga0496100_0146278 | |||
| 2025 | Ga0496100_0356976 | |||
| 2026 | Ga0496100_1137280 | |||
| 2027 | Ga0496101_0041950 | |||
| 2028 | Ga0496101_0274945 | |||
| 2029 | Ga0496101_0302264 | |||
| 2030 | Ga0496101_0458362 | |||
| 2031 | Ga0496101_0506190 | |||
| 2032 | Ga0496101_0540478 | |||
| 2033 | Ga0496102_0013853 | |||
| 2034 | Ga0496102_0084587 | |||
| 2035 | Ga0496102_0121931 | |||
| 2036 | Ga0496102_0537020 | |||
| 2037 | Ga0496102_0582110 | |||
| 2038 | Ga0496102_0659030 | |||
| 2039 | Ga0496102_0748320 | |||
| 2040 | Ga0496102_0868540 | |||
| 2041 | Ga0496102_1727856 | |||
| 2042 | Ga0496103_0269023 | |||
| 2043 | Ga0496104_0044882 | |||
| 2044 | Ga0496104_0615082 | |||
| 2045 | Ga0496104_0938932 | |||
| 2046 | Ga0496104_1473436 | |||
| 2047 | Ga0496105_0004094 | |||
| 2048 | Ga0496105_0179579 | |||
| 2049 | Ga0496105_0800765 | |||
| 2050 | Ga0496105_1315901 | |||
| 2051 | Ga0496106_0005142 | |||
| 2052 | Ga0496106_0008314 | |||
| 2053 | Ga0496106_0587477 | |||
| 2054 | Ga0496106_0863908 | |||
| 2055 | Ga0496107_0127229 | |||
| 2056 | Ga0496107_0127812 | |||
| 2057 | Ga0496107_0270960 | |||
| 2058 | Ga0496108_0068160 | |||
| 2059 | Ga0496108_0081616 | |||
| 2060 | Ga0496108_0201916 | |||
| 2061 | Ga0496109_0109385 | |||
| 2062 | Ga0496109_0131055 | |||
| 2063 | Ga0496109_0335316 | |||
| 2064 | Ga0496109_0810869 | |||
| 2065 | Ga0496109_1146448 | |||
| 2066 | Ga0496110_0431333 | |||
| 2067 | Ga0496110_0433957 | |||
| 2068 | Ga0496110_0473800 | |||
| 2069 | Ga0496110_0847219 | |||
| 2070 | Ga0496111_0011220 | |||
| 2071 | Ga0496111_0265190 | |||
| 2072 | Ga0496112_0000035 | |||
| 2073 | Ga0496112_0069768 | |||
| 2074 | Ga0496112_0241886 | |||
| 2075 | Ga0496112_0874933 | |||
| 2076 | Ga0496112_0893636 | |||
| 2077 | Ga0496112_1068731 | |||
| 2078 | Ga0496113_0139537 | |||
| 2079 | Ga0496113_0390894 | |||
| 2080 | Ga0496113_0780975 | |||
| 2081 | Ga0496114_0024694 | |||
| 2082 | Ga0496114_0975256 | |||
| 2083 | Ga0496115_0004493 | |||
| 2084 | Ga0496116_0000965 | |||
| 2085 | Ga0496117_0007318 | |||
| 2086 | Ga0496117_0099761 | |||
| 2087 | Ga0496117_0191671 | |||
| 2088 | Ga0496118_0010242 | |||
| 2089 | Ga0496118_0042994 | |||
| 2090 | Ga0496118_0388921 | |||
| 2091 | Ga0496118_0470174 | |||
| 2092 | Ga0496119_0007397 | |||
| 2093 | Ga0496119_0057355 | |||
| 2094 | Ga0496119_0392004 | |||
| 2095 | Ga0496120_0003365 | |||
| 2096 | Ga0496120_0086329 | |||
| 2097 | Ga0496120_0120536 | |||
| 2098 | Ga0496120_0337294 | |||
| 2099 | Ga0496121_0017077 | |||
| 2100 | Ga0496121_0017170 | |||
| 2101 | Ga0496121_0066269 | |||
| 2102 | Ga0496121_0197139 | |||
| 2103 | Ga0496121_0199297 | |||
| 2104 | Ga0496121_0599127 | |||
| 2105 | Ga0496122_0033148 | |||
| 2106 | Ga0496122_0053150 | |||
| 2107 | Ga0496122_0086448 | |||
| 2108 | Ga0496123_0006724 | |||
| 2109 | Ga0496123_0054779 | |||
| 2110 | Ga0496123_0225183 | |||
| 2111 | Ga0496124_0097640 | |||
| 2112 | Ga0496124_0195416 | |||
| 2113 | Ga0496124_0632778 | |||
| 2114 | Ga0496125_0001630 | |||
| 2115 | Ga0496125_0010481 | |||
| 2116 | Ga0496125_0048905 | |||
| 2117 | Ga0496125_0095013 | |||
| 2118 | Ga0496126_0003472 | |||
| 2119 | Ga0496126_0018186 | |||
| 2120 | Ga0496126_0055280 | |||
| 2121 | Ga0496126_0072841 | |||
| 2122 | Ga0496126_0075361 | |||
| 2123 | Ga0496126_0132356 | |||
| 2124 | Ga0496126_0269499 | |||
| 2125 | Ga0496126_0541267 | |||
| 2126 | Ga0496126_0622125 | |||
| 2127 | Ga0496126_0704132 | |||
| 2128 | Ga0501031_0001791 | |||
| 2129 | Ga0501031_0093802 | |||
| 2130 | Ga0501032_0000762 | |||
| 2131 | Ga0501033_0000136 | |||
| 2132 | Ga0501033_0182365 | |||
| 2133 | Ga0501034_0000251 | |||
| 2134 | Ga0501036_0000036 | |||
| 2135 | Ga0501037_0000867 | |||
| 2136 | Ga0501037_0140096 | |||
| 2137 | Ga0501037_0292848 | |||
| 2138 | Ga0501038_0000428 | |||
| 2139 | Ga0501038_0049185 | |||
| 2140 | Ga0501039_0219064 | |||
| 2141 | Ga0501040_0603753 | |||
| 2142 | Ga0501041_0170512 | |||
| 2143 | Ga0501042_0025922 | |||
| 2144 | Ga0501043_0000165 | |||
| 2145 | Ga0501043_0351129 | |||
| 2146 | Ga0501046_0000839 | |||
| 2147 | Ga0501046_0320277 | |||
| 2148 | Ga0501047_0000340 | |||
| 2149 | Ga0501047_1232007 | |||
| 2150 | Ga0501048_0004509 | |||
| 2151 | Ga0501048_0522818 | |||
| 2152 | Ga0501067_0007630 | |||
| 2153 | Ga0501067_0486136 | |||
| 2154 | Ga0501068_0003807 | |||
| 2155 | Ga0501068_0945089 | |||
| 2156 | Ga0501069_0007026 | |||
| 2157 | Ga0501070_0006502 | |||
| 2158 | Ga0501070_0188830 | |||
| 2159 | Ga0501072_0007916 | |||
| 2160 | Ga0501072_0184865 | |||
| 2161 | Ga0501073_0000037 | |||
| 2162 | Ga0501073_0589554 | |||
| 2163 | Ga0501074_0000167 | |||
| 2164 | Ga0501074_0078814 | |||
| 2165 | Ga0501076_0225653 | |||
| 2166 | Ga0501076_0922858 | |||
| 2167 | Ga0501079_0001057 | |||
| 2168 | Ga0501080_0003259 | |||
| 2169 | Ga0501080_0500984 | |||
| 2170 | Ga0501080_0595495 | |||
| 2171 | Ga0501083_0001812 | |||
| 2172 | Ga0501035_0000142 | |||
| 2173 | Ga0501035_0197984 | |||
| 2174 | Ga0501044_0000414 | |||
| 2175 | Ga0501044_0162165 | |||
| 2176 | Ga0501044_0249253 | |||
| 2177 | Ga0501045_0036286 | |||
| 2178 | nmdc:mga03683_119060_c1 | |||
| 2179 | nmdc:mga03683_144094_c1 | |||
| 2180 | nmdc:mga03683_209617_c1 | |||
| 2181 | nmdc:mga03683_415109_c1 | |||
| 2182 | nmdc:mga03n38_303412_c1 | |||
| 2183 | nmdc:mga03n38_3607_c1 | |||
| 2184 | nmdc:mga03n38_544897_c1 | |||
| 2185 | nmdc:mga00v17_15862_c1 | |||
| 2186 | nmdc:mga00v17_254121_c1 | |||
| 2187 | nmdc:mga00v17_33928_c1 | |||
| 2188 | nmdc:mga00v17_43108_c1 | |||
| 2189 | nmdc:mga0yw44_17100_c1 | |||
| 2190 | nmdc:mga0yw44_18813_c1 | |||
| 2191 | nmdc:mga0yw44_200253_c1 | |||
| 2192 | nmdc:mga0yw44_251604_c1 | |||
| 2193 | nmdc:mga0yw44_502646_c1 | |||
| 2194 | nmdc:mga0yw44_9428_c1 | |||
| 2195 | nmdc:mga0k408_120585_c1 | |||
| 2196 | nmdc:mga0k408_214900_c1 | |||
| 2197 | nmdc:mga0k408_233594_c1 | |||
| 2198 | nmdc:mga0k408_302298_c1 | |||
| 2199 | nmdc:mga06z11_114580_c1 | |||
| 2200 | nmdc:mga06z11_214115_c1 | |||
| 2201 | nmdc:mga06z11_25604_c1 | |||
| 2202 | nmdc:mga06z11_35146_c1 | |||
| 2203 | nmdc:mga06z11_84907_c1 | |||
| 2204 | nmdc:mga06z11_93465_c1 | |||
| 2205 | nmdc:mga04h51_113795_c1 | |||
| 2206 | nmdc:mga04h51_22600_c1 | |||
| 2207 | nmdc:mga07m45_26680_c1 | |||
| 2208 | nmdc:mga07m45_280075_c1 | |||
| 2209 | nmdc:mga07m45_495697_c1 | |||
| 2210 | nmdc:mga07m45_532518_c1 | |||
| 2211 | nmdc:mga07m45_74635_c1 | |||
| 2212 | nmdc:mga05p37_211226_c1 | |||
| 2213 | nmdc:mga05p37_548580_c1 | |||
| 2214 | nmdc:mga0qj67_637820_c1 | |||
| 2215 | nmdc:mga08y16_1055738_c1 | |||
| 2216 | nmdc:mga08y16_586043_c1 | |||
| 2217 | nmdc:mga0n895_783721_c1 | |||
| 2218 | nmdc:mga0rr50_454903_c1 | |||
| 2219 | nmdc:mga0a205_1100808_c1 | |||
| 2220 | nmdc:mga0sz30_146398_c1 | |||
| 2221 | nmdc:mga0sz30_166288_c1 | |||
| 2222 | nmdc:mga0sz30_199165_c1 | |||
| 2223 | nmdc:mga0sz30_28823_c1 | |||
| 2224 | nmdc:mga0sz30_541858_c1 | |||
| 2225 | nmdc:mga0sz30_93353_c1 | |||
| 2226 | Ga0495601_0216694 | |||
| 2227 | Ga0495612_0023692 | |||
| 2228 | Ga0495612_0070558 | |||
| 2229 | Ga0495612_0130920 | |||
| 2230 | Ga0495612_0156811 | |||
| 2231 | Ga0500610_0255682 | |||
| 2232 | Ga0500635_0302216 | |||
| 2233 | Ga0495595_0000828 | |||
| 2234 | Ga0495595_0669471 | |||
| 2235 | Ga0495619_0000912 | |||
| 2236 | Ga0495619_0102327 | |||
| 2237 | Ga0495619_0718543 | |||
| 2238 | Ga0495619_0724918 | |||
| 2239 | Ga0500578_0156825 | |||
| 2240 | Ga0500578_0232065 | |||
| 2241 | Ga0500643_000048 | |||
| 2242 | Ga0500643_067043 | |||
| 2243 | Ga0500581_116512 | |||
| 2244 | Ga0500646_0010979 | |||
| 2245 | Ga0500646_0017492 | |||
| 2246 | Ga0500647_0241710 | |||
| 2247 | Ga0500583_0144820 | |||
| 2248 | Ga0500583_0177472 | |||
| 2249 | Ga0500651_0037353 | |||
| 2250 | Ga0500651_0239009 | |||
| 2251 | Ga0500651_0575009 | |||
| 2252 | Ga0500566_0000126 | |||
| 2253 | Ga0500566_0004965 | |||
| 2254 | Ga0500566_0029885 | |||
| 2255 | Ga0500640_007080 | |||
| 2256 | Ga0500641_0012056 | |||
| 2257 | Ga0500554_007778 | |||
| 2258 | Ga0500555_058884 | |||
| 2259 | Ga0500556_0036495 | |||
| 2260 | Ga0500557_000083 | |||
| 2261 | Ga0500562_027531 | |||
| 2262 | Ga0500562_049544 | |||
| 2263 | Ga0500569_002207 | |||
| 2264 | Ga0500569_020574 | |||
| 2265 | Ga0500572_004191 | |||
| 2266 | Ga0500591_250562 | |||
| 2267 | Ga0500594_0169626 | |||
| 2268 | Ga0500594_0219768 | |||
| 2269 | Ga0500595_000333 | |||
| 2270 | Ga0500595_005544 | |||
| 2271 | Ga0500595_031641 | |||
| 2272 | Ga0500595_092253 | |||
| 2273 | Ga0500608_017998 | |||
| 2274 | Ga0500608_197079 | |||
| 2275 | Ga0500614_070743 | |||
| 2276 | Ga0500614_132923 | |||
| 2277 | Ga0500642_0056130 | |||
| 2278 | Ga0500642_0141531 | |||
| 2279 | Ga0500658_0016844 | |||
| 2280 | Ga0500658_0293632 | |||
| 2281 | Ga0500559_0003961 | |||
| 2282 | Ga0500559_0327889 | |||
| 2283 | Ga0500568_0066543 | |||
| 2284 | Ga0500577_0049030 | |||
| 2285 | Ga0500577_0080669 | |||
| 2286 | Ga0500577_0242731 | |||
| 2287 | Ga0500588_0051976 | |||
| 2288 | Ga0500588_0204124 | |||
| 2289 | Ga0500589_094668 | |||
| 2290 | Ga0500589_166093 | |||
| 2291 | Ga0500603_000178 | |||
| 2292 | Ga0500603_000304 | |||
| 2293 | Ga0500603_007176 | |||
| 2294 | Ga0500604_0083099 | |||
| 2295 | Ga0500604_0130236 | |||
| 2296 | Ga0500616_0000033 | |||
| 2297 | Ga0500619_149490 | |||
| 2298 | Ga0500620_136482 | |||
| 2299 | Ga0500622_0005267 | |||
| 2300 | Ga0500622_0078202 | |||
| 2301 | Ga0500622_0428744 | |||
| 2302 | Ga0500630_002602 | |||
| 2303 | Ga0500634_0076256 | |||
| 2304 | Ga0500638_007384 | |||
| 2305 | Ga0500638_109121 | |||
| 2306 | Ga0500638_192821 | |||
| 2307 | Ga0500639_000039 | |||
| 2308 | Ga0500636_0015443 | |||
| 2309 | Ga0500636_0032865 | |||
| 2310 | Ga0500636_0103923 | |||
| 2311 | Ga0500637_0000060 | |||
| 2312 | Ga0500637_0003041 | |||
| 2313 | Ga0500625_007842 | |||
| 2314 | Ga0500645_041367 | |||
| 2315 | Ga0500645_127898 | |||
| 2316 | Ga0500609_001859 | |||
| 2317 | Ga0500599_013831 | |||
| 2318 | Ga0500601_008730 | |||
| 2319 | Ga0501084_0041770 | |||
| 2320 | Ga0500661_003670 | |||
| 2321 | Ga0500661_032918 | |||
| 2322 | Ga0501082_0002719 | |||
| 2323 | 2793077974 | |||
| 2324 | 2513659783 | |||
| 2325 | 2513704354 | |||
| 2326 | 2513857245 | |||
| 2327 | 2513918859 | |||
| 2328 | 2524468639 | |||
| 2329 | 2524533361 | |||
| 2330 | 2603860086 | |||
| 2331 | 2617347779 | |||
| 2332 | 2671119356 | |||
| 2333 | 2723842256 | |||
| 2334 | 2793061565 | |||
| 2335 | 2824775740 | |||
| 2336 | 2857513315 | |||
| 2337 | 2874620221 | |||
| 2338 | 2876815709 | |||
| 2339 | 2879106653 | |||
| 2340 | 2879117031 | |||
| 2341 | 2885380645 | |||
| 2342 | 2889036372 | |||
| 2343 | 2906643419 | |||
| 2344 | 2906666611 | |||
| 2345 | 2908746712 | |||
| 2346 | 2919078957 | |||
| 2347 | 2922389352 | |||
| 2348 | 2932800637 | |||
| 2349 | 2932808368 | |||
| 2350 | 2932813326 | |||
| 2351 | 2932820023 | |||
| 2352 | 2935687223 | |||
| 2353 | 2935716911 | |||
| 2354 | 2935722964 | |||
| 2355 | 2935734521 | |||
| 2356 | 2935744688 | |||
| 2357 | 2935753189 | |||
| 2358 | 2935767593 | |||
| 2359 | 2935770188 | |||
| 2360 | 2935777782 | |||
| 2361 | 2935786758 | |||
| 2362 | 2935794812 | |||
| 2363 | 2935883475 | |||
| 2364 | 2940559102 | |||
| 2365 | 3005475656 | |||
| 2366 | 3005601851 | |||
| 2367 | 3005717589 | |||
| 2368 | 3005724638 | |||
| 2369 | 8006936991 | |||
| 2370 | 8006966343 | |||
| 2371 | 8006976958 | |||
| 2372 | 8006993169 | |||
| 2373 | 8016526945 | |||
| 2374 | 8016545239 | |||
| 2375 | 8016556849 | |||
| 2376 | 8016565202 | |||
| 2377 | 8016570318 | |||
| 2378 | 8016582865 | |||
| 2379 | 8016602845 | |||
| 2380 | 8016605715 | |||
| 2381 | 8016617622 | |||
| 2382 | 8016623948 | |||
| 2383 | 8016634916 | |||
| 2384 | 8019531848 | |||
| 2385 | 8019539683 | |||
| 2386 | 8019550967 | |||
| 2387 | 8056678194 | |||
| 2388 | 8056975361 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c5o-assembly1.cif.gz_D | crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris | 0.9614 | 3 | 153 |
| 3c5o-assembly1.cif.gz_A | crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris | 0.9583 | 3 | 153 |
| 3c5o-assembly1.cif.gz_C | crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris | 0.9553 | 3 | 153 |
| 3c5o-assembly1.cif.gz_A | crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris | 0.9521 | 3 | 153 |
| 3c5o-assembly1.cif.gz_D | crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris | 0.9491 | 3 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3c5oC00 | Mainly Beta;Beta Barrel;Porin; | 0.9548 | 3 | 153 | 2.40.160.20 |
| 3c5oC00 | Mainly Beta;Beta Barrel;Porin; | 0.9486 | 3 | 153 | 2.40.160.20 |
| 3g7gG00 | Mainly Beta;Beta Barrel;Porin; | 0.9439 | 7 | 153 | 2.40.160.20 |
| 3g7gG00 | Mainly Beta;Beta Barrel;Porin; | 0.9314 | 7 | 153 | 2.40.160.20 |
| 4puxA00 | Mainly Beta;Beta Barrel;Porin; | 0.8623 | 3 | 153 | 2.40.160.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1D3TUE5-F1-model_v4 | Uncharacterized protein | 0.9761 | 51 | 151 |
|
| AF-A0A354V2T9-F1-model_v4 | UPF0311 protein DDZ81_08495 | 0.975 | 4 | 153 |
|
| AF-A0A534X2K0-F1-model_v4 | DUF3237 domain-containing protein | 0.9746 | 17 | 90 |
|
| AF-A0A268AF19-F1-model_v4 | UPF0311 protein CHH64_03120 | 0.9719 | 1 | 153 |
|
| AF-A0A8A2VAF6-F1-model_v4 | DUF3237 domain-containing protein | 0.9695 | 5 | 153 |
|