F491503

General Info

Members Datasets Scaffolds Average Seq Length
1194 539 2388 153

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2791355199|2793077974
Length 186
Sequence AIRDNFSRCEAAPGCAALHPGYDALQSEINGGPMTPQLETRYVFTITARIGEVTSAGEIGTGVRRIIPIIGGEVRGEQVNGKVLPFGADFQIIRPNELIELEAKYAFETDDGAVVYVENKGLRFGPVELLQKLKRGEPVDPKLIYFRTVPKFETGAPKYRWLMENLFIASAARHADRVVIDVHQVL

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
87 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
88 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
89 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
192 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
193 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
194 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
219 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
220 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
221 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
224 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
225 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
226 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
227 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
251 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
252 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
253 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
254 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
255 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
256 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
257 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
258 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
259 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
260 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
261 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
262 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
263 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
264 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
265 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
276 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
277 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
282 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
283 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
288 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
289 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
290 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
291 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
294 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
295 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
296 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
297 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
302 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
303 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
304 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
305 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
310 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
314 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
315 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
316 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
321 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
322 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
323 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
329 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
330 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
331 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
332 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
333 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
334 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
335 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
338 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
339 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
340 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
341 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
342 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
343 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
346 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
347 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
348 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
349 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
350 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
351 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
352 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
353 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
354 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
355 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
356 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
357 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
358 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
359 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
360 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
361 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
362 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
363 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
364 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
365 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
366 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
367 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
368 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
369 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
370 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
371 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
372 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
373 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
374 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
375 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
391 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
392 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
393 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
394 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
395 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
396 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
397 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
398 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
399 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
400 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
401 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
404 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
405 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
406 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
407 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
408 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
409 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
410 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
411 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
412 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
413 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
414 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
415 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
416 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
417 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
418 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
419 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
420 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
421 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
422 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
423 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
424 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
425 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
426 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
427 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
428 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
429 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
430 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
431 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
432 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
433 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
434 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
435 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
436 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
437 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
438 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
439 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
440 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
441 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
442 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
443 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
444 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
445 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
446 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
447 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
448 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
449 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
450 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
451 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
452 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
453 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
454 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
455 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
456 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
457 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
458 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
459 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
460 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
461 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
462 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
463 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
464 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
465 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
466 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
467 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
468 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
469 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
470 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
471 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
472 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
473 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
474 2791355199
475 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
476 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
477 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
478 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
479 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
480 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
481 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
482 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
483 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
484 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
485 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
486 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
487 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
488 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
489 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
490 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
491 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
492 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
493 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
494 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
495 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
496 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
497 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
498 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
499 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
500 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
501 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
502 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
503 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
504 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
505 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
506 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
507 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
508 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
509 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
510 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
511 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
512 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
513 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
514 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
515 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
516 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
517 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
518 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
519 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
520 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
521 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
522 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
523 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
524 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
525 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
526 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
527 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
528 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
529 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
530 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
531 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
532 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
533 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
534 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
535 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
536 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
537 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
538 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
539 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.47
Metatranscriptomes 0.08
Isolates 5.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.33
Nodule 5.28
Rhizoplane 5.86
Rhizosphere 67.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10006399 3300001989 Bacteria 4447
2 JGI25406J46586_10022537 3300003203 Bacteria 2506
3 JGI25153J46596_10003608 3300003215 Bacteria 8589
4 JGI25153J46596_10004959 3300003215 Bacteria 7069
5 JGI25153J46596_10006371 3300003215 Bacteria 5987
6 JGI25160J50197_1018792 3300003354 Bacteria 2141
7 JGI25404J52841_10016499 3300003659 Bacteria 1602
8 JGI25404J52841_10023848 3300003659 Bacteria 1319
9 JGI25404J52841_10024822 3300003659 Bacteria 1291
10 Ga0055543_1052251 3300004625 Bacteria 668
11 Ga0065165_1001167 3300005262 Bacteria 30545
12 Ga0070658_10196084 3300005327 Bacteria 1703
13 Ga0070658_10283368 3300005327 Bacteria 1411
14 Ga0070658_10381761 3300005327 Bacteria 1209
15 Ga0070658_10396113 3300005327 Bacteria 1186
16 Ga0070658_11209812 3300005327 Bacteria 657
17 Ga0070676_10079748 3300005328 Bacteria 1983
18 Ga0070676_10379389 3300005328 Bacteria 979
19 Ga0070690_100560287 3300005330 Bacteria 863
20 Ga0070670_100153306 3300005331 Bacteria 1995
21 Ga0070677_10611733 3300005333 Bacteria 605
22 Ga0068869_100039611 3300005334 Bacteria 3365
23 Ga0068869_100237260 3300005334 Bacteria 1451
24 Ga0068869_100240733 3300005334 Bacteria 1442
25 Ga0068869_100316965 3300005334 Bacteria 1263
26 Ga0070666_10151911 3300005335 Bacteria 1616
27 Ga0070666_10198061 3300005335 Bacteria 1413
28 Ga0070680_100469175 3300005336 Bacteria 1076
29 Ga0070682_101517579 3300005337 Bacteria 577
30 Ga0068868_100040865 3300005338 Bacteria 3611
31 Ga0068868_100483032 3300005338 Bacteria 1082
32 Ga0068868_101014153 3300005338 Bacteria 760
33 Ga0068868_101140663 3300005338 Bacteria 719
34 Ga0070661_100058873 3300005344 Bacteria 2816
35 Ga0070661_100165332 3300005344 Bacteria 1678
36 Ga0070668_100362475 3300005347 Bacteria 1229
37 Ga0070668_100616553 3300005347 Bacteria 950
38 Ga0070668_100910678 3300005347 Bacteria 786
39 Ga0070668_101351939 3300005347 Bacteria 648
40 Ga0070669_100095141 3300005353 Bacteria 2239
41 Ga0070669_100385403 3300005353 Bacteria 1144
42 Ga0070675_100211821 3300005354 Bacteria 1684
43 Ga0070671_100116309 3300005355 Bacteria 2248
44 Ga0070671_100425391 3300005355 Bacteria 1138
45 Ga0070671_100565108 3300005355 Bacteria 981
46 Ga0070671_100581789 3300005355 Bacteria 967
47 Ga0070671_100632877 3300005355 Bacteria 926
48 Ga0070671_101352816 3300005355 Bacteria 629
49 Ga0070674_100617891 3300005356 Bacteria 918
50 Ga0070674_101096692 3300005356 Bacteria 703
51 Ga0070673_100247812 3300005364 Bacteria 1551
52 Ga0070667_100706940 3300005367 Bacteria 933
53 Ga0070667_100932570 3300005367 Bacteria 809
54 Ga0070709_10001520 3300005434 Bacteria 12532
55 Ga0070709_10008885 3300005434 Bacteria 5530
56 Ga0070714_100005907 3300005435 Bacteria 9391
57 Ga0070714_101141603 3300005435 Bacteria 760
58 Ga0070713_100331509 3300005436 Bacteria 1408
59 Ga0070713_100886729 3300005436 Bacteria 858
60 Ga0070710_10000733 3300005437 Bacteria 15629
61 Ga0070710_10014290 3300005437 Bacteria 3994
62 Ga0070710_10342128 3300005437 Bacteria 988
63 Ga0070711_100001130 3300005439 Bacteria 14272
64 Ga0070711_100005326 3300005439 Bacteria 7689
65 Ga0070711_100558104 3300005439 Bacteria 951
66 Ga0070700_100054382 3300005441 Bacteria 2501
67 Ga0070663_100148671 3300005455 Bacteria 1795
68 Ga0070663_100168859 3300005455 Bacteria 1689
69 Ga0070663_100390385 3300005455 Bacteria 1135
70 Ga0070678_100024391 3300005456 Bacteria 4048
71 Ga0070678_100115610 3300005456 Bacteria 2106
72 Ga0070678_101261298 3300005456 Bacteria 687
73 Ga0070662_100052852 3300005457 Bacteria 2939
74 Ga0070662_100081245 3300005457 Bacteria 2414
75 Ga0070662_100182385 3300005457 Bacteria 1655
76 Ga0070662_100285527 3300005457 Bacteria 1336
77 Ga0070681_10211895 3300005458 Bacteria 1853
78 Ga0070681_10569120 3300005458 Bacteria 1047
79 Ga0070681_10921359 3300005458 Bacteria 792
80 Ga0068867_100244819 3300005459 Bacteria 1456
81 Ga0068867_100274201 3300005459 Bacteria 1381
82 Ga0068867_100369011 3300005459 Bacteria 1203
83 Ga0070706_100740746 3300005467 Bacteria 911
84 Ga0070707_100452275 3300005468 Bacteria 1245
85 Ga0070698_100427261 3300005471 Bacteria 1259
86 Ga0070698_100430652 3300005471 Bacteria 1254
87 Ga0070698_100483081 3300005471 Bacteria 1176
88 Ga0070699_101088599 3300005518 Bacteria 733
89 Ga0070679_100080757 3300005530 Bacteria 3241
90 Ga0070679_100126592 3300005530 Bacteria 2537
91 Ga0070697_100096466 3300005536 Bacteria 2453
92 Ga0068853_100037982 3300005539 Bacteria 4100
93 Ga0068853_100407464 3300005539 Bacteria 1273
94 Ga0068853_100824905 3300005539 Bacteria 889
95 Ga0070672_101310748 3300005543 Bacteria 647
96 Ga0070696_100171166 3300005546 Bacteria 1606
97 Ga0070693_100107854 3300005547 Bacteria 1707
98 Ga0070693_100591800 3300005547 Bacteria 800
99 Ga0070665_100004629 3300005548 Bacteria 14379
100 Ga0070665_100090496 3300005548 Bacteria 3065
101 Ga0070665_100105979 3300005548 Bacteria 2813
102 Ga0070665_100201348 3300005548 Bacteria 1991
103 Ga0070665_100505908 3300005548 Bacteria 1219
104 Ga0070665_100744167 3300005548 Bacteria 993
105 Ga0070665_100829596 3300005548 Bacteria 938
106 Ga0070665_101263734 3300005548 Bacteria 748
107 Ga0068855_100077128 3300005563 Bacteria 3866
108 Ga0068855_100099019 3300005563 Bacteria 3358
109 Ga0068855_100236674 3300005563 Bacteria 2042
110 Ga0068855_100817199 3300005563 Bacteria 990
111 Ga0070664_100087892 3300005564 Bacteria 2687
112 Ga0070664_100513061 3300005564 Bacteria 1106
113 Ga0068854_100902723 3300005578 Bacteria 777
114 Ga0068854_101024358 3300005578 Bacteria 732
115 Ga0068856_100205397 3300005614 Bacteria 1985
116 Ga0070702_100282790 3300005615 Bacteria 1140
117 Ga0070702_100426556 3300005615 Bacteria 956
118 Ga0068852_100067797 3300005616 Bacteria 3120
119 Ga0068852_100156188 3300005616 Bacteria 2125
120 Ga0068852_100301187 3300005616 Bacteria 1552
121 Ga0068852_101141836 3300005616 Bacteria 800
122 Ga0068852_101418258 3300005616 Bacteria 717
123 Ga0068852_101606654 3300005616 Bacteria 673
124 Ga0068859_100273153 3300005617 Bacteria 1782
125 Ga0068859_100719402 3300005617 Bacteria 1088
126 Ga0068859_101111325 3300005617 Bacteria 869
127 Ga0068859_101763055 3300005617 Bacteria 684
128 Ga0068864_100264613 3300005618 Bacteria 1600
129 Ga0068864_101421818 3300005618 Bacteria 696
130 Ga0068866_10039340 3300005718 Bacteria 2335
131 Ga0068861_100076821 3300005719 Bacteria 2603
132 Ga0068861_100119779 3300005719 Bacteria 2121
133 Ga0068861_100707850 3300005719 Bacteria 936
134 Ga0068861_100724546 3300005719 Bacteria 926
135 Ga0068861_100836656 3300005719 Bacteria 867
136 Ga0068861_101507593 3300005719 Bacteria 660
137 Ga0068870_10281582 3300005840 Bacteria 1043
138 Ga0068870_10324289 3300005840 Bacteria 979
139 Ga0068863_100339344 3300005841 Bacteria 1462
140 Ga0068863_101413576 3300005841 Bacteria 704
141 Ga0068858_100060026 3300005842 Bacteria 3515
142 Ga0068858_100317108 3300005842 Bacteria 1489
143 Ga0068858_101242336 3300005842 Bacteria 733
144 Ga0068860_100141032 3300005843 Bacteria 2316
145 Ga0068860_100421243 3300005843 Bacteria 1323
146 Ga0068862_100196039 3300005844 Bacteria 1819
147 Ga0068862_100212955 3300005844 Bacteria 1746
148 Ga0068862_100260305 3300005844 Bacteria 1583
149 Ga0068862_100309934 3300005844 Bacteria 1454
150 Ga0068862_101124046 3300005844 Bacteria 781
151 Ga0081455_10080519 3300005937 Bacteria 2670
152 Ga0081455_10127351 3300005937 Bacteria 1996
153 Ga0081455_10157722 3300005937 Bacteria 1742
154 Ga0081540_1002866 3300005983 Bacteria 13942
155 Ga0081540_1005656 3300005983 Bacteria 9295
156 Ga0081540_1016160 3300005983 Bacteria 4686
157 Ga0081540_1021799 3300005983 Bacteria 3801
158 Ga0081540_1024467 3300005983 Bacteria 3504
159 Ga0081540_1027780 3300005983 Bacteria 3196
160 Ga0081540_1039864 3300005983 Bacteria 2457
161 Ga0081540_1074197 3300005983 Bacteria 1560
162 Ga0081540_1160389 3300005983 Bacteria 873
163 Ga0081539_10000157 3300005985 Bacteria 158278
164 Ga0081539_10037110 3300005985 Bacteria 2906
165 Ga0070717_10008111 3300006028 Bacteria 7834
166 Ga0075365_10070542 3300006038 Bacteria 2350
167 Ga0075365_10085860 3300006038 Bacteria 2138
168 Ga0075365_10125077 3300006038 Bacteria 1776
169 Ga0075365_10131480 3300006038 Bacteria 1732
170 Ga0075365_10132947 3300006038 Bacteria 1723
171 Ga0075365_10227586 3300006038 Bacteria 1309
172 Ga0075368_10092765 3300006042 Bacteria 1235
173 Ga0075368_10256249 3300006042 Bacteria 748
174 Ga0075363_100002704 3300006048 Bacteria 7338
175 Ga0075363_100125558 3300006048 Bacteria 1436
176 Ga0075364_10035757 3300006051 Bacteria 3210
177 Ga0075364_10144996 3300006051 Bacteria 1598
178 Ga0075364_10176908 3300006051 Bacteria 1443
179 Ga0075364_10270559 3300006051 Bacteria 1155
180 Ga0075364_10930453 3300006051 Bacteria 591
181 Ga0070715_10278916 3300006163 Bacteria 885
182 Ga0070716_100268189 3300006173 Bacteria 1172
183 Ga0070716_100556967 3300006173 Bacteria 856
184 Ga0070716_100763611 3300006173 Bacteria 745
185 Ga0070712_100002371 3300006175 Bacteria 11602
186 Ga0070712_100556936 3300006175 Bacteria 966
187 Ga0075362_10047780 3300006177 Bacteria 1907
188 Ga0075362_10113141 3300006177 Bacteria 1279
189 Ga0075362_10175993 3300006177 Bacteria 1035
190 Ga0075362_10400758 3300006177 Bacteria 692
191 Ga0075367_10005584 3300006178 Bacteria 6264
192 Ga0075367_10076759 3300006178 Bacteria 2016
193 Ga0075367_10105118 3300006178 Bacteria 1729
194 Ga0075367_10208934 3300006178 Bacteria 1220
195 Ga0075367_10352705 3300006178 Bacteria 929
196 Ga0075369_10004189 3300006186 Bacteria 5315
197 Ga0075369_10058287 3300006186 Bacteria 1681
198 Ga0075369_10186833 3300006186 Bacteria 954
199 Ga0075369_10190255 3300006186 Bacteria 946
200 Ga0075366_10067116 3300006195 Bacteria 2134
201 Ga0075366_10140574 3300006195 Bacteria 1459
202 Ga0075366_10410474 3300006195 Bacteria 834
203 Ga0097621_100220287 3300006237 Bacteria 1653
204 Ga0075370_10001262 3300006353 Bacteria 10776
205 Ga0075370_10066034 3300006353 Bacteria 2064
206 Ga0075370_10135157 3300006353 Bacteria 1440
207 Ga0075370_10183674 3300006353 Bacteria 1231
208 Ga0068871_100100889 3300006358 Bacteria 2418
209 Ga0068871_100517093 3300006358 Bacteria 1077
210 Ga0068871_100665344 3300006358 Bacteria 952
211 Ga0068871_100829921 3300006358 Bacteria 854
212 Ga0075428_100074682 3300006844 Bacteria 3703
213 Ga0075428_100871338 3300006844 Bacteria 956
214 Ga0075433_10857647 3300006852 Bacteria 793
215 Ga0075434_100087493 3300006871 Bacteria 3116
216 Ga0075434_100469416 3300006871 Bacteria 1280
217 Ga0068865_100008510 3300006881 Bacteria 6343
218 Ga0097620_100273166 3300006931 Bacteria 1782
219 Ga0097620_100719387 3300006931 Bacteria 1088
220 Ga0097620_101111300 3300006931 Bacteria 869
221 Ga0097620_101763323 3300006931 Bacteria 684
222 Ga0099825_1025612 3300006941 Bacteria 3257
223 Ga0099824_1008303 3300006942 Bacteria 13338
224 Ga0099822_1000541 3300006943 Bacteria 35996
225 Ga0099823_1031325 3300006944 Bacteria 4394
226 Ga0075435_100571611 3300007076 Bacteria 979
227 Ga0099794_10118262 3300007265 Bacteria 1332
228 Ga0099794_10166703 3300007265 Bacteria 1122
229 Ga0099795_10078154 3300007788 Bacteria 1261
230 Ga0099795_10146250 3300007788 Bacteria 965
231 Ga0099795_10254010 3300007788 Bacteria 759
232 Ga0105250_10309503 3300009092 Bacteria 685
233 Ga0105250_10394331 3300009092 Bacteria 613
234 Ga0105240_10013303 3300009093 Bacteria 11310
235 Ga0105240_10362741 3300009093 Bacteria 1640
236 Ga0105240_11000465 3300009093 Bacteria 894
237 Ga0105240_11470620 3300009093 Bacteria 715
238 Ga0111539_10456176 3300009094 Bacteria 1489
239 Ga0111539_10657793 3300009094 Bacteria 1220
240 Ga0111539_11471018 3300009094 Bacteria 790
241 Ga0105245_10042563 3300009098 Bacteria 4053
242 Ga0105245_10089665 3300009098 Bacteria 2827
243 Ga0105245_10492023 3300009098 Bacteria 1241
244 Ga0105247_10067424 3300009101 Bacteria 2230
245 Ga0105247_10159213 3300009101 Bacteria 1493
246 Ga0105247_10171621 3300009101 Bacteria 1442
247 Ga0105247_10232180 3300009101 Bacteria 1253
248 Ga0114129_10172553 3300009147 Bacteria 2947
249 Ga0114129_11556122 3300009147 Bacteria 811
250 Ga0105243_10760555 3300009148 Bacteria 951
251 Ga0105243_10816378 3300009148 Bacteria 921
252 Ga0105243_11861817 3300009148 Bacteria 634
253 Ga0105241_10004267 3300009174 Bacteria 10572
254 Ga0105241_10024156 3300009174 Bacteria 4514
255 Ga0105241_10036215 3300009174 Bacteria 3713
256 Ga0105242_10042608 3300009176 Bacteria 3667
257 Ga0105242_10274728 3300009176 Bacteria 1528
258 Ga0105248_10046362 3300009177 Bacteria 4871
259 Ga0105248_10401747 3300009177 Bacteria 1543
260 Ga0105248_10532904 3300009177 Bacteria 1324
261 Ga0105248_11549125 3300009177 Bacteria 751
262 Ga0105248_12285696 3300009177 Bacteria 616
263 Ga0105237_10017841 3300009545 Bacteria 7357
264 Ga0105237_10082678 3300009545 Bacteria 3202
265 Ga0105237_10323997 3300009545 Bacteria 1545
266 Ga0105237_10483707 3300009545 Bacteria 1244
267 Ga0105237_10684936 3300009545 Bacteria 1032
268 Ga0105238_11066560 3300009551 Bacteria 830
269 Ga0105238_12971070 3300009551 Bacteria 510
270 Ga0105249_10231397 3300009553 Bacteria 1823
271 Ga0105249_10750143 3300009553 Bacteria 1038
272 Ga0105249_11861447 3300009553 Bacteria 674
273 Ga0099796_10154143 3300010159 Bacteria 906
274 Ga0105239_10072795 3300010375 Bacteria 3778
275 Ga0105239_10134403 3300010375 Bacteria 2753
276 Ga0105239_10759835 3300010375 Bacteria 1110
277 Ga0105239_11441313 3300010375 Bacteria 795
278 Ga0105246_10151873 3300011119 Bacteria 1754
279 Ga0105246_10411645 3300011119 Bacteria 1126
280 Ga0105246_10524800 3300011119 Bacteria 1010
281 Ga0105246_10538567 3300011119 Bacteria 998
282 Ga0105246_10612107 3300011119 Bacteria 943
283 Ga0105246_10780316 3300011119 Bacteria 846
284 Ga0157370_10115958 3300013104 Bacteria 2502
285 Ga0157370_10267710 3300013104 Bacteria 1579
286 Ga0157369_10580485 3300013105 Bacteria 1158
287 Ga0157369_10630574 3300013105 Bacteria 1106
288 Ga0157369_10645994 3300013105 Bacteria 1091
289 Ga0157374_10156652 3300013296 Bacteria 2217
290 Ga0157374_10516010 3300013296 Bacteria 1201
291 Ga0157374_10641331 3300013296 Bacteria 1074
292 Ga0157378_10091042 3300013297 Bacteria 2773
293 Ga0157378_11737268 3300013297 Bacteria 671
294 Ga0163162_10201665 3300013306 Bacteria 2118
295 Ga0157372_10154292 3300013307 Bacteria 2652
296 Ga0157372_10495804 3300013307 Bacteria 1424
297 Ga0157375_10407254 3300013308 Bacteria 1526
298 Ga0157375_11192575 3300013308 Bacteria 893
299 Ga0163163_10010769 3300014325 Bacteria 8250
300 Ga0163163_10633800 3300014325 Bacteria 1132
301 Ga0163163_10845293 3300014325 Bacteria 979
302 Ga0163163_10878787 3300014325 Bacteria 960
303 Ga0157380_10109852 3300014326 Bacteria 2315
304 Ga0157380_13021209 3300014326 Bacteria 536
305 Ga0182008_10711944 3300014497 Bacteria 575
306 Ga0157377_10362097 3300014745 Bacteria 976
307 Ga0157379_10381576 3300014968 Bacteria 1293
308 Ga0157379_10502781 3300014968 Bacteria 1124
309 Ga0157379_10688993 3300014968 Bacteria 959
310 Ga0157376_10279832 3300014969 Bacteria 1571
311 Ga0157376_11327521 3300014969 Bacteria 750
312 Ga0157376_12293560 3300014969 Bacteria 579
313 Ga0163161_10090485 3300017792 Bacteria 2264
314 Ga0163161_11269528 3300017792 Bacteria 639
315 Ga0209233_1024790 3300025261 Bacteria 1494
316 Ga0209233_1040219 3300025261 Bacteria 1019
317 Ga0209564_1005249 3300025295 Bacteria 7481
318 Ga0209758_1000015 3300025297 Bacteria 851943
319 Ga0209758_1000711 3300025297 Bacteria 49164
320 Ga0209758_1000764 3300025297 Bacteria 46385
321 Ga0209758_1001468 3300025297 Bacteria 27665
322 Ga0209758_1004096 3300025297 Bacteria 12498
323 Ga0209758_1020867 3300025297 Bacteria 3078
324 Ga0209758_1023868 3300025297 Bacteria 2748
325 Ga0209758_1120108 3300025297 Bacteria 711
326 Ga0207426_1000368 3300025302 Bacteria 79715
327 Ga0207426_1005258 3300025302 Bacteria 5970
328 Ga0209257_1001688 3300025304 Bacteria 24840
329 Ga0209257_1046246 3300025304 Bacteria 1258
330 Ga0207656_10228227 3300025321 Bacteria 907
331 Ga0207696_1074971 3300025711 Bacteria 938
332 Ga0207653_10113249 3300025885 Bacteria 970
333 Ga0207692_10015137 3300025898 Bacteria 3387
334 Ga0207642_10090991 3300025899 Bacteria 1507
335 Ga0207710_10030533 3300025900 Bacteria 2352
336 Ga0207710_10062253 3300025900 Bacteria 1695
337 Ga0207710_10364493 3300025900 Bacteria 738
338 Ga0207688_10044786 3300025901 Bacteria 2466
339 Ga0207688_10243807 3300025901 Bacteria 1087
340 Ga0207680_10082706 3300025903 Bacteria 2021
341 Ga0207680_10151823 3300025903 Bacteria 1545
342 Ga0207685_10115210 3300025905 Bacteria 1171
343 Ga0207699_10001435 3300025906 Bacteria 11313
344 Ga0207699_10014909 3300025906 Bacteria 4024
345 Ga0207645_10093050 3300025907 Bacteria 1939
346 Ga0207645_10226471 3300025907 Bacteria 1233
347 Ga0207645_10536081 3300025907 Bacteria 794
348 Ga0207643_10282726 3300025908 Bacteria 1029
349 Ga0207705_10092997 3300025909 Bacteria 2210
350 Ga0207705_10437836 3300025909 Bacteria 1013
351 Ga0207684_10175591 3300025910 Bacteria 1847
352 Ga0207684_10242516 3300025910 Bacteria 1555
353 Ga0207654_10007028 3300025911 Bacteria 5670
354 Ga0207654_10014303 3300025911 Bacteria 4099
355 Ga0207654_10033366 3300025911 Bacteria 2853
356 Ga0207654_10343487 3300025911 Bacteria 1026
357 Ga0207707_10329438 3300025912 Bacteria 1317
358 Ga0207707_11086164 3300025912 Bacteria 653
359 Ga0207707_11235162 3300025912 Bacteria 603
360 Ga0207695_10000059 3300025913 Bacteria 363920
361 Ga0207671_10069543 3300025914 Bacteria 2624
362 Ga0207671_10070718 3300025914 Bacteria 2602
363 Ga0207693_10031785 3300025915 Bacteria 4171
364 Ga0207693_10055562 3300025915 Bacteria 3106
365 Ga0207693_10529038 3300025915 Bacteria 920
366 Ga0207663_10010613 3300025916 Bacteria 4911
367 Ga0207663_10157663 3300025916 Bacteria 1598
368 Ga0207663_11013254 3300025916 Bacteria 666
369 Ga0207660_10126351 3300025917 Bacteria 1942
370 Ga0207660_10215862 3300025917 Bacteria 1504
371 Ga0207662_10311038 3300025918 Bacteria 1049
372 Ga0207657_10335838 3300025919 Bacteria 1193
373 Ga0207657_10414767 3300025919 Bacteria 1059
374 Ga0207649_10582023 3300025920 Bacteria 859
375 Ga0207649_10856645 3300025920 Bacteria 711
376 Ga0207649_11020206 3300025920 Bacteria 651
377 Ga0207652_10080629 3300025921 Bacteria 2846
378 Ga0207652_10097186 3300025921 Bacteria 2595
379 Ga0207652_10462534 3300025921 Bacteria 1143
380 Ga0207646_10679543 3300025922 Bacteria 921
381 Ga0207646_11679166 3300025922 Bacteria 546
382 Ga0207681_10298305 3300025923 Bacteria 1274
383 Ga0207681_10372841 3300025923 Bacteria 1147
384 Ga0207681_10445951 3300025923 Bacteria 1052
385 Ga0207681_11336926 3300025923 Bacteria 602
386 Ga0207694_10702565 3300025924 Bacteria 853
387 Ga0207659_10161582 3300025926 Bacteria 1759
388 Ga0207687_10007517 3300025927 Bacteria 7164
389 Ga0207687_10119132 3300025927 Bacteria 1971
390 Ga0207687_10121735 3300025927 Bacteria 1952
391 Ga0207687_10151728 3300025927 Bacteria 1769
392 Ga0207687_11273632 3300025927 Bacteria 632
393 Ga0207700_10057510 3300025928 Bacteria 2933
394 Ga0207700_10140200 3300025928 Bacteria 1986
395 Ga0207664_10006581 3300025929 Bacteria 8002
396 Ga0207664_10841798 3300025929 Bacteria 825
397 Ga0207664_11068265 3300025929 Bacteria 722
398 Ga0207644_10250191 3300025931 Bacteria 1414
399 Ga0207644_10464983 3300025931 Bacteria 1040
400 Ga0207644_10903355 3300025931 Bacteria 740
401 Ga0207644_10912867 3300025931 Bacteria 736
402 Ga0207690_10490569 3300025932 Bacteria 992
403 Ga0207706_10109499 3300025933 Bacteria 2431
404 Ga0207706_10287563 3300025933 Bacteria 1433
405 Ga0207706_10356857 3300025933 Bacteria 1270
406 Ga0207686_10208175 3300025934 Bacteria 1405
407 Ga0207709_10095190 3300025935 Bacteria 1956
408 Ga0207709_10638257 3300025935 Bacteria 847
409 Ga0207669_10016439 3300025937 Bacteria 3759
410 Ga0207669_10479684 3300025937 Bacteria 991
411 Ga0207704_10131029 3300025938 Bacteria 1736
412 Ga0207704_10796728 3300025938 Bacteria 789
413 Ga0207704_10986212 3300025938 Bacteria 712
414 Ga0207665_10006088 3300025939 Bacteria 8010
415 Ga0207665_10227470 3300025939 Bacteria 1369
416 Ga0207665_10454280 3300025939 Bacteria 984
417 Ga0207665_10728701 3300025939 Bacteria 781
418 Ga0207665_10991492 3300025939 Bacteria 668
419 Ga0207691_10162687 3300025940 Bacteria 1957
420 Ga0207691_10309795 3300025940 Bacteria 1355
421 Ga0207711_10146825 3300025941 Bacteria 2125
422 Ga0207711_10422082 3300025941 Bacteria 1241
423 Ga0207711_10727953 3300025941 Bacteria 925
424 Ga0207689_10131954 3300025942 Bacteria 2056
425 Ga0207689_10224110 3300025942 Bacteria 1554
426 Ga0207689_10228549 3300025942 Bacteria 1538
427 Ga0207689_10239009 3300025942 Bacteria 1501
428 Ga0207689_10649416 3300025942 Bacteria 889
429 Ga0207689_10719062 3300025942 Bacteria 842
430 Ga0207661_10253616 3300025944 Bacteria 1565
431 Ga0207679_10134361 3300025945 Bacteria 1990
432 Ga0207667_10071740 3300025949 Bacteria 3600
433 Ga0207667_10282055 3300025949 Bacteria 1697
434 Ga0207651_10311346 3300025960 Bacteria 1313
435 Ga0207651_11011749 3300025960 Bacteria 743
436 Ga0207651_11072339 3300025960 Bacteria 721
437 Ga0207712_10084145 3300025961 Bacteria 2324
438 Ga0207668_10064617 3300025972 Bacteria 2586
439 Ga0207668_10065243 3300025972 Bacteria 2576
440 Ga0207668_10080782 3300025972 Bacteria 2356
441 Ga0207668_10378129 3300025972 Bacteria 1191
442 Ga0207668_10703504 3300025972 Bacteria 888
443 Ga0207668_10877529 3300025972 Bacteria 797
444 Ga0207640_11108375 3300025981 Bacteria 700
445 Ga0207640_11146691 3300025981 Bacteria 689
446 Ga0207658_11764203 3300025986 Bacteria 565
447 Ga0207677_10020036 3300026023 Bacteria 4052
448 Ga0207677_10385154 3300026023 Bacteria 1184
449 Ga0207677_11065326 3300026023 Bacteria 736
450 Ga0207703_10319032 3300026035 Bacteria 1422
451 Ga0207703_10997110 3300026035 Bacteria 803
452 Ga0207703_11303432 3300026035 Bacteria 698
453 Ga0207639_10056817 3300026041 Bacteria 3001
454 Ga0207639_10127047 3300026041 Bacteria 2105
455 Ga0207639_10168537 3300026041 Bacteria 1852
456 Ga0207639_10826691 3300026041 Bacteria 864
457 Ga0207639_10853308 3300026041 Bacteria 850
458 Ga0207639_10983079 3300026041 Bacteria 790
459 Ga0207678_10015293 3300026067 Bacteria 6749
460 Ga0207678_10025317 3300026067 Bacteria 5180
461 Ga0207678_10056561 3300026067 Bacteria 3376
462 Ga0207678_10065075 3300026067 Bacteria 3131
463 Ga0207678_10067421 3300026067 Bacteria 3072
464 Ga0207678_10085166 3300026067 Bacteria 2702
465 Ga0207678_10120473 3300026067 Bacteria 2239
466 Ga0207678_10269220 3300026067 Bacteria 1461
467 Ga0207708_10120227 3300026075 Bacteria 2046
468 Ga0207708_11225937 3300026075 Bacteria 656
469 Ga0207702_10073535 3300026078 Bacteria 2948
470 Ga0207702_11696247 3300026078 Bacteria 625
471 Ga0207641_10147876 3300026088 Bacteria 2126
472 Ga0207641_10190911 3300026088 Bacteria 1883
473 Ga0207641_10778498 3300026088 Bacteria 946
474 Ga0207641_11281438 3300026088 Bacteria 733
475 Ga0207641_11681042 3300026088 Bacteria 637
476 Ga0207648_10531033 3300026089 Bacteria 1079
477 Ga0207676_10146696 3300026095 Bacteria 2027
478 Ga0207676_10583607 3300026095 Bacteria 1072
479 Ga0207675_100032142 3300026118 Bacteria 4889
480 Ga0207675_100062464 3300026118 Bacteria 3478
481 Ga0207675_100561650 3300026118 Bacteria 1141
482 Ga0207683_10032945 3300026121 Bacteria 4501
483 Ga0207683_10157927 3300026121 Bacteria 2049
484 Ga0207683_10185954 3300026121 Bacteria 1885
485 Ga0207683_10249214 3300026121 Bacteria 1621
486 Ga0207683_10397770 3300026121 Bacteria 1267
487 Ga0207683_10745295 3300026121 Bacteria 909
488 Ga0207683_10964213 3300026121 Bacteria 792
489 Ga0207698_10120617 3300026142 Bacteria 2218
490 Ga0207698_10138313 3300026142 Bacteria 2093
491 Ga0207698_10190731 3300026142 Bacteria 1825
492 Ga0207698_10673807 3300026142 Bacteria 1027
493 Ga0207698_10706092 3300026142 Bacteria 1004
494 Ga0207698_10992837 3300026142 Bacteria 850
495 Ga0207698_11081931 3300026142 Bacteria 814
496 Ga0209389_1000012 3300027296 Bacteria 213243
497 Ga0209589_1000015 3300027357 Bacteria 225913
498 Ga0209489_100015 3300027361 Bacteria 225913
499 Ga0209489_100019 3300027361 Bacteria 213243
500 Ga0209700_100018 3300027363 Bacteria 238200
501 Ga0209700_100025 3300027363 Bacteria 225913
502 Ga0209813_10018990 3300027866 Bacteria 1906
503 Ga0209813_10067524 3300027866 Bacteria 1156
504 Ga0209813_10194350 3300027866 Bacteria 748
505 Ga0207428_10354871 3300027907 Bacteria 1078
506 Ga0268266_10003191 3300028379 Bacteria 16594
507 Ga0268266_10003840 3300028379 Bacteria 14672
508 Ga0268266_10021532 3300028379 Bacteria 5492
509 Ga0268266_10081383 3300028379 Bacteria 2823
510 Ga0268266_10212237 3300028379 Bacteria 1776
511 Ga0268266_10329679 3300028379 Bacteria 1430
512 Ga0268266_10392100 3300028379 Bacteria 1311
513 Ga0268266_11612031 3300028379 Bacteria 624
514 Ga0268266_12091799 3300028379 Bacteria 539
515 Ga0268265_10099262 3300028380 Bacteria 2347
516 Ga0268265_10188787 3300028380 Bacteria 1777
517 Ga0268265_10238970 3300028380 Bacteria 1601
518 Ga0268265_10554591 3300028380 Bacteria 1091
519 Ga0268265_10799106 3300028380 Bacteria 919
520 Ga0268264_10166142 3300028381 Bacteria 1992
521 Ga0268264_10727311 3300028381 Bacteria 987
522 Ga0268264_11147903 3300028381 Bacteria 786
523 Ga0307517_10010277 3300028786 Bacteria 13120
524 Ga0307517_10104578 3300028786 Bacteria 2204
525 Ga0307517_10492427 3300028786 Bacteria 626
526 Ga0307515_10150736 3300028794 Bacteria 2432
527 Ga0307511_10239206 3300030521 Bacteria 888
528 Ga0307509_10086316 3300031507 Bacteria 3227
529 Ga0307508_10000012 3300031616 Bacteria 243167
530 Ga0265314_10031058 3300031711 Bacteria 3948
531 Ga0265314_10035228 3300031711 Bacteria 3650
532 Ga0265342_10284576 3300031712 Bacteria 874
533 Ga0307516_10154357 3300031730 Bacteria 2053
534 Ga0307516_10420812 3300031730 Bacteria 994
535 Ga0307516_10769411 3300031730 Bacteria 623
536 Ga0307405_10238070 3300031731 Bacteria 1346
537 Ga0307405_11279955 3300031731 Bacteria 637
538 Ga0307413_10444453 3300031824 Bacteria 1027
539 Ga0307410_10362065 3300031852 Bacteria 1162
540 Ga0307406_10229561 3300031901 Bacteria 1385
541 Ga0307406_10301802 3300031901 Bacteria 1231
542 Ga0307407_10198331 3300031903 Bacteria 1343
543 Ga0307409_100021182 3300031995 Bacteria 4451
544 Ga0307416_101043225 3300032002 Bacteria 921
545 Ga0307416_103126773 3300032002 Bacteria 554
546 Ga0307414_10089285 3300032004 Bacteria 2284
547 Ga0307411_10034698 3300032005 Bacteria 3142
548 Ga0307411_10110407 3300032005 Bacteria 1966
549 Ga0307415_100715251 3300032126 Bacteria 905
550 Ga0307415_100716156 3300032126 Bacteria 905
551 Ga0307510_10015377 3300033180 Bacteria 9047
552 Ga0307510_10023362 3300033180 Bacteria 7168
553 Ga0307510_10104600 3300033180 Bacteria 2603
554 Ga0315911_1000021 3300033442 Bacteria 124874
555 Ga0316215_1003776 3300033544 Bacteria 1450
556 Ga0373938_0016509 3300034957 Bacteria 1443
557 Ga0373926_0384712 3300035083 Bacteria 553
558 Ga0373928_0065155 3300035084 Bacteria 889
559 Ga0373929_0039749 3300035085 Bacteria 1040
560 Ga0373934_0002532 3300035086 Bacteria 6723
561 Ga0373934_0025001 3300035086 Bacteria 2311
562 Ga0373940_0106914 3300035088 Bacteria 855
563 Ga0373923_0001264 3300035111 Bacteria 7120
564 Ga0373932_0031046 3300035112 Bacteria 1486
565 Ga0373936_0019784 3300035113 Bacteria 2611
566 Ga0373936_0054802 3300035113 Bacteria 1618
567 Ga0373936_0175662 3300035113 Bacteria 938
568 Ga0373953_0001769 3300035117 Bacteria 6378
569 Ga0373953_0024250 3300035117 Bacteria 2305
570 Ga0373953_0182785 3300035117 Bacteria 905
571 Ga0373954_0001440 3300035118 Bacteria 9662
572 Ga0373954_0018385 3300035118 Bacteria 3146
573 Ga0373954_0346040 3300035118 Bacteria 734
574 Ga0373956_0000376 3300035119 Bacteria 18268
575 Ga0373957_0020605 3300035120 Bacteria 2331
576 Ga0373943_0088008 3300035170 Bacteria 1604
577 Ga0373943_0574848 3300035170 Bacteria 662
578 Ga0373946_0030372 3300035171 Bacteria 2157
579 Ga0373946_0358732 3300035171 Bacteria 730
580 Ga0373955_0000325 3300035172 Bacteria 19823
581 Ga0373924_0004645 3300035410 Bacteria 4813
582 Ga0373924_0034842 3300035410 Bacteria 2040
583 Ga0373931_0231505 3300035691 Bacteria 1116
584 Ga0373927_0005689 3300035695 Bacteria 8558
585 Ga0373927_0043271 3300035695 Bacteria 2916
586 Ga0373927_0127315 3300035695 Bacteria 1663
587 Ga0373927_0365934 3300035695 Bacteria 950
588 Ga0373927_0477611 3300035695 Bacteria 824
589 Ga0373933_0005894 3300035724 Bacteria 6664
590 Ga0373933_0066591 3300035724 Bacteria 2183
591 Ga0373947_0010663 3300035725 Bacteria 5275
592 Ga0373947_0381697 3300035725 Bacteria 949
593 Ga0373937_0007855 3300036401 Bacteria 9247
594 Ga0373937_0041689 3300036401 Bacteria 4187
595 Ga0372808_043016 3300036459 Bacteria 647
596 Ga0373925_0240302 3300037068 Bacteria 1450
597 Ga0373925_0491280 3300037068 Bacteria 1007
598 Ga0395899_0038874 3300037312 Bacteria 3563
599 Ga0395900_0001756 3300037418 Bacteria 24872
600 Ga0395900_0285802 3300037418 Bacteria 1640
601 Ga0395900_0496477 3300037418 Bacteria 1171
602 Ga0395898_0023431 3300037466 Bacteria 6239
603 Ga0395898_0175732 3300037466 Bacteria 2047
604 Ga0395898_0517680 3300037466 Bacteria 1134
605 Ga0395905_0131973 3300037471 Bacteria 2349
606 Ga0395905_0212851 3300037471 Bacteria 1810
607 Ga0395905_0219176 3300037471 Bacteria 1781
608 Ga0395905_1069562 3300037471 Bacteria 710
609 Ga0395901_0237445 3300038443 Bacteria 1902
610 Ga0451791_1154616 3300041451 Bacteria 1126
611 Ga0451793_0680179 3300041452 Bacteria 509
612 Ga0451793_1462621 3300041452 Bacteria 708
613 Ga0451797_0708742 3300041453 Bacteria 569
614 Ga0451795_0001015 3300041456 Bacteria 775
615 Ga0451795_1592328 3300041456 Bacteria 683
616 Ga0451798_0463913 3300041458 Bacteria 998
617 Ga0451807_2142046 3300041486 Bacteria 1114
618 Ga0451835_1074072 3300041492 Bacteria 547
619 Ga0451841_1265539 3300041498 Bacteria 681
620 Ga0451843_0523243 3300041509 Bacteria 623
621 Ga0451843_0551884 3300041509 Bacteria 553
622 Ga0451853_3149176 3300041512 Bacteria 1525
623 Ga0439431_0108654 3300041997 Bacteria 767
624 Ga0439458_0005013 3300042157 Bacteria 2995
625 Ga0466969_0150312 3300044656 Bacteria 1073
626 Ga0466972_0099302 3300044658 Bacteria 1378
627 Ga0466966_0001463 3300044684 Bacteria 15199
628 Ga0466961_0000065 3300044693 Bacteria 63259
629 Ga0466963_0235852 3300044694 Bacteria 1282
630 Ga0466957_0197417 3300044842 Bacteria 1320
631 Ga0466960_0009188 3300044901 Bacteria 4069
632 Ga0466959_0000634 3300045049 Bacteria 20407
633 Ga0466967_0267715 3300045976 Bacteria 1636
634 Ga0466967_0412491 3300045976 Bacteria 1315
635 Ga0495617_140332 3300046452 Bacteria 772
636 Ga0495617_150273 3300046452 Bacteria 741
637 Ga0495592_0000339 3300046454 Bacteria 38389
638 Ga0495592_0083745 3300046454 Bacteria 2302
639 Ga0495592_0127004 3300046454 Bacteria 1788
640 Ga0495603_0043528 3300046455 Bacteria 2680
641 Ga0495603_0050828 3300046455 Bacteria 2464
642 Ga0495603_0052048 3300046455 Bacteria 2432
643 Ga0495603_0115547 3300046455 Bacteria 1565
644 Ga0495603_0118466 3300046455 Bacteria 1543
645 Ga0495603_0141413 3300046455 Bacteria 1400
646 Ga0495603_0190931 3300046455 Bacteria 1184
647 Ga0495629_0001483 3300046459 Bacteria 18494
648 Ga0495629_0006648 3300046459 Bacteria 8555
649 Ga0495629_0222645 3300046459 Bacteria 1301
650 Ga0495638_0022821 3300046460 Bacteria 4102
651 Ga0495638_0077199 3300046460 Bacteria 2028
652 Ga0495638_0117441 3300046460 Bacteria 1574
653 Ga0495638_0188711 3300046460 Bacteria 1171
654 Ga0495638_0224123 3300046460 Bacteria 1049
655 Ga0495638_0290946 3300046460 Bacteria 884
656 Ga0495641_0151578 3300046461 Bacteria 1036
657 Ga0495651_0015606 3300046462 Bacteria 5879
658 Ga0495651_0017638 3300046462 Bacteria 5524
659 Ga0495651_0112213 3300046462 Bacteria 2014
660 Ga0495651_0278941 3300046462 Bacteria 1130
661 Ga0495653_0001063 3300046463 Bacteria 21155
662 Ga0495653_0281852 3300046463 Bacteria 1090
663 Ga0495650_0071255 3300046471 Bacteria 1363
664 Ga0495650_0149314 3300046471 Bacteria 840
665 Ga0495580_0317654 3300046472 Bacteria 1059
666 Ga0495605_0238287 3300046474 Bacteria 782
667 Ga0495639_0080160 3300046475 Bacteria 1519
668 Ga0495639_0103420 3300046475 Bacteria 1347
669 Ga0495639_0159612 3300046475 Bacteria 1091
670 Ga0495639_0175459 3300046475 Bacteria 1042
671 Ga0495664_0221848 3300046477 Bacteria 1144
672 Ga0495664_0234375 3300046477 Bacteria 1110
673 Ga0495664_0484171 3300046477 Bacteria 740
674 Ga0495584_0238821 3300046491 Bacteria 924
675 Ga0495584_0293954 3300046491 Bacteria 825
676 Ga0495584_0526588 3300046491 Bacteria 602
677 Ga0495585_0084268 3300046492 Bacteria 1719
678 Ga0495585_0354893 3300046492 Bacteria 712
679 Ga0495594_0210577 3300046499 Bacteria 1108
680 Ga0495596_0180146 3300046500 Bacteria 821
681 Ga0495583_0136697 3300046506 Bacteria 1023
682 Ga0495583_0141772 3300046506 Bacteria 1000
683 Ga0495583_0288084 3300046506 Bacteria 654
684 Ga0495606_0011270 3300046507 Bacteria 7313
685 Ga0495606_0174337 3300046507 Bacteria 1245
686 Ga0495606_0184517 3300046507 Bacteria 1200
687 Ga0495606_0209119 3300046507 Bacteria 1106
688 Ga0495606_0343491 3300046507 Bacteria 794
689 Ga0495608_0002749 3300046511 Bacteria 12636
690 Ga0495608_0015906 3300046511 Bacteria 5207
691 Ga0495608_0016049 3300046511 Bacteria 5182
692 Ga0495608_0165818 3300046511 Bacteria 1403
693 Ga0495616_0182488 3300046513 Bacteria 932
694 Ga0495616_0196151 3300046513 Bacteria 890
695 Ga0495616_0412072 3300046513 Bacteria 553
696 Ga0495628_0010789 3300046516 Bacteria 7737
697 Ga0495628_0464198 3300046516 Bacteria 918
698 Ga0495630_0364281 3300046517 Bacteria 1107
699 Ga0495631_0049616 3300046518 Bacteria 1837
700 Ga0495631_0120207 3300046518 Bacteria 1130
701 Ga0495631_0324867 3300046518 Bacteria 655
702 Ga0495631_0434180 3300046518 Bacteria 559
703 Ga0495632_0027499 3300046519 Bacteria 2979
704 Ga0495632_0042897 3300046519 Bacteria 2265
705 Ga0495637_0024893 3300046520 Bacteria 2705
706 Ga0495637_0310393 3300046520 Bacteria 558
707 Ga0495643_0145135 3300046522 Bacteria 1180
708 Ga0495643_0534814 3300046522 Bacteria 501
709 Ga0495644_0180538 3300046523 Bacteria 811
710 Ga0495644_0287436 3300046523 Bacteria 642
711 Ga0495648_0252535 3300046524 Bacteria 850
712 Ga0495648_0264290 3300046524 Bacteria 824
713 Ga0495652_0005458 3300046529 Bacteria 11981
714 Ga0495652_0022492 3300046529 Bacteria 5594
715 Ga0495652_0025147 3300046529 Bacteria 5271
716 Ga0495652_0026600 3300046529 Bacteria 5108
717 Ga0495652_0171306 3300046529 Bacteria 1675
718 Ga0495640_0008433 3300046533 Bacteria 8084
719 Ga0495640_0022764 3300046533 Bacteria 4576
720 Ga0495640_0052678 3300046533 Bacteria 2793
721 Ga0495640_0145276 3300046533 Bacteria 1526
722 Ga0495640_0217847 3300046533 Bacteria 1205
723 Ga0495587_0010898 3300046536 Bacteria 5768
724 Ga0495587_0027904 3300046536 Bacteria 3437
725 Ga0495587_0093759 3300046536 Bacteria 1733
726 Ga0495609_0109021 3300046538 Bacteria 1196
727 Ga0495609_0141808 3300046538 Bacteria 1025
728 Ga0495621_0391448 3300046539 Bacteria 588
729 Ga0495597_0214762 3300046542 Bacteria 766
730 Ga0495645_0028867 3300046543 Bacteria 4032
731 Ga0495645_0052929 3300046543 Bacteria 2952
732 Ga0495645_0060101 3300046543 Bacteria 2755
733 Ga0495622_0010744 3300046557 Bacteria 4224
734 Ga0495622_0105852 3300046557 Bacteria 1289
735 Ga0495622_0136431 3300046557 Bacteria 1115
736 Ga0495622_0289776 3300046557 Bacteria 715
737 Ga0495633_0542477 3300046558 Bacteria 524
738 Ga0495667_0011132 3300046559 Bacteria 6087
739 Ga0495667_0021611 3300046559 Bacteria 4342
740 Ga0495667_0062012 3300046559 Bacteria 2450
741 Ga0495667_0236235 3300046559 Bacteria 1165
742 Ga0495656_0006097 3300046615 Bacteria 4206
743 Ga0495656_0109117 3300046615 Bacteria 1291
744 Ga0495668_0251860 3300046616 Bacteria 967
745 Ga0495634_0002330 3300046642 Bacteria 15886
746 Ga0495634_0496723 3300046642 Bacteria 715
747 Ga0495611_0021976 3300046648 Bacteria 2758
748 Ga0495625_0071860 3300046660 Bacteria 2427
749 Ga0495625_0674558 3300046660 Bacteria 613
750 Ga0495635_0000917 3300046663 Bacteria 19365
751 Ga0495635_0002291 3300046663 Bacteria 13017
752 Ga0495635_0039894 3300046663 Bacteria 3247
753 Ga0495635_0301041 3300046663 Bacteria 1075
754 Ga0495635_0465298 3300046663 Bacteria 835
755 Ga0495659_0121879 3300046664 Bacteria 1027
756 Ga0495659_0314819 3300046664 Bacteria 663
757 Ga0495661_0100123 3300046665 Bacteria 1633
758 Ga0495661_0419024 3300046665 Bacteria 649
759 Ga0495661_0474834 3300046665 Bacteria 599
760 Ga0495588_0080246 3300046674 Bacteria 1703
761 Ga0495588_0131640 3300046674 Bacteria 1319
762 Ga0495588_0259417 3300046674 Bacteria 916
763 Ga0495588_0358089 3300046674 Bacteria 767
764 Ga0495657_0003543 3300046675 Bacteria 12725
765 Ga0495657_0026551 3300046675 Bacteria 4100
766 Ga0495657_0101888 3300046675 Bacteria 1828
767 Ga0495599_0001780 3300046678 Bacteria 12490
768 Ga0495599_0170003 3300046678 Bacteria 1345
769 Ga0495599_0270213 3300046678 Bacteria 1032
770 Ga0495623_0020263 3300046679 Bacteria 4298
771 Ga0495623_0024146 3300046679 Bacteria 3921
772 Ga0495623_0058222 3300046679 Bacteria 2429
773 Ga0495646_0025247 3300046680 Bacteria 3739
774 Ga0495646_0057432 3300046680 Bacteria 2329
775 Ga0495646_0294624 3300046680 Bacteria 859
776 Ga0495647_0056602 3300046681 Bacteria 1538
777 Ga0495647_0185565 3300046681 Bacteria 907
778 Ga0495658_0119099 3300046683 Bacteria 1595
779 Ga0495658_0241851 3300046683 Bacteria 1134
780 Ga0495669_0039242 3300046684 Bacteria 2096
781 Ga0495669_0057752 3300046684 Bacteria 1751
782 Ga0495613_0012318 3300046689 Bacteria 6353
783 Ga0495613_0027022 3300046689 Bacteria 4272
784 Ga0495624_0011428 3300046690 Bacteria 6100
785 Ga0495670_0029527 3300046691 Bacteria 2721
786 Ga0495649_0191678 3300046694 Bacteria 1064
787 Ga0495589_0161598 3300046794 Bacteria 1067
788 Ga0495589_0585228 3300046794 Bacteria 508
789 Ga0495600_0002741 3300046809 Bacteria 10203
790 Ga0495600_0017271 3300046809 Bacteria 4587
791 Ga0495600_0019437 3300046809 Bacteria 4338
792 Ga0495600_0186219 3300046809 Bacteria 1336
793 Ga0495581_0040506 3300047315 Bacteria 2696
794 Ga0495581_0320880 3300047315 Bacteria 905
795 Ga0495604_0002741 3300047317 Bacteria 14128
796 Ga0495604_0007541 3300047317 Bacteria 8607
797 Ga0495604_0007941 3300047317 Bacteria 8404
798 Ga0495674_0007236 3300047319 Bacteria 10620
799 Ga0495674_0077634 3300047319 Bacteria 2855
800 Ga0495672_0014087 3300047320 Bacteria 5489
801 Ga0495672_0343969 3300047320 Bacteria 694
802 Ga0495676_0014630 3300047321 Bacteria 7017
803 Ga0495680_0001065 3300047322 Bacteria 30372
804 Ga0495680_0001876 3300047322 Bacteria 22116
805 Ga0495680_0069818 3300047322 Bacteria 2679
806 Ga0495683_0349466 3300047323 Bacteria 624
807 Ga0495675_0000901 3300047444 Bacteria 18140
808 Ga0495675_0045446 3300047444 Bacteria 2796
809 Ga0495675_0440305 3300047444 Bacteria 755
810 Ga0495677_0175682 3300047445 Bacteria 829
811 Ga0495677_0366596 3300047445 Bacteria 569
812 Ga0495679_191402 3300047446 Bacteria 540
813 Ga0495673_0035084 3300047469 Bacteria 2314
814 Ga0495673_0231847 3300047469 Bacteria 680
815 Ga0495673_0250519 3300047469 Bacteria 647
816 Ga0495681_0120855 3300047470 Bacteria 1124
817 Ga0495684_0000721 3300047471 Bacteria 26637
818 Ga0495684_0107418 3300047471 Bacteria 2108
819 Ga0495686_0022393 3300047472 Bacteria 4182
820 Ga0495686_0153380 3300047472 Bacteria 1351
821 Ga0495686_0356459 3300047472 Bacteria 794
822 Ga0495686_0560971 3300047472 Bacteria 595
823 Ga0495686_0581437 3300047472 Bacteria 582
824 Ga0495686_0707315 3300047472 Bacteria 514
825 Ga0495593_0003019 3300047673 Bacteria 10137
826 Ga0495602_0029916 3300048088 Bacteria 5175
827 Ga0495602_0084544 3300048088 Bacteria 2654
828 Ga0495602_0327374 3300048088 Bacteria 1112
829 Ga0495602_0819925 3300048088 Bacteria 624
830 Ga0496100_0146278 3300048903 Bacteria 1681
831 Ga0496100_0356976 3300048903 Bacteria 1105
832 Ga0496100_1137280 3300048903 Bacteria 615
833 Ga0496101_0041950 3300048904 Bacteria 3265
834 Ga0496101_0274945 3300048904 Bacteria 1315
835 Ga0496101_0302264 3300048904 Bacteria 1253
836 Ga0496101_0458362 3300048904 Bacteria 1006
837 Ga0496101_0506190 3300048904 Bacteria 954
838 Ga0496101_0540478 3300048904 Bacteria 921
839 Ga0496102_0013853 3300048905 Bacteria 6997
840 Ga0496102_0084587 3300048905 Bacteria 2928
841 Ga0496102_0121931 3300048905 Bacteria 2435
842 Ga0496102_0537020 3300048905 Bacteria 1092
843 Ga0496102_0582110 3300048905 Bacteria 1042
844 Ga0496102_0659030 3300048905 Bacteria 970
845 Ga0496102_0748320 3300048905 Bacteria 900
846 Ga0496102_0868540 3300048905 Bacteria 824
847 Ga0496102_1727856 3300048905 Bacteria 543
848 Ga0496103_0269023 3300048906 Bacteria 1096
849 Ga0496104_0044882 3300048907 Bacteria 4154
850 Ga0496104_0615082 3300048907 Bacteria 996
851 Ga0496104_0938932 3300048907 Bacteria 770
852 Ga0496104_1473436 3300048907 Bacteria 583
853 Ga0496105_0004094 3300048908 Bacteria 10925
854 Ga0496105_0179579 3300048908 Bacteria 1733
855 Ga0496105_0800765 3300048908 Bacteria 716
856 Ga0496105_1315901 3300048908 Bacteria 527
857 Ga0496106_0005142 3300048909 Bacteria 9697
858 Ga0496106_0008314 3300048909 Bacteria 7679
859 Ga0496106_0587477 3300048909 Bacteria 892
860 Ga0496106_0863908 3300048909 Bacteria 715
861 Ga0496107_0127229 3300048910 Bacteria 1880
862 Ga0496107_0127812 3300048910 Bacteria 1875
863 Ga0496107_0270960 3300048910 Bacteria 1263
864 Ga0496108_0068160 3300048911 Bacteria 3001
865 Ga0496108_0081616 3300048911 Bacteria 2740
866 Ga0496108_0201916 3300048911 Bacteria 1725
867 Ga0496109_0109385 3300048912 Bacteria 2569
868 Ga0496109_0131055 3300048912 Bacteria 2340
869 Ga0496109_0335316 3300048912 Bacteria 1428
870 Ga0496109_0810869 3300048912 Bacteria 874
871 Ga0496109_1146448 3300048912 Bacteria 714
872 Ga0496110_0431333 3300048913 Bacteria 1201
873 Ga0496110_0433957 3300048913 Bacteria 1197
874 Ga0496110_0473800 3300048913 Bacteria 1140
875 Ga0496110_0847219 3300048913 Bacteria 819
876 Ga0496111_0011220 3300048914 Bacteria 6030
877 Ga0496111_0265190 3300048914 Bacteria 1274
878 Ga0496112_0000035 3300048915 Bacteria 106983
879 Ga0496112_0069768 3300048915 Bacteria 3471
880 Ga0496112_0241886 3300048915 Bacteria 1757
881 Ga0496112_0874933 3300048915 Bacteria 821
882 Ga0496112_0893636 3300048915 Bacteria 810
883 Ga0496112_1068731 3300048915 Bacteria 726
884 Ga0496113_0139537 3300048916 Bacteria 1906
885 Ga0496113_0390894 3300048916 Bacteria 1116
886 Ga0496113_0780975 3300048916 Bacteria 759
887 Ga0496114_0024694 3300048917 Bacteria 4906
888 Ga0496114_0975256 3300048917 Bacteria 730
889 Ga0496115_0004493 3300048918 Bacteria 10094
890 Ga0496116_0000965 3300048919 Bacteria 35491
891 Ga0496117_0007318 3300048920 Bacteria 10829
892 Ga0496117_0099761 3300048920 Bacteria 1841
893 Ga0496117_0191671 3300048920 Bacteria 1163
894 Ga0496118_0010242 3300048921 Bacteria 9306
895 Ga0496118_0042994 3300048921 Bacteria 3557
896 Ga0496118_0388921 3300048921 Bacteria 729
897 Ga0496118_0470174 3300048921 Bacteria 633
898 Ga0496119_0007397 3300048922 Bacteria 9903
899 Ga0496119_0057355 3300048922 Bacteria 2353
900 Ga0496119_0392004 3300048922 Bacteria 664
901 Ga0496120_0003365 3300048923 Bacteria 14668
902 Ga0496120_0086329 3300048923 Bacteria 1687
903 Ga0496120_0120536 3300048923 Bacteria 1357
904 Ga0496120_0337294 3300048923 Bacteria 680
905 Ga0496121_0017077 3300048924 Bacteria 7442
906 Ga0496121_0017170 3300048924 Bacteria 7411
907 Ga0496121_0066269 3300048924 Bacteria 2933
908 Ga0496121_0197139 3300048924 Bacteria 1438
909 Ga0496121_0199297 3300048924 Bacteria 1428
910 Ga0496121_0599127 3300048924 Bacteria 680
911 Ga0496122_0033148 3300048925 Bacteria 4255
912 Ga0496122_0053150 3300048925 Bacteria 3057
913 Ga0496122_0086448 3300048925 Bacteria 2158
914 Ga0496123_0006724 3300048926 Bacteria 11061
915 Ga0496123_0054779 3300048926 Bacteria 2622
916 Ga0496123_0225183 3300048926 Bacteria 943
917 Ga0496124_0097640 3300048927 Bacteria 2385
918 Ga0496124_0195416 3300048927 Bacteria 1544
919 Ga0496124_0632778 3300048927 Bacteria 690
920 Ga0496125_0001630 3300048928 Bacteria 31638
921 Ga0496125_0010481 3300048928 Bacteria 9373
922 Ga0496125_0048905 3300048928 Bacteria 3520
923 Ga0496125_0095013 3300048928 Bacteria 2219
924 Ga0496126_0003472 3300048929 Bacteria 19892
925 Ga0496126_0018186 3300048929 Bacteria 6973
926 Ga0496126_0055280 3300048929 Bacteria 3592
927 Ga0496126_0072841 3300048929 Bacteria 3055
928 Ga0496126_0075361 3300048929 Bacteria 2994
929 Ga0496126_0132356 3300048929 Bacteria 2154
930 Ga0496126_0269499 3300048929 Bacteria 1413
931 Ga0496126_0541267 3300048929 Bacteria 925
932 Ga0496126_0622125 3300048929 Bacteria 848
933 Ga0496126_0704132 3300048929 Bacteria 784
934 Ga0501031_0001791 3300049568 Bacteria 13478
935 Ga0501031_0093802 3300049568 Bacteria 1959
936 Ga0501032_0000762 3300049569 Bacteria 26183
937 Ga0501033_0000136 3300049570 Bacteria 70952
938 Ga0501033_0182365 3300049570 Bacteria 1504
939 Ga0501034_0000251 3300049571 Bacteria 99406
940 Ga0501036_0000036 3300049572 Bacteria 87244
941 Ga0501037_0000867 3300049573 Bacteria 22596
942 Ga0501037_0140096 3300049573 Bacteria 1731
943 Ga0501037_0292848 3300049573 Bacteria 1132
944 Ga0501038_0000428 3300049574 Bacteria 36623
945 Ga0501038_0049185 3300049574 Bacteria 3646
946 Ga0501039_0219064 3300049575 Bacteria 1496
947 Ga0501040_0603753 3300049576 Bacteria 793
948 Ga0501041_0170512 3300049577 Bacteria 1362
949 Ga0501042_0025922 3300049578 Bacteria 4120
950 Ga0501043_0000165 3300049579 Bacteria 59980
951 Ga0501043_0351129 3300049579 Bacteria 1120
952 Ga0501046_0000839 3300049580 Bacteria 29959
953 Ga0501046_0320277 3300049580 Bacteria 1130
954 Ga0501047_0000340 3300049581 Bacteria 53278
955 Ga0501047_1232007 3300049581 Bacteria 562
956 Ga0501048_0004509 3300049582 Bacteria 10606
957 Ga0501048_0522818 3300049582 Bacteria 851
958 Ga0501067_0007630 3300049583 Bacteria 6013
959 Ga0501067_0486136 3300049583 Bacteria 690
960 Ga0501068_0003807 3300049584 Bacteria 8179
961 Ga0501068_0945089 3300049584 Bacteria 568
962 Ga0501069_0007026 3300049585 Bacteria 5893
963 Ga0501070_0006502 3300049586 Bacteria 9938
964 Ga0501070_0188830 3300049586 Bacteria 1694
965 Ga0501072_0007916 3300049588 Bacteria 8069
966 Ga0501072_0184865 3300049588 Bacteria 1663
967 Ga0501073_0000037 3300049589 Bacteria 87345
968 Ga0501073_0589554 3300049589 Bacteria 768
969 Ga0501074_0000167 3300049590 Bacteria 35108
970 Ga0501074_0078814 3300049590 Bacteria 2364
971 Ga0501076_0225653 3300049592 Bacteria 1531
972 Ga0501076_0922858 3300049592 Bacteria 720
973 Ga0501079_0001057 3300049741 Bacteria 19118
974 Ga0501080_0003259 3300049742 Bacteria 14325
975 Ga0501080_0500984 3300049742 Bacteria 1085
976 Ga0501080_0595495 3300049742 Bacteria 982
977 Ga0501083_0001812 3300049744 Bacteria 14636
978 Ga0501035_0000142 3300049822 Bacteria 87561
979 Ga0501035_0197984 3300049822 Bacteria 1724
980 Ga0501044_0000414 3300049823 Bacteria 52784
981 Ga0501044_0162165 3300049823 Bacteria 2211
982 Ga0501044_0249253 3300049823 Bacteria 1717
983 Ga0501045_0036286 3300049824 Bacteria 3579
984 nmdc:mga03683_119060_c1 3300050489 Bacteria 1173
985 nmdc:mga03683_144094_c1 3300050489 Bacteria 1072
986 nmdc:mga03683_209617_c1 3300050489 Bacteria 896
987 nmdc:mga03683_415109_c1 3300050489 Bacteria 644
988 nmdc:mga03n38_303412_c1 3300050490 Bacteria 858
989 nmdc:mga03n38_3607_c1 3300050490 Bacteria 5004
990 nmdc:mga03n38_544897_c1 3300050490 Bacteria 656
991 nmdc:mga00v17_15862_c1 3300050491 Bacteria 4238
992 nmdc:mga00v17_254121_c1 3300050491 Bacteria 1140
993 nmdc:mga00v17_33928_c1 3300050491 Bacteria 3028
994 nmdc:mga00v17_43108_c1 3300050491 Bacteria 2716
995 nmdc:mga0yw44_17100_c1 3300050492 Bacteria 3937
996 nmdc:mga0yw44_18813_c1 3300050492 Bacteria 3793
997 nmdc:mga0yw44_200253_c1 3300050492 Bacteria 1319
998 nmdc:mga0yw44_251604_c1 3300050492 Bacteria 1176
999 nmdc:mga0yw44_502646_c1 3300050492 Bacteria 823
1000 nmdc:mga0yw44_9428_c1 3300050492 Bacteria 4936
1001 nmdc:mga0k408_120585_c1 3300050493 Bacteria 1553
1002 nmdc:mga0k408_214900_c1 3300050493 Bacteria 1148
1003 nmdc:mga0k408_233594_c1 3300050493 Bacteria 1098
1004 nmdc:mga0k408_302298_c1 3300050493 Bacteria 955
1005 nmdc:mga06z11_114580_c1 3300050494 Bacteria 1497
1006 nmdc:mga06z11_214115_c1 3300050494 Bacteria 1124
1007 nmdc:mga06z11_25604_c1 3300050494 Bacteria 2799
1008 nmdc:mga06z11_35146_c1 3300050494 Bacteria 2465
1009 nmdc:mga06z11_84907_c1 3300050494 Bacteria 1707
1010 nmdc:mga06z11_93465_c1 3300050494 Bacteria 1637
1011 nmdc:mga04h51_113795_c1 3300050495 Bacteria 1001
1012 nmdc:mga04h51_22600_c1 3300050495 Bacteria 1905
1013 nmdc:mga07m45_26680_c1 3300050496 Bacteria 3176
1014 nmdc:mga07m45_280075_c1 3300050496 Bacteria 970
1015 nmdc:mga07m45_495697_c1 3300050496 Bacteria 707
1016 nmdc:mga07m45_532518_c1 3300050496 Bacteria 680
1017 nmdc:mga07m45_74635_c1 3300050496 Bacteria 1932
1018 nmdc:mga05p37_211226_c1 3300050507 Bacteria 1411
1019 nmdc:mga05p37_548580_c1 3300050507 Bacteria 1316
1020 nmdc:mga0qj67_637820_c1 3300050509 Bacteria 850
1021 nmdc:mga08y16_1055738_c1 3300050511 Bacteria 789
1022 nmdc:mga08y16_586043_c1 3300050511 Bacteria 1125
1023 nmdc:mga0n895_783721_c1 3300050512 Bacteria 945
1024 nmdc:mga0rr50_454903_c1 3300050513 Bacteria 1085
1025 nmdc:mga0a205_1100808_c1 3300050515 Bacteria 642
1026 nmdc:mga0sz30_146398_c1 3300050516 Bacteria 1044
1027 nmdc:mga0sz30_166288_c1 3300050516 Bacteria 978
1028 nmdc:mga0sz30_199165_c1 3300050516 Bacteria 889
1029 nmdc:mga0sz30_28823_c1 3300050516 Bacteria 2286
1030 nmdc:mga0sz30_541858_c1 3300050516 Bacteria 525
1031 nmdc:mga0sz30_93353_c1 3300050516 Bacteria 1311
1032 Ga0495601_0216694 3300053077 Bacteria 1250
1033 Ga0495612_0023692 3300053078 Bacteria 2464
1034 Ga0495612_0070558 3300053078 Bacteria 1456
1035 Ga0495612_0130920 3300053078 Bacteria 1084
1036 Ga0495612_0156811 3300053078 Bacteria 993
1037 Ga0500610_0255682 3300053079 Bacteria 804
1038 Ga0500635_0302216 3300053080 Bacteria 631
1039 Ga0495595_0000828 3300053084 Bacteria 11843
1040 Ga0495595_0669471 3300053084 Bacteria 531
1041 Ga0495619_0000912 3300053085 Bacteria 19381
1042 Ga0495619_0102327 3300053085 Bacteria 1951
1043 Ga0495619_0718543 3300053085 Bacteria 679
1044 Ga0495619_0724918 3300053085 Bacteria 675
1045 Ga0500578_0156825 3300053086 Bacteria 1415
1046 Ga0500578_0232065 3300053086 Bacteria 1118
1047 Ga0500643_000048 3300053087 Bacteria 147879
1048 Ga0500643_067043 3300053087 Bacteria 999
1049 Ga0500581_116512 3300053089 Bacteria 1295
1050 Ga0500646_0010979 3300053090 Bacteria 2326
1051 Ga0500646_0017492 3300053090 Bacteria 1881
1052 Ga0500647_0241710 3300053091 Bacteria 798
1053 Ga0500583_0144820 3300053092 Bacteria 1181
1054 Ga0500583_0177472 3300053092 Bacteria 1061
1055 Ga0500651_0037353 3300053093 Bacteria 3060
1056 Ga0500651_0239009 3300053093 Bacteria 1060
1057 Ga0500651_0575009 3300053093 Bacteria 614
1058 Ga0500566_0000126 3300053094 Bacteria 39286
1059 Ga0500566_0004965 3300053094 Bacteria 7920
1060 Ga0500566_0029885 3300053094 Bacteria 3181
1061 Ga0500640_007080 3300053095 Bacteria 4334
1062 Ga0500641_0012056 3300053096 Bacteria 3150
1063 Ga0500554_007778 3300053102 Bacteria 2483
1064 Ga0500555_058884 3300053103 Bacteria 1037
1065 Ga0500556_0036495 3300053104 Bacteria 1705
1066 Ga0500557_000083 3300053105 Bacteria 32931
1067 Ga0500562_027531 3300053108 Bacteria 1492
1068 Ga0500562_049544 3300053108 Bacteria 1122
1069 Ga0500569_002207 3300053109 Bacteria 3798
1070 Ga0500569_020574 3300053109 Bacteria 1733
1071 Ga0500572_004191 3300053111 Bacteria 3277
1072 Ga0500591_250562 3300053115 Bacteria 547
1073 Ga0500594_0169626 3300053118 Bacteria 708
1074 Ga0500594_0219768 3300053118 Bacteria 628
1075 Ga0500595_000333 3300053119 Bacteria 30925
1076 Ga0500595_005544 3300053119 Bacteria 5498
1077 Ga0500595_031641 3300053119 Bacteria 1773
1078 Ga0500595_092253 3300053119 Bacteria 875
1079 Ga0500608_017998 3300053122 Bacteria 3218
1080 Ga0500608_197079 3300053122 Bacteria 836
1081 Ga0500614_070743 3300053123 Bacteria 957
1082 Ga0500614_132923 3300053123 Bacteria 740
1083 Ga0500642_0056130 3300053130 Bacteria 1754
1084 Ga0500642_0141531 3300053130 Bacteria 1128
1085 Ga0500658_0016844 3300053134 Bacteria 2725
1086 Ga0500658_0293632 3300053134 Bacteria 747
1087 Ga0500559_0003961 3300053136 Bacteria 7132
1088 Ga0500559_0327889 3300053136 Bacteria 717
1089 Ga0500568_0066543 3300053139 Bacteria 1386
1090 Ga0500577_0049030 3300053142 Bacteria 1577
1091 Ga0500577_0080669 3300053142 Bacteria 1297
1092 Ga0500577_0242731 3300053142 Bacteria 782
1093 Ga0500588_0051976 3300053146 Bacteria 1281
1094 Ga0500588_0204124 3300053146 Bacteria 733
1095 Ga0500589_094668 3300053147 Bacteria 1308
1096 Ga0500589_166093 3300053147 Bacteria 882
1097 Ga0500603_000178 3300053150 Bacteria 16265
1098 Ga0500603_000304 3300053150 Bacteria 12869
1099 Ga0500603_007176 3300053150 Bacteria 2442
1100 Ga0500604_0083099 3300053151 Bacteria 1037
1101 Ga0500604_0130236 3300053151 Bacteria 845
1102 Ga0500616_0000033 3300053153 Bacteria 398830
1103 Ga0500619_149490 3300053154 Bacteria 795
1104 Ga0500620_136482 3300053155 Bacteria 858
1105 Ga0500622_0005267 3300053156 Bacteria 7803
1106 Ga0500622_0078202 3300053156 Bacteria 1660
1107 Ga0500622_0428744 3300053156 Bacteria 531
1108 Ga0500630_002602 3300053159 Bacteria 8690
1109 Ga0500634_0076256 3300053161 Bacteria 1741
1110 Ga0500638_007384 3300053162 Bacteria 4593
1111 Ga0500638_109121 3300053162 Bacteria 1280
1112 Ga0500638_192821 3300053162 Bacteria 869
1113 Ga0500639_000039 3300053163 Bacteria 65182
1114 Ga0500636_0015443 3300053177 Bacteria 4500
1115 Ga0500636_0032865 3300053177 Bacteria 3071
1116 Ga0500636_0103923 3300053177 Bacteria 1612
1117 Ga0500637_0000060 3300053178 Bacteria 38881
1118 Ga0500637_0003041 3300053178 Bacteria 7626
1119 Ga0500625_007842 3300053729 Bacteria 4666
1120 Ga0500645_041367 3300053730 Bacteria 1361
1121 Ga0500645_127898 3300053730 Bacteria 707
1122 Ga0500609_001859 3300053731 Bacteria 3062
1123 Ga0500599_013831 3300053736 Bacteria 1095
1124 Ga0500601_008730 3300053737 Bacteria 1128
1125 Ga0501084_0041770 3300054114 Bacteria 3836
1126 Ga0500661_003670 3300055283 Bacteria 2884
1127 Ga0500661_032918 3300055283 Bacteria 915
1128 Ga0501082_0002719 3300060353 Bacteria 15447
1129 2793077974
1130 2513659783 2513237096 Bacteria 8722461
1131 2513704354 2513237102 Bacteria 7703324
1132 2513857245 2513237137 Bacteria 9558895
1133 2513918859 2513237145 Bacteria 8979722
1134 2524468639 2524023210 Bacteria 9029266
1135 2524533361 2524023228 Bacteria 10118060
1136 2603860086 2602042107 Bacteria 6226103
1137 2617347779 2617270735 Bacteria 9163226
1138 2671119356 2667528175 Bacteria 7532676
1139 2723842256 2721755755 Bacteria 8322773
1140 2793061565 2791355196 Bacteria 7323613
1141 2824775740 2824773399 Bacteria 8360218
1142 2857513315 2857509624 Bacteria 7472071
1143 2874620221 2874612657 Bacteria 8252029
1144 2876815709 2876808645 Bacteria 8824342
1145 2879106653 2879099564 Bacteria 10442239
1146 2879117031 2879110137 Bacteria 8907982
1147 2885380645 2885374607 Bacteria 8927485
1148 2889036372 2889033259 Bacteria 9099371
1149 2906643419 2906635258 Bacteria 8601019
1150 2906666611 2906660503 Bacteria 8595048
1151 2908746712 2908739725 Bacteria 8628932
1152 2919078957 2919073203 Bacteria 6531949
1153 2922389352 2922386360 Bacteria 7017218
1154 2932800637 2932794094 Bacteria 7915132
1155 2932808368 2932801729 Bacteria 7987968
1156 2932813326 2932809354 Bacteria 9135765
1157 2932820023 2932818245 Bacteria 9955613
1158 2935687223 2935684952 Bacteria 9590419
1159 2935716911 2935713505 Bacteria 9608509
1160 2935722964 2935722832 Bacteria 9608746
1161 2935734521 2935732158 Bacteria 9706831
1162 2935744688 2935741537 Bacteria 9707219
1163 2935753189 2935750917 Bacteria 9590372
1164 2935767593 2935760218 Bacteria 9817913
1165 2935770188 2935769743 Bacteria 7878163
1166 2935777782 2935777560 Bacteria 8077691
1167 2935786758 2935785616 Bacteria 7962367
1168 2935794812 2935793552 Bacteria 8012592
1169 2935883475 2935883170 Bacteria 7964738
1170 2940559102 2940556831 Bacteria 9590747
1171 3005475656 3005474847 Bacteria 9259049
1172 3005601851 3005594810 Bacteria 8716512
1173 3005717589 3005710791 Bacteria 7622528
1174 3005724638 3005718088 Bacteria 8283608
1175 8006936991 8006933436 Bacteria 10410654
1176 8006966343 8006964411 Bacteria 8966052
1177 8006976958 8006973647 Bacteria 10679141
1178 8006993169 8006984368 Bacteria 9651211
1179 8016526945 8016522445 Bacteria 8156687
1180 8016545239 8016539877 Bacteria 8155419
1181 8016556849 8016548790 Bacteria 8155074
1182 8016565202 8016557553 Bacteria 8154380
1183 8016570318 8016566248 Bacteria 8158151
1184 8016582865 8016575299 Bacteria 8154085
1185 8016602845 8016595262 Bacteria 8149947
1186 8016605715 8016603502 Bacteria 8731218
1187 8016617622 8016613128 Bacteria 8794220
1188 8016623948 8016622563 Bacteria 7999408
1189 8016634916 8016630954 Bacteria 9217207
1190 8019531848 8019530166 Bacteria 8155624
1191 8019539683 8019538911 Bacteria 7872763
1192 8019550967 8019547302 Bacteria 7996444
1193 8056678194 8056673599 Bacteria 7871253
1194 8056975361 8056967851 Bacteria 9038162
1195 JGI24739J22299_10006399
1196 JGI25406J46586_10022537
1197 JGI25153J46596_10003608
1198 JGI25153J46596_10004959
1199 JGI25153J46596_10006371
1200 JGI25160J50197_1018792
1201 JGI25404J52841_10016499
1202 JGI25404J52841_10023848
1203 JGI25404J52841_10024822
1204 Ga0055543_1052251
1205 Ga0065165_1001167
1206 Ga0070658_10196084
1207 Ga0070658_10283368
1208 Ga0070658_10381761
1209 Ga0070658_10396113
1210 Ga0070658_11209812
1211 Ga0070676_10079748
1212 Ga0070676_10379389
1213 Ga0070690_100560287
1214 Ga0070670_100153306
1215 Ga0070677_10611733
1216 Ga0068869_100039611
1217 Ga0068869_100237260
1218 Ga0068869_100240733
1219 Ga0068869_100316965
1220 Ga0070666_10151911
1221 Ga0070666_10198061
1222 Ga0070680_100469175
1223 Ga0070682_101517579
1224 Ga0068868_100040865
1225 Ga0068868_100483032
1226 Ga0068868_101014153
1227 Ga0068868_101140663
1228 Ga0070661_100058873
1229 Ga0070661_100165332
1230 Ga0070668_100362475
1231 Ga0070668_100616553
1232 Ga0070668_100910678
1233 Ga0070668_101351939
1234 Ga0070669_100095141
1235 Ga0070669_100385403
1236 Ga0070675_100211821
1237 Ga0070671_100116309
1238 Ga0070671_100425391
1239 Ga0070671_100565108
1240 Ga0070671_100581789
1241 Ga0070671_100632877
1242 Ga0070671_101352816
1243 Ga0070674_100617891
1244 Ga0070674_101096692
1245 Ga0070673_100247812
1246 Ga0070667_100706940
1247 Ga0070667_100932570
1248 Ga0070709_10001520
1249 Ga0070709_10008885
1250 Ga0070714_100005907
1251 Ga0070714_101141603
1252 Ga0070713_100331509
1253 Ga0070713_100886729
1254 Ga0070710_10000733
1255 Ga0070710_10014290
1256 Ga0070710_10342128
1257 Ga0070711_100001130
1258 Ga0070711_100005326
1259 Ga0070711_100558104
1260 Ga0070700_100054382
1261 Ga0070663_100148671
1262 Ga0070663_100168859
1263 Ga0070663_100390385
1264 Ga0070678_100024391
1265 Ga0070678_100115610
1266 Ga0070678_101261298
1267 Ga0070662_100052852
1268 Ga0070662_100081245
1269 Ga0070662_100182385
1270 Ga0070662_100285527
1271 Ga0070681_10211895
1272 Ga0070681_10569120
1273 Ga0070681_10921359
1274 Ga0068867_100244819
1275 Ga0068867_100274201
1276 Ga0068867_100369011
1277 Ga0070706_100740746
1278 Ga0070707_100452275
1279 Ga0070698_100427261
1280 Ga0070698_100430652
1281 Ga0070698_100483081
1282 Ga0070699_101088599
1283 Ga0070679_100080757
1284 Ga0070679_100126592
1285 Ga0070697_100096466
1286 Ga0068853_100037982
1287 Ga0068853_100407464
1288 Ga0068853_100824905
1289 Ga0070672_101310748
1290 Ga0070696_100171166
1291 Ga0070693_100107854
1292 Ga0070693_100591800
1293 Ga0070665_100004629
1294 Ga0070665_100090496
1295 Ga0070665_100105979
1296 Ga0070665_100201348
1297 Ga0070665_100505908
1298 Ga0070665_100744167
1299 Ga0070665_100829596
1300 Ga0070665_101263734
1301 Ga0068855_100077128
1302 Ga0068855_100099019
1303 Ga0068855_100236674
1304 Ga0068855_100817199
1305 Ga0070664_100087892
1306 Ga0070664_100513061
1307 Ga0068854_100902723
1308 Ga0068854_101024358
1309 Ga0068856_100205397
1310 Ga0070702_100282790
1311 Ga0070702_100426556
1312 Ga0068852_100067797
1313 Ga0068852_100156188
1314 Ga0068852_100301187
1315 Ga0068852_101141836
1316 Ga0068852_101418258
1317 Ga0068852_101606654
1318 Ga0068859_100273153
1319 Ga0068859_100719402
1320 Ga0068859_101111325
1321 Ga0068859_101763055
1322 Ga0068864_100264613
1323 Ga0068864_101421818
1324 Ga0068866_10039340
1325 Ga0068861_100076821
1326 Ga0068861_100119779
1327 Ga0068861_100707850
1328 Ga0068861_100724546
1329 Ga0068861_100836656
1330 Ga0068861_101507593
1331 Ga0068870_10281582
1332 Ga0068870_10324289
1333 Ga0068863_100339344
1334 Ga0068863_101413576
1335 Ga0068858_100060026
1336 Ga0068858_100317108
1337 Ga0068858_101242336
1338 Ga0068860_100141032
1339 Ga0068860_100421243
1340 Ga0068862_100196039
1341 Ga0068862_100212955
1342 Ga0068862_100260305
1343 Ga0068862_100309934
1344 Ga0068862_101124046
1345 Ga0081455_10080519
1346 Ga0081455_10127351
1347 Ga0081455_10157722
1348 Ga0081540_1002866
1349 Ga0081540_1005656
1350 Ga0081540_1016160
1351 Ga0081540_1021799
1352 Ga0081540_1024467
1353 Ga0081540_1027780
1354 Ga0081540_1039864
1355 Ga0081540_1074197
1356 Ga0081540_1160389
1357 Ga0081539_10000157
1358 Ga0081539_10037110
1359 Ga0070717_10008111
1360 Ga0075365_10070542
1361 Ga0075365_10085860
1362 Ga0075365_10125077
1363 Ga0075365_10131480
1364 Ga0075365_10132947
1365 Ga0075365_10227586
1366 Ga0075368_10092765
1367 Ga0075368_10256249
1368 Ga0075363_100002704
1369 Ga0075363_100125558
1370 Ga0075364_10035757
1371 Ga0075364_10144996
1372 Ga0075364_10176908
1373 Ga0075364_10270559
1374 Ga0075364_10930453
1375 Ga0070715_10278916
1376 Ga0070716_100268189
1377 Ga0070716_100556967
1378 Ga0070716_100763611
1379 Ga0070712_100002371
1380 Ga0070712_100556936
1381 Ga0075362_10047780
1382 Ga0075362_10113141
1383 Ga0075362_10175993
1384 Ga0075362_10400758
1385 Ga0075367_10005584
1386 Ga0075367_10076759
1387 Ga0075367_10105118
1388 Ga0075367_10208934
1389 Ga0075367_10352705
1390 Ga0075369_10004189
1391 Ga0075369_10058287
1392 Ga0075369_10186833
1393 Ga0075369_10190255
1394 Ga0075366_10067116
1395 Ga0075366_10140574
1396 Ga0075366_10410474
1397 Ga0097621_100220287
1398 Ga0075370_10001262
1399 Ga0075370_10066034
1400 Ga0075370_10135157
1401 Ga0075370_10183674
1402 Ga0068871_100100889
1403 Ga0068871_100517093
1404 Ga0068871_100665344
1405 Ga0068871_100829921
1406 Ga0075428_100074682
1407 Ga0075428_100871338
1408 Ga0075433_10857647
1409 Ga0075434_100087493
1410 Ga0075434_100469416
1411 Ga0068865_100008510
1412 Ga0097620_100273166
1413 Ga0097620_100719387
1414 Ga0097620_101111300
1415 Ga0097620_101763323
1416 Ga0099825_1025612
1417 Ga0099824_1008303
1418 Ga0099822_1000541
1419 Ga0099823_1031325
1420 Ga0075435_100571611
1421 Ga0099794_10118262
1422 Ga0099794_10166703
1423 Ga0099795_10078154
1424 Ga0099795_10146250
1425 Ga0099795_10254010
1426 Ga0105250_10309503
1427 Ga0105250_10394331
1428 Ga0105240_10013303
1429 Ga0105240_10362741
1430 Ga0105240_11000465
1431 Ga0105240_11470620
1432 Ga0111539_10456176
1433 Ga0111539_10657793
1434 Ga0111539_11471018
1435 Ga0105245_10042563
1436 Ga0105245_10089665
1437 Ga0105245_10492023
1438 Ga0105247_10067424
1439 Ga0105247_10159213
1440 Ga0105247_10171621
1441 Ga0105247_10232180
1442 Ga0114129_10172553
1443 Ga0114129_11556122
1444 Ga0105243_10760555
1445 Ga0105243_10816378
1446 Ga0105243_11861817
1447 Ga0105241_10004267
1448 Ga0105241_10024156
1449 Ga0105241_10036215
1450 Ga0105242_10042608
1451 Ga0105242_10274728
1452 Ga0105248_10046362
1453 Ga0105248_10401747
1454 Ga0105248_10532904
1455 Ga0105248_11549125
1456 Ga0105248_12285696
1457 Ga0105237_10017841
1458 Ga0105237_10082678
1459 Ga0105237_10323997
1460 Ga0105237_10483707
1461 Ga0105237_10684936
1462 Ga0105238_11066560
1463 Ga0105238_12971070
1464 Ga0105249_10231397
1465 Ga0105249_10750143
1466 Ga0105249_11861447
1467 Ga0099796_10154143
1468 Ga0105239_10072795
1469 Ga0105239_10134403
1470 Ga0105239_10759835
1471 Ga0105239_11441313
1472 Ga0105246_10151873
1473 Ga0105246_10411645
1474 Ga0105246_10524800
1475 Ga0105246_10538567
1476 Ga0105246_10612107
1477 Ga0105246_10780316
1478 Ga0157370_10115958
1479 Ga0157370_10267710
1480 Ga0157369_10580485
1481 Ga0157369_10630574
1482 Ga0157369_10645994
1483 Ga0157374_10156652
1484 Ga0157374_10516010
1485 Ga0157374_10641331
1486 Ga0157378_10091042
1487 Ga0157378_11737268
1488 Ga0163162_10201665
1489 Ga0157372_10154292
1490 Ga0157372_10495804
1491 Ga0157375_10407254
1492 Ga0157375_11192575
1493 Ga0163163_10010769
1494 Ga0163163_10633800
1495 Ga0163163_10845293
1496 Ga0163163_10878787
1497 Ga0157380_10109852
1498 Ga0157380_13021209
1499 Ga0182008_10711944
1500 Ga0157377_10362097
1501 Ga0157379_10381576
1502 Ga0157379_10502781
1503 Ga0157379_10688993
1504 Ga0157376_10279832
1505 Ga0157376_11327521
1506 Ga0157376_12293560
1507 Ga0163161_10090485
1508 Ga0163161_11269528
1509 Ga0209233_1024790
1510 Ga0209233_1040219
1511 Ga0209564_1005249
1512 Ga0209758_1000015
1513 Ga0209758_1000711
1514 Ga0209758_1000764
1515 Ga0209758_1001468
1516 Ga0209758_1004096
1517 Ga0209758_1020867
1518 Ga0209758_1023868
1519 Ga0209758_1120108
1520 Ga0207426_1000368
1521 Ga0207426_1005258
1522 Ga0209257_1001688
1523 Ga0209257_1046246
1524 Ga0207656_10228227
1525 Ga0207696_1074971
1526 Ga0207653_10113249
1527 Ga0207692_10015137
1528 Ga0207642_10090991
1529 Ga0207710_10030533
1530 Ga0207710_10062253
1531 Ga0207710_10364493
1532 Ga0207688_10044786
1533 Ga0207688_10243807
1534 Ga0207680_10082706
1535 Ga0207680_10151823
1536 Ga0207685_10115210
1537 Ga0207699_10001435
1538 Ga0207699_10014909
1539 Ga0207645_10093050
1540 Ga0207645_10226471
1541 Ga0207645_10536081
1542 Ga0207643_10282726
1543 Ga0207705_10092997
1544 Ga0207705_10437836
1545 Ga0207684_10175591
1546 Ga0207684_10242516
1547 Ga0207654_10007028
1548 Ga0207654_10014303
1549 Ga0207654_10033366
1550 Ga0207654_10343487
1551 Ga0207707_10329438
1552 Ga0207707_11086164
1553 Ga0207707_11235162
1554 Ga0207695_10000059
1555 Ga0207671_10069543
1556 Ga0207671_10070718
1557 Ga0207693_10031785
1558 Ga0207693_10055562
1559 Ga0207693_10529038
1560 Ga0207663_10010613
1561 Ga0207663_10157663
1562 Ga0207663_11013254
1563 Ga0207660_10126351
1564 Ga0207660_10215862
1565 Ga0207662_10311038
1566 Ga0207657_10335838
1567 Ga0207657_10414767
1568 Ga0207649_10582023
1569 Ga0207649_10856645
1570 Ga0207649_11020206
1571 Ga0207652_10080629
1572 Ga0207652_10097186
1573 Ga0207652_10462534
1574 Ga0207646_10679543
1575 Ga0207646_11679166
1576 Ga0207681_10298305
1577 Ga0207681_10372841
1578 Ga0207681_10445951
1579 Ga0207681_11336926
1580 Ga0207694_10702565
1581 Ga0207659_10161582
1582 Ga0207687_10007517
1583 Ga0207687_10119132
1584 Ga0207687_10121735
1585 Ga0207687_10151728
1586 Ga0207687_11273632
1587 Ga0207700_10057510
1588 Ga0207700_10140200
1589 Ga0207664_10006581
1590 Ga0207664_10841798
1591 Ga0207664_11068265
1592 Ga0207644_10250191
1593 Ga0207644_10464983
1594 Ga0207644_10903355
1595 Ga0207644_10912867
1596 Ga0207690_10490569
1597 Ga0207706_10109499
1598 Ga0207706_10287563
1599 Ga0207706_10356857
1600 Ga0207686_10208175
1601 Ga0207709_10095190
1602 Ga0207709_10638257
1603 Ga0207669_10016439
1604 Ga0207669_10479684
1605 Ga0207704_10131029
1606 Ga0207704_10796728
1607 Ga0207704_10986212
1608 Ga0207665_10006088
1609 Ga0207665_10227470
1610 Ga0207665_10454280
1611 Ga0207665_10728701
1612 Ga0207665_10991492
1613 Ga0207691_10162687
1614 Ga0207691_10309795
1615 Ga0207711_10146825
1616 Ga0207711_10422082
1617 Ga0207711_10727953
1618 Ga0207689_10131954
1619 Ga0207689_10224110
1620 Ga0207689_10228549
1621 Ga0207689_10239009
1622 Ga0207689_10649416
1623 Ga0207689_10719062
1624 Ga0207661_10253616
1625 Ga0207679_10134361
1626 Ga0207667_10071740
1627 Ga0207667_10282055
1628 Ga0207651_10311346
1629 Ga0207651_11011749
1630 Ga0207651_11072339
1631 Ga0207712_10084145
1632 Ga0207668_10064617
1633 Ga0207668_10065243
1634 Ga0207668_10080782
1635 Ga0207668_10378129
1636 Ga0207668_10703504
1637 Ga0207668_10877529
1638 Ga0207640_11108375
1639 Ga0207640_11146691
1640 Ga0207658_11764203
1641 Ga0207677_10020036
1642 Ga0207677_10385154
1643 Ga0207677_11065326
1644 Ga0207703_10319032
1645 Ga0207703_10997110
1646 Ga0207703_11303432
1647 Ga0207639_10056817
1648 Ga0207639_10127047
1649 Ga0207639_10168537
1650 Ga0207639_10826691
1651 Ga0207639_10853308
1652 Ga0207639_10983079
1653 Ga0207678_10015293
1654 Ga0207678_10025317
1655 Ga0207678_10056561
1656 Ga0207678_10065075
1657 Ga0207678_10067421
1658 Ga0207678_10085166
1659 Ga0207678_10120473
1660 Ga0207678_10269220
1661 Ga0207708_10120227
1662 Ga0207708_11225937
1663 Ga0207702_10073535
1664 Ga0207702_11696247
1665 Ga0207641_10147876
1666 Ga0207641_10190911
1667 Ga0207641_10778498
1668 Ga0207641_11281438
1669 Ga0207641_11681042
1670 Ga0207648_10531033
1671 Ga0207676_10146696
1672 Ga0207676_10583607
1673 Ga0207675_100032142
1674 Ga0207675_100062464
1675 Ga0207675_100561650
1676 Ga0207683_10032945
1677 Ga0207683_10157927
1678 Ga0207683_10185954
1679 Ga0207683_10249214
1680 Ga0207683_10397770
1681 Ga0207683_10745295
1682 Ga0207683_10964213
1683 Ga0207698_10120617
1684 Ga0207698_10138313
1685 Ga0207698_10190731
1686 Ga0207698_10673807
1687 Ga0207698_10706092
1688 Ga0207698_10992837
1689 Ga0207698_11081931
1690 Ga0209389_1000012
1691 Ga0209589_1000015
1692 Ga0209489_100015
1693 Ga0209489_100019
1694 Ga0209700_100018
1695 Ga0209700_100025
1696 Ga0209813_10018990
1697 Ga0209813_10067524
1698 Ga0209813_10194350
1699 Ga0207428_10354871
1700 Ga0268266_10003191
1701 Ga0268266_10003840
1702 Ga0268266_10021532
1703 Ga0268266_10081383
1704 Ga0268266_10212237
1705 Ga0268266_10329679
1706 Ga0268266_10392100
1707 Ga0268266_11612031
1708 Ga0268266_12091799
1709 Ga0268265_10099262
1710 Ga0268265_10188787
1711 Ga0268265_10238970
1712 Ga0268265_10554591
1713 Ga0268265_10799106
1714 Ga0268264_10166142
1715 Ga0268264_10727311
1716 Ga0268264_11147903
1717 Ga0307517_10010277
1718 Ga0307517_10104578
1719 Ga0307517_10492427
1720 Ga0307515_10150736
1721 Ga0307511_10239206
1722 Ga0307509_10086316
1723 Ga0307508_10000012
1724 Ga0265314_10031058
1725 Ga0265314_10035228
1726 Ga0265342_10284576
1727 Ga0307516_10154357
1728 Ga0307516_10420812
1729 Ga0307516_10769411
1730 Ga0307405_10238070
1731 Ga0307405_11279955
1732 Ga0307413_10444453
1733 Ga0307410_10362065
1734 Ga0307406_10229561
1735 Ga0307406_10301802
1736 Ga0307407_10198331
1737 Ga0307409_100021182
1738 Ga0307416_101043225
1739 Ga0307416_103126773
1740 Ga0307414_10089285
1741 Ga0307411_10034698
1742 Ga0307411_10110407
1743 Ga0307415_100715251
1744 Ga0307415_100716156
1745 Ga0307510_10015377
1746 Ga0307510_10023362
1747 Ga0307510_10104600
1748 Ga0315911_1000021
1749 Ga0316215_1003776
1750 Ga0373938_0016509
1751 Ga0373926_0384712
1752 Ga0373928_0065155
1753 Ga0373929_0039749
1754 Ga0373934_0002532
1755 Ga0373934_0025001
1756 Ga0373940_0106914
1757 Ga0373923_0001264
1758 Ga0373932_0031046
1759 Ga0373936_0019784
1760 Ga0373936_0054802
1761 Ga0373936_0175662
1762 Ga0373953_0001769
1763 Ga0373953_0024250
1764 Ga0373953_0182785
1765 Ga0373954_0001440
1766 Ga0373954_0018385
1767 Ga0373954_0346040
1768 Ga0373956_0000376
1769 Ga0373957_0020605
1770 Ga0373943_0088008
1771 Ga0373943_0574848
1772 Ga0373946_0030372
1773 Ga0373946_0358732
1774 Ga0373955_0000325
1775 Ga0373924_0004645
1776 Ga0373924_0034842
1777 Ga0373931_0231505
1778 Ga0373927_0005689
1779 Ga0373927_0043271
1780 Ga0373927_0127315
1781 Ga0373927_0365934
1782 Ga0373927_0477611
1783 Ga0373933_0005894
1784 Ga0373933_0066591
1785 Ga0373947_0010663
1786 Ga0373947_0381697
1787 Ga0373937_0007855
1788 Ga0373937_0041689
1789 Ga0372808_043016
1790 Ga0373925_0240302
1791 Ga0373925_0491280
1792 Ga0395899_0038874
1793 Ga0395900_0001756
1794 Ga0395900_0285802
1795 Ga0395900_0496477
1796 Ga0395898_0023431
1797 Ga0395898_0175732
1798 Ga0395898_0517680
1799 Ga0395905_0131973
1800 Ga0395905_0212851
1801 Ga0395905_0219176
1802 Ga0395905_1069562
1803 Ga0395901_0237445
1804 Ga0451791_1154616
1805 Ga0451793_0680179
1806 Ga0451793_1462621
1807 Ga0451797_0708742
1808 Ga0451795_0001015
1809 Ga0451795_1592328
1810 Ga0451798_0463913
1811 Ga0451807_2142046
1812 Ga0451835_1074072
1813 Ga0451841_1265539
1814 Ga0451843_0523243
1815 Ga0451843_0551884
1816 Ga0451853_3149176
1817 Ga0439431_0108654
1818 Ga0439458_0005013
1819 Ga0466969_0150312
1820 Ga0466972_0099302
1821 Ga0466966_0001463
1822 Ga0466961_0000065
1823 Ga0466963_0235852
1824 Ga0466957_0197417
1825 Ga0466960_0009188
1826 Ga0466959_0000634
1827 Ga0466967_0267715
1828 Ga0466967_0412491
1829 Ga0495617_140332
1830 Ga0495617_150273
1831 Ga0495592_0000339
1832 Ga0495592_0083745
1833 Ga0495592_0127004
1834 Ga0495603_0043528
1835 Ga0495603_0050828
1836 Ga0495603_0052048
1837 Ga0495603_0115547
1838 Ga0495603_0118466
1839 Ga0495603_0141413
1840 Ga0495603_0190931
1841 Ga0495629_0001483
1842 Ga0495629_0006648
1843 Ga0495629_0222645
1844 Ga0495638_0022821
1845 Ga0495638_0077199
1846 Ga0495638_0117441
1847 Ga0495638_0188711
1848 Ga0495638_0224123
1849 Ga0495638_0290946
1850 Ga0495641_0151578
1851 Ga0495651_0015606
1852 Ga0495651_0017638
1853 Ga0495651_0112213
1854 Ga0495651_0278941
1855 Ga0495653_0001063
1856 Ga0495653_0281852
1857 Ga0495650_0071255
1858 Ga0495650_0149314
1859 Ga0495580_0317654
1860 Ga0495605_0238287
1861 Ga0495639_0080160
1862 Ga0495639_0103420
1863 Ga0495639_0159612
1864 Ga0495639_0175459
1865 Ga0495664_0221848
1866 Ga0495664_0234375
1867 Ga0495664_0484171
1868 Ga0495584_0238821
1869 Ga0495584_0293954
1870 Ga0495584_0526588
1871 Ga0495585_0084268
1872 Ga0495585_0354893
1873 Ga0495594_0210577
1874 Ga0495596_0180146
1875 Ga0495583_0136697
1876 Ga0495583_0141772
1877 Ga0495583_0288084
1878 Ga0495606_0011270
1879 Ga0495606_0174337
1880 Ga0495606_0184517
1881 Ga0495606_0209119
1882 Ga0495606_0343491
1883 Ga0495608_0002749
1884 Ga0495608_0015906
1885 Ga0495608_0016049
1886 Ga0495608_0165818
1887 Ga0495616_0182488
1888 Ga0495616_0196151
1889 Ga0495616_0412072
1890 Ga0495628_0010789
1891 Ga0495628_0464198
1892 Ga0495630_0364281
1893 Ga0495631_0049616
1894 Ga0495631_0120207
1895 Ga0495631_0324867
1896 Ga0495631_0434180
1897 Ga0495632_0027499
1898 Ga0495632_0042897
1899 Ga0495637_0024893
1900 Ga0495637_0310393
1901 Ga0495643_0145135
1902 Ga0495643_0534814
1903 Ga0495644_0180538
1904 Ga0495644_0287436
1905 Ga0495648_0252535
1906 Ga0495648_0264290
1907 Ga0495652_0005458
1908 Ga0495652_0022492
1909 Ga0495652_0025147
1910 Ga0495652_0026600
1911 Ga0495652_0171306
1912 Ga0495640_0008433
1913 Ga0495640_0022764
1914 Ga0495640_0052678
1915 Ga0495640_0145276
1916 Ga0495640_0217847
1917 Ga0495587_0010898
1918 Ga0495587_0027904
1919 Ga0495587_0093759
1920 Ga0495609_0109021
1921 Ga0495609_0141808
1922 Ga0495621_0391448
1923 Ga0495597_0214762
1924 Ga0495645_0028867
1925 Ga0495645_0052929
1926 Ga0495645_0060101
1927 Ga0495622_0010744
1928 Ga0495622_0105852
1929 Ga0495622_0136431
1930 Ga0495622_0289776
1931 Ga0495633_0542477
1932 Ga0495667_0011132
1933 Ga0495667_0021611
1934 Ga0495667_0062012
1935 Ga0495667_0236235
1936 Ga0495656_0006097
1937 Ga0495656_0109117
1938 Ga0495668_0251860
1939 Ga0495634_0002330
1940 Ga0495634_0496723
1941 Ga0495611_0021976
1942 Ga0495625_0071860
1943 Ga0495625_0674558
1944 Ga0495635_0000917
1945 Ga0495635_0002291
1946 Ga0495635_0039894
1947 Ga0495635_0301041
1948 Ga0495635_0465298
1949 Ga0495659_0121879
1950 Ga0495659_0314819
1951 Ga0495661_0100123
1952 Ga0495661_0419024
1953 Ga0495661_0474834
1954 Ga0495588_0080246
1955 Ga0495588_0131640
1956 Ga0495588_0259417
1957 Ga0495588_0358089
1958 Ga0495657_0003543
1959 Ga0495657_0026551
1960 Ga0495657_0101888
1961 Ga0495599_0001780
1962 Ga0495599_0170003
1963 Ga0495599_0270213
1964 Ga0495623_0020263
1965 Ga0495623_0024146
1966 Ga0495623_0058222
1967 Ga0495646_0025247
1968 Ga0495646_0057432
1969 Ga0495646_0294624
1970 Ga0495647_0056602
1971 Ga0495647_0185565
1972 Ga0495658_0119099
1973 Ga0495658_0241851
1974 Ga0495669_0039242
1975 Ga0495669_0057752
1976 Ga0495613_0012318
1977 Ga0495613_0027022
1978 Ga0495624_0011428
1979 Ga0495670_0029527
1980 Ga0495649_0191678
1981 Ga0495589_0161598
1982 Ga0495589_0585228
1983 Ga0495600_0002741
1984 Ga0495600_0017271
1985 Ga0495600_0019437
1986 Ga0495600_0186219
1987 Ga0495581_0040506
1988 Ga0495581_0320880
1989 Ga0495604_0002741
1990 Ga0495604_0007541
1991 Ga0495604_0007941
1992 Ga0495674_0007236
1993 Ga0495674_0077634
1994 Ga0495672_0014087
1995 Ga0495672_0343969
1996 Ga0495676_0014630
1997 Ga0495680_0001065
1998 Ga0495680_0001876
1999 Ga0495680_0069818
2000 Ga0495683_0349466
2001 Ga0495675_0000901
2002 Ga0495675_0045446
2003 Ga0495675_0440305
2004 Ga0495677_0175682
2005 Ga0495677_0366596
2006 Ga0495679_191402
2007 Ga0495673_0035084
2008 Ga0495673_0231847
2009 Ga0495673_0250519
2010 Ga0495681_0120855
2011 Ga0495684_0000721
2012 Ga0495684_0107418
2013 Ga0495686_0022393
2014 Ga0495686_0153380
2015 Ga0495686_0356459
2016 Ga0495686_0560971
2017 Ga0495686_0581437
2018 Ga0495686_0707315
2019 Ga0495593_0003019
2020 Ga0495602_0029916
2021 Ga0495602_0084544
2022 Ga0495602_0327374
2023 Ga0495602_0819925
2024 Ga0496100_0146278
2025 Ga0496100_0356976
2026 Ga0496100_1137280
2027 Ga0496101_0041950
2028 Ga0496101_0274945
2029 Ga0496101_0302264
2030 Ga0496101_0458362
2031 Ga0496101_0506190
2032 Ga0496101_0540478
2033 Ga0496102_0013853
2034 Ga0496102_0084587
2035 Ga0496102_0121931
2036 Ga0496102_0537020
2037 Ga0496102_0582110
2038 Ga0496102_0659030
2039 Ga0496102_0748320
2040 Ga0496102_0868540
2041 Ga0496102_1727856
2042 Ga0496103_0269023
2043 Ga0496104_0044882
2044 Ga0496104_0615082
2045 Ga0496104_0938932
2046 Ga0496104_1473436
2047 Ga0496105_0004094
2048 Ga0496105_0179579
2049 Ga0496105_0800765
2050 Ga0496105_1315901
2051 Ga0496106_0005142
2052 Ga0496106_0008314
2053 Ga0496106_0587477
2054 Ga0496106_0863908
2055 Ga0496107_0127229
2056 Ga0496107_0127812
2057 Ga0496107_0270960
2058 Ga0496108_0068160
2059 Ga0496108_0081616
2060 Ga0496108_0201916
2061 Ga0496109_0109385
2062 Ga0496109_0131055
2063 Ga0496109_0335316
2064 Ga0496109_0810869
2065 Ga0496109_1146448
2066 Ga0496110_0431333
2067 Ga0496110_0433957
2068 Ga0496110_0473800
2069 Ga0496110_0847219
2070 Ga0496111_0011220
2071 Ga0496111_0265190
2072 Ga0496112_0000035
2073 Ga0496112_0069768
2074 Ga0496112_0241886
2075 Ga0496112_0874933
2076 Ga0496112_0893636
2077 Ga0496112_1068731
2078 Ga0496113_0139537
2079 Ga0496113_0390894
2080 Ga0496113_0780975
2081 Ga0496114_0024694
2082 Ga0496114_0975256
2083 Ga0496115_0004493
2084 Ga0496116_0000965
2085 Ga0496117_0007318
2086 Ga0496117_0099761
2087 Ga0496117_0191671
2088 Ga0496118_0010242
2089 Ga0496118_0042994
2090 Ga0496118_0388921
2091 Ga0496118_0470174
2092 Ga0496119_0007397
2093 Ga0496119_0057355
2094 Ga0496119_0392004
2095 Ga0496120_0003365
2096 Ga0496120_0086329
2097 Ga0496120_0120536
2098 Ga0496120_0337294
2099 Ga0496121_0017077
2100 Ga0496121_0017170
2101 Ga0496121_0066269
2102 Ga0496121_0197139
2103 Ga0496121_0199297
2104 Ga0496121_0599127
2105 Ga0496122_0033148
2106 Ga0496122_0053150
2107 Ga0496122_0086448
2108 Ga0496123_0006724
2109 Ga0496123_0054779
2110 Ga0496123_0225183
2111 Ga0496124_0097640
2112 Ga0496124_0195416
2113 Ga0496124_0632778
2114 Ga0496125_0001630
2115 Ga0496125_0010481
2116 Ga0496125_0048905
2117 Ga0496125_0095013
2118 Ga0496126_0003472
2119 Ga0496126_0018186
2120 Ga0496126_0055280
2121 Ga0496126_0072841
2122 Ga0496126_0075361
2123 Ga0496126_0132356
2124 Ga0496126_0269499
2125 Ga0496126_0541267
2126 Ga0496126_0622125
2127 Ga0496126_0704132
2128 Ga0501031_0001791
2129 Ga0501031_0093802
2130 Ga0501032_0000762
2131 Ga0501033_0000136
2132 Ga0501033_0182365
2133 Ga0501034_0000251
2134 Ga0501036_0000036
2135 Ga0501037_0000867
2136 Ga0501037_0140096
2137 Ga0501037_0292848
2138 Ga0501038_0000428
2139 Ga0501038_0049185
2140 Ga0501039_0219064
2141 Ga0501040_0603753
2142 Ga0501041_0170512
2143 Ga0501042_0025922
2144 Ga0501043_0000165
2145 Ga0501043_0351129
2146 Ga0501046_0000839
2147 Ga0501046_0320277
2148 Ga0501047_0000340
2149 Ga0501047_1232007
2150 Ga0501048_0004509
2151 Ga0501048_0522818
2152 Ga0501067_0007630
2153 Ga0501067_0486136
2154 Ga0501068_0003807
2155 Ga0501068_0945089
2156 Ga0501069_0007026
2157 Ga0501070_0006502
2158 Ga0501070_0188830
2159 Ga0501072_0007916
2160 Ga0501072_0184865
2161 Ga0501073_0000037
2162 Ga0501073_0589554
2163 Ga0501074_0000167
2164 Ga0501074_0078814
2165 Ga0501076_0225653
2166 Ga0501076_0922858
2167 Ga0501079_0001057
2168 Ga0501080_0003259
2169 Ga0501080_0500984
2170 Ga0501080_0595495
2171 Ga0501083_0001812
2172 Ga0501035_0000142
2173 Ga0501035_0197984
2174 Ga0501044_0000414
2175 Ga0501044_0162165
2176 Ga0501044_0249253
2177 Ga0501045_0036286
2178 nmdc:mga03683_119060_c1
2179 nmdc:mga03683_144094_c1
2180 nmdc:mga03683_209617_c1
2181 nmdc:mga03683_415109_c1
2182 nmdc:mga03n38_303412_c1
2183 nmdc:mga03n38_3607_c1
2184 nmdc:mga03n38_544897_c1
2185 nmdc:mga00v17_15862_c1
2186 nmdc:mga00v17_254121_c1
2187 nmdc:mga00v17_33928_c1
2188 nmdc:mga00v17_43108_c1
2189 nmdc:mga0yw44_17100_c1
2190 nmdc:mga0yw44_18813_c1
2191 nmdc:mga0yw44_200253_c1
2192 nmdc:mga0yw44_251604_c1
2193 nmdc:mga0yw44_502646_c1
2194 nmdc:mga0yw44_9428_c1
2195 nmdc:mga0k408_120585_c1
2196 nmdc:mga0k408_214900_c1
2197 nmdc:mga0k408_233594_c1
2198 nmdc:mga0k408_302298_c1
2199 nmdc:mga06z11_114580_c1
2200 nmdc:mga06z11_214115_c1
2201 nmdc:mga06z11_25604_c1
2202 nmdc:mga06z11_35146_c1
2203 nmdc:mga06z11_84907_c1
2204 nmdc:mga06z11_93465_c1
2205 nmdc:mga04h51_113795_c1
2206 nmdc:mga04h51_22600_c1
2207 nmdc:mga07m45_26680_c1
2208 nmdc:mga07m45_280075_c1
2209 nmdc:mga07m45_495697_c1
2210 nmdc:mga07m45_532518_c1
2211 nmdc:mga07m45_74635_c1
2212 nmdc:mga05p37_211226_c1
2213 nmdc:mga05p37_548580_c1
2214 nmdc:mga0qj67_637820_c1
2215 nmdc:mga08y16_1055738_c1
2216 nmdc:mga08y16_586043_c1
2217 nmdc:mga0n895_783721_c1
2218 nmdc:mga0rr50_454903_c1
2219 nmdc:mga0a205_1100808_c1
2220 nmdc:mga0sz30_146398_c1
2221 nmdc:mga0sz30_166288_c1
2222 nmdc:mga0sz30_199165_c1
2223 nmdc:mga0sz30_28823_c1
2224 nmdc:mga0sz30_541858_c1
2225 nmdc:mga0sz30_93353_c1
2226 Ga0495601_0216694
2227 Ga0495612_0023692
2228 Ga0495612_0070558
2229 Ga0495612_0130920
2230 Ga0495612_0156811
2231 Ga0500610_0255682
2232 Ga0500635_0302216
2233 Ga0495595_0000828
2234 Ga0495595_0669471
2235 Ga0495619_0000912
2236 Ga0495619_0102327
2237 Ga0495619_0718543
2238 Ga0495619_0724918
2239 Ga0500578_0156825
2240 Ga0500578_0232065
2241 Ga0500643_000048
2242 Ga0500643_067043
2243 Ga0500581_116512
2244 Ga0500646_0010979
2245 Ga0500646_0017492
2246 Ga0500647_0241710
2247 Ga0500583_0144820
2248 Ga0500583_0177472
2249 Ga0500651_0037353
2250 Ga0500651_0239009
2251 Ga0500651_0575009
2252 Ga0500566_0000126
2253 Ga0500566_0004965
2254 Ga0500566_0029885
2255 Ga0500640_007080
2256 Ga0500641_0012056
2257 Ga0500554_007778
2258 Ga0500555_058884
2259 Ga0500556_0036495
2260 Ga0500557_000083
2261 Ga0500562_027531
2262 Ga0500562_049544
2263 Ga0500569_002207
2264 Ga0500569_020574
2265 Ga0500572_004191
2266 Ga0500591_250562
2267 Ga0500594_0169626
2268 Ga0500594_0219768
2269 Ga0500595_000333
2270 Ga0500595_005544
2271 Ga0500595_031641
2272 Ga0500595_092253
2273 Ga0500608_017998
2274 Ga0500608_197079
2275 Ga0500614_070743
2276 Ga0500614_132923
2277 Ga0500642_0056130
2278 Ga0500642_0141531
2279 Ga0500658_0016844
2280 Ga0500658_0293632
2281 Ga0500559_0003961
2282 Ga0500559_0327889
2283 Ga0500568_0066543
2284 Ga0500577_0049030
2285 Ga0500577_0080669
2286 Ga0500577_0242731
2287 Ga0500588_0051976
2288 Ga0500588_0204124
2289 Ga0500589_094668
2290 Ga0500589_166093
2291 Ga0500603_000178
2292 Ga0500603_000304
2293 Ga0500603_007176
2294 Ga0500604_0083099
2295 Ga0500604_0130236
2296 Ga0500616_0000033
2297 Ga0500619_149490
2298 Ga0500620_136482
2299 Ga0500622_0005267
2300 Ga0500622_0078202
2301 Ga0500622_0428744
2302 Ga0500630_002602
2303 Ga0500634_0076256
2304 Ga0500638_007384
2305 Ga0500638_109121
2306 Ga0500638_192821
2307 Ga0500639_000039
2308 Ga0500636_0015443
2309 Ga0500636_0032865
2310 Ga0500636_0103923
2311 Ga0500637_0000060
2312 Ga0500637_0003041
2313 Ga0500625_007842
2314 Ga0500645_041367
2315 Ga0500645_127898
2316 Ga0500609_001859
2317 Ga0500599_013831
2318 Ga0500601_008730
2319 Ga0501084_0041770
2320 Ga0500661_003670
2321 Ga0500661_032918
2322 Ga0501082_0002719
2323 2793077974
2324 2513659783
2325 2513704354
2326 2513857245
2327 2513918859
2328 2524468639
2329 2524533361
2330 2603860086
2331 2617347779
2332 2671119356
2333 2723842256
2334 2793061565
2335 2824775740
2336 2857513315
2337 2874620221
2338 2876815709
2339 2879106653
2340 2879117031
2341 2885380645
2342 2889036372
2343 2906643419
2344 2906666611
2345 2908746712
2346 2919078957
2347 2922389352
2348 2932800637
2349 2932808368
2350 2932813326
2351 2932820023
2352 2935687223
2353 2935716911
2354 2935722964
2355 2935734521
2356 2935744688
2357 2935753189
2358 2935767593
2359 2935770188
2360 2935777782
2361 2935786758
2362 2935794812
2363 2935883475
2364 2940559102
2365 3005475656
2366 3005601851
2367 3005717589
2368 3005724638
2369 8006936991
2370 8006966343
2371 8006976958
2372 8006993169
2373 8016526945
2374 8016545239
2375 8016556849
2376 8016565202
2377 8016570318
2378 8016582865
2379 8016602845
2380 8016605715
2381 8016617622
2382 8016623948
2383 8016634916
2384 8019531848
2385 8019539683
2386 8019550967
2387 8056678194
2388 8056975361

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11578

DUF3237

Protein of unknown function (DUF3237)

37

185

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c5o-assembly1.cif.gz_D crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9614 3 153
3c5o-assembly1.cif.gz_A crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9583 3 153
3c5o-assembly1.cif.gz_C crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9553 3 153
3c5o-assembly1.cif.gz_A crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9521 3 153
3c5o-assembly1.cif.gz_D crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9491 3 153
ID Description Score Start End Superfamily
3c5oC00 Mainly Beta;Beta Barrel;Porin; 0.9548 3 153 2.40.160.20
3c5oC00 Mainly Beta;Beta Barrel;Porin; 0.9486 3 153 2.40.160.20
3g7gG00 Mainly Beta;Beta Barrel;Porin; 0.9439 7 153 2.40.160.20
3g7gG00 Mainly Beta;Beta Barrel;Porin; 0.9314 7 153 2.40.160.20
4puxA00 Mainly Beta;Beta Barrel;Porin; 0.8623 3 153 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A1D3TUE5-F1-model_v4 Uncharacterized protein 0.9761 51 151
AF-A0A354V2T9-F1-model_v4 UPF0311 protein DDZ81_08495 0.975 4 153
AF-A0A534X2K0-F1-model_v4 DUF3237 domain-containing protein 0.9746 17 90
AF-A0A268AF19-F1-model_v4 UPF0311 protein CHH64_03120 0.9719 1 153
AF-A0A8A2VAF6-F1-model_v4 DUF3237 domain-containing protein 0.9695 5 153

Map