F491398

General Info

Members Datasets Scaffolds Average Seq Length
1187 322 2374 109

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100153286|Ga0070698_1001532863
Length 134
Sequence MRPRRKSGGVFCCTGRRKPAPTAGIEMDFSKLDGLIPAVVQDHVSGEVLMVGFMNPEAWDVTRRTGYVTFFSRTRNTLWTKGETSGNRLAVRDVLIDCDEDTLLVKAERLGDGNVCHTGERTCFFQRAEGVTIP

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
200 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
201 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
202 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
203 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
210 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
217 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
218 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
224 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
225 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
226 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
227 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
228 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
229 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
230 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
231 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
232 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
233 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
234 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
235 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
236 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
237 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
238 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
239 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
240 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
241 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
252 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
253 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
254 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
255 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
259 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
260 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
273 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
282 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
302 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
303 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
304 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
305 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.67
Rhizosphere 99.07
Stem 0
Stem Tuber 0
Unclassified 11.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100153286 3300005471 Bacteria 2251
2 JGI24746J21847_1003852 3300001977 Bacteria 2370
3 JGI24033J26618_1071756 3300002155 Bacteria 521
4 JGI25406J46586_10000210 3300003203 Bacteria 25956
5 JGI25406J46586_10001441 3300003203 Bacteria 11218
6 Ga0065714_10393758 3300005288 Bacteria 596
7 Ga0065704_10075134 3300005289 Bacteria 5772
8 Ga0065704_10120579 3300005289 Bacteria 1780
9 Ga0065704_10213091 3300005289 Unclassified 1101
10 Ga0065704_10254809 3300005289 Bacteria 980
11 Ga0065704_10319194 3300005289 Bacteria 854
12 Ga0065712_10071657 3300005290 Bacteria 5127
13 Ga0065712_10071874 3300005290 Bacteria 5005
14 Ga0065712_10169372 3300005290 Bacteria 1253
15 Ga0065712_10174808 3300005290 Bacteria 1223
16 Ga0065712_10251681 3300005290 Unclassified 958
17 Ga0065712_10538648 3300005290 Bacteria 625
18 Ga0065712_10664258 3300005290 Bacteria 529
19 Ga0065715_10024922 3300005293 Bacteria 1322
20 Ga0065715_10121975 3300005293 Bacteria 2216
21 Ga0065715_10143961 3300005293 Bacteria 1814
22 Ga0065715_10163838 3300005293 Bacteria 1604
23 Ga0065715_10182550 3300005293 Bacteria 1466
24 Ga0065715_10197291 3300005293 Bacteria 1380
25 Ga0065715_10725975 3300005293 Bacteria 641
26 Ga0065707_10001927 3300005295 Bacteria 6902
27 Ga0065707_10050056 3300005295 Unclassified 1030
28 Ga0065707_10084472 3300005295 Bacteria 7165
29 Ga0065707_10094961 3300005295 Bacteria 3431
30 Ga0065707_10096043 3300005295 Bacteria 3303
31 Ga0065707_10132434 3300005295 Bacteria 1897
32 Ga0065707_10388273 3300005295 Bacteria 868
33 Ga0065707_10652118 3300005295 Bacteria 662
34 Ga0070658_10059977 3300005327 Bacteria 3098
35 Ga0070676_10016430 3300005328 Bacteria 4092
36 Ga0070676_10069242 3300005328 Bacteria 2114
37 Ga0070676_10109584 3300005328 Bacteria 1718
38 Ga0070676_10780116 3300005328 Bacteria 704
39 Ga0070676_10825837 3300005328 Bacteria 686
40 Ga0070683_100047386 3300005329 Bacteria 3971
41 Ga0070690_100002748 3300005330 Bacteria 9497
42 Ga0070690_100026065 3300005330 Bacteria 3603
43 Ga0070690_100029220 3300005330 Bacteria 3418
44 Ga0070690_100549049 3300005330 Bacteria 871
45 Ga0070690_101046345 3300005330 Unclassified 645
46 Ga0070670_100009691 3300005331 Bacteria 8222
47 Ga0070670_100022639 3300005331 Bacteria 5408
48 Ga0070670_100030264 3300005331 Bacteria 4662
49 Ga0070670_100176869 3300005331 Bacteria 1852
50 Ga0070670_100687108 3300005331 Bacteria 920
51 Ga0070670_100797971 3300005331 Bacteria 852
52 Ga0070670_101344252 3300005331 Bacteria 654
53 Ga0070677_10000945 3300005333 Bacteria 9414
54 Ga0070677_10027340 3300005333 Unclassified 2147
55 Ga0070677_10046985 3300005333 Bacteria 1729
56 Ga0070677_10050838 3300005333 Bacteria 1675
57 Ga0070677_10058752 3300005333 Bacteria 1580
58 Ga0070677_10088916 3300005333 Bacteria 1339
59 Ga0070677_10142668 3300005333 Bacteria 1106
60 Ga0070677_10159545 3300005333 Bacteria 1057
61 Ga0070677_10734172 3300005333 Bacteria 559
62 Ga0068869_100010054 3300005334 Bacteria 6154
63 Ga0068869_100095036 3300005334 Bacteria 2248
64 Ga0068869_100123913 3300005334 Unclassified 1980
65 Ga0068869_100195829 3300005334 Unclassified 1591
66 Ga0068869_100223081 3300005334 Bacteria 1495
67 Ga0068869_100260548 3300005334 Bacteria 1388
68 Ga0068869_100457707 3300005334 Unclassified 1058
69 Ga0068869_100517233 3300005334 Bacteria 998
70 Ga0068869_100948271 3300005334 Bacteria 747
71 Ga0070666_10003269 3300005335 Bacteria 9841
72 Ga0070666_10178717 3300005335 Bacteria 1488
73 Ga0070666_10755938 3300005335 Bacteria 715
74 Ga0070680_100075424 3300005336 Bacteria 2776
75 Ga0070680_100145383 3300005336 Bacteria 1989
76 Ga0070680_100291612 3300005336 Bacteria 1383
77 Ga0070680_100326479 3300005336 Bacteria 1303
78 Ga0070680_100573539 3300005336 Bacteria 968
79 Ga0070680_100936502 3300005336 Unclassified 748
80 Ga0068868_100021467 3300005338 Bacteria 4861
81 Ga0068868_100087568 3300005338 Bacteria 2504
82 Ga0068868_100333185 3300005338 Bacteria 1296
83 Ga0070689_100004279 3300005340 Bacteria 9623
84 Ga0070689_100005732 3300005340 Bacteria 8517
85 Ga0070689_100033784 3300005340 Bacteria 3899
86 Ga0070689_100070837 3300005340 Bacteria 2723
87 Ga0070689_100076528 3300005340 Bacteria 2621
88 Ga0070689_100157928 3300005340 Bacteria 1832
89 Ga0070689_100234086 3300005340 Bacteria 1511
90 Ga0070689_101244848 3300005340 Bacteria 669
91 Ga0070689_101879171 3300005340 Bacteria 547
92 Ga0070691_10028106 3300005341 Bacteria 2626
93 Ga0070691_10279703 3300005341 Unclassified 905
94 Ga0070691_10460254 3300005341 Unclassified 728
95 Ga0070691_10674880 3300005341 Bacteria 618
96 Ga0070687_100001643 3300005343 Bacteria 7985
97 Ga0070687_100069454 3300005343 Bacteria 1887
98 Ga0070687_100114372 3300005343 Bacteria 1533
99 Ga0070687_100132079 3300005343 Bacteria 1443
100 Ga0070687_100516688 3300005343 Bacteria 807
101 Ga0070687_101001505 3300005343 Unclassified 606
102 Ga0070661_100151681 3300005344 Bacteria 1752
103 Ga0070661_100211714 3300005344 Unclassified 1484
104 Ga0070661_100231237 3300005344 Bacteria 1421
105 Ga0070661_100309796 3300005344 Bacteria 1231
106 Ga0070661_100411220 3300005344 Bacteria 1071
107 Ga0070661_100436735 3300005344 Bacteria 1040
108 Ga0070661_100621200 3300005344 Unclassified 875
109 Ga0070692_10418776 3300005345 Bacteria 850
110 Ga0070692_11161023 3300005345 Unclassified 548
111 Ga0070668_100053903 3300005347 Bacteria 3101
112 Ga0070668_100496510 3300005347 Bacteria 1056
113 Ga0070668_101196026 3300005347 Bacteria 689
114 Ga0070669_100025602 3300005353 Bacteria 4238
115 Ga0070669_100051015 3300005353 Bacteria 3023
116 Ga0070669_100066848 3300005353 Bacteria 2650
117 Ga0070669_100070596 3300005353 Bacteria 2582
118 Ga0070669_100257436 3300005353 Bacteria 1391
119 Ga0070669_100444193 3300005353 Bacteria 1068
120 Ga0070669_100449252 3300005353 Bacteria 1062
121 Ga0070669_100487768 3300005353 Bacteria 1021
122 Ga0070675_100000179 3300005354 Bacteria 39545
123 Ga0070675_100000385 3300005354 Bacteria 29879
124 Ga0070675_100004051 3300005354 Bacteria 11124
125 Ga0070675_100010384 3300005354 Bacteria 7273
126 Ga0070675_100023997 3300005354 Bacteria 4881
127 Ga0070675_100037355 3300005354 Bacteria 3956
128 Ga0070675_100051572 3300005354 Bacteria 3381
129 Ga0070675_100053204 3300005354 Bacteria 3329
130 Ga0070675_100060562 3300005354 Bacteria 3125
131 Ga0070675_100157409 3300005354 Bacteria 1951
132 Ga0070675_100201688 3300005354 Bacteria 1727
133 Ga0070675_100436644 3300005354 Bacteria 1172
134 Ga0070675_100487205 3300005354 Bacteria 1110
135 Ga0070675_100488178 3300005354 Unclassified 1109
136 Ga0070675_100875418 3300005354 Archaea 823
137 Ga0070675_101057096 3300005354 Bacteria 746
138 Ga0070671_100007197 3300005355 Bacteria 8897
139 Ga0070671_100007699 3300005355 Bacteria 8608
140 Ga0070671_100164277 3300005355 Unclassified 1877
141 Ga0070671_100303372 3300005355 Bacteria 1360
142 Ga0070671_100627059 3300005355 Bacteria 930
143 Ga0070671_101468959 3300005355 Bacteria 603
144 Ga0070674_100050496 3300005356 Bacteria 2863
145 Ga0070674_100119931 3300005356 Bacteria 1946
146 Ga0070674_100201901 3300005356 Bacteria 1536
147 Ga0070674_100234307 3300005356 Bacteria 1434
148 Ga0070674_100285675 3300005356 Unclassified 1309
149 Ga0070674_100719484 3300005356 Bacteria 855
150 Ga0070674_100789825 3300005356 Bacteria 819
151 Ga0070673_100008003 3300005364 Bacteria 7002
152 Ga0070673_100030705 3300005364 Bacteria 4026
153 Ga0070673_100044745 3300005364 Bacteria 3429
154 Ga0070673_100067492 3300005364 Bacteria 2860
155 Ga0070673_100165363 3300005364 Unclassified 1884
156 Ga0070673_100166927 3300005364 Bacteria 1876
157 Ga0070673_100209842 3300005364 Bacteria 1681
158 Ga0070673_100281825 3300005364 Bacteria 1458
159 Ga0070673_100740375 3300005364 Bacteria 905
160 Ga0070673_101031490 3300005364 Bacteria 767
161 Ga0070688_100002830 3300005365 Bacteria 8834
162 Ga0070688_100004619 3300005365 Bacteria 7189
163 Ga0070688_100006025 3300005365 Bacteria 6433
164 Ga0070688_100034885 3300005365 Bacteria 3051
165 Ga0070688_100216154 3300005365 Unclassified 1349
166 Ga0070688_100557797 3300005365 Bacteria 872
167 Ga0070688_100654188 3300005365 Bacteria 810
168 Ga0070659_100008173 3300005366 Bacteria 7632
169 Ga0070659_100273881 3300005366 Bacteria 1403
170 Ga0070659_100408608 3300005366 Unclassified 1147
171 Ga0070659_100713161 3300005366 Bacteria 868
172 Ga0070659_100801913 3300005366 Bacteria 819
173 Ga0070659_101108557 3300005366 Bacteria 698
174 Ga0070659_102143706 3300005366 Bacteria 503
175 Ga0070667_100049281 3300005367 Bacteria 3547
176 Ga0070667_100130901 3300005367 Bacteria 2190
177 Ga0070667_100229863 3300005367 Bacteria 1653
178 Ga0070667_100661840 3300005367 Bacteria 964
179 Ga0070667_101165033 3300005367 Bacteria 721
180 Ga0070667_101487619 3300005367 Unclassified 636
181 Ga0070703_10164398 3300005406 Bacteria 845
182 Ga0070713_100074560 3300005436 Bacteria 2875
183 Ga0070701_10008685 3300005438 Bacteria 4410
184 Ga0070701_10016079 3300005438 Bacteria 3470
185 Ga0070701_10052410 3300005438 Bacteria 2119
186 Ga0070701_10111894 3300005438 Bacteria 1526
187 Ga0070701_10191086 3300005438 Bacteria 1205
188 Ga0070701_10225889 3300005438 Unclassified 1119
189 Ga0070701_10924414 3300005438 Bacteria 604
190 Ga0070705_100000746 3300005440 Bacteria 18450
191 Ga0070705_100060904 3300005440 Bacteria 2241
192 Ga0070700_100005562 3300005441 Bacteria 6679
193 Ga0070700_100098767 3300005441 Bacteria 1919
194 Ga0070700_100236231 3300005441 Bacteria 1304
195 Ga0070700_100258876 3300005441 Bacteria 1252
196 Ga0070700_100354676 3300005441 Bacteria 1089
197 Ga0070700_100521196 3300005441 Bacteria 918
198 Ga0070700_101359183 3300005441 Bacteria 599
199 Ga0070700_102016335 3300005441 Bacteria 501
200 Ga0070694_100000370 3300005444 Bacteria 24146
201 Ga0070694_100007196 3300005444 Bacteria 6775
202 Ga0070694_100112507 3300005444 Bacteria 1941
203 Ga0070694_100129251 3300005444 Bacteria 1823
204 Ga0070694_100166238 3300005444 Bacteria 1622
205 Ga0070694_100309589 3300005444 Bacteria 1212
206 Ga0070694_100471367 3300005444 Bacteria 995
207 Ga0070694_100553024 3300005444 Bacteria 922
208 Ga0070694_100559358 3300005444 Bacteria 917
209 Ga0070694_101192957 3300005444 Bacteria 638
210 Ga0070708_100086208 3300005445 Bacteria 2852
211 Ga0070708_101000895 3300005445 Bacteria 784
212 Ga0070708_101410725 3300005445 Bacteria 650
213 Ga0070663_100078390 3300005455 Unclassified 2421
214 Ga0070663_101130740 3300005455 Bacteria 686
215 Ga0070663_102181633 3300005455 Bacteria 500
216 Ga0070678_100142212 3300005456 Bacteria 1921
217 Ga0070678_100175098 3300005456 Bacteria 1751
218 Ga0070678_100323591 3300005456 Bacteria 1317
219 Ga0070678_100533180 3300005456 Bacteria 1040
220 Ga0070678_101112909 3300005456 Unclassified 730
221 Ga0070678_101396278 3300005456 Bacteria 654
222 Ga0070662_100035902 3300005457 Bacteria 3503
223 Ga0070662_100072366 3300005457 Unclassified 2545
224 Ga0070662_100807188 3300005457 Bacteria 798
225 Ga0070662_101138027 3300005457 Bacteria 670
226 Ga0070662_101863449 3300005457 Unclassified 520
227 Ga0070681_10212602 3300005458 Bacteria 1850
228 Ga0070681_11296078 3300005458 Bacteria 651
229 Ga0068867_100008687 3300005459 Bacteria 7170
230 Ga0068867_100015612 3300005459 Bacteria 5389
231 Ga0068867_100106852 3300005459 Bacteria 2145
232 Ga0068867_100231612 3300005459 Bacteria 1493
233 Ga0068867_100289238 3300005459 Unclassified 1347
234 Ga0068867_101024970 3300005459 Bacteria 749
235 Ga0068867_101047955 3300005459 Bacteria 742
236 Ga0068867_102231695 3300005459 Bacteria 520
237 Ga0070685_10025976 3300005466 Bacteria 3226
238 Ga0070685_10026560 3300005466 Bacteria 3191
239 Ga0070685_10094780 3300005466 Bacteria 1813
240 Ga0070685_11078461 3300005466 Bacteria 606
241 Ga0070706_101051151 3300005467 Bacteria 750
242 Ga0070706_101429669 3300005467 Unclassified 633
243 Ga0070706_101795351 3300005467 Bacteria 557
244 Ga0070707_100016751 3300005468 Bacteria 6879
245 Ga0070707_100093026 3300005468 Bacteria 2919
246 Ga0070707_100362175 3300005468 Bacteria 1409
247 Ga0070707_100685081 3300005468 Bacteria 988
248 Ga0070707_100971031 3300005468 Unclassified 815
249 Ga0070707_101374185 3300005468 Bacteria 673
250 Ga0070698_100075821 3300005471 Bacteria 3367
251 Ga0070698_100370610 3300005471 Bacteria 1364
252 Ga0070698_100498419 3300005471 Bacteria 1156
253 Ga0070698_101453586 3300005471 Bacteria 637
254 Ga0070699_100006431 3300005518 Bacteria 10232
255 Ga0070699_100018848 3300005518 Bacteria 5930
256 Ga0070699_100019972 3300005518 Bacteria 5774
257 Ga0070699_100041847 3300005518 Bacteria 3964
258 Ga0070699_100422881 3300005518 Bacteria 1206
259 Ga0070699_100596236 3300005518 Bacteria 1007
260 Ga0070699_101210602 3300005518 Bacteria 693
261 Ga0070699_101300620 3300005518 Bacteria 667
262 Ga0070679_101221835 3300005530 Bacteria 697
263 Ga0070684_100193534 3300005535 Bacteria 1851
264 Ga0070684_101391172 3300005535 Bacteria 661
265 Ga0070697_101626636 3300005536 Bacteria 578
266 Ga0068853_100159623 3300005539 Bacteria 2034
267 Ga0070672_100008155 3300005543 Bacteria 7160
268 Ga0070672_100008378 3300005543 Bacteria 7067
269 Ga0070672_100012183 3300005543 Bacteria 6024
270 Ga0070672_100023729 3300005543 Bacteria 4525
271 Ga0070672_100043955 3300005543 Bacteria 3449
272 Ga0070672_100154602 3300005543 Bacteria 1899
273 Ga0070672_100164507 3300005543 Bacteria 1842
274 Ga0070672_100216203 3300005543 Unclassified 1606
275 Ga0070672_100499597 3300005543 Bacteria 1052
276 Ga0070672_100582286 3300005543 Bacteria 974
277 Ga0070686_100007258 3300005544 Bacteria 6175
278 Ga0070686_100020856 3300005544 Bacteria 3884
279 Ga0070686_100073297 3300005544 Bacteria 2248
280 Ga0070686_101549218 3300005544 Bacteria 560
281 Ga0070695_100004458 3300005545 Bacteria 8224
282 Ga0070695_100047225 3300005545 Bacteria 2750
283 Ga0070695_100191602 3300005545 Bacteria 1455
284 Ga0070695_100199257 3300005545 Bacteria 1430
285 Ga0070696_100000965 3300005546 Bacteria 18625
286 Ga0070696_100007198 3300005546 Bacteria 7431
287 Ga0070696_100013145 3300005546 Bacteria 5553
288 Ga0070696_100073884 3300005546 Bacteria 2403
289 Ga0070693_100164882 3300005547 Bacteria 1414
290 Ga0070693_100967409 3300005547 Unclassified 642
291 Ga0070665_100024814 3300005548 Bacteria 6040
292 Ga0070665_101091339 3300005548 Bacteria 810
293 Ga0070665_101430664 3300005548 Bacteria 700
294 Ga0070704_100000234 3300005549 Bacteria 23608
295 Ga0070704_100047372 3300005549 Bacteria 3004
296 Ga0070704_100110013 3300005549 Bacteria 2095
297 Ga0070704_100190033 3300005549 Bacteria 1650
298 Ga0070704_100489210 3300005549 Bacteria 1066
299 Ga0070704_100630511 3300005549 Bacteria 945
300 Ga0070704_100733234 3300005549 Bacteria 879
301 Ga0070704_101057849 3300005549 Unclassified 736
302 Ga0070664_100001259 3300005564 Bacteria 20292
303 Ga0070664_100007187 3300005564 Bacteria 8978
304 Ga0070664_100086237 3300005564 Bacteria 2713
305 Ga0070664_100088020 3300005564 Bacteria 2685
306 Ga0070664_100253191 3300005564 Bacteria 1583
307 Ga0070664_100322568 3300005564 Bacteria 1400
308 Ga0070664_100369897 3300005564 Unclassified 1307
309 Ga0070664_100992649 3300005564 Unclassified 789
310 Ga0068857_100045272 3300005577 Unclassified 3903
311 Ga0068857_100054093 3300005577 Bacteria 3562
312 Ga0068857_100565815 3300005577 Bacteria 1072
313 Ga0068857_100658375 3300005577 Bacteria 993
314 Ga0068857_100727832 3300005577 Bacteria 944
315 Ga0068857_101532407 3300005577 Unclassified 650
316 Ga0068857_101548127 3300005577 Unclassified 647
317 Ga0068854_100186243 3300005578 Bacteria 1624
318 Ga0068854_100338798 3300005578 Unclassified 1228
319 Ga0068854_101253736 3300005578 Bacteria 666
320 Ga0068856_101410343 3300005614 Bacteria 711
321 Ga0070702_100090494 3300005615 Bacteria 1855
322 Ga0070702_100160807 3300005615 Bacteria 1452
323 Ga0070702_100473581 3300005615 Bacteria 914
324 Ga0070702_100685826 3300005615 Bacteria 779
325 Ga0070702_101814533 3300005615 Bacteria 510
326 Ga0068852_100017699 3300005616 Bacteria 5597
327 Ga0068859_100001202 3300005617 Bacteria 26419
328 Ga0068859_100015638 3300005617 Bacteria 7625
329 Ga0068859_100029485 3300005617 Bacteria 5505
330 Ga0068859_100050949 3300005617 Bacteria 4160
331 Ga0068859_100067434 3300005617 Bacteria 3612
332 Ga0068859_100119903 3300005617 Bacteria 2697
333 Ga0068859_100364602 3300005617 Bacteria 1540
334 Ga0068859_100443355 3300005617 Bacteria 1394
335 Ga0068859_102500394 3300005617 Bacteria 569
336 Ga0068859_102856938 3300005617 Bacteria 529
337 Ga0068864_100021615 3300005618 Bacteria 5388
338 Ga0068864_100054988 3300005618 Bacteria 3436
339 Ga0068864_100070924 3300005618 Bacteria 3033
340 Ga0068864_100087506 3300005618 Bacteria 2743
341 Ga0068864_100116922 3300005618 Bacteria 2380
342 Ga0068864_101309808 3300005618 Bacteria 725
343 Ga0068864_101370505 3300005618 Bacteria 709
344 Ga0068864_102702887 3300005618 Unclassified 502
345 Ga0068866_11204490 3300005718 Bacteria 547
346 Ga0068861_100018811 3300005719 Bacteria 4925
347 Ga0068861_100022665 3300005719 Bacteria 4527
348 Ga0068861_100113756 3300005719 Bacteria 2172
349 Ga0068861_100398612 3300005719 Bacteria 1220
350 Ga0068861_100464780 3300005719 Bacteria 1136
351 Ga0068861_100537909 3300005719 Bacteria 1062
352 Ga0068861_101067006 3300005719 Bacteria 775
353 Ga0068851_10168041 3300005834 Bacteria 1209
354 Ga0068870_10001437 3300005840 Bacteria 9631
355 Ga0068870_10016054 3300005840 Bacteria 3569
356 Ga0068870_10054295 3300005840 Bacteria 2130
357 Ga0068870_10055887 3300005840 Bacteria 2105
358 Ga0068870_10066674 3300005840 Bacteria 1951
359 Ga0068870_10228889 3300005840 Bacteria 1142
360 Ga0068870_10283738 3300005840 Bacteria 1039
361 Ga0068870_10290775 3300005840 Bacteria 1028
362 Ga0068870_10348386 3300005840 Bacteria 950
363 Ga0068870_10479064 3300005840 Bacteria 826
364 Ga0068863_100034099 3300005841 Bacteria 4849
365 Ga0068863_100113132 3300005841 Bacteria 2585
366 Ga0068863_100233139 3300005841 Bacteria 1776
367 Ga0068863_100901242 3300005841 Bacteria 884
368 Ga0068863_102144659 3300005841 Unclassified 569
369 Ga0068858_100037048 3300005842 Bacteria 4521
370 Ga0068858_100080275 3300005842 Bacteria 3031
371 Ga0068858_100124976 3300005842 Bacteria 2407
372 Ga0068858_100164441 3300005842 Bacteria 2090
373 Ga0068858_100428248 3300005842 Bacteria 1273
374 Ga0068858_100827232 3300005842 Bacteria 904
375 Ga0068860_100024633 3300005843 Bacteria 5810
376 Ga0068860_100052886 3300005843 Bacteria 3862
377 Ga0068860_100065930 3300005843 Bacteria 3438
378 Ga0068860_101517368 3300005843 Bacteria 692
379 Ga0068862_100000554 3300005844 Bacteria 39072
380 Ga0068862_100001194 3300005844 Bacteria 24496
381 Ga0068862_100094438 3300005844 Bacteria 2609
382 Ga0068862_100095088 3300005844 Bacteria 2599
383 Ga0068862_100114884 3300005844 Bacteria 2367
384 Ga0068862_100123011 3300005844 Bacteria 2288
385 Ga0068862_100861258 3300005844 Bacteria 889
386 Ga0068862_100862309 3300005844 Bacteria 888
387 Ga0068862_101332248 3300005844 Bacteria 720
388 Ga0081455_10064715 3300005937 Bacteria 3060
389 Ga0081455_10823628 3300005937 Bacteria 581
390 Ga0081539_10000093 3300005985 Bacteria 207314
391 Ga0081539_10000535 3300005985 Bacteria 78890
392 Ga0081539_10004525 3300005985 Bacteria 15269
393 Ga0081539_10045059 3300005985 Bacteria 2540
394 Ga0070717_10956523 3300006028 Bacteria 780
395 Ga0075432_10137073 3300006058 Bacteria 931
396 Ga0075432_10179469 3300006058 Bacteria 828
397 Ga0070712_100091699 3300006175 Bacteria 2227
398 Ga0075427_10026889 3300006194 Unclassified 933
399 Ga0075427_10052400 3300006194 Bacteria 704
400 Ga0097621_100132548 3300006237 Bacteria 2122
401 Ga0097621_100262723 3300006237 Bacteria 1515
402 Ga0097621_100402451 3300006237 Bacteria 1226
403 Ga0097621_100451932 3300006237 Bacteria 1158
404 Ga0068871_100065745 3300006358 Bacteria 2971
405 Ga0068871_100469436 3300006358 Bacteria 1130
406 Ga0068871_101934868 3300006358 Bacteria 561
407 Ga0068871_102085786 3300006358 Bacteria 540
408 Ga0068871_102166447 3300006358 Bacteria 530
409 Ga0075428_100001298 3300006844 Bacteria 26510
410 Ga0075428_100005299 3300006844 Bacteria 14336
411 Ga0075428_100134637 3300006844 Bacteria 2687
412 Ga0075428_100147078 3300006844 Bacteria 2561
413 Ga0075428_100332889 3300006844 Bacteria 1631
414 Ga0075428_100367084 3300006844 Bacteria 1544
415 Ga0075428_100401314 3300006844 Bacteria 1469
416 Ga0075428_101784743 3300006844 Bacteria 641
417 Ga0075430_100056948 3300006846 Bacteria 3287
418 Ga0075430_100179647 3300006846 Bacteria 1760
419 Ga0075430_100261664 3300006846 Bacteria 1433
420 Ga0075430_100381187 3300006846 Bacteria 1164
421 Ga0075430_101019980 3300006846 Unclassified 682
422 Ga0075430_101611475 3300006846 Bacteria 533
423 Ga0075430_101689050 3300006846 Bacteria 520
424 Ga0075431_100026579 3300006847 Bacteria 5938
425 Ga0075431_100101258 3300006847 Bacteria 2972
426 Ga0075431_100299102 3300006847 Bacteria 1626
427 Ga0075431_100865085 3300006847 Unclassified 875
428 Ga0075433_10002098 3300006852 Bacteria 15096
429 Ga0075433_10005810 3300006852 Bacteria 9712
430 Ga0075433_10201654 3300006852 Unclassified 1769
431 Ga0075433_10213870 3300006852 Bacteria 1713
432 Ga0075433_10299576 3300006852 Bacteria 1424
433 Ga0075434_100007857 3300006871 Bacteria 9880
434 Ga0075434_100086029 3300006871 Bacteria 3143
435 Ga0075434_100118602 3300006871 Unclassified 2660
436 Ga0075434_100233564 3300006871 Bacteria 1859
437 Ga0075434_100907146 3300006871 Bacteria 896
438 Ga0075429_100017823 3300006880 Bacteria 6140
439 Ga0075429_100042246 3300006880 Bacteria 3968
440 Ga0075429_100048682 3300006880 Bacteria 3685
441 Ga0075429_100232053 3300006880 Bacteria 1616
442 Ga0075429_100487841 3300006880 Bacteria 1080
443 Ga0075429_100964471 3300006880 Bacteria 746
444 Ga0075429_101571367 3300006880 Bacteria 572
445 Ga0068865_100016987 3300006881 Bacteria 4671
446 Ga0068865_100285302 3300006881 Bacteria 1316
447 Ga0068865_100297527 3300006881 Bacteria 1290
448 Ga0075436_100806740 3300006914 Bacteria 699
449 Ga0075436_100944624 3300006914 Bacteria 646
450 Ga0097620_100001202 3300006931 Bacteria 26419
451 Ga0097620_100015638 3300006931 Bacteria 7625
452 Ga0097620_100029484 3300006931 Bacteria 5505
453 Ga0097620_100050950 3300006931 Bacteria 4160
454 Ga0097620_100067434 3300006931 Bacteria 3612
455 Ga0097620_100119898 3300006931 Bacteria 2697
456 Ga0097620_100364604 3300006931 Bacteria 1540
457 Ga0097620_100443324 3300006931 Bacteria 1394
458 Ga0097620_102500161 3300006931 Bacteria 569
459 Ga0097620_102857023 3300006931 Bacteria 529
460 Ga0075435_100005103 3300007076 Bacteria 9123
461 Ga0075435_100037651 3300007076 Bacteria 3853
462 Ga0075435_100038469 3300007076 Bacteria 3814
463 Ga0075435_100040007 3300007076 Bacteria 3743
464 Ga0075435_100202184 3300007076 Bacteria 1684
465 Ga0075435_100229848 3300007076 Bacteria 1576
466 Ga0075435_101006198 3300007076 Bacteria 728
467 Ga0105244_10192167 3300009036 Bacteria 965
468 Ga0105240_10053659 3300009093 Bacteria 5059
469 Ga0111539_10000937 3300009094 Bacteria 38215
470 Ga0111539_10007215 3300009094 Bacteria 14247
471 Ga0111539_10007947 3300009094 Bacteria 13526
472 Ga0111539_10011336 3300009094 Bacteria 11198
473 Ga0111539_10018172 3300009094 Bacteria 8709
474 Ga0111539_10025633 3300009094 Bacteria 7226
475 Ga0111539_10084703 3300009094 Bacteria 3726
476 Ga0111539_10117974 3300009094 Bacteria 3110
477 Ga0111539_10371569 3300009094 Bacteria 1664
478 Ga0111539_10465252 3300009094 Unclassified 1472
479 Ga0111539_10803388 3300009094 Bacteria 1095
480 Ga0111539_10909443 3300009094 Bacteria 1023
481 Ga0111539_10953555 3300009094 Bacteria 997
482 Ga0111539_10979355 3300009094 Bacteria 983
483 Ga0111539_11481864 3300009094 Bacteria 787
484 Ga0111539_11795832 3300009094 Bacteria 711
485 Ga0105245_10472517 3300009098 Unclassified 1266
486 Ga0105245_12434449 3300009098 Bacteria 577
487 Ga0114129_10000428 3300009147 Bacteria 49983
488 Ga0114129_10012760 3300009147 Bacteria 11960
489 Ga0114129_10017625 3300009147 Bacteria 10167
490 Ga0114129_10018975 3300009147 Bacteria 9796
491 Ga0114129_10053286 3300009147 Bacteria 5675
492 Ga0114129_10085809 3300009147 Unclassified 4367
493 Ga0114129_10134421 3300009147 Bacteria 3394
494 Ga0114129_10193248 3300009147 Bacteria 2762
495 Ga0114129_10617236 3300009147 Bacteria 1403
496 Ga0114129_11508167 3300009147 Bacteria 826
497 Ga0114129_11833931 3300009147 Bacteria 737
498 Ga0114129_12163651 3300009147 Bacteria 670
499 Ga0105243_10003500 3300009148 Bacteria 12676
500 Ga0105243_10019534 3300009148 Bacteria 5137
501 Ga0105243_10026196 3300009148 Bacteria 4463
502 Ga0105243_10294650 3300009148 Bacteria 1467
503 Ga0105243_10442306 3300009148 Bacteria 1218
504 Ga0105243_10500322 3300009148 Unclassified 1151
505 Ga0105243_10747708 3300009148 Bacteria 958
506 Ga0105243_10829908 3300009148 Bacteria 914
507 Ga0105243_11391817 3300009148 Unclassified 722
508 Ga0105243_11756760 3300009148 Bacteria 650
509 Ga0105243_11811964 3300009148 Unclassified 641
510 Ga0105241_10398014 3300009174 Bacteria 1207
511 Ga0105242_10042378 3300009176 Bacteria 3675
512 Ga0105242_10744195 3300009176 Bacteria 964
513 Ga0105242_11701641 3300009176 Bacteria 667
514 Ga0105242_13097705 3300009176 Bacteria 515
515 Ga0105248_10170987 3300009177 Unclassified 2449
516 Ga0105248_10292287 3300009177 Bacteria 1835
517 Ga0105248_10314752 3300009177 Unclassified 1763
518 Ga0105248_10477645 3300009177 Bacteria 1405
519 Ga0105238_10014597 3300009551 Bacteria 7943
520 Ga0105238_10598065 3300009551 Bacteria 1111
521 Ga0105238_12206496 3300009551 Bacteria 585
522 Ga0105249_10001435 3300009553 Bacteria 20875
523 Ga0105249_10118865 3300009553 Bacteria 2509
524 Ga0105249_10670558 3300009553 Bacteria 1095
525 Ga0105249_11401680 3300009553 Bacteria 771
526 Ga0105249_11622080 3300009553 Bacteria 719
527 Ga0105239_10256227 3300010375 Unclassified 1966
528 Ga0105239_11310687 3300010375 Unclassified 835
529 Ga0105246_10070854 3300011119 Unclassified 2453
530 Ga0105246_10269911 3300011119 Bacteria 1359
531 Ga0157342_1057940 3300012507 Unclassified 561
532 Ga0157371_10985500 3300013102 Bacteria 642
533 Ga0157371_11121535 3300013102 Bacteria 604
534 Ga0157374_10158541 3300013296 Bacteria 2204
535 Ga0157374_10315161 3300013296 Bacteria 1549
536 Ga0157374_10907191 3300013296 Bacteria 899
537 Ga0157374_11988004 3300013296 Unclassified 608
538 Ga0157378_11869302 3300013297 Bacteria 649
539 Ga0157378_11960267 3300013297 Unclassified 635
540 Ga0163162_10047240 3300013306 Bacteria 4314
541 Ga0163162_10073222 3300013306 Bacteria 3482
542 Ga0163162_10990023 3300013306 Bacteria 950
543 Ga0163162_11029431 3300013306 Bacteria 931
544 Ga0163162_11644828 3300013306 Bacteria 733
545 Ga0157375_10002396 3300013308 Bacteria 16230
546 Ga0157375_10027796 3300013308 Bacteria 5292
547 Ga0157375_10278416 3300013308 Bacteria 1836
548 Ga0157375_10724158 3300013308 Bacteria 1147
549 Ga0157375_10792387 3300013308 Bacteria 1097
550 Ga0157375_10993226 3300013308 Bacteria 979
551 Ga0157375_11161694 3300013308 Bacteria 905
552 Ga0157375_11242734 3300013308 Bacteria 874
553 Ga0157375_11693659 3300013308 Unclassified 749
554 Ga0157375_12278120 3300013308 Unclassified 646
555 Ga0157375_12477688 3300013308 Bacteria 619
556 Ga0163163_10019474 3300014325 Bacteria 6374
557 Ga0163163_10022372 3300014325 Bacteria 5984
558 Ga0163163_10172773 3300014325 Bacteria 2208
559 Ga0163163_10396001 3300014325 Bacteria 1439
560 Ga0163163_10446717 3300014325 Bacteria 1353
561 Ga0163163_10858827 3300014325 Bacteria 971
562 Ga0163163_11669873 3300014325 Bacteria 698
563 Ga0163163_11836788 3300014325 Bacteria 666
564 Ga0157380_10007797 3300014326 Bacteria 7618
565 Ga0157380_10009711 3300014326 Bacteria 6905
566 Ga0157380_10010846 3300014326 Bacteria 6570
567 Ga0157380_10020944 3300014326 Bacteria 4897
568 Ga0157380_10070467 3300014326 Bacteria 2825
569 Ga0157380_10142449 3300014326 Bacteria 2061
570 Ga0157380_10209190 3300014326 Bacteria 1737
571 Ga0157380_10247577 3300014326 Bacteria 1611
572 Ga0157380_10414575 3300014326 Bacteria 1282
573 Ga0157380_10520452 3300014326 Bacteria 1160
574 Ga0157380_10568264 3300014326 Bacteria 1116
575 Ga0157380_10616661 3300014326 Bacteria 1076
576 Ga0157380_10731610 3300014326 Bacteria 998
577 Ga0157380_10779863 3300014326 Bacteria 971
578 Ga0157380_10910431 3300014326 Bacteria 906
579 Ga0157380_11836330 3300014326 Unclassified 666
580 Ga0157380_12325199 3300014326 Bacteria 601
581 Ga0157377_10024220 3300014745 Bacteria 3225
582 Ga0157377_10067338 3300014745 Bacteria 2062
583 Ga0157377_10068506 3300014745 Bacteria 2045
584 Ga0157377_10070914 3300014745 Unclassified 2014
585 Ga0157377_10503958 3300014745 Bacteria 846
586 Ga0157377_10698043 3300014745 Bacteria 736
587 Ga0157377_10796669 3300014745 Bacteria 696
588 Ga0157379_10035666 3300014968 Bacteria 4434
589 Ga0157376_10091248 3300014969 Unclassified 2638
590 Ga0157376_10365942 3300014969 Bacteria 1384
591 Ga0157376_10516584 3300014969 Bacteria 1176
592 Ga0157376_12341692 3300014969 Bacteria 573
593 Ga0157376_12579652 3300014969 Unclassified 548
594 Ga0157376_13103274 3300014969 Unclassified 503
595 Ga0163161_10433369 3300017792 Bacteria 1060
596 Ga0163161_10621962 3300017792 Bacteria 892
597 Ga0207666_1047458 3300025271 Bacteria 677
598 Ga0207666_1072199 3300025271 Bacteria 556
599 Ga0207673_1024191 3300025290 Bacteria 829
600 Ga0207697_10000701 3300025315 Bacteria 19066
601 Ga0207697_10114923 3300025315 Bacteria 1155
602 Ga0207697_10139490 3300025315 Bacteria 1051
603 Ga0207697_10297672 3300025315 Bacteria 715
604 Ga0207697_10511332 3300025315 Bacteria 530
605 Ga0207656_10139231 3300025321 Bacteria 1143
606 Ga0207653_10091341 3300025885 Bacteria 1067
607 Ga0207682_10000378 3300025893 Bacteria 20628
608 Ga0207682_10008600 3300025893 Bacteria 4035
609 Ga0207682_10016592 3300025893 Bacteria 2873
610 Ga0207682_10021145 3300025893 Bacteria 2559
611 Ga0207682_10035377 3300025893 Bacteria 2018
612 Ga0207682_10158617 3300025893 Unclassified 1024
613 Ga0207682_10199402 3300025893 Bacteria 920
614 Ga0207682_10223792 3300025893 Bacteria 871
615 Ga0207682_10253183 3300025893 Bacteria 820
616 Ga0207688_10000628 3300025901 Bacteria 17382
617 Ga0207688_10031253 3300025901 Bacteria 2939
618 Ga0207688_10255878 3300025901 Bacteria 1061
619 Ga0207680_10011142 3300025903 Bacteria 4531
620 Ga0207680_10867810 3300025903 Bacteria 647
621 Ga0207680_11290523 3300025903 Bacteria 519
622 Ga0207647_10164504 3300025904 Bacteria 1293
623 Ga0207645_10001911 3300025907 Bacteria 16819
624 Ga0207645_10014270 3300025907 Bacteria 5321
625 Ga0207645_10141205 3300025907 Bacteria 1569
626 Ga0207645_10220213 3300025907 Bacteria 1251
627 Ga0207645_10943526 3300025907 Bacteria 585
628 Ga0207643_10000925 3300025908 Bacteria 17575
629 Ga0207643_10012789 3300025908 Bacteria 4537
630 Ga0207643_10020502 3300025908 Bacteria 3628
631 Ga0207643_10020871 3300025908 Bacteria 3595
632 Ga0207643_10032012 3300025908 Bacteria 2934
633 Ga0207643_10040543 3300025908 Bacteria 2622
634 Ga0207643_10087731 3300025908 Bacteria 1810
635 Ga0207643_10106227 3300025908 Bacteria 1650
636 Ga0207643_10191613 3300025908 Bacteria 1241
637 Ga0207643_10329576 3300025908 Bacteria 955
638 Ga0207643_10535407 3300025908 Bacteria 751
639 Ga0207654_10662121 3300025911 Unclassified 748
640 Ga0207707_10109972 3300025912 Bacteria 2409
641 Ga0207695_10032450 3300025913 Bacteria 5714
642 Ga0207693_10155175 3300025915 Bacteria 1800
643 Ga0207660_10056606 3300025917 Bacteria 2806
644 Ga0207660_10140288 3300025917 Bacteria 1847
645 Ga0207660_10181975 3300025917 Unclassified 1633
646 Ga0207660_10465273 3300025917 Bacteria 1024
647 Ga0207660_10501512 3300025917 Bacteria 985
648 Ga0207662_10028554 3300025918 Bacteria 3227
649 Ga0207662_10035421 3300025918 Bacteria 2915
650 Ga0207662_10040686 3300025918 Bacteria 2733
651 Ga0207662_10224656 3300025918 Bacteria 1224
652 Ga0207662_10448578 3300025918 Bacteria 882
653 Ga0207662_10476016 3300025918 Bacteria 857
654 Ga0207657_10717245 3300025919 Bacteria 776
655 Ga0207649_10256683 3300025920 Bacteria 1261
656 Ga0207649_10270704 3300025920 Bacteria 1231
657 Ga0207652_10684169 3300025921 Bacteria 916
658 Ga0207652_10825763 3300025921 Unclassified 822
659 Ga0207646_10454714 3300025922 Bacteria 1155
660 Ga0207646_10472670 3300025922 Bacteria 1131
661 Ga0207646_11101233 3300025922 Bacteria 699
662 Ga0207681_10039064 3300025923 Bacteria 3148
663 Ga0207681_10040362 3300025923 Bacteria 3105
664 Ga0207681_10050672 3300025923 Bacteria 2810
665 Ga0207681_10078889 3300025923 Bacteria 2318
666 Ga0207681_10110465 3300025923 Bacteria 1999
667 Ga0207681_10266055 3300025923 Bacteria 1344
668 Ga0207681_10412790 3300025923 Bacteria 1092
669 Ga0207681_10845870 3300025923 Bacteria 765
670 Ga0207694_10172413 3300025924 Bacteria 1752
671 Ga0207694_10930394 3300025924 Bacteria 735
672 Ga0207650_10001613 3300025925 Bacteria 16089
673 Ga0207650_10027981 3300025925 Bacteria 4039
674 Ga0207650_10030923 3300025925 Bacteria 3862
675 Ga0207650_10086526 3300025925 Bacteria 2386
676 Ga0207650_10141203 3300025925 Bacteria 1894
677 Ga0207650_10309605 3300025925 Bacteria 1291
678 Ga0207650_10352799 3300025925 Bacteria 1210
679 Ga0207650_10781382 3300025925 Bacteria 809
680 Ga0207650_11796210 3300025925 Bacteria 519
681 Ga0207659_10000228 3300025926 Bacteria 34204
682 Ga0207659_10004292 3300025926 Bacteria 8618
683 Ga0207659_10005741 3300025926 Bacteria 7557
684 Ga0207659_10011671 3300025926 Bacteria 5558
685 Ga0207659_10061680 3300025926 Bacteria 2703
686 Ga0207659_10084137 3300025926 Bacteria 2360
687 Ga0207659_10102634 3300025926 Bacteria 2159
688 Ga0207659_10118544 3300025926 Bacteria 2024
689 Ga0207659_10261247 3300025926 Bacteria 1409
690 Ga0207659_10338258 3300025926 Bacteria 1246
691 Ga0207659_10393321 3300025926 Bacteria 1158
692 Ga0207659_10423279 3300025926 Unclassified 1117
693 Ga0207659_10446788 3300025926 Bacteria 1088
694 Ga0207659_10564538 3300025926 Bacteria 968
695 Ga0207659_11409882 3300025926 Unclassified 597
696 Ga0207687_10409984 3300025927 Bacteria 1116
697 Ga0207700_10264985 3300025928 Bacteria 1473
698 Ga0207644_10009869 3300025931 Bacteria 6280
699 Ga0207644_10021899 3300025931 Bacteria 4359
700 Ga0207644_10082446 3300025931 Unclassified 2379
701 Ga0207644_10315516 3300025931 Bacteria 1263
702 Ga0207644_10528307 3300025931 Bacteria 975
703 Ga0207644_11009791 3300025931 Bacteria 698
704 Ga0207690_10134241 3300025932 Unclassified 1815
705 Ga0207690_10165789 3300025932 Bacteria 1651
706 Ga0207690_10199129 3300025932 Bacteria 1520
707 Ga0207690_11328817 3300025932 Unclassified 601
708 Ga0207706_10005892 3300025933 Bacteria 11400
709 Ga0207706_10032854 3300025933 Bacteria 4617
710 Ga0207706_10045538 3300025933 Bacteria 3886
711 Ga0207706_10119323 3300025933 Bacteria 2319
712 Ga0207706_11352436 3300025933 Bacteria 587
713 Ga0207686_10043976 3300025934 Bacteria 2740
714 Ga0207686_10088161 3300025934 Bacteria 2042
715 Ga0207686_10171973 3300025934 Bacteria 1529
716 Ga0207709_10047414 3300025935 Bacteria 2612
717 Ga0207709_10122590 3300025935 Bacteria 1758
718 Ga0207709_10207360 3300025935 Bacteria 1404
719 Ga0207709_10713745 3300025935 Bacteria 803
720 Ga0207709_10894340 3300025935 Bacteria 721
721 Ga0207670_10008582 3300025936 Bacteria 5775
722 Ga0207670_10045730 3300025936 Bacteria 2904
723 Ga0207670_10086419 3300025936 Bacteria 2207
724 Ga0207670_10412158 3300025936 Unclassified 1082
725 Ga0207670_10429747 3300025936 Bacteria 1061
726 Ga0207670_10999308 3300025936 Bacteria 704
727 Ga0207669_10000517 3300025937 Bacteria 16886
728 Ga0207669_10096969 3300025937 Bacteria 1937
729 Ga0207669_10299849 3300025937 Bacteria 1221
730 Ga0207669_10559571 3300025937 Bacteria 924
731 Ga0207669_11116208 3300025937 Bacteria 666
732 Ga0207704_10292220 3300025938 Bacteria 1244
733 Ga0207704_10301122 3300025938 Bacteria 1228
734 Ga0207704_10516581 3300025938 Bacteria 965
735 Ga0207691_10005381 3300025940 Bacteria 12358
736 Ga0207691_10011876 3300025940 Bacteria 8357
737 Ga0207691_10024642 3300025940 Bacteria 5658
738 Ga0207691_10035476 3300025940 Bacteria 4628
739 Ga0207691_10046739 3300025940 Bacteria 3975
740 Ga0207691_10071076 3300025940 Bacteria 3142
741 Ga0207691_10435508 3300025940 Bacteria 1116
742 Ga0207691_10674966 3300025940 Bacteria 872
743 Ga0207691_10774774 3300025940 Bacteria 807
744 Ga0207691_10799559 3300025940 Bacteria 793
745 Ga0207711_10034751 3300025941 Unclassified 4269
746 Ga0207711_10054765 3300025941 Bacteria 3424
747 Ga0207711_11880631 3300025941 Bacteria 541
748 Ga0207689_10001594 3300025942 Bacteria 21468
749 Ga0207689_10005493 3300025942 Bacteria 11339
750 Ga0207689_10072548 3300025942 Bacteria 2828
751 Ga0207689_10134402 3300025942 Bacteria 2036
752 Ga0207689_10166820 3300025942 Bacteria 1814
753 Ga0207689_10246992 3300025942 Bacteria 1476
754 Ga0207689_11060166 3300025942 Bacteria 683
755 Ga0207679_10047164 3300025945 Bacteria 3128
756 Ga0207679_10096493 3300025945 Bacteria 2300
757 Ga0207679_10228570 3300025945 Unclassified 1569
758 Ga0207679_10373351 3300025945 Bacteria 1249
759 Ga0207679_10375310 3300025945 Bacteria 1245
760 Ga0207679_10825747 3300025945 Unclassified 846
761 Ga0207679_11016980 3300025945 Bacteria 760
762 Ga0207679_11172431 3300025945 Bacteria 705
763 Ga0207679_12118165 3300025945 Bacteria 511
764 Ga0207651_10056892 3300025960 Bacteria 2694
765 Ga0207651_10060271 3300025960 Bacteria 2633
766 Ga0207651_10091471 3300025960 Bacteria 2228
767 Ga0207651_10175029 3300025960 Bacteria 1696
768 Ga0207651_10231169 3300025960 Bacteria 1501
769 Ga0207651_10311305 3300025960 Bacteria 1313
770 Ga0207651_10423904 3300025960 Unclassified 1136
771 Ga0207651_10427128 3300025960 Bacteria 1132
772 Ga0207651_10473263 3300025960 Bacteria 1078
773 Ga0207651_10576192 3300025960 Bacteria 981
774 Ga0207651_11101295 3300025960 Unclassified 712
775 Ga0207651_11340898 3300025960 Bacteria 643
776 Ga0207712_10005897 3300025961 Bacteria 7723
777 Ga0207712_10011699 3300025961 Bacteria 5596
778 Ga0207668_10005977 3300025972 Bacteria 7176
779 Ga0207668_10280678 3300025972 Unclassified 1366
780 Ga0207668_10830473 3300025972 Bacteria 819
781 Ga0207640_10042877 3300025981 Bacteria 2888
782 Ga0207640_10193226 3300025981 Unclassified 1536
783 Ga0207640_10318729 3300025981 Bacteria 1237
784 Ga0207640_10877609 3300025981 Bacteria 782
785 Ga0207640_11405118 3300025981 Bacteria 625
786 Ga0207658_10525516 3300025986 Unclassified 1056
787 Ga0207658_10596119 3300025986 Bacteria 992
788 Ga0207658_10643461 3300025986 Bacteria 955
789 Ga0207658_10914922 3300025986 Bacteria 799
790 Ga0207677_10064811 3300026023 Unclassified 2546
791 Ga0207677_10401306 3300026023 Bacteria 1163
792 Ga0207703_10009949 3300026035 Bacteria 7463
793 Ga0207703_10067639 3300026035 Bacteria 2941
794 Ga0207703_10403808 3300026035 Bacteria 1268
795 Ga0207703_10582738 3300026035 Bacteria 1057
796 Ga0207703_10790443 3300026035 Bacteria 906
797 Ga0207639_10329675 3300026041 Bacteria 1358
798 Ga0207678_10053959 3300026067 Bacteria 3462
799 Ga0207678_10154060 3300026067 Bacteria 1962
800 Ga0207678_10163014 3300026067 Bacteria 1904
801 Ga0207678_10178375 3300026067 Unclassified 1814
802 Ga0207678_10257068 3300026067 Bacteria 1496
803 Ga0207678_11229932 3300026067 Bacteria 663
804 Ga0207708_10008381 3300026075 Bacteria 7651
805 Ga0207708_10013147 3300026075 Bacteria 6177
806 Ga0207708_10029168 3300026075 Bacteria 4180
807 Ga0207708_10072262 3300026075 Bacteria 2643
808 Ga0207708_10122686 3300026075 Bacteria 2025
809 Ga0207708_10252726 3300026075 Bacteria 1421
810 Ga0207708_10457960 3300026075 Bacteria 1063
811 Ga0207708_10551626 3300026075 Bacteria 972
812 Ga0207708_10703057 3300026075 Bacteria 864
813 Ga0207708_11282323 3300026075 Bacteria 641
814 Ga0207708_11612216 3300026075 Bacteria 570
815 Ga0207708_11717474 3300026075 Bacteria 551
816 Ga0207702_11125643 3300026078 Unclassified 779
817 Ga0207641_10007161 3300026088 Bacteria 9311
818 Ga0207641_10350939 3300026088 Bacteria 1406
819 Ga0207641_11258153 3300026088 Bacteria 740
820 Ga0207641_12081158 3300026088 Bacteria 568
821 Ga0207648_10000163 3300026089 Bacteria 68352
822 Ga0207648_10013761 3300026089 Bacteria 7510
823 Ga0207648_10018129 3300026089 Bacteria 6377
824 Ga0207648_10089986 3300026089 Bacteria 2682
825 Ga0207648_10124738 3300026089 Bacteria 2265
826 Ga0207648_10498706 3300026089 Bacteria 1114
827 Ga0207648_10966358 3300026089 Bacteria 797
828 Ga0207648_10975542 3300026089 Bacteria 793
829 Ga0207676_10019508 3300026095 Bacteria 4949
830 Ga0207676_10026259 3300026095 Bacteria 4331
831 Ga0207676_10055207 3300026095 Bacteria 3117
832 Ga0207676_10073147 3300026095 Bacteria 2757
833 Ga0207676_11153103 3300026095 Bacteria 767
834 Ga0207676_11233635 3300026095 Bacteria 742
835 Ga0207674_10003394 3300026116 Bacteria 19533
836 Ga0207674_10030026 3300026116 Bacteria 5719
837 Ga0207674_10051550 3300026116 Bacteria 4199
838 Ga0207674_10120389 3300026116 Bacteria 2593
839 Ga0207674_10182081 3300026116 Bacteria 2052
840 Ga0207674_10269346 3300026116 Unclassified 1650
841 Ga0207674_10790839 3300026116 Bacteria 916
842 Ga0207674_11367583 3300026116 Bacteria 677
843 Ga0207675_100011812 3300026118 Bacteria 8163
844 Ga0207675_100011858 3300026118 Bacteria 8143
845 Ga0207675_100036803 3300026118 Bacteria 4565
846 Ga0207675_100170564 3300026118 Bacteria 2079
847 Ga0207675_100243641 3300026118 Bacteria 1738
848 Ga0207675_100437139 3300026118 Bacteria 1295
849 Ga0207675_100460422 3300026118 Bacteria 1261
850 Ga0207675_100551708 3300026118 Bacteria 1151
851 Ga0207683_10003680 3300026121 Bacteria 13322
852 Ga0207683_10274424 3300026121 Bacteria 1540
853 Ga0207683_10471445 3300026121 Bacteria 1158
854 Ga0207683_10513857 3300026121 Bacteria 1107
855 Ga0207683_10600586 3300026121 Unclassified 1019
856 Ga0207683_11835105 3300026121 Bacteria 555
857 Ga0207698_10174732 3300026142 Bacteria 1895
858 Ga0207698_11362088 3300026142 Bacteria 724
859 Ga0207698_11939842 3300026142 Unclassified 603
860 Ga0209973_1025191 3300027252 Bacteria 813
861 Ga0209969_1039070 3300027360 Unclassified 734
862 Ga0209968_1051979 3300027526 Bacteria 713
863 Ga0209971_1148006 3300027682 Bacteria 579
864 Ga0209998_10074901 3300027717 Bacteria 813
865 Ga0209974_10043181 3300027876 Bacteria 1502
866 Ga0209974_10090409 3300027876 Bacteria 1061
867 Ga0207428_10001366 3300027907 Bacteria 25889
868 Ga0207428_10001370 3300027907 Bacteria 25833
869 Ga0207428_10001377 3300027907 Bacteria 25761
870 Ga0207428_10027437 3300027907 Bacteria 4740
871 Ga0207428_10151616 3300027907 Bacteria 1764
872 Ga0207428_10447717 3300027907 Bacteria 942
873 Ga0207428_10512855 3300027907 Bacteria 870
874 Ga0268266_10624105 3300028379 Unclassified 1036
875 Ga0268266_12020066 3300028379 Bacteria 550
876 Ga0268265_10001766 3300028380 Bacteria 17361
877 Ga0268265_10055223 3300028380 Bacteria 3017
878 Ga0268265_10192823 3300028380 Bacteria 1761
879 Ga0268265_10243218 3300028380 Bacteria 1589
880 Ga0268265_10325822 3300028380 Bacteria 1393
881 Ga0268265_10476722 3300028380 Bacteria 1171
882 Ga0268264_10003737 3300028381 Bacteria 13072
883 Ga0268264_10124573 3300028381 Bacteria 2275
884 Ga0268264_10369296 3300028381 Bacteria 1371
885 Ga0268264_11333281 3300028381 Bacteria 728
886 Ga0268264_11537508 3300028381 Bacteria 676
887 Ga0307408_100096208 3300031548 Bacteria 2246
888 Ga0307408_100414157 3300031548 Bacteria 1160
889 Ga0307408_100428671 3300031548 Bacteria 1142
890 Ga0307408_101254379 3300031548 Bacteria 693
891 Ga0307405_10009847 3300031731 Bacteria 4918
892 Ga0307405_10380425 3300031731 Bacteria 1099
893 Ga0307405_11542767 3300031731 Bacteria 585
894 Ga0307405_11809247 3300031731 Unclassified 543
895 Ga0307413_10009844 3300031824 Bacteria 4599
896 Ga0307413_10281633 3300031824 Bacteria 1251
897 Ga0307413_11275001 3300031824 Unclassified 642
898 Ga0307410_10042471 3300031852 Bacteria 3006
899 Ga0307410_10066083 3300031852 Bacteria 2490
900 Ga0307410_10320800 3300031852 Bacteria 1229
901 Ga0307410_10406669 3300031852 Bacteria 1101
902 Ga0307406_10100615 3300031901 Bacteria 1968
903 Ga0307406_10118697 3300031901 Bacteria 1834
904 Ga0307407_10781071 3300031903 Bacteria 725
905 Ga0307407_11692185 3300031903 Bacteria 504
906 Ga0307412_10022850 3300031911 Bacteria 3840
907 Ga0307412_10034865 3300031911 Bacteria 3210
908 Ga0307412_10284266 3300031911 Bacteria 1300
909 Ga0307412_11132187 3300031911 Bacteria 698
910 Ga0307409_100017933 3300031995 Bacteria 4737
911 Ga0307409_101844382 3300031995 Bacteria 634
912 Ga0307416_100019771 3300032002 Bacteria 4784
913 Ga0307416_100134077 3300032002 Bacteria 2236
914 Ga0307416_100167775 3300032002 Bacteria 2039
915 Ga0307416_100209223 3300032002 Bacteria 1859
916 Ga0307416_100500465 3300032002 Bacteria 1279
917 Ga0307416_100626468 3300032002 Bacteria 1158
918 Ga0307416_101324765 3300032002 Bacteria 826
919 Ga0307414_10602726 3300032004 Bacteria 985
920 Ga0307414_12219817 3300032004 Bacteria 513
921 Ga0307411_10072904 3300032005 Bacteria 2333
922 Ga0307411_11389046 3300032005 Bacteria 642
923 Ga0307415_100117006 3300032126 Bacteria 1990
924 Ga0307415_100281641 3300032126 Bacteria 1367
925 Ga0373958_0009786 3300034819 Bacteria 1585
926 Ga0373928_0217731 3300035084 Bacteria 557
927 Ga0373929_0128783 3300035085 Unclassified 662
928 Ga0373940_0030968 3300035088 Bacteria 1426
929 Ga0373949_0070799 3300035090 Bacteria 913
930 Ga0373951_0114533 3300035091 Bacteria 728
931 Ga0373952_0027431 3300035092 Bacteria 1243
932 Ga0373932_0252930 3300035112 Unclassified 643
933 Ga0373939_0018013 3300035114 Unclassified 1885
934 Ga0373939_0028506 3300035114 Bacteria 1590
935 Ga0373943_0806730 3300035170 Bacteria 559
936 Ga0373961_0031381 3300035241 Bacteria 1484
937 Ga0373961_0143681 3300035241 Bacteria 808
938 Ga0373962_0124031 3300035242 Bacteria 826
939 Ga0373924_0120483 3300035410 Bacteria 1138
940 Ga0373931_0058440 3300035691 Bacteria 2071
941 Ga0373927_0450668 3300035695 Bacteria 850
942 Ga0373947_0629347 3300035725 Bacteria 731
943 Ga0373947_1217889 3300035725 Bacteria 513
944 Ga0373937_0055977 3300036401 Bacteria 3621
945 Ga0439436_0260972 3300041404 Bacteria 504
946 Ga0439439_0213581 3300041406 Bacteria 564
947 Ga0439453_0004211 3300041408 Bacteria 2126
948 Ga0439453_0006905 3300041408 Bacteria 1784
949 Ga0439461_0091504 3300041410 Bacteria 730
950 Ga0451807_1168084 3300041486 Unclassified 745
951 Ga0451807_2232228 3300041486 Bacteria 1299
952 Ga0451847_0949984 3300041503 Bacteria 572
953 Ga0451853_0959504 3300041512 Unclassified 553
954 Ga0451853_3567470 3300041512 Bacteria 777
955 Ga0439433_0136495 3300041999 Unclassified 626
956 Ga0439433_0142521 3300041999 Bacteria 614
957 Ga0439443_010689 3300042003 Bacteria 1334
958 Ga0439443_110657 3300042003 Bacteria 533
959 Ga0439448_0145621 3300042005 Bacteria 821
960 Ga0439454_059682 3300042011 Bacteria 659
961 Ga0439455_0256413 3300042012 Unclassified 513
962 Ga0450920_094723 3300042122 Bacteria 617
963 Ga0450923_014718 3300042125 Bacteria 1455
964 Ga0450923_033703 3300042125 Bacteria 1054
965 Ga0450894_005331 3300042131 Bacteria 1665
966 Ga0450894_083539 3300042131 Bacteria 500
967 Ga0450895_004034 3300042132 Bacteria 1148
968 Ga0450896_000018 3300042133 Bacteria 8868
969 Ga0450896_017019 3300042133 Bacteria 1048
970 Ga0450899_008460 3300042135 Unclassified 1128
971 Ga0450906_076472 3300042145 Bacteria 602
972 Ga0439446_0028799 3300042156 Bacteria 1601
973 Ga0450908_019100 3300042184 Bacteria 1208
974 Ga0439435_0254669 3300042436 Unclassified 592
975 Ga0439444_0014313 3300042437 Bacteria 1325
976 Ga0439444_0041675 3300042437 Bacteria 904
977 Ga0450918_057283 3300042531 Bacteria 716
978 Ga0439440_0015856 3300042993 Unclassified 1642
979 Ga0453683_0112590 3300044673 Bacteria 1712
980 Ga0453684_2307783 3300044712 Bacteria 535
981 Ga0451576_0019237 3300045051 Bacteria 7455
982 Ga0451576_0026272 3300045051 Bacteria 6264
983 Ga0451576_0359990 3300045051 Bacteria 1523
984 Ga0451576_0491262 3300045051 Bacteria 1289
985 Ga0451576_0546914 3300045051 Bacteria 1216
986 Ga0451576_1742139 3300045051 Bacteria 645
987 Ga0495603_0337785 3300046455 Unclassified 864
988 Ga0495629_0002871 3300046459 Bacteria 13168
989 Ga0495629_0500995 3300046459 Bacteria 819
990 Ga0495582_0625472 3300046473 Bacteria 623
991 Ga0495584_0071812 3300046491 Bacteria 1739
992 Ga0495584_0217443 3300046491 Bacteria 971
993 Ga0495594_0004891 3300046499 Bacteria 6897
994 Ga0495637_0291436 3300046520 Bacteria 581
995 Ga0495643_0003489 3300046522 Bacteria 11463
996 Ga0495644_0376231 3300046523 Bacteria 561
997 Ga0495663_0006606 3300046525 Bacteria 3199
998 Ga0495663_0092499 3300046525 Bacteria 987
999 Ga0495642_0042366 3300046528 Bacteria 1854
1000 Ga0495642_0115201 3300046528 Bacteria 1151
1001 Ga0495642_0334115 3300046528 Unclassified 665
1002 Ga0495642_0568432 3300046528 Bacteria 503
1003 Ga0495598_0001849 3300046537 Bacteria 4264
1004 Ga0495598_0024717 3300046537 Bacteria 1631
1005 Ga0495598_0034557 3300046537 Unclassified 1442
1006 Ga0495598_0036781 3300046537 Bacteria 1409
1007 Ga0495598_0049498 3300046537 Bacteria 1260
1008 Ga0495598_0180944 3300046537 Bacteria 752
1009 Ga0495598_0314796 3300046537 Bacteria 595
1010 Ga0495609_0243767 3300046538 Bacteria 741
1011 Ga0495621_0004705 3300046539 Bacteria 3866
1012 Ga0495621_0024309 3300046539 Bacteria 2023
1013 Ga0495621_0060589 3300046539 Unclassified 1373
1014 Ga0495621_0105142 3300046539 Bacteria 1078
1015 Ga0495621_0139139 3300046539 Bacteria 949
1016 Ga0495621_0416563 3300046539 Bacteria 571
1017 Ga0495621_0421921 3300046539 Bacteria 568
1018 Ga0495645_0305622 3300046543 Bacteria 1037
1019 Ga0495622_0470224 3300046557 Bacteria 538
1020 Ga0495633_0041948 3300046558 Bacteria 2174
1021 Ga0495633_0315285 3300046558 Bacteria 710
1022 Ga0495656_0383231 3300046615 Bacteria 733
1023 Ga0495656_0634392 3300046615 Bacteria 573
1024 Ga0495656_0802045 3300046615 Bacteria 509
1025 Ga0495634_0771190 3300046642 Bacteria 550
1026 Ga0495659_0001340 3300046664 Bacteria 8446
1027 Ga0495659_0012172 3300046664 Bacteria 2782
1028 Ga0495659_0067005 3300046664 Bacteria 1338
1029 Ga0495659_0144483 3300046664 Bacteria 952
1030 Ga0495659_0166897 3300046664 Unclassified 891
1031 Ga0495659_0326938 3300046664 Bacteria 652
1032 Ga0495659_0335321 3300046664 Unclassified 644
1033 Ga0495659_0488952 3300046664 Bacteria 538
1034 Ga0495588_0115979 3300046674 Unclassified 1411
1035 Ga0495588_0462388 3300046674 Bacteria 665
1036 Ga0495588_0737196 3300046674 Bacteria 515
1037 Ga0495623_0140831 3300046679 Bacteria 1435
1038 Ga0495647_0096108 3300046681 Bacteria 1221
1039 Ga0495647_0161558 3300046681 Unclassified 966
1040 Ga0495647_0292659 3300046681 Unclassified 733
1041 Ga0495647_0425644 3300046681 Bacteria 612
1042 Ga0495658_0026690 3300046683 Bacteria 3098
1043 Ga0495658_0057627 3300046683 Bacteria 2220
1044 Ga0495658_0562783 3300046683 Unclassified 730
1045 Ga0495669_0039387 3300046684 Bacteria 2093
1046 Ga0495669_0072754 3300046684 Bacteria 1569
1047 Ga0495669_0330850 3300046684 Bacteria 736
1048 Ga0495670_0015678 3300046691 Bacteria 3725
1049 Ga0495670_0288090 3300046691 Bacteria 879
1050 Ga0495670_0341236 3300046691 Bacteria 806
1051 Ga0495581_0666746 3300047315 Bacteria 601
1052 Ga0495636_0044549 3300047318 Bacteria 1847
1053 Ga0495636_0076549 3300047318 Unclassified 1435
1054 Ga0495636_0294948 3300047318 Bacteria 758
1055 Ga0495636_0424533 3300047318 Unclassified 636
1056 Ga0495674_0283834 3300047319 Bacteria 1356
1057 Ga0495677_0038697 3300047445 Bacteria 1743
1058 Ga0495685_166666 3300047447 Bacteria 712
1059 Ga0495684_0497393 3300047471 Bacteria 839
1060 Ga0496106_0427882 3300048909 Bacteria 1064
1061 Ga0496108_0919473 3300048911 Bacteria 750
1062 Ga0496109_0099373 3300048912 Bacteria 2699
1063 Ga0496110_1349718 3300048913 Bacteria 622
1064 Ga0496112_0301961 3300048915 Bacteria 1546
1065 Ga0496113_0253112 3300048916 Bacteria 1406
1066 Ga0501292_032876 3300049515 Unclassified 877
1067 Ga0501300_032849 3300049523 Unclassified 769
1068 Ga0501036_0084680 3300049572 Bacteria 2680
1069 Ga0501036_0372873 3300049572 Bacteria 1191
1070 Ga0501037_0481944 3300049573 Bacteria 843
1071 Ga0501039_0038767 3300049575 Bacteria 3679
1072 Ga0501039_0368618 3300049575 Bacteria 1128
1073 Ga0501040_0024019 3300049576 Bacteria 4090
1074 Ga0501040_0129278 3300049576 Bacteria 1775
1075 Ga0501040_0842956 3300049576 Bacteria 664
1076 Ga0501041_0224499 3300049577 Bacteria 1179
1077 Ga0501042_0224295 3300049578 Bacteria 1355
1078 Ga0501042_0260100 3300049578 Bacteria 1253
1079 Ga0501042_0396530 3300049578 Unclassified 1000
1080 Ga0501042_0854245 3300049578 Unclassified 663
1081 Ga0501043_0132921 3300049579 Bacteria 1950
1082 Ga0501046_0397213 3300049580 Bacteria 996
1083 Ga0501048_0035209 3300049582 Bacteria 3605
1084 Ga0501068_0386933 3300049584 Bacteria 901
1085 Ga0501070_0839164 3300049586 Unclassified 720
1086 Ga0501071_0234674 3300049587 Bacteria 1382
1087 Ga0501071_1146868 3300049587 Bacteria 601
1088 Ga0501072_0194492 3300049588 Bacteria 1617
1089 Ga0501073_0468738 3300049589 Bacteria 871
1090 Ga0501074_0535874 3300049590 Bacteria 829
1091 Ga0501075_0124437 3300049591 Bacteria 1963
1092 Ga0501075_0508487 3300049591 Bacteria 919
1093 Ga0501075_1114528 3300049591 Bacteria 599
1094 Ga0501076_0316458 3300049592 Bacteria 1280
1095 Ga0501076_0780081 3300049592 Unclassified 789
1096 Ga0501077_0110105 3300049593 Bacteria 1745
1097 Ga0501077_0401437 3300049593 Bacteria 876
1098 Ga0501217_050284 3300049661 Bacteria 1088
1099 Ga0501217_328131 3300049661 Bacteria 511
1100 Ga0501223_055276 3300049663 Bacteria 772
1101 Ga0501221_114570 3300049704 Unclassified 683
1102 Ga0501225_0109591 3300049705 Bacteria 813
1103 Ga0501245_093759 3300049708 Unclassified 598
1104 Ga0501079_0033766 3300049741 Bacteria 3937
1105 Ga0501079_0062746 3300049741 Bacteria 2866
1106 Ga0501079_1221750 3300049741 Bacteria 592
1107 Ga0501081_0023984 3300049743 Bacteria 4093
1108 Ga0501081_0903507 3300049743 Bacteria 666
1109 Ga0501283_006867 3300049779 Unclassified 1606
1110 Ga0501045_0064197 3300049824 Bacteria 2695
1111 nmdc:mga05p37_136036_c1 3300050507 Bacteria 3013
1112 nmdc:mga05p37_198327_c1 3300050507 Bacteria 2433
1113 nmdc:mga05p37_206549_c1 3300050507 Bacteria 2376
1114 nmdc:mga05p37_280939_c1 3300050507 Bacteria 1985
1115 nmdc:mga05p37_4324_c1 3300050507 Bacteria 16595
1116 nmdc:mga05p37_583365_c1 3300050507 Unclassified 1266
1117 nmdc:mga05p37_602466_c1 3300050507 Bacteria 1240
1118 nmdc:mga05p37_62156_c1 3300050507 Bacteria 4596
1119 nmdc:mga05p37_638290_c1 3300050507 Unclassified 1195
1120 nmdc:mga09592_1026021_c1 3300050508 Bacteria 688
1121 nmdc:mga09592_103934_c1 3300050508 Bacteria 2434
1122 nmdc:mga09592_10882_c1 3300050508 Bacteria 7404
1123 nmdc:mga09592_135878_c1 3300050508 Bacteria 2118
1124 nmdc:mga09592_1412671_c1 3300050508 Unclassified 569
1125 nmdc:mga09592_19125_c1 3300050508 Bacteria 5621
1126 nmdc:mga09592_246359_c1 3300050508 Bacteria 1549
1127 nmdc:mga09592_60164_c1 3300050508 Bacteria 3211
1128 nmdc:mga09592_69042_c1 3300050508 Bacteria 2998
1129 nmdc:mga0qj67_1412576_c1 3300050509 Bacteria 537
1130 nmdc:mga0qj67_24967_c1 3300050509 Bacteria 4612
1131 nmdc:mga0qj67_313572_c1 3300050509 Bacteria 1270
1132 nmdc:mga0qj67_33632_c1 3300050509 Bacteria 4000
1133 nmdc:mga0qj67_821609_c1 3300050509 Bacteria 735
1134 nmdc:mga0qj67_970209_c1 3300050509 Bacteria 668
1135 nmdc:mga06r32_1225942_c1 3300050510 Bacteria 696
1136 nmdc:mga06r32_1847966_c1 3300050510 Bacteria 539
1137 nmdc:mga06r32_20427_c1 3300050510 Bacteria 6099
1138 nmdc:mga06r32_237647_c1 3300050510 Bacteria 1810
1139 nmdc:mga06r32_307369_c1 3300050510 Bacteria 1571
1140 nmdc:mga06r32_62930_c1 3300050510 Bacteria 3575
1141 nmdc:mga06r32_716119_c1 3300050510 Bacteria 966
1142 nmdc:mga08y16_1036_c2 3300050511 Bacteria 14973
1143 nmdc:mga08y16_1115665_c1 3300050511 Bacteria 763
1144 nmdc:mga08y16_124522_c1 3300050511 Bacteria 2681
1145 nmdc:mga08y16_163142_c1 3300050511 Bacteria 2315
1146 nmdc:mga08y16_164849_c1 3300050511 Bacteria 2302
1147 nmdc:mga08y16_1789166_c1 3300050511 Unclassified 568
1148 nmdc:mga08y16_222762_c1 3300050511 Bacteria 1952
1149 nmdc:mga08y16_23988_c1 3300050511 Bacteria 6443
1150 nmdc:mga08y16_28438_c1 3300050511 Bacteria 5894
1151 nmdc:mga08y16_34609_c1 3300050511 Bacteria 5307
1152 nmdc:mga08y16_494187_c1 3300050511 Unclassified 1244
1153 nmdc:mga08y16_743_c1 3300050511 Bacteria 31040
1154 nmdc:mga08y16_786723_c1 3300050511 Bacteria 945
1155 nmdc:mga08y16_93469_c1 3300050511 Bacteria 3133
1156 nmdc:mga0n895_165424_c1 3300050512 Bacteria 2244
1157 nmdc:mga0n895_177409_c1 3300050512 Bacteria 2162
1158 nmdc:mga0n895_19455_c1 3300050512 Bacteria 6312
1159 nmdc:mga0n895_303039_c1 3300050512 Bacteria 1620
1160 nmdc:mga0n895_3742_c1 3300050512 Bacteria 12312
1161 nmdc:mga0n895_4506_c2 3300050512 Bacteria 10814
1162 nmdc:mga0n895_462741_c1 3300050512 Unclassified 1280
1163 nmdc:mga0n895_93118_c1 3300050512 Bacteria 3017
1164 nmdc:mga0rr50_10072_c1 3300050513 Bacteria 5981
1165 nmdc:mga0rr50_275989_c1 3300050513 Bacteria 1402
1166 nmdc:mga0rr50_30584_c1 3300050513 Bacteria 3814
1167 nmdc:mga0rr50_50639_c1 3300050513 Bacteria 3078
1168 nmdc:mga0rr50_596847_c1 3300050513 Bacteria 941
1169 nmdc:mga0rr50_657422_c1 3300050513 Bacteria 894
1170 nmdc:mga0rr50_711556_c1 3300050513 Bacteria 857
1171 nmdc:mga0rr50_778579_c1 3300050513 Bacteria 816
1172 nmdc:mga08x19_320047_c1 3300050514 Bacteria 1079
1173 nmdc:mga0a205_1519039_c1 3300050515 Bacteria 518
1174 nmdc:mga0a205_29117_c1 3300050515 Bacteria 5285
1175 nmdc:mga0a205_2928_c1 3300050515 Bacteria 15120
1176 nmdc:mga0a205_322011_c1 3300050515 Bacteria 1417
1177 nmdc:mga0a205_670619_c1 3300050515 Bacteria 887
1178 nmdc:mga0a205_68910_c1 3300050515 Bacteria 3417
1179 nmdc:mga0a205_708_c1 3300050515 Bacteria 26770
1180 nmdc:mga0a205_71813_c2 3300050515 Unclassified 1800
1181 Ga0495601_0513993 3300053077 Bacteria 772
1182 Ga0501084_0609111 3300054114 Bacteria 923
1183 Ga0501084_1269642 3300054114 Bacteria 617
1184 Ga0501082_0140885 3300060353 Bacteria 2093
1185 Ga0501082_0654618 3300060353 Bacteria 919
1186 Ga0530510_0032700 3300061734 Bacteria 3744
1187 Ga0530510_0338317 3300061734 Bacteria 1130
1188 Ga0070698_100153286
1189 JGI24746J21847_1003852
1190 JGI24033J26618_1071756
1191 JGI25406J46586_10000210
1192 JGI25406J46586_10001441
1193 Ga0065714_10393758
1194 Ga0065704_10075134
1195 Ga0065704_10120579
1196 Ga0065704_10213091
1197 Ga0065704_10254809
1198 Ga0065704_10319194
1199 Ga0065712_10071657
1200 Ga0065712_10071874
1201 Ga0065712_10169372
1202 Ga0065712_10174808
1203 Ga0065712_10251681
1204 Ga0065712_10538648
1205 Ga0065712_10664258
1206 Ga0065715_10024922
1207 Ga0065715_10121975
1208 Ga0065715_10143961
1209 Ga0065715_10163838
1210 Ga0065715_10182550
1211 Ga0065715_10197291
1212 Ga0065715_10725975
1213 Ga0065707_10001927
1214 Ga0065707_10050056
1215 Ga0065707_10084472
1216 Ga0065707_10094961
1217 Ga0065707_10096043
1218 Ga0065707_10132434
1219 Ga0065707_10388273
1220 Ga0065707_10652118
1221 Ga0070658_10059977
1222 Ga0070676_10016430
1223 Ga0070676_10069242
1224 Ga0070676_10109584
1225 Ga0070676_10780116
1226 Ga0070676_10825837
1227 Ga0070683_100047386
1228 Ga0070690_100002748
1229 Ga0070690_100026065
1230 Ga0070690_100029220
1231 Ga0070690_100549049
1232 Ga0070690_101046345
1233 Ga0070670_100009691
1234 Ga0070670_100022639
1235 Ga0070670_100030264
1236 Ga0070670_100176869
1237 Ga0070670_100687108
1238 Ga0070670_100797971
1239 Ga0070670_101344252
1240 Ga0070677_10000945
1241 Ga0070677_10027340
1242 Ga0070677_10046985
1243 Ga0070677_10050838
1244 Ga0070677_10058752
1245 Ga0070677_10088916
1246 Ga0070677_10142668
1247 Ga0070677_10159545
1248 Ga0070677_10734172
1249 Ga0068869_100010054
1250 Ga0068869_100095036
1251 Ga0068869_100123913
1252 Ga0068869_100195829
1253 Ga0068869_100223081
1254 Ga0068869_100260548
1255 Ga0068869_100457707
1256 Ga0068869_100517233
1257 Ga0068869_100948271
1258 Ga0070666_10003269
1259 Ga0070666_10178717
1260 Ga0070666_10755938
1261 Ga0070680_100075424
1262 Ga0070680_100145383
1263 Ga0070680_100291612
1264 Ga0070680_100326479
1265 Ga0070680_100573539
1266 Ga0070680_100936502
1267 Ga0068868_100021467
1268 Ga0068868_100087568
1269 Ga0068868_100333185
1270 Ga0070689_100004279
1271 Ga0070689_100005732
1272 Ga0070689_100033784
1273 Ga0070689_100070837
1274 Ga0070689_100076528
1275 Ga0070689_100157928
1276 Ga0070689_100234086
1277 Ga0070689_101244848
1278 Ga0070689_101879171
1279 Ga0070691_10028106
1280 Ga0070691_10279703
1281 Ga0070691_10460254
1282 Ga0070691_10674880
1283 Ga0070687_100001643
1284 Ga0070687_100069454
1285 Ga0070687_100114372
1286 Ga0070687_100132079
1287 Ga0070687_100516688
1288 Ga0070687_101001505
1289 Ga0070661_100151681
1290 Ga0070661_100211714
1291 Ga0070661_100231237
1292 Ga0070661_100309796
1293 Ga0070661_100411220
1294 Ga0070661_100436735
1295 Ga0070661_100621200
1296 Ga0070692_10418776
1297 Ga0070692_11161023
1298 Ga0070668_100053903
1299 Ga0070668_100496510
1300 Ga0070668_101196026
1301 Ga0070669_100025602
1302 Ga0070669_100051015
1303 Ga0070669_100066848
1304 Ga0070669_100070596
1305 Ga0070669_100257436
1306 Ga0070669_100444193
1307 Ga0070669_100449252
1308 Ga0070669_100487768
1309 Ga0070675_100000179
1310 Ga0070675_100000385
1311 Ga0070675_100004051
1312 Ga0070675_100010384
1313 Ga0070675_100023997
1314 Ga0070675_100037355
1315 Ga0070675_100051572
1316 Ga0070675_100053204
1317 Ga0070675_100060562
1318 Ga0070675_100157409
1319 Ga0070675_100201688
1320 Ga0070675_100436644
1321 Ga0070675_100487205
1322 Ga0070675_100488178
1323 Ga0070675_100875418
1324 Ga0070675_101057096
1325 Ga0070671_100007197
1326 Ga0070671_100007699
1327 Ga0070671_100164277
1328 Ga0070671_100303372
1329 Ga0070671_100627059
1330 Ga0070671_101468959
1331 Ga0070674_100050496
1332 Ga0070674_100119931
1333 Ga0070674_100201901
1334 Ga0070674_100234307
1335 Ga0070674_100285675
1336 Ga0070674_100719484
1337 Ga0070674_100789825
1338 Ga0070673_100008003
1339 Ga0070673_100030705
1340 Ga0070673_100044745
1341 Ga0070673_100067492
1342 Ga0070673_100165363
1343 Ga0070673_100166927
1344 Ga0070673_100209842
1345 Ga0070673_100281825
1346 Ga0070673_100740375
1347 Ga0070673_101031490
1348 Ga0070688_100002830
1349 Ga0070688_100004619
1350 Ga0070688_100006025
1351 Ga0070688_100034885
1352 Ga0070688_100216154
1353 Ga0070688_100557797
1354 Ga0070688_100654188
1355 Ga0070659_100008173
1356 Ga0070659_100273881
1357 Ga0070659_100408608
1358 Ga0070659_100713161
1359 Ga0070659_100801913
1360 Ga0070659_101108557
1361 Ga0070659_102143706
1362 Ga0070667_100049281
1363 Ga0070667_100130901
1364 Ga0070667_100229863
1365 Ga0070667_100661840
1366 Ga0070667_101165033
1367 Ga0070667_101487619
1368 Ga0070703_10164398
1369 Ga0070713_100074560
1370 Ga0070701_10008685
1371 Ga0070701_10016079
1372 Ga0070701_10052410
1373 Ga0070701_10111894
1374 Ga0070701_10191086
1375 Ga0070701_10225889
1376 Ga0070701_10924414
1377 Ga0070705_100000746
1378 Ga0070705_100060904
1379 Ga0070700_100005562
1380 Ga0070700_100098767
1381 Ga0070700_100236231
1382 Ga0070700_100258876
1383 Ga0070700_100354676
1384 Ga0070700_100521196
1385 Ga0070700_101359183
1386 Ga0070700_102016335
1387 Ga0070694_100000370
1388 Ga0070694_100007196
1389 Ga0070694_100112507
1390 Ga0070694_100129251
1391 Ga0070694_100166238
1392 Ga0070694_100309589
1393 Ga0070694_100471367
1394 Ga0070694_100553024
1395 Ga0070694_100559358
1396 Ga0070694_101192957
1397 Ga0070708_100086208
1398 Ga0070708_101000895
1399 Ga0070708_101410725
1400 Ga0070663_100078390
1401 Ga0070663_101130740
1402 Ga0070663_102181633
1403 Ga0070678_100142212
1404 Ga0070678_100175098
1405 Ga0070678_100323591
1406 Ga0070678_100533180
1407 Ga0070678_101112909
1408 Ga0070678_101396278
1409 Ga0070662_100035902
1410 Ga0070662_100072366
1411 Ga0070662_100807188
1412 Ga0070662_101138027
1413 Ga0070662_101863449
1414 Ga0070681_10212602
1415 Ga0070681_11296078
1416 Ga0068867_100008687
1417 Ga0068867_100015612
1418 Ga0068867_100106852
1419 Ga0068867_100231612
1420 Ga0068867_100289238
1421 Ga0068867_101024970
1422 Ga0068867_101047955
1423 Ga0068867_102231695
1424 Ga0070685_10025976
1425 Ga0070685_10026560
1426 Ga0070685_10094780
1427 Ga0070685_11078461
1428 Ga0070706_101051151
1429 Ga0070706_101429669
1430 Ga0070706_101795351
1431 Ga0070707_100016751
1432 Ga0070707_100093026
1433 Ga0070707_100362175
1434 Ga0070707_100685081
1435 Ga0070707_100971031
1436 Ga0070707_101374185
1437 Ga0070698_100075821
1438 Ga0070698_100370610
1439 Ga0070698_100498419
1440 Ga0070698_101453586
1441 Ga0070699_100006431
1442 Ga0070699_100018848
1443 Ga0070699_100019972
1444 Ga0070699_100041847
1445 Ga0070699_100422881
1446 Ga0070699_100596236
1447 Ga0070699_101210602
1448 Ga0070699_101300620
1449 Ga0070679_101221835
1450 Ga0070684_100193534
1451 Ga0070684_101391172
1452 Ga0070697_101626636
1453 Ga0068853_100159623
1454 Ga0070672_100008155
1455 Ga0070672_100008378
1456 Ga0070672_100012183
1457 Ga0070672_100023729
1458 Ga0070672_100043955
1459 Ga0070672_100154602
1460 Ga0070672_100164507
1461 Ga0070672_100216203
1462 Ga0070672_100499597
1463 Ga0070672_100582286
1464 Ga0070686_100007258
1465 Ga0070686_100020856
1466 Ga0070686_100073297
1467 Ga0070686_101549218
1468 Ga0070695_100004458
1469 Ga0070695_100047225
1470 Ga0070695_100191602
1471 Ga0070695_100199257
1472 Ga0070696_100000965
1473 Ga0070696_100007198
1474 Ga0070696_100013145
1475 Ga0070696_100073884
1476 Ga0070693_100164882
1477 Ga0070693_100967409
1478 Ga0070665_100024814
1479 Ga0070665_101091339
1480 Ga0070665_101430664
1481 Ga0070704_100000234
1482 Ga0070704_100047372
1483 Ga0070704_100110013
1484 Ga0070704_100190033
1485 Ga0070704_100489210
1486 Ga0070704_100630511
1487 Ga0070704_100733234
1488 Ga0070704_101057849
1489 Ga0070664_100001259
1490 Ga0070664_100007187
1491 Ga0070664_100086237
1492 Ga0070664_100088020
1493 Ga0070664_100253191
1494 Ga0070664_100322568
1495 Ga0070664_100369897
1496 Ga0070664_100992649
1497 Ga0068857_100045272
1498 Ga0068857_100054093
1499 Ga0068857_100565815
1500 Ga0068857_100658375
1501 Ga0068857_100727832
1502 Ga0068857_101532407
1503 Ga0068857_101548127
1504 Ga0068854_100186243
1505 Ga0068854_100338798
1506 Ga0068854_101253736
1507 Ga0068856_101410343
1508 Ga0070702_100090494
1509 Ga0070702_100160807
1510 Ga0070702_100473581
1511 Ga0070702_100685826
1512 Ga0070702_101814533
1513 Ga0068852_100017699
1514 Ga0068859_100001202
1515 Ga0068859_100015638
1516 Ga0068859_100029485
1517 Ga0068859_100050949
1518 Ga0068859_100067434
1519 Ga0068859_100119903
1520 Ga0068859_100364602
1521 Ga0068859_100443355
1522 Ga0068859_102500394
1523 Ga0068859_102856938
1524 Ga0068864_100021615
1525 Ga0068864_100054988
1526 Ga0068864_100070924
1527 Ga0068864_100087506
1528 Ga0068864_100116922
1529 Ga0068864_101309808
1530 Ga0068864_101370505
1531 Ga0068864_102702887
1532 Ga0068866_11204490
1533 Ga0068861_100018811
1534 Ga0068861_100022665
1535 Ga0068861_100113756
1536 Ga0068861_100398612
1537 Ga0068861_100464780
1538 Ga0068861_100537909
1539 Ga0068861_101067006
1540 Ga0068851_10168041
1541 Ga0068870_10001437
1542 Ga0068870_10016054
1543 Ga0068870_10054295
1544 Ga0068870_10055887
1545 Ga0068870_10066674
1546 Ga0068870_10228889
1547 Ga0068870_10283738
1548 Ga0068870_10290775
1549 Ga0068870_10348386
1550 Ga0068870_10479064
1551 Ga0068863_100034099
1552 Ga0068863_100113132
1553 Ga0068863_100233139
1554 Ga0068863_100901242
1555 Ga0068863_102144659
1556 Ga0068858_100037048
1557 Ga0068858_100080275
1558 Ga0068858_100124976
1559 Ga0068858_100164441
1560 Ga0068858_100428248
1561 Ga0068858_100827232
1562 Ga0068860_100024633
1563 Ga0068860_100052886
1564 Ga0068860_100065930
1565 Ga0068860_101517368
1566 Ga0068862_100000554
1567 Ga0068862_100001194
1568 Ga0068862_100094438
1569 Ga0068862_100095088
1570 Ga0068862_100114884
1571 Ga0068862_100123011
1572 Ga0068862_100861258
1573 Ga0068862_100862309
1574 Ga0068862_101332248
1575 Ga0081455_10064715
1576 Ga0081455_10823628
1577 Ga0081539_10000093
1578 Ga0081539_10000535
1579 Ga0081539_10004525
1580 Ga0081539_10045059
1581 Ga0070717_10956523
1582 Ga0075432_10137073
1583 Ga0075432_10179469
1584 Ga0070712_100091699
1585 Ga0075427_10026889
1586 Ga0075427_10052400
1587 Ga0097621_100132548
1588 Ga0097621_100262723
1589 Ga0097621_100402451
1590 Ga0097621_100451932
1591 Ga0068871_100065745
1592 Ga0068871_100469436
1593 Ga0068871_101934868
1594 Ga0068871_102085786
1595 Ga0068871_102166447
1596 Ga0075428_100001298
1597 Ga0075428_100005299
1598 Ga0075428_100134637
1599 Ga0075428_100147078
1600 Ga0075428_100332889
1601 Ga0075428_100367084
1602 Ga0075428_100401314
1603 Ga0075428_101784743
1604 Ga0075430_100056948
1605 Ga0075430_100179647
1606 Ga0075430_100261664
1607 Ga0075430_100381187
1608 Ga0075430_101019980
1609 Ga0075430_101611475
1610 Ga0075430_101689050
1611 Ga0075431_100026579
1612 Ga0075431_100101258
1613 Ga0075431_100299102
1614 Ga0075431_100865085
1615 Ga0075433_10002098
1616 Ga0075433_10005810
1617 Ga0075433_10201654
1618 Ga0075433_10213870
1619 Ga0075433_10299576
1620 Ga0075434_100007857
1621 Ga0075434_100086029
1622 Ga0075434_100118602
1623 Ga0075434_100233564
1624 Ga0075434_100907146
1625 Ga0075429_100017823
1626 Ga0075429_100042246
1627 Ga0075429_100048682
1628 Ga0075429_100232053
1629 Ga0075429_100487841
1630 Ga0075429_100964471
1631 Ga0075429_101571367
1632 Ga0068865_100016987
1633 Ga0068865_100285302
1634 Ga0068865_100297527
1635 Ga0075436_100806740
1636 Ga0075436_100944624
1637 Ga0097620_100001202
1638 Ga0097620_100015638
1639 Ga0097620_100029484
1640 Ga0097620_100050950
1641 Ga0097620_100067434
1642 Ga0097620_100119898
1643 Ga0097620_100364604
1644 Ga0097620_100443324
1645 Ga0097620_102500161
1646 Ga0097620_102857023
1647 Ga0075435_100005103
1648 Ga0075435_100037651
1649 Ga0075435_100038469
1650 Ga0075435_100040007
1651 Ga0075435_100202184
1652 Ga0075435_100229848
1653 Ga0075435_101006198
1654 Ga0105244_10192167
1655 Ga0105240_10053659
1656 Ga0111539_10000937
1657 Ga0111539_10007215
1658 Ga0111539_10007947
1659 Ga0111539_10011336
1660 Ga0111539_10018172
1661 Ga0111539_10025633
1662 Ga0111539_10084703
1663 Ga0111539_10117974
1664 Ga0111539_10371569
1665 Ga0111539_10465252
1666 Ga0111539_10803388
1667 Ga0111539_10909443
1668 Ga0111539_10953555
1669 Ga0111539_10979355
1670 Ga0111539_11481864
1671 Ga0111539_11795832
1672 Ga0105245_10472517
1673 Ga0105245_12434449
1674 Ga0114129_10000428
1675 Ga0114129_10012760
1676 Ga0114129_10017625
1677 Ga0114129_10018975
1678 Ga0114129_10053286
1679 Ga0114129_10085809
1680 Ga0114129_10134421
1681 Ga0114129_10193248
1682 Ga0114129_10617236
1683 Ga0114129_11508167
1684 Ga0114129_11833931
1685 Ga0114129_12163651
1686 Ga0105243_10003500
1687 Ga0105243_10019534
1688 Ga0105243_10026196
1689 Ga0105243_10294650
1690 Ga0105243_10442306
1691 Ga0105243_10500322
1692 Ga0105243_10747708
1693 Ga0105243_10829908
1694 Ga0105243_11391817
1695 Ga0105243_11756760
1696 Ga0105243_11811964
1697 Ga0105241_10398014
1698 Ga0105242_10042378
1699 Ga0105242_10744195
1700 Ga0105242_11701641
1701 Ga0105242_13097705
1702 Ga0105248_10170987
1703 Ga0105248_10292287
1704 Ga0105248_10314752
1705 Ga0105248_10477645
1706 Ga0105238_10014597
1707 Ga0105238_10598065
1708 Ga0105238_12206496
1709 Ga0105249_10001435
1710 Ga0105249_10118865
1711 Ga0105249_10670558
1712 Ga0105249_11401680
1713 Ga0105249_11622080
1714 Ga0105239_10256227
1715 Ga0105239_11310687
1716 Ga0105246_10070854
1717 Ga0105246_10269911
1718 Ga0157342_1057940
1719 Ga0157371_10985500
1720 Ga0157371_11121535
1721 Ga0157374_10158541
1722 Ga0157374_10315161
1723 Ga0157374_10907191
1724 Ga0157374_11988004
1725 Ga0157378_11869302
1726 Ga0157378_11960267
1727 Ga0163162_10047240
1728 Ga0163162_10073222
1729 Ga0163162_10990023
1730 Ga0163162_11029431
1731 Ga0163162_11644828
1732 Ga0157375_10002396
1733 Ga0157375_10027796
1734 Ga0157375_10278416
1735 Ga0157375_10724158
1736 Ga0157375_10792387
1737 Ga0157375_10993226
1738 Ga0157375_11161694
1739 Ga0157375_11242734
1740 Ga0157375_11693659
1741 Ga0157375_12278120
1742 Ga0157375_12477688
1743 Ga0163163_10019474
1744 Ga0163163_10022372
1745 Ga0163163_10172773
1746 Ga0163163_10396001
1747 Ga0163163_10446717
1748 Ga0163163_10858827
1749 Ga0163163_11669873
1750 Ga0163163_11836788
1751 Ga0157380_10007797
1752 Ga0157380_10009711
1753 Ga0157380_10010846
1754 Ga0157380_10020944
1755 Ga0157380_10070467
1756 Ga0157380_10142449
1757 Ga0157380_10209190
1758 Ga0157380_10247577
1759 Ga0157380_10414575
1760 Ga0157380_10520452
1761 Ga0157380_10568264
1762 Ga0157380_10616661
1763 Ga0157380_10731610
1764 Ga0157380_10779863
1765 Ga0157380_10910431
1766 Ga0157380_11836330
1767 Ga0157380_12325199
1768 Ga0157377_10024220
1769 Ga0157377_10067338
1770 Ga0157377_10068506
1771 Ga0157377_10070914
1772 Ga0157377_10503958
1773 Ga0157377_10698043
1774 Ga0157377_10796669
1775 Ga0157379_10035666
1776 Ga0157376_10091248
1777 Ga0157376_10365942
1778 Ga0157376_10516584
1779 Ga0157376_12341692
1780 Ga0157376_12579652
1781 Ga0157376_13103274
1782 Ga0163161_10433369
1783 Ga0163161_10621962
1784 Ga0207666_1047458
1785 Ga0207666_1072199
1786 Ga0207673_1024191
1787 Ga0207697_10000701
1788 Ga0207697_10114923
1789 Ga0207697_10139490
1790 Ga0207697_10297672
1791 Ga0207697_10511332
1792 Ga0207656_10139231
1793 Ga0207653_10091341
1794 Ga0207682_10000378
1795 Ga0207682_10008600
1796 Ga0207682_10016592
1797 Ga0207682_10021145
1798 Ga0207682_10035377
1799 Ga0207682_10158617
1800 Ga0207682_10199402
1801 Ga0207682_10223792
1802 Ga0207682_10253183
1803 Ga0207688_10000628
1804 Ga0207688_10031253
1805 Ga0207688_10255878
1806 Ga0207680_10011142
1807 Ga0207680_10867810
1808 Ga0207680_11290523
1809 Ga0207647_10164504
1810 Ga0207645_10001911
1811 Ga0207645_10014270
1812 Ga0207645_10141205
1813 Ga0207645_10220213
1814 Ga0207645_10943526
1815 Ga0207643_10000925
1816 Ga0207643_10012789
1817 Ga0207643_10020502
1818 Ga0207643_10020871
1819 Ga0207643_10032012
1820 Ga0207643_10040543
1821 Ga0207643_10087731
1822 Ga0207643_10106227
1823 Ga0207643_10191613
1824 Ga0207643_10329576
1825 Ga0207643_10535407
1826 Ga0207654_10662121
1827 Ga0207707_10109972
1828 Ga0207695_10032450
1829 Ga0207693_10155175
1830 Ga0207660_10056606
1831 Ga0207660_10140288
1832 Ga0207660_10181975
1833 Ga0207660_10465273
1834 Ga0207660_10501512
1835 Ga0207662_10028554
1836 Ga0207662_10035421
1837 Ga0207662_10040686
1838 Ga0207662_10224656
1839 Ga0207662_10448578
1840 Ga0207662_10476016
1841 Ga0207657_10717245
1842 Ga0207649_10256683
1843 Ga0207649_10270704
1844 Ga0207652_10684169
1845 Ga0207652_10825763
1846 Ga0207646_10454714
1847 Ga0207646_10472670
1848 Ga0207646_11101233
1849 Ga0207681_10039064
1850 Ga0207681_10040362
1851 Ga0207681_10050672
1852 Ga0207681_10078889
1853 Ga0207681_10110465
1854 Ga0207681_10266055
1855 Ga0207681_10412790
1856 Ga0207681_10845870
1857 Ga0207694_10172413
1858 Ga0207694_10930394
1859 Ga0207650_10001613
1860 Ga0207650_10027981
1861 Ga0207650_10030923
1862 Ga0207650_10086526
1863 Ga0207650_10141203
1864 Ga0207650_10309605
1865 Ga0207650_10352799
1866 Ga0207650_10781382
1867 Ga0207650_11796210
1868 Ga0207659_10000228
1869 Ga0207659_10004292
1870 Ga0207659_10005741
1871 Ga0207659_10011671
1872 Ga0207659_10061680
1873 Ga0207659_10084137
1874 Ga0207659_10102634
1875 Ga0207659_10118544
1876 Ga0207659_10261247
1877 Ga0207659_10338258
1878 Ga0207659_10393321
1879 Ga0207659_10423279
1880 Ga0207659_10446788
1881 Ga0207659_10564538
1882 Ga0207659_11409882
1883 Ga0207687_10409984
1884 Ga0207700_10264985
1885 Ga0207644_10009869
1886 Ga0207644_10021899
1887 Ga0207644_10082446
1888 Ga0207644_10315516
1889 Ga0207644_10528307
1890 Ga0207644_11009791
1891 Ga0207690_10134241
1892 Ga0207690_10165789
1893 Ga0207690_10199129
1894 Ga0207690_11328817
1895 Ga0207706_10005892
1896 Ga0207706_10032854
1897 Ga0207706_10045538
1898 Ga0207706_10119323
1899 Ga0207706_11352436
1900 Ga0207686_10043976
1901 Ga0207686_10088161
1902 Ga0207686_10171973
1903 Ga0207709_10047414
1904 Ga0207709_10122590
1905 Ga0207709_10207360
1906 Ga0207709_10713745
1907 Ga0207709_10894340
1908 Ga0207670_10008582
1909 Ga0207670_10045730
1910 Ga0207670_10086419
1911 Ga0207670_10412158
1912 Ga0207670_10429747
1913 Ga0207670_10999308
1914 Ga0207669_10000517
1915 Ga0207669_10096969
1916 Ga0207669_10299849
1917 Ga0207669_10559571
1918 Ga0207669_11116208
1919 Ga0207704_10292220
1920 Ga0207704_10301122
1921 Ga0207704_10516581
1922 Ga0207691_10005381
1923 Ga0207691_10011876
1924 Ga0207691_10024642
1925 Ga0207691_10035476
1926 Ga0207691_10046739
1927 Ga0207691_10071076
1928 Ga0207691_10435508
1929 Ga0207691_10674966
1930 Ga0207691_10774774
1931 Ga0207691_10799559
1932 Ga0207711_10034751
1933 Ga0207711_10054765
1934 Ga0207711_11880631
1935 Ga0207689_10001594
1936 Ga0207689_10005493
1937 Ga0207689_10072548
1938 Ga0207689_10134402
1939 Ga0207689_10166820
1940 Ga0207689_10246992
1941 Ga0207689_11060166
1942 Ga0207679_10047164
1943 Ga0207679_10096493
1944 Ga0207679_10228570
1945 Ga0207679_10373351
1946 Ga0207679_10375310
1947 Ga0207679_10825747
1948 Ga0207679_11016980
1949 Ga0207679_11172431
1950 Ga0207679_12118165
1951 Ga0207651_10056892
1952 Ga0207651_10060271
1953 Ga0207651_10091471
1954 Ga0207651_10175029
1955 Ga0207651_10231169
1956 Ga0207651_10311305
1957 Ga0207651_10423904
1958 Ga0207651_10427128
1959 Ga0207651_10473263
1960 Ga0207651_10576192
1961 Ga0207651_11101295
1962 Ga0207651_11340898
1963 Ga0207712_10005897
1964 Ga0207712_10011699
1965 Ga0207668_10005977
1966 Ga0207668_10280678
1967 Ga0207668_10830473
1968 Ga0207640_10042877
1969 Ga0207640_10193226
1970 Ga0207640_10318729
1971 Ga0207640_10877609
1972 Ga0207640_11405118
1973 Ga0207658_10525516
1974 Ga0207658_10596119
1975 Ga0207658_10643461
1976 Ga0207658_10914922
1977 Ga0207677_10064811
1978 Ga0207677_10401306
1979 Ga0207703_10009949
1980 Ga0207703_10067639
1981 Ga0207703_10403808
1982 Ga0207703_10582738
1983 Ga0207703_10790443
1984 Ga0207639_10329675
1985 Ga0207678_10053959
1986 Ga0207678_10154060
1987 Ga0207678_10163014
1988 Ga0207678_10178375
1989 Ga0207678_10257068
1990 Ga0207678_11229932
1991 Ga0207708_10008381
1992 Ga0207708_10013147
1993 Ga0207708_10029168
1994 Ga0207708_10072262
1995 Ga0207708_10122686
1996 Ga0207708_10252726
1997 Ga0207708_10457960
1998 Ga0207708_10551626
1999 Ga0207708_10703057
2000 Ga0207708_11282323
2001 Ga0207708_11612216
2002 Ga0207708_11717474
2003 Ga0207702_11125643
2004 Ga0207641_10007161
2005 Ga0207641_10350939
2006 Ga0207641_11258153
2007 Ga0207641_12081158
2008 Ga0207648_10000163
2009 Ga0207648_10013761
2010 Ga0207648_10018129
2011 Ga0207648_10089986
2012 Ga0207648_10124738
2013 Ga0207648_10498706
2014 Ga0207648_10966358
2015 Ga0207648_10975542
2016 Ga0207676_10019508
2017 Ga0207676_10026259
2018 Ga0207676_10055207
2019 Ga0207676_10073147
2020 Ga0207676_11153103
2021 Ga0207676_11233635
2022 Ga0207674_10003394
2023 Ga0207674_10030026
2024 Ga0207674_10051550
2025 Ga0207674_10120389
2026 Ga0207674_10182081
2027 Ga0207674_10269346
2028 Ga0207674_10790839
2029 Ga0207674_11367583
2030 Ga0207675_100011812
2031 Ga0207675_100011858
2032 Ga0207675_100036803
2033 Ga0207675_100170564
2034 Ga0207675_100243641
2035 Ga0207675_100437139
2036 Ga0207675_100460422
2037 Ga0207675_100551708
2038 Ga0207683_10003680
2039 Ga0207683_10274424
2040 Ga0207683_10471445
2041 Ga0207683_10513857
2042 Ga0207683_10600586
2043 Ga0207683_11835105
2044 Ga0207698_10174732
2045 Ga0207698_11362088
2046 Ga0207698_11939842
2047 Ga0209973_1025191
2048 Ga0209969_1039070
2049 Ga0209968_1051979
2050 Ga0209971_1148006
2051 Ga0209998_10074901
2052 Ga0209974_10043181
2053 Ga0209974_10090409
2054 Ga0207428_10001366
2055 Ga0207428_10001370
2056 Ga0207428_10001377
2057 Ga0207428_10027437
2058 Ga0207428_10151616
2059 Ga0207428_10447717
2060 Ga0207428_10512855
2061 Ga0268266_10624105
2062 Ga0268266_12020066
2063 Ga0268265_10001766
2064 Ga0268265_10055223
2065 Ga0268265_10192823
2066 Ga0268265_10243218
2067 Ga0268265_10325822
2068 Ga0268265_10476722
2069 Ga0268264_10003737
2070 Ga0268264_10124573
2071 Ga0268264_10369296
2072 Ga0268264_11333281
2073 Ga0268264_11537508
2074 Ga0307408_100096208
2075 Ga0307408_100414157
2076 Ga0307408_100428671
2077 Ga0307408_101254379
2078 Ga0307405_10009847
2079 Ga0307405_10380425
2080 Ga0307405_11542767
2081 Ga0307405_11809247
2082 Ga0307413_10009844
2083 Ga0307413_10281633
2084 Ga0307413_11275001
2085 Ga0307410_10042471
2086 Ga0307410_10066083
2087 Ga0307410_10320800
2088 Ga0307410_10406669
2089 Ga0307406_10100615
2090 Ga0307406_10118697
2091 Ga0307407_10781071
2092 Ga0307407_11692185
2093 Ga0307412_10022850
2094 Ga0307412_10034865
2095 Ga0307412_10284266
2096 Ga0307412_11132187
2097 Ga0307409_100017933
2098 Ga0307409_101844382
2099 Ga0307416_100019771
2100 Ga0307416_100134077
2101 Ga0307416_100167775
2102 Ga0307416_100209223
2103 Ga0307416_100500465
2104 Ga0307416_100626468
2105 Ga0307416_101324765
2106 Ga0307414_10602726
2107 Ga0307414_12219817
2108 Ga0307411_10072904
2109 Ga0307411_11389046
2110 Ga0307415_100117006
2111 Ga0307415_100281641
2112 Ga0373958_0009786
2113 Ga0373928_0217731
2114 Ga0373929_0128783
2115 Ga0373940_0030968
2116 Ga0373949_0070799
2117 Ga0373951_0114533
2118 Ga0373952_0027431
2119 Ga0373932_0252930
2120 Ga0373939_0018013
2121 Ga0373939_0028506
2122 Ga0373943_0806730
2123 Ga0373961_0031381
2124 Ga0373961_0143681
2125 Ga0373962_0124031
2126 Ga0373924_0120483
2127 Ga0373931_0058440
2128 Ga0373927_0450668
2129 Ga0373947_0629347
2130 Ga0373947_1217889
2131 Ga0373937_0055977
2132 Ga0439436_0260972
2133 Ga0439439_0213581
2134 Ga0439453_0004211
2135 Ga0439453_0006905
2136 Ga0439461_0091504
2137 Ga0451807_1168084
2138 Ga0451807_2232228
2139 Ga0451847_0949984
2140 Ga0451853_0959504
2141 Ga0451853_3567470
2142 Ga0439433_0136495
2143 Ga0439433_0142521
2144 Ga0439443_010689
2145 Ga0439443_110657
2146 Ga0439448_0145621
2147 Ga0439454_059682
2148 Ga0439455_0256413
2149 Ga0450920_094723
2150 Ga0450923_014718
2151 Ga0450923_033703
2152 Ga0450894_005331
2153 Ga0450894_083539
2154 Ga0450895_004034
2155 Ga0450896_000018
2156 Ga0450896_017019
2157 Ga0450899_008460
2158 Ga0450906_076472
2159 Ga0439446_0028799
2160 Ga0450908_019100
2161 Ga0439435_0254669
2162 Ga0439444_0014313
2163 Ga0439444_0041675
2164 Ga0450918_057283
2165 Ga0439440_0015856
2166 Ga0453683_0112590
2167 Ga0453684_2307783
2168 Ga0451576_0019237
2169 Ga0451576_0026272
2170 Ga0451576_0359990
2171 Ga0451576_0491262
2172 Ga0451576_0546914
2173 Ga0451576_1742139
2174 Ga0495603_0337785
2175 Ga0495629_0002871
2176 Ga0495629_0500995
2177 Ga0495582_0625472
2178 Ga0495584_0071812
2179 Ga0495584_0217443
2180 Ga0495594_0004891
2181 Ga0495637_0291436
2182 Ga0495643_0003489
2183 Ga0495644_0376231
2184 Ga0495663_0006606
2185 Ga0495663_0092499
2186 Ga0495642_0042366
2187 Ga0495642_0115201
2188 Ga0495642_0334115
2189 Ga0495642_0568432
2190 Ga0495598_0001849
2191 Ga0495598_0024717
2192 Ga0495598_0034557
2193 Ga0495598_0036781
2194 Ga0495598_0049498
2195 Ga0495598_0180944
2196 Ga0495598_0314796
2197 Ga0495609_0243767
2198 Ga0495621_0004705
2199 Ga0495621_0024309
2200 Ga0495621_0060589
2201 Ga0495621_0105142
2202 Ga0495621_0139139
2203 Ga0495621_0416563
2204 Ga0495621_0421921
2205 Ga0495645_0305622
2206 Ga0495622_0470224
2207 Ga0495633_0041948
2208 Ga0495633_0315285
2209 Ga0495656_0383231
2210 Ga0495656_0634392
2211 Ga0495656_0802045
2212 Ga0495634_0771190
2213 Ga0495659_0001340
2214 Ga0495659_0012172
2215 Ga0495659_0067005
2216 Ga0495659_0144483
2217 Ga0495659_0166897
2218 Ga0495659_0326938
2219 Ga0495659_0335321
2220 Ga0495659_0488952
2221 Ga0495588_0115979
2222 Ga0495588_0462388
2223 Ga0495588_0737196
2224 Ga0495623_0140831
2225 Ga0495647_0096108
2226 Ga0495647_0161558
2227 Ga0495647_0292659
2228 Ga0495647_0425644
2229 Ga0495658_0026690
2230 Ga0495658_0057627
2231 Ga0495658_0562783
2232 Ga0495669_0039387
2233 Ga0495669_0072754
2234 Ga0495669_0330850
2235 Ga0495670_0015678
2236 Ga0495670_0288090
2237 Ga0495670_0341236
2238 Ga0495581_0666746
2239 Ga0495636_0044549
2240 Ga0495636_0076549
2241 Ga0495636_0294948
2242 Ga0495636_0424533
2243 Ga0495674_0283834
2244 Ga0495677_0038697
2245 Ga0495685_166666
2246 Ga0495684_0497393
2247 Ga0496106_0427882
2248 Ga0496108_0919473
2249 Ga0496109_0099373
2250 Ga0496110_1349718
2251 Ga0496112_0301961
2252 Ga0496113_0253112
2253 Ga0501292_032876
2254 Ga0501300_032849
2255 Ga0501036_0084680
2256 Ga0501036_0372873
2257 Ga0501037_0481944
2258 Ga0501039_0038767
2259 Ga0501039_0368618
2260 Ga0501040_0024019
2261 Ga0501040_0129278
2262 Ga0501040_0842956
2263 Ga0501041_0224499
2264 Ga0501042_0224295
2265 Ga0501042_0260100
2266 Ga0501042_0396530
2267 Ga0501042_0854245
2268 Ga0501043_0132921
2269 Ga0501046_0397213
2270 Ga0501048_0035209
2271 Ga0501068_0386933
2272 Ga0501070_0839164
2273 Ga0501071_0234674
2274 Ga0501071_1146868
2275 Ga0501072_0194492
2276 Ga0501073_0468738
2277 Ga0501074_0535874
2278 Ga0501075_0124437
2279 Ga0501075_0508487
2280 Ga0501075_1114528
2281 Ga0501076_0316458
2282 Ga0501076_0780081
2283 Ga0501077_0110105
2284 Ga0501077_0401437
2285 Ga0501217_050284
2286 Ga0501217_328131
2287 Ga0501223_055276
2288 Ga0501221_114570
2289 Ga0501225_0109591
2290 Ga0501245_093759
2291 Ga0501079_0033766
2292 Ga0501079_0062746
2293 Ga0501079_1221750
2294 Ga0501081_0023984
2295 Ga0501081_0903507
2296 Ga0501283_006867
2297 Ga0501045_0064197
2298 nmdc:mga05p37_136036_c1
2299 nmdc:mga05p37_198327_c1
2300 nmdc:mga05p37_206549_c1
2301 nmdc:mga05p37_280939_c1
2302 nmdc:mga05p37_4324_c1
2303 nmdc:mga05p37_583365_c1
2304 nmdc:mga05p37_602466_c1
2305 nmdc:mga05p37_62156_c1
2306 nmdc:mga05p37_638290_c1
2307 nmdc:mga09592_1026021_c1
2308 nmdc:mga09592_103934_c1
2309 nmdc:mga09592_10882_c1
2310 nmdc:mga09592_135878_c1
2311 nmdc:mga09592_1412671_c1
2312 nmdc:mga09592_19125_c1
2313 nmdc:mga09592_246359_c1
2314 nmdc:mga09592_60164_c1
2315 nmdc:mga09592_69042_c1
2316 nmdc:mga0qj67_1412576_c1
2317 nmdc:mga0qj67_24967_c1
2318 nmdc:mga0qj67_313572_c1
2319 nmdc:mga0qj67_33632_c1
2320 nmdc:mga0qj67_821609_c1
2321 nmdc:mga0qj67_970209_c1
2322 nmdc:mga06r32_1225942_c1
2323 nmdc:mga06r32_1847966_c1
2324 nmdc:mga06r32_20427_c1
2325 nmdc:mga06r32_237647_c1
2326 nmdc:mga06r32_307369_c1
2327 nmdc:mga06r32_62930_c1
2328 nmdc:mga06r32_716119_c1
2329 nmdc:mga08y16_1036_c2
2330 nmdc:mga08y16_1115665_c1
2331 nmdc:mga08y16_124522_c1
2332 nmdc:mga08y16_163142_c1
2333 nmdc:mga08y16_164849_c1
2334 nmdc:mga08y16_1789166_c1
2335 nmdc:mga08y16_222762_c1
2336 nmdc:mga08y16_23988_c1
2337 nmdc:mga08y16_28438_c1
2338 nmdc:mga08y16_34609_c1
2339 nmdc:mga08y16_494187_c1
2340 nmdc:mga08y16_743_c1
2341 nmdc:mga08y16_786723_c1
2342 nmdc:mga08y16_93469_c1
2343 nmdc:mga0n895_165424_c1
2344 nmdc:mga0n895_177409_c1
2345 nmdc:mga0n895_19455_c1
2346 nmdc:mga0n895_303039_c1
2347 nmdc:mga0n895_3742_c1
2348 nmdc:mga0n895_4506_c2
2349 nmdc:mga0n895_462741_c1
2350 nmdc:mga0n895_93118_c1
2351 nmdc:mga0rr50_10072_c1
2352 nmdc:mga0rr50_275989_c1
2353 nmdc:mga0rr50_30584_c1
2354 nmdc:mga0rr50_50639_c1
2355 nmdc:mga0rr50_596847_c1
2356 nmdc:mga0rr50_657422_c1
2357 nmdc:mga0rr50_711556_c1
2358 nmdc:mga0rr50_778579_c1
2359 nmdc:mga08x19_320047_c1
2360 nmdc:mga0a205_1519039_c1
2361 nmdc:mga0a205_29117_c1
2362 nmdc:mga0a205_2928_c1
2363 nmdc:mga0a205_322011_c1
2364 nmdc:mga0a205_670619_c1
2365 nmdc:mga0a205_68910_c1
2366 nmdc:mga0a205_708_c1
2367 nmdc:mga0a205_71813_c2
2368 Ga0495601_0513993
2369 Ga0501084_0609111
2370 Ga0501084_1269642
2371 Ga0501082_0140885
2372 Ga0501082_0654618
2373 Ga0530510_0032700
2374 Ga0530510_0338317

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

50

125

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zps-assembly1.cif.gz_A crystal structure of methanobacterium thermoautotrophicum phosphoribosyl-amp cyclohydrolase hisi 0.9665 9 104
7bgm-assembly1.cif.gz_A crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway 0.9635 5 102
7bgm-assembly1.cif.gz_B crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway 0.959 5 101
7bgn-assembly1.cif.gz_B crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9555 5 102
7bgn-assembly1.cif.gz_A crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9549 5 102
ID Description Score Start End Superfamily
af_Q2FUU3_250_343_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.973 1 85 3.10.20.810
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9716 9 85 3.10.20.810
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9497 5 90 3.10.20.810
af_P9WMM7_1_97_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9425 5 85 3.10.20.810
af_A0A1D8PKY7_169_272_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9121 5 90 3.10.20.810
ID Description Score Start End GO Terms
AF-A0A2V8E5X9-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9922 10 102 GO:0000105
GO:0004635
AF-A0A0P7WMM4-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9864 1 98 GO:0000105
GO:0004635
AF-A0A7C1FXE9-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9839 2 104 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A7C6FY49-F1-model_v4 Histidine biosynthesis bifunctional protein HisIE [Includes: Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19); Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31)] 0.9832 2 98 GO:0000105
GO:0004635
GO:0004636
GO:0005524
GO:0005737
AF-A0A0G0JPF9-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9831 9 102 GO:0000105
GO:0004635

Map