F491355

General Info

Members Datasets Scaffolds Average Seq Length
1184 565 1072 159

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0003241|Ga0466969_0003241_6087_6617
Length 176
Sequence MDTTAAPAVLSEPSTDPSEAAVEDAPWLTAAEQRLWRAHLEVSRLLMYQLERELQPYGLSNNDYTILVELSEAPQRRMRMTDLAVATLQSKSRLSHQITRMEAAGLVTRDTCPGDRRGLFAVLTEQGWQTMRRVAPHHVRSVREHFIDRFDEDQLASMYEALAPVAEHLRELRGRG

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
8 2643221548 Streptomyces sp. Root55 Isolate Unclassified
9 2643221578 Streptomyces sp. Root63 Isolate Unclassified
10 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
11 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
12 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
13 2643221647 Streptomyces sp. Root369 Isolate Unclassified
14 2643221670 Streptomyces sp. Root431 Isolate Unclassified
15 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
16 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
17 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
18 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
19 2643221714 Streptomyces sp. Root264 Isolate Unclassified
20 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
21 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
22 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
23 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
24 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
25 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
26 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
27 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
28 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
29 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
30 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
31 2808606448 Streptomyces sp. 193411 Isolate Unclassified
32 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
33 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
34 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
35 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
36 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
37 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
38 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
39 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
40 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
41 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
42 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
43 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
44 2862574272 Streptomyces sp. AcE210 Isolate Nodule
45 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
46 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
47 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
48 2867369537 Streptomyces sp. Z26 Isolate Unclassified
49 2867428634 Streptomyces sp. RP5T Isolate Unclassified
50 2867475112 Streptomyces sp. TM32 Isolate Unclassified
51 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
52 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
53 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
54 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
55 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
56 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
57 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
58 2891562705 Microbispora tritici MT50 Isolate Unclassified
59 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
60 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
61 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
62 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
63 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
64 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
65 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
66 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
67 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
68 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
69 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
70 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
71 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
72 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
73 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
74 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
75 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
76 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
77 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
78 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
79 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
80 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
81 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
82 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
83 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
84 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
85 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
86 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
87 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
88 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
89 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
90 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
91 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
92 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
93 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
94 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
96 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
97 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
98 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
99 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
100 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
101 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
102 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
104 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
105 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
106 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
107 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
108 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
109 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
110 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
111 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
112 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
113 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
114 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
115 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
116 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
117 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
118 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
119 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
120 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
121 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
122 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
123 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
124 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
125 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
126 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
127 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
128 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
129 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
130 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
131 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
132 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
133 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
134 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
135 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
136 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
137 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
138 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
139 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
140 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
141 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
142 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
143 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
144 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
145 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
146 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
147 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
148 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
149 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
150 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
151 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
152 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
153 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
154 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
155 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
156 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
157 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
158 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
159 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
160 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
161 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
162 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
163 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
164 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
165 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
166 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
167 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
168 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
169 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
170 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
171 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
172 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
173 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
174 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
175 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
176 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
177 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
178 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
179 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
180 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
181 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
182 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
183 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
184 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
185 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
186 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
187 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
188 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
189 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
190 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
191 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
192 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
195 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
197 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
199 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
200 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
201 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
202 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
252 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
255 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
256 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
257 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
258 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
259 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
260 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
263 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
264 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
265 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
266 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
267 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
268 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
269 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
270 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
271 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
272 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
273 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
274 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
275 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
276 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
277 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
278 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
279 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
280 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
281 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
282 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
283 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
284 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
285 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
286 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
287 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
288 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
289 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
290 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
291 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
292 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
293 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
294 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
295 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
296 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
297 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
298 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
299 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
300 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
301 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
302 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
303 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
304 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
305 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
306 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
307 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
308 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
309 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
310 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
311 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
312 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
313 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
314 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
315 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
316 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
317 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
318 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
319 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
320 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
321 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
322 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
323 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
324 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
325 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
326 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
327 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
328 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
329 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
330 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
331 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
332 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
333 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
334 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
335 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
336 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
337 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
338 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
339 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
340 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
341 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
342 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
343 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
344 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
345 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
346 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
347 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
348 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
349 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
350 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
351 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
352 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
353 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
354 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
355 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
356 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
357 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
358 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
359 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
360 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
361 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
362 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
363 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
364 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
365 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
366 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
367 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
368 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
369 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
370 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
371 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
372 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
373 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
374 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
375 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
376 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
377 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
378 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
379 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
380 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
381 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
382 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
383 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
384 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
385 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
386 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
387 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
388 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
389 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
390 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
391 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
392 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
393 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
394 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
395 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
396 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
397 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
398 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
399 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
400 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
401 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
402 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
403 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
404 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
405 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
406 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
407 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
408 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
409 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
410 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
411 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
412 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
413 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
414 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
415 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
416 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
417 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
418 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
419 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
420 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
421 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
422 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
423 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
424 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
425 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
426 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
427 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
428 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
429 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
430 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
431 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
432 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
433 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
434 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
435 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
436 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
437 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
438 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
439 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
440 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
441 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
442 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
443 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
444 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
445 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
446 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
447 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
448 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
449 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
450 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
451 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
452 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
453 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
454 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
455 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
456 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
457 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
462 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
463 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
472 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
475 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
478 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
479 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
483 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
484 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
485 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
486 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
487 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
488 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
489 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
490 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
491 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
492 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
493 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
494 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
495 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
496 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
498 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
499 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
500 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
501 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
502 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
503 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
504 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
505 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
506 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
507 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
508 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
509 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
510 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
511 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
512 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
513 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
514 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
515 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
516 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
517 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
518 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
519 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
520 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
521 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
522 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
523 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
524 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
525 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
526 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
527 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
528 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
529 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
530 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
531 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
532 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
533 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
534 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
535 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
536 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
545 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
546 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
547 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
548 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
549 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
550 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
551 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
552 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
553 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
554 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
555 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
556 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
557 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
558 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
559 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
560 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
561 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
562 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
563 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
564 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
565 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.25
Metatranscriptomes 3.29
Isolates 9.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.89
Nodule 0.25
Rhizoplane 2.36
Rhizosphere 83.19
Stem 0
Stem Tuber 0.08
Unclassified 10.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10008412 3300002075 Bacteria 2348
2 JGI25406J46586_10001472 3300003203 Bacteria 11106
3 Ga0006758J48902_1016282 3300003300 Bacteria 539
4 Ga0006777J48905_1014226 3300003308 Bacteria 807
5 rootH1_10005406 3300003316 Bacteria 4715
6 rootH1_10035274 3300003316 Bacteria 3206
7 rootH2_10018527 3300003320 Bacteria 4980
8 rootH2_10084890 3300003320 Bacteria 1129
9 rootH2_10148651 3300003320 Bacteria 2078
10 rootH1_10091099 3300003323 Bacteria 3489
11 JGI25160J50197_1024881 3300003354 Bacteria 1689
12 JGI25160J50197_1032890 3300003354 Bacteria 1312
13 Ga0007429J51699_1022096 3300003579 Bacteria 566
14 Ga0058861_12008866 3300004800 Bacteria 836
15 Ga0070658_10171134 3300005327 Bacteria 1824
16 Ga0070683_100006536 3300005329 Bacteria 9790
17 Ga0070683_100095325 3300005329 Bacteria 2798
18 Ga0070683_100438750 3300005329 Bacteria 1246
19 Ga0070690_100810923 3300005330 Unclassified 726
20 Ga0070670_100802416 3300005331 Bacteria 850
21 Ga0070680_100021287 3300005336 Bacteria 5152
22 Ga0070660_100659235 3300005339 Bacteria 876
23 Ga0070661_100367626 3300005344 Bacteria 1131
24 Ga0070668_100285973 3300005347 Bacteria 1379
25 Ga0070668_100587733 3300005347 Bacteria 973
26 Ga0070674_100157779 3300005356 Bacteria 1718
27 Ga0070673_100187500 3300005364 Bacteria 1774
28 Ga0070659_100332214 3300005366 Bacteria 1272
29 Ga0070659_100908527 3300005366 Bacteria 770
30 Ga0070667_100121550 3300005367 Bacteria 2271
31 Ga0070709_10025748 3300005434 Bacteria 3478
32 Ga0070709_10039672 3300005434 Bacteria 2890
33 Ga0070709_10085969 3300005434 Bacteria 2063
34 Ga0070709_10133484 3300005434 Bacteria 1697
35 Ga0070709_10868909 3300005434 Bacteria 711
36 Ga0070714_100004044 3300005435 Bacteria 11021
37 Ga0070714_100109541 3300005435 Bacteria 2443
38 Ga0070714_100127885 3300005435 Bacteria 2267
39 Ga0070714_100523069 3300005435 Bacteria 1133
40 Ga0070714_100816644 3300005435 Bacteria 903
41 Ga0070714_100845027 3300005435 Bacteria 888
42 Ga0070714_101161205 3300005435 Bacteria 753
43 Ga0070713_100243560 3300005436 Bacteria 1638
44 Ga0070713_100884842 3300005436 Bacteria 858
45 Ga0070710_10103161 3300005437 Bacteria 1702
46 Ga0070710_10104590 3300005437 Bacteria 1691
47 Ga0070710_10837933 3300005437 Bacteria 659
48 Ga0070711_100113640 3300005439 Bacteria 1991
49 Ga0070711_100129637 3300005439 Bacteria 1877
50 Ga0070711_100204606 3300005439 Bacteria 1525
51 Ga0070711_101011128 3300005439 Bacteria 713
52 Ga0070694_100075814 3300005444 Bacteria 2327
53 Ga0070708_100003731 3300005445 Bacteria 11945
54 Ga0070663_100125838 3300005455 Bacteria 1941
55 Ga0070662_100117947 3300005457 Bacteria 2031
56 Ga0070685_10018280 3300005466 Bacteria 3767
57 Ga0070706_100008655 3300005467 Bacteria 9484
58 Ga0070706_100091325 3300005467 Bacteria 2824
59 Ga0070706_100183832 3300005467 Bacteria 1952
60 Ga0070706_100541154 3300005467 Bacteria 1083
61 Ga0070707_100012429 3300005468 Bacteria 7951
62 Ga0070707_100025575 3300005468 Bacteria 5603
63 Ga0070707_100042124 3300005468 Bacteria 4370
64 Ga0070698_100001201 3300005471 Bacteria 28730
65 Ga0070698_100034761 3300005471 Bacteria 5215
66 Ga0070698_100147517 3300005471 Bacteria 2301
67 Ga0070698_100304028 3300005471 Bacteria 1526
68 Ga0070698_100466314 3300005471 Bacteria 1199
69 Ga0070699_100001397 3300005518 Bacteria 22204
70 Ga0070679_100020257 3300005530 Bacteria 6482
71 Ga0070684_100211337 3300005535 Bacteria 1768
72 Ga0070684_100307367 3300005535 Bacteria 1456
73 Ga0070684_101046713 3300005535 Bacteria 766
74 Ga0070697_100004674 3300005536 Bacteria 10498
75 Ga0070672_100071426 3300005543 Bacteria 2762
76 Ga0070672_101586958 3300005543 Bacteria 587
77 Ga0070695_100133462 3300005545 Bacteria 1713
78 Ga0070696_100416789 3300005546 Bacteria 1053
79 Ga0070665_100339480 3300005548 Bacteria 1507
80 Ga0070665_100343290 3300005548 Bacteria 1498
81 Ga0070664_100017308 3300005564 Bacteria 5917
82 Ga0068857_100041495 3300005577 Bacteria 4080
83 Ga0068854_100470375 3300005578 Bacteria 1053
84 Ga0068856_100069718 3300005614 Bacteria 3477
85 Ga0068856_100182712 3300005614 Bacteria 2111
86 Ga0068856_100679071 3300005614 Bacteria 1050
87 Ga0068852_100605205 3300005616 Bacteria 1100
88 Ga0068859_101542260 3300005617 Bacteria 733
89 Ga0068859_101875324 3300005617 Bacteria 662
90 Ga0068866_10071750 3300005718 Bacteria 1832
91 Ga0068870_10598728 3300005840 Bacteria 749
92 Ga0068860_100461120 3300005843 Bacteria 1264
93 Ga0068862_100825965 3300005844 Bacteria 907
94 Ga0081455_10124405 3300005937 Bacteria 2026
95 Ga0081540_1000009 3300005983 Bacteria 193562
96 Ga0070717_10007214 3300006028 Bacteria 8244
97 Ga0070717_10268281 3300006028 Bacteria 1511
98 Ga0070717_10288147 3300006028 Bacteria 1457
99 Ga0070717_10481654 3300006028 Bacteria 1120
100 Ga0070717_10701645 3300006028 Bacteria 919
101 Ga0070717_10958469 3300006028 Bacteria 779
102 Ga0070717_10968958 3300006028 Unclassified 774
103 Ga0075368_10033951 3300006042 Bacteria 1986
104 Ga0075363_100249174 3300006048 Bacteria 1022
105 Ga0070715_10019913 3300006163 Bacteria 2580
106 Ga0070716_100121416 3300006173 Bacteria 1636
107 Ga0070716_100131151 3300006173 Bacteria 1584
108 Ga0070712_100003385 3300006175 Bacteria 9809
109 Ga0070712_100031793 3300006175 Bacteria 3558
110 Ga0070712_100284293 3300006175 Bacteria 1333
111 Ga0070712_100692174 3300006175 Bacteria 868
112 Ga0070712_100745901 3300006175 Bacteria 837
113 Ga0075434_100403247 3300006871 Bacteria 1388
114 Ga0068865_100851440 3300006881 Bacteria 790
115 Ga0075436_100133238 3300006914 Bacteria 1743
116 Ga0075436_100429864 3300006914 Bacteria 960
117 Ga0075436_100514443 3300006914 Unclassified 877
118 Ga0097620_101542226 3300006931 Bacteria 733
119 Ga0097620_101875024 3300006931 Bacteria 662
120 Ga0075435_100227732 3300007076 Bacteria 1583
121 Ga0099794_10337837 3300007265 Bacteria 782
122 Ga0105251_10073150 3300009011 Bacteria 1593
123 Ga0105251_10109922 3300009011 Bacteria 1256
124 Ga0105244_10285605 3300009036 Bacteria 765
125 Ga0105250_10045640 3300009092 Bacteria 1757
126 Ga0105240_10229594 3300009093 Bacteria 2158
127 Ga0105245_10163986 3300009098 Bacteria 2111
128 Ga0105247_10797995 3300009101 Bacteria 720
129 Ga0105243_10173590 3300009148 Bacteria 1869
130 Ga0105241_10415761 3300009174 Bacteria 1182
131 Ga0105248_10627474 3300009177 Bacteria 1213
132 Ga0105237_11260386 3300009545 Bacteria 746
133 Ga0105238_10569133 3300009551 Bacteria 1138
134 Ga0105028_129068 3300009993 Bacteria 614
135 Ga0105239_10411233 3300010375 Bacteria 1532
136 Ga0105239_10956721 3300010375 Bacteria 984
137 Ga0105239_11418126 3300010375 Bacteria 802
138 Ga0105246_10006671 3300011119 Bacteria 7059
139 Ga0105246_10575366 3300011119 Bacteria 969
140 Ga0105246_10656982 3300011119 Bacteria 913
141 Ga0105246_10891373 3300011119 Bacteria 797
142 Ga0157341_1018722 3300012494 Bacteria 665
143 Ga0157315_1004244 3300012508 Bacteria 1015
144 Ga0157373_10321146 3300013100 Bacteria 1101
145 Ga0157371_10033294 3300013102 Bacteria 3703
146 Ga0157369_10034777 3300013105 Bacteria 5527
147 Ga0157369_10175083 3300013105 Bacteria 2259
148 Ga0157374_11277102 3300013296 Bacteria 756
149 Ga0157372_10371645 3300013307 Bacteria 1666
150 Ga0163163_10136261 3300014325 Bacteria 2496
151 Ga0182008_10001523 3300014497 Bacteria 15449
152 Ga0157377_10375702 3300014745 Bacteria 961
153 Ga0157379_10304147 3300014968 Bacteria 1454
154 Ga0182006_1024939 3300015261 Bacteria 2461
155 Ga0182007_10005632 3300015262 Bacteria 5469
156 Ga0182005_1017915 3300015265 Bacteria 1958
157 Ga0183367_1002 3300015688 Bacteria 1101531
158 Ga0163161_11007753 3300017792 Bacteria 711
159 Ga0197907_11416890 3300020069 Bacteria 869
160 Ga0206356_10810878 3300020070 Bacteria 2156
161 Ga0206356_11359384 3300020070 Bacteria 1113
162 Ga0206351_10861184 3300020077 Bacteria 728
163 Ga0206352_10879267 3300020078 Bacteria 936
164 Ga0206350_10981988 3300020080 Bacteria 899
165 Ga0206350_11340047 3300020080 Bacteria 953
166 Ga0206354_11543200 3300020081 Bacteria 1028
167 Ga0206353_10730323 3300020082 Bacteria 1924
168 Ga0206353_11306639 3300020082 Bacteria 1205
169 Ga0154015_1480972 3300020610 Bacteria 623
170 Ga0213875_10002694 3300021388 Bacteria 10486
171 Ga0213875_10003336 3300021388 Bacteria 9163
172 Ga0213875_10022923 3300021388 Bacteria 2985
173 Ga0213875_10024438 3300021388 Bacteria 2881
174 Ga0213875_10322704 3300021388 Bacteria 732
175 Ga0224712_10445971 3300022467 Bacteria 621
176 Ga0228598_1008297 3300024227 Bacteria 2101
177 Ga0209758_1002043 3300025297 Bacteria 21643
178 Ga0207426_1002336 3300025302 Bacteria 12383
179 Ga0207426_1007124 3300025302 Bacteria 4727
180 Ga0207426_1029138 3300025302 Bacteria 1824
181 Ga0207426_1068987 3300025302 Bacteria 992
182 Ga0207655_1179439 3300025728 Bacteria 648
183 Ga0207713_1038278 3300025735 Bacteria 2036
184 Ga0207653_10051332 3300025885 Unclassified 1373
185 Ga0207692_10022907 3300025898 Bacteria 2881
186 Ga0207692_10845615 3300025898 Bacteria 600
187 Ga0207642_10209825 3300025899 Bacteria 1081
188 Ga0207688_10091412 3300025901 Bacteria 1748
189 Ga0207647_10006463 3300025904 Bacteria 8519
190 Ga0207647_10082703 3300025904 Bacteria 1923
191 Ga0207699_10003180 3300025906 Bacteria 7813
192 Ga0207699_10009261 3300025906 Bacteria 4895
193 Ga0207699_10019000 3300025906 Bacteria 3654
194 Ga0207643_10007955 3300025908 Bacteria 5689
195 Ga0207684_10033691 3300025910 Bacteria 4357
196 Ga0207684_10072689 3300025910 Bacteria 2921
197 Ga0207684_10618009 3300025910 Bacteria 925
198 Ga0207707_10200009 3300025912 Bacteria 1742
199 Ga0207671_10621702 3300025914 Bacteria 861
200 Ga0207693_10010984 3300025915 Bacteria 7339
201 Ga0207693_10020666 3300025915 Bacteria 5235
202 Ga0207693_10346259 3300025915 Bacteria 1163
203 Ga0207663_10008261 3300025916 Bacteria 5434
204 Ga0207660_10302102 3300025917 Bacteria 1274
205 Ga0207657_10022671 3300025919 Bacteria 5868
206 Ga0207649_10220986 3300025920 Bacteria 1349
207 Ga0207652_10941951 3300025921 Bacteria 761
208 Ga0207646_10012425 3300025922 Bacteria 8184
209 Ga0207646_10023703 3300025922 Bacteria 5634
210 Ga0207646_10042204 3300025922 Bacteria 4099
211 Ga0207681_11180768 3300025923 Bacteria 643
212 Ga0207659_10116885 3300025926 Bacteria 2037
213 Ga0207700_10016756 3300025928 Bacteria 4878
214 Ga0207700_10091383 3300025928 Bacteria 2404
215 Ga0207700_10191375 3300025928 Bacteria 1719
216 Ga0207700_10243403 3300025928 Bacteria 1534
217 Ga0207700_10275158 3300025928 Bacteria 1446
218 Ga0207664_10018165 3300025929 Bacteria 5168
219 Ga0207664_10019807 3300025929 Bacteria 4979
220 Ga0207664_10049825 3300025929 Bacteria 3299
221 Ga0207664_10082344 3300025929 Bacteria 2621
222 Ga0207664_10119578 3300025929 Bacteria 2203
223 Ga0207664_10245304 3300025929 Bacteria 1561
224 Ga0207664_10291023 3300025929 Bacteria 1435
225 Ga0207644_10357328 3300025931 Bacteria 1187
226 Ga0207690_10602544 3300025932 Bacteria 897
227 Ga0207706_10022821 3300025933 Bacteria 5614
228 Ga0207709_10034710 3300025935 Bacteria 2975
229 Ga0207670_10022698 3300025936 Bacteria 3893
230 Ga0207669_10319878 3300025937 Bacteria 1187
231 Ga0207704_10131259 3300025938 Bacteria 1735
232 Ga0207665_10010016 3300025939 Bacteria 6224
233 Ga0207665_10037081 3300025939 Bacteria 3243
234 Ga0207665_10138798 3300025939 Bacteria 1731
235 Ga0207665_10165343 3300025939 Bacteria 1594
236 Ga0207691_10031590 3300025940 Bacteria 4940
237 Ga0207691_10112106 3300025940 Bacteria 2425
238 Ga0207711_10232356 3300025941 Bacteria 1689
239 Ga0207661_10182912 3300025944 Bacteria 1832
240 Ga0207667_10681492 3300025949 Bacteria 1031
241 Ga0207651_10351869 3300025960 Bacteria 1241
242 Ga0207668_10186162 3300025972 Unclassified 1642
243 Ga0207640_11122703 3300025981 Bacteria 696
244 Ga0207639_10117241 3300026041 Bacteria 2182
245 Ga0207639_10614582 3300026041 Bacteria 1003
246 Ga0207678_11124097 3300026067 Bacteria 696
247 Ga0207708_10506191 3300026075 Bacteria 1013
248 Ga0207702_10005527 3300026078 Bacteria 11045
249 Ga0207702_10479286 3300026078 Bacteria 1210
250 Ga0207641_11908027 3300026088 Bacteria 595
251 Ga0207676_11782984 3300026095 Bacteria 614
252 Ga0207674_10020822 3300026116 Bacteria 7079
253 Ga0207675_100091161 3300026118 Bacteria 2866
254 Ga0207683_10001450 3300026121 Bacteria 21423
255 Ga0209371_1022012 3300027312 Bacteria 1533
256 Ga0209371_1046036 3300027312 Bacteria 859
257 Ga0209813_10009115 3300027866 Bacteria 2528
258 Ga0268266_10174059 3300028379 Bacteria 1955
259 Ga0268266_10320364 3300028379 Bacteria 1451
260 Ga0268266_10387713 3300028379 Bacteria 1319
261 Ga0268264_10335073 3300028381 Bacteria 1435
262 Ga0307517_10006432 3300028786 Bacteria 17390
263 Ga0307517_10013995 3300028786 Bacteria 10829
264 Ga0307515_10019441 3300028794 Bacteria 12219
265 Ga0307515_10054034 3300028794 Bacteria 5907
266 Ga0265338_10038691 3300028800 Bacteria 4513
267 Ga0268256_1024711 3300030500 Bacteria 1537
268 Ga0268256_1044065 3300030500 Bacteria 980
269 Ga0307511_10002529 3300030521 Bacteria 19097
270 Ga0307511_10062255 3300030521 Bacteria 2834
271 Ga0307511_10156723 3300030521 Bacteria 1290
272 Ga0307512_10018157 3300030522 Bacteria 6432
273 Ga0307512_10035855 3300030522 Bacteria 4218
274 Ga0265767_101432 3300030836 Bacteria 1170
275 Ga0265760_10011674 3300031090 Bacteria 2510
276 Ga0265760_10117098 3300031090 Bacteria 853
277 Ga0307513_10017315 3300031456 Bacteria 8643
278 Ga0307513_10116425 3300031456 Bacteria 2652
279 Ga0307513_10123568 3300031456 Bacteria 2549
280 Ga0307509_10020553 3300031507 Bacteria 7486
281 Ga0307509_10111935 3300031507 Bacteria 2731
282 Ga0307508_10021810 3300031616 Bacteria 5827
283 Ga0307508_10041733 3300031616 Bacteria 4116
284 Ga0307508_10048027 3300031616 Bacteria 3803
285 Ga0307508_10171956 3300031616 Bacteria 1769
286 Ga0307508_10215710 3300031616 Bacteria 1519
287 Ga0307508_10351689 3300031616 Bacteria 1065
288 Ga0307514_10017130 3300031649 Bacteria 5964
289 Ga0307514_10034987 3300031649 Bacteria 4001
290 Ga0307514_10115479 3300031649 Bacteria 1889
291 Ga0307514_10180619 3300031649 Bacteria 1361
292 Ga0307516_10001694 3300031730 Bacteria 30318
293 Ga0307516_10069325 3300031730 Bacteria 3392
294 Ga0307516_10259869 3300031730 Bacteria 1427
295 Ga0307413_10434098 3300031824 Bacteria 1038
296 Ga0307518_10234128 3300031838 Bacteria 1185
297 Ga0307518_10267199 3300031838 Bacteria 1071
298 Ga0307409_101042037 3300031995 Bacteria 837
299 Ga0307416_102577154 3300032002 Bacteria 606
300 Ga0307415_100154543 3300032126 Bacteria 1770
301 Ga0307507_10065610 3300033179 Bacteria 3336
302 Ga0307507_10094796 3300033179 Bacteria 2535
303 Ga0307510_10047845 3300033180 Bacteria 4572
304 Ga0307510_10075253 3300033180 Bacteria 3330
305 Ga0307510_10414676 3300033180 Bacteria 789
306 Ga0373930_0004467 3300034816 Bacteria 2279
307 Ga0373948_0034847 3300034817 Bacteria 1031
308 Ga0373958_0161341 3300034819 Bacteria 567
309 Ga0373938_0050244 3300034957 Bacteria 951
310 Ga0373926_0000765 3300035083 Bacteria 9006
311 Ga0373926_0001515 3300035083 Bacteria 7113
312 Ga0373928_0106764 3300035084 Bacteria 737
313 Ga0373934_0003049 3300035086 Bacteria 6118
314 Ga0373934_0009621 3300035086 Bacteria 3623
315 Ga0373944_0000224 3300035089 Bacteria 12254
316 Ga0373944_0012535 3300035089 Bacteria 2338
317 Ga0373923_0001164 3300035111 Bacteria 7315
318 Ga0373923_0015531 3300035111 Bacteria 2876
319 Ga0373923_0047425 3300035111 Bacteria 1790
320 Ga0373932_0031095 3300035112 Bacteria 1485
321 Ga0373936_0000334 3300035113 Bacteria 15965
322 Ga0373936_0013060 3300035113 Bacteria 3167
323 Ga0373936_0139665 3300035113 Bacteria 1045
324 Ga0373941_0353539 3300035115 Bacteria 598
325 Ga0373945_0000228 3300035116 Bacteria 15386
326 Ga0373945_0011604 3300035116 Bacteria 2915
327 Ga0373953_0024122 3300035117 Bacteria 2309
328 Ga0373953_0064125 3300035117 Bacteria 1506
329 Ga0373953_0122074 3300035117 Bacteria 1107
330 Ga0373954_0017279 3300035118 Bacteria 3238
331 Ga0373954_0017440 3300035118 Bacteria 3225
332 Ga0373956_0003365 3300035119 Bacteria 6439
333 Ga0373956_0052379 3300035119 Bacteria 1835
334 Ga0373957_0019021 3300035120 Bacteria 2411
335 Ga0373960_0082514 3300035121 Bacteria 1015
336 Ga0373960_0138682 3300035121 Bacteria 822
337 Ga0373943_0002009 3300035170 Bacteria 9214
338 Ga0373943_0013785 3300035170 Bacteria 3654
339 Ga0373943_0390413 3300035170 Bacteria 802
340 Ga0373946_0000096 3300035171 Bacteria 24568
341 Ga0373946_0000515 3300035171 Bacteria 12831
342 Ga0373955_0044853 3300035172 Bacteria 2383
343 Ga0373955_0053401 3300035172 Bacteria 2206
344 Ga0373955_0135427 3300035172 Bacteria 1440
345 Ga0373955_0401001 3300035172 Bacteria 833
346 Ga0373955_0424072 3300035172 Bacteria 809
347 Ga0373942_0020308 3300035207 Bacteria 1667
348 Ga0373962_0184121 3300035242 Unclassified 700
349 Ga0373924_0012279 3300035410 Bacteria 3197
350 Ga0373924_0035196 3300035410 Bacteria 2030
351 Ga0373931_0009215 3300035691 Bacteria 4714
352 Ga0373935_0004359 3300035692 Bacteria 8306
353 Ga0373935_0039125 3300035692 Bacteria 2972
354 Ga0373927_0001355 3300035695 Bacteria 18458
355 Ga0373927_0045993 3300035695 Bacteria 2824
356 Ga0373933_0018935 3300035724 Bacteria 3878
357 Ga0373933_0034929 3300035724 Bacteria 2933
358 Ga0373933_0431084 3300035724 Bacteria 861
359 Ga0373947_0000887 3300035725 Bacteria 18078
360 Ga0373947_0060518 3300035725 Bacteria 2299
361 Ga0373947_0136608 3300035725 Bacteria 1569
362 Ga0373947_0419450 3300035725 Bacteria 904
363 Ga0373937_0012529 3300036401 Bacteria 7460
364 Ga0373937_0094505 3300036401 Bacteria 2772
365 Ga0373937_0123048 3300036401 Bacteria 2418
366 Ga0373937_0128069 3300036401 Bacteria 2369
367 Ga0373937_0414883 3300036401 Bacteria 1277
368 Ga0372808_025407 3300036459 Bacteria 851
369 Ga0373925_0012546 3300037068 Bacteria 6140
370 Ga0373925_0025268 3300037068 Bacteria 4338
371 Ga0373925_0216829 3300037068 Bacteria 1526
372 Ga0373925_0248399 3300037068 Bacteria 1426
373 Ga0395900_0493198 3300037418 Bacteria 1176
374 Ga0395898_0005934 3300037466 Bacteria 13118
375 Ga0395898_0029812 3300037466 Bacteria 5461
376 Ga0395898_1085852 3300037466 Bacteria 734
377 Ga0436364_0166036 3300037853 Bacteria 1699
378 Ga0436364_0321419 3300037853 Bacteria 2008
379 Ga0436364_0340069 3300037853 Bacteria 1323
380 Ga0436364_0356204 3300037853 Bacteria 846
381 Ga0436364_0584067 3300037853 Bacteria 157477
382 Ga0436364_0585418 3300037853 Bacteria 2999
383 Ga0436364_0667270 3300037853 Bacteria 158868
384 Ga0436364_0894301 3300037853 Bacteria 12265
385 Ga0436364_0976891 3300037853 Bacteria 1862
386 Ga0436364_1247794 3300037853 Bacteria 1433
387 Ga0395901_0004321 3300038443 Bacteria 14345
388 Ga0436365_1421416 3300039437 Bacteria 597
389 Ga0436360_0208252 3300039438 Bacteria 797
390 Ga0436360_0236768 3300039438 Bacteria 733
391 Ga0436360_0274104 3300039438 Unclassified 664
392 Ga0436361_0046152 3300039447 Bacteria 706
393 Ga0436363_0426389 3300039450 Bacteria 1014
394 Ga0436363_1443462 3300039450 Bacteria 885
395 Ga0436363_1570653 3300039450 Bacteria 2115
396 Ga0436362_0983991 3300039453 Bacteria 792
397 Ga0436362_1292336 3300039453 Unclassified 882
398 Ga0439436_0012288 3300041404 Bacteria 2599
399 Ga0439436_0019687 3300041404 Bacteria 2013
400 Ga0439439_0001796 3300041406 Bacteria 4383
401 Ga0451787_359134 3300041441 Bacteria 599
402 Ga0451791_1205736 3300041451 Bacteria 732
403 Ga0451802_1987063 3300041460 Bacteria 1019
404 Ga0451804_0436132 3300041463 Bacteria 1031
405 Ga0451807_1543669 3300041486 Unclassified 690
406 Ga0451833_0239514 3300041491 Bacteria 773
407 Ga0451837_0778280 3300041494 Bacteria 2269
408 Ga0451841_0429692 3300041498 Bacteria 1634
409 Ga0451845_0895553 3300041501 Bacteria 732
410 Ga0451853_2320900 3300041512 Bacteria 3539
411 Ga0451853_2374569 3300041512 Bacteria 6049
412 Ga0451853_2502482 3300041512 Bacteria 785
413 Ga0451853_2847812 3300041512 Bacteria 1174
414 Ga0439433_0000279 3300041999 Bacteria 8738
415 Ga0439442_003766 3300042002 Bacteria 3002
416 Ga0439448_0046552 3300042005 Bacteria 1413
417 Ga0439449_0047343 3300042007 Bacteria 1592
418 Ga0439449_0101207 3300042007 Bacteria 1065
419 Ga0439449_0121145 3300042007 Bacteria 971
420 Ga0439450_063864 3300042008 Bacteria 894
421 Ga0439455_0039978 3300042012 Bacteria 1198
422 Ga0439457_000721 3300042014 Bacteria 9804
423 Ga0439457_002443 3300042014 Bacteria 5312
424 Ga0439457_045983 3300042014 Bacteria 976
425 Ga0439462_0002910 3300042015 Bacteria 4054
426 Ga0450920_044482 3300042122 Bacteria 887
427 Ga0450890_059547 3300042127 Bacteria 596
428 Ga0450898_013530 3300042134 Bacteria 1361
429 Ga0450899_000745 3300042135 Bacteria 3706
430 Ga0450900_019218 3300042136 Bacteria 942
431 Ga0450903_001883 3300042138 Bacteria 3807
432 Ga0450906_000226 3300042145 Bacteria 10823
433 Ga0439458_0005506 3300042157 Bacteria 2847
434 Ga0450908_016280 3300042184 Bacteria 1327
435 Ga0466969_0002485 3300044656 Bacteria 9841
436 Ga0466969_0003241 3300044656 Bacteria 8659
437 Ga0466969_0050663 3300044656 Bacteria 2046
438 Ga0466969_0055615 3300044656 Bacteria 1935
439 Ga0466969_0404869 3300044656 Bacteria 619
440 Ga0466972_0003351 3300044658 Bacteria 7937
441 Ga0466972_0017124 3300044658 Bacteria 3624
442 Ga0466972_0025927 3300044658 Bacteria 2904
443 Ga0466972_0193031 3300044658 Bacteria 954
444 Ga0466972_0431652 3300044658 Bacteria 618
445 Ga0466965_0109129 3300044683 Bacteria 1421
446 Ga0466966_0003158 3300044684 Bacteria 10843
447 Ga0466966_0006738 3300044684 Bacteria 7607
448 Ga0466966_0012255 3300044684 Bacteria 5680
449 Ga0466961_0024718 3300044693 Bacteria 3864
450 Ga0466961_0025584 3300044693 Bacteria 3795
451 Ga0466961_0037580 3300044693 Bacteria 3106
452 Ga0466961_0055353 3300044693 Bacteria 2529
453 Ga0466963_0005506 3300044694 Bacteria 7410
454 Ga0466963_0025453 3300044694 Bacteria 3774
455 Ga0466963_0028605 3300044694 Bacteria 3581
456 Ga0466964_0030772 3300044706 Bacteria 2125
457 Ga0466964_0067983 3300044706 Bacteria 1499
458 Ga0466964_0396070 3300044706 Bacteria 720
459 Ga0466971_0001389 3300044719 Bacteria 10160
460 Ga0466971_0053086 3300044719 Bacteria 1826
461 Ga0466971_0054585 3300044719 Bacteria 1800
462 Ga0466968_0479983 3300044735 Bacteria 617
463 Ga0466970_0002309 3300044765 Bacteria 9221
464 Ga0466970_0116074 3300044765 Bacteria 1464
465 Ga0466970_0117800 3300044765 Bacteria 1453
466 Ga0466957_0232532 3300044842 Bacteria 1221
467 Ga0466957_0337788 3300044842 Bacteria 1019
468 Ga0466960_0004566 3300044901 Bacteria 5427
469 Ga0466960_0180345 3300044901 Bacteria 1144
470 Ga0466959_0001895 3300045049 Bacteria 13168
471 Ga0466959_0003319 3300045049 Bacteria 10505
472 Ga0466959_0004806 3300045049 Bacteria 9122
473 Ga0466959_0758306 3300045049 Unclassified 649
474 Ga0466958_0070757 3300045836 Bacteria 2135
475 Ga0466958_0308253 3300045836 Bacteria 1017
476 Ga0466958_0660370 3300045836 Bacteria 681
477 Ga0466958_0784552 3300045836 Bacteria 621
478 Ga0466958_0802254 3300045836 Bacteria 614
479 Ga0466967_0011974 3300045976 Bacteria 6609
480 Ga0466967_0025672 3300045976 Bacteria 4861
481 Ga0466967_0049282 3300045976 Bacteria 3682
482 Ga0466967_0137166 3300045976 Bacteria 2276
483 Ga0466967_0664839 3300045976 Bacteria 1031
484 Ga0466967_0689780 3300045976 Bacteria 1011
485 Ga0495617_214352 3300046452 Bacteria 599
486 Ga0495592_0013789 3300046454 Bacteria 6145
487 Ga0495592_0017207 3300046454 Bacteria 5490
488 Ga0495592_0021680 3300046454 Bacteria 4886
489 Ga0495592_0064286 3300046454 Bacteria 2689
490 Ga0495592_0162390 3300046454 Bacteria 1536
491 Ga0495592_0185555 3300046454 Bacteria 1413
492 Ga0495603_0001170 3300046455 Bacteria 15283
493 Ga0495603_0001759 3300046455 Bacteria 12757
494 Ga0495603_0003763 3300046455 Bacteria 9021
495 Ga0495603_0007613 3300046455 Bacteria 6518
496 Ga0495603_0131380 3300046455 Bacteria 1458
497 Ga0495603_0138178 3300046455 Bacteria 1418
498 Ga0495603_0212275 3300046455 Bacteria 1117
499 Ga0495590_0024466 3300046457 Bacteria 2127
500 Ga0495590_0161883 3300046457 Bacteria 814
501 Ga0495629_0002692 3300046459 Bacteria 13615
502 Ga0495629_0005448 3300046459 Bacteria 9489
503 Ga0495629_0008361 3300046459 Bacteria 7612
504 Ga0495629_0008455 3300046459 Bacteria 7577
505 Ga0495629_0014435 3300046459 Bacteria 5683
506 Ga0495629_0032184 3300046459 Bacteria 3714
507 Ga0495629_0041614 3300046459 Bacteria 3233
508 Ga0495629_0101167 3300046459 Bacteria 2011
509 Ga0495629_0156787 3300046459 Bacteria 1581
510 Ga0495629_0206749 3300046459 Bacteria 1356
511 Ga0495629_0330914 3300046459 Bacteria 1041
512 Ga0495638_0095648 3300046460 Bacteria 1783
513 Ga0495638_0247645 3300046460 Bacteria 984
514 Ga0495641_0009687 3300046461 Bacteria 5694
515 Ga0495641_0024612 3300046461 Bacteria 2968
516 Ga0495651_0001653 3300046462 Bacteria 17272
517 Ga0495651_0002577 3300046462 Bacteria 14014
518 Ga0495651_0014489 3300046462 Bacteria 6094
519 Ga0495651_0040615 3300046462 Bacteria 3617
520 Ga0495651_0049806 3300046462 Bacteria 3233
521 Ga0495651_0053092 3300046462 Bacteria 3121
522 Ga0495651_0139162 3300046462 Bacteria 1762
523 Ga0495651_0147922 3300046462 Bacteria 1696
524 Ga0495653_0004910 3300046463 Bacteria 10854
525 Ga0495653_0009521 3300046463 Bacteria 7946
526 Ga0495653_0015160 3300046463 Bacteria 6283
527 Ga0495653_0066028 3300046463 Bacteria 2722
528 Ga0495653_0135933 3300046463 Bacteria 1734
529 Ga0495653_0168432 3300046463 Bacteria 1514
530 Ga0495653_0414898 3300046463 Bacteria 853
531 Ga0495650_0169531 3300046471 Bacteria 774
532 Ga0495580_0001943 3300046472 Bacteria 18146
533 Ga0495580_0026504 3300046472 Bacteria 4225
534 Ga0495582_0000741 3300046473 Bacteria 18037
535 Ga0495582_0105904 3300046473 Bacteria 1577
536 Ga0495605_0008865 3300046474 Bacteria 5670
537 Ga0495639_0002161 3300046475 Bacteria 8668
538 Ga0495639_0103628 3300046475 Bacteria 1345
539 Ga0495662_0001192 3300046476 Bacteria 12825
540 Ga0495662_0003402 3300046476 Bacteria 8063
541 Ga0495662_0037091 3300046476 Bacteria 2354
542 Ga0495662_0045311 3300046476 Bacteria 2123
543 Ga0495662_0063821 3300046476 Bacteria 1779
544 Ga0495662_0066015 3300046476 Bacteria 1749
545 Ga0495662_0077396 3300046476 Bacteria 1615
546 Ga0495662_0082165 3300046476 Bacteria 1567
547 Ga0495662_0191117 3300046476 Bacteria 1009
548 Ga0495664_0000282 3300046477 Bacteria 24266
549 Ga0495664_0000962 3300046477 Bacteria 14809
550 Ga0495664_0005505 3300046477 Bacteria 6953
551 Ga0495664_0013862 3300046477 Bacteria 4570
552 Ga0495664_0061339 3300046477 Bacteria 2239
553 Ga0495664_0112678 3300046477 Bacteria 1642
554 Ga0495664_0157756 3300046477 Bacteria 1376
555 Ga0495585_0009401 3300046492 Bacteria 5864
556 Ga0495585_0182554 3300046492 Bacteria 1078
557 Ga0495585_0378970 3300046492 Bacteria 683
558 Ga0495594_0002260 3300046499 Bacteria 10036
559 Ga0495594_0026432 3300046499 Bacteria 3122
560 Ga0495594_0046749 3300046499 Bacteria 2377
561 Ga0495594_0058145 3300046499 Bacteria 2135
562 Ga0495594_0106393 3300046499 Bacteria 1580
563 Ga0495596_0055282 3300046500 Bacteria 1551
564 Ga0495607_0021008 3300046501 Bacteria 4113
565 Ga0495607_0069409 3300046501 Bacteria 1972
566 Ga0495607_0140903 3300046501 Bacteria 1244
567 Ga0495583_0101987 3300046506 Bacteria 1224
568 Ga0495606_0201596 3300046507 Bacteria 1133
569 Ga0495608_0000475 3300046511 Bacteria 27866
570 Ga0495608_0021905 3300046511 Bacteria 4382
571 Ga0495608_0023637 3300046511 Bacteria 4210
572 Ga0495608_0050637 3300046511 Bacteria 2755
573 Ga0495608_0109718 3300046511 Bacteria 1774
574 Ga0495608_0155355 3300046511 Bacteria 1456
575 Ga0495608_0313751 3300046511 Bacteria 969
576 Ga0495610_0026281 3300046512 Bacteria 3110
577 Ga0495618_0007301 3300046514 Bacteria 6686
578 Ga0495618_0107407 3300046514 Bacteria 1787
579 Ga0495618_0107503 3300046514 Bacteria 1786
580 Ga0495618_0111160 3300046514 Bacteria 1754
581 Ga0495618_0123278 3300046514 Bacteria 1659
582 Ga0495620_0121679 3300046515 Bacteria 1028
583 Ga0495628_0000710 3300046516 Bacteria 30813
584 Ga0495628_0011936 3300046516 Bacteria 7327
585 Ga0495628_0023600 3300046516 Bacteria 5047
586 Ga0495628_0040088 3300046516 Bacteria 3744
587 Ga0495628_0125974 3300046516 Bacteria 1962
588 Ga0495628_0352775 3300046516 Bacteria 1081
589 Ga0495628_0517841 3300046516 Bacteria 859
590 Ga0495630_0001986 3300046517 Bacteria 14252
591 Ga0495630_0010159 3300046517 Bacteria 6785
592 Ga0495630_0029888 3300046517 Bacteria 4052
593 Ga0495630_0058729 3300046517 Bacteria 2884
594 Ga0495630_0110163 3300046517 Bacteria 2085
595 Ga0495630_0299668 3300046517 Bacteria 1228
596 Ga0495631_0003642 3300046518 Bacteria 8409
597 Ga0495631_0129231 3300046518 Bacteria 1086
598 Ga0495631_0212547 3300046518 Bacteria 826
599 Ga0495637_0024557 3300046520 Bacteria 2727
600 Ga0495643_0001554 3300046522 Bacteria 20479
601 Ga0495643_0001610 3300046522 Bacteria 19994
602 Ga0495644_0334376 3300046523 Bacteria 595
603 Ga0495648_0104390 3300046524 Bacteria 1556
604 Ga0495666_0002890 3300046526 Bacteria 8600
605 Ga0495666_0009938 3300046526 Bacteria 4751
606 Ga0495666_0066325 3300046526 Bacteria 1721
607 Ga0495666_0101342 3300046526 Bacteria 1356
608 Ga0495652_0049924 3300046529 Bacteria 3579
609 Ga0495652_0073721 3300046529 Bacteria 2841
610 Ga0495652_0115282 3300046529 Bacteria 2153
611 Ga0495652_0120132 3300046529 Bacteria 2097
612 Ga0495652_0135059 3300046529 Bacteria 1947
613 Ga0495652_0234635 3300046529 Bacteria 1369
614 Ga0495652_0261247 3300046529 Bacteria 1278
615 Ga0495652_0393119 3300046529 Unclassified 983
616 Ga0495652_0485286 3300046529 Bacteria 859
617 Ga0495654_0022533 3300046530 Bacteria 3269
618 Ga0495665_0000906 3300046531 Bacteria 15593
619 Ga0495665_0005660 3300046531 Bacteria 6742
620 Ga0495665_0090627 3300046531 Bacteria 1606
621 Ga0495665_0460580 3300046531 Bacteria 642
622 Ga0495640_0001961 3300046533 Bacteria 16417
623 Ga0495640_0002320 3300046533 Bacteria 15277
624 Ga0495640_0015848 3300046533 Bacteria 5656
625 Ga0495640_0024254 3300046533 Bacteria 4414
626 Ga0495640_0035145 3300046533 Bacteria 3548
627 Ga0495640_0067264 3300046533 Bacteria 2413
628 Ga0495640_0115581 3300046533 Bacteria 1748
629 Ga0495640_0158249 3300046533 Bacteria 1453
630 Ga0495586_0017357 3300046535 Bacteria 3826
631 Ga0495586_0435644 3300046535 Bacteria 755
632 Ga0495587_0003804 3300046536 Bacteria 10013
633 Ga0495587_0026748 3300046536 Bacteria 3514
634 Ga0495587_0038914 3300046536 Bacteria 2849
635 Ga0495587_0055943 3300046536 Bacteria 2322
636 Ga0495587_0125953 3300046536 Bacteria 1465
637 Ga0495587_0331419 3300046536 Bacteria 849
638 Ga0495609_0004574 3300046538 Bacteria 7518
639 Ga0495609_0058435 3300046538 Bacteria 1706
640 Ga0495597_0062272 3300046542 Bacteria 1623
641 Ga0495645_0003107 3300046543 Bacteria 11254
642 Ga0495645_0040226 3300046543 Bacteria 3411
643 Ga0495645_0040384 3300046543 Bacteria 3404
644 Ga0495645_0041548 3300046543 Bacteria 3353
645 Ga0495645_0055725 3300046543 Bacteria 2870
646 Ga0495645_0102662 3300046543 Bacteria 2032
647 Ga0495645_0191232 3300046543 Bacteria 1394
648 Ga0495622_0005508 3300046557 Bacteria 5870
649 Ga0495622_0084844 3300046557 Bacteria 1457
650 Ga0495622_0215087 3300046557 Bacteria 853
651 Ga0495622_0374443 3300046557 Bacteria 615
652 Ga0495633_0095427 3300046558 Bacteria 1381
653 Ga0495667_0010218 3300046559 Bacteria 6353
654 Ga0495667_0017248 3300046559 Bacteria 4877
655 Ga0495667_0089327 3300046559 Bacteria 1997
656 Ga0495667_0101014 3300046559 Bacteria 1866
657 Ga0495667_0113481 3300046559 Bacteria 1751
658 Ga0495667_0136192 3300046559 Bacteria 1583
659 Ga0495667_0175690 3300046559 Bacteria 1375
660 Ga0495667_0209159 3300046559 Bacteria 1247
661 Ga0495667_0534015 3300046559 Bacteria 733
662 Ga0495656_0266167 3300046615 Bacteria 870
663 Ga0495656_0490228 3300046615 Bacteria 651
664 Ga0495634_0001381 3300046642 Bacteria 21858
665 Ga0495634_0014605 3300046642 Bacteria 5656
666 Ga0495634_0015448 3300046642 Bacteria 5486
667 Ga0495634_0026394 3300046642 Bacteria 4054
668 Ga0495634_0060612 3300046642 Bacteria 2517
669 Ga0495634_0066359 3300046642 Bacteria 2389
670 Ga0495634_0069780 3300046642 Bacteria 2317
671 Ga0495634_0221785 3300046642 Bacteria 1167
672 Ga0495611_0028329 3300046648 Bacteria 2451
673 Ga0495611_0041868 3300046648 Bacteria 2044
674 Ga0495625_0007829 3300046660 Bacteria 9211
675 Ga0495625_0018691 3300046660 Bacteria 5399
676 Ga0495625_0183510 3300046660 Bacteria 1390
677 Ga0495635_0006651 3300046663 Bacteria 8072
678 Ga0495635_0015815 3300046663 Bacteria 5270
679 Ga0495635_0026450 3300046663 Bacteria 4036
680 Ga0495635_0042810 3300046663 Bacteria 3125
681 Ga0495635_0143959 3300046663 Bacteria 1623
682 Ga0495635_0149885 3300046663 Bacteria 1587
683 Ga0495635_0179437 3300046663 Bacteria 1439
684 Ga0495635_0294182 3300046663 Bacteria 1089
685 Ga0495635_0343008 3300046663 Bacteria 997
686 Ga0495661_0163666 3300046665 Bacteria 1192
687 Ga0495588_0006288 3300046674 Bacteria 5342
688 Ga0495588_0019662 3300046674 Bacteria 3310
689 Ga0495588_0119137 3300046674 Bacteria 1391
690 Ga0495588_0275311 3300046674 Bacteria 887
691 Ga0495588_0361310 3300046674 Bacteria 763
692 Ga0495588_0364185 3300046674 Bacteria 759
693 Ga0495657_0002972 3300046675 Bacteria 14033
694 Ga0495657_0004900 3300046675 Bacteria 10656
695 Ga0495657_0006131 3300046675 Bacteria 9419
696 Ga0495657_0026711 3300046675 Bacteria 4086
697 Ga0495657_0050139 3300046675 Bacteria 2807
698 Ga0495657_0052689 3300046675 Bacteria 2726
699 Ga0495657_0067834 3300046675 Bacteria 2340
700 Ga0495657_0227433 3300046675 Bacteria 1129
701 Ga0495599_0035030 3300046678 Bacteria 3152
702 Ga0495599_0043602 3300046678 Bacteria 2815
703 Ga0495599_0046263 3300046678 Bacteria 2728
704 Ga0495599_0269375 3300046678 Bacteria 1033
705 Ga0495623_0006609 3300046679 Bacteria 7547
706 Ga0495623_0007559 3300046679 Bacteria 7053
707 Ga0495623_0063138 3300046679 Bacteria 2320
708 Ga0495623_0071154 3300046679 Bacteria 2165
709 Ga0495623_0095716 3300046679 Bacteria 1815
710 Ga0495623_0099589 3300046679 Bacteria 1772
711 Ga0495623_0222253 3300046679 Bacteria 1075
712 Ga0495623_0298636 3300046679 Bacteria 891
713 Ga0495646_0025299 3300046680 Bacteria 3734
714 Ga0495646_0025806 3300046680 Bacteria 3694
715 Ga0495646_0049198 3300046680 Bacteria 2559
716 Ga0495646_0050920 3300046680 Bacteria 2507
717 Ga0495646_0078571 3300046680 Bacteria 1928
718 Ga0495646_0592601 3300046680 Bacteria 563
719 Ga0495613_0001650 3300046689 Bacteria 16986
720 Ga0495613_0006019 3300046689 Bacteria 9075
721 Ga0495613_0007869 3300046689 Bacteria 7926
722 Ga0495613_0010656 3300046689 Bacteria 6818
723 Ga0495613_0027108 3300046689 Bacteria 4263
724 Ga0495613_0036074 3300046689 Bacteria 3666
725 Ga0495613_0046407 3300046689 Bacteria 3213
726 Ga0495613_0056515 3300046689 Bacteria 2881
727 Ga0495613_0941571 3300046689 Bacteria 557
728 Ga0495624_0011180 3300046690 Bacteria 6176
729 Ga0495624_0014743 3300046690 Bacteria 5293
730 Ga0495624_0016185 3300046690 Bacteria 5022
731 Ga0495624_0270769 3300046690 Bacteria 1026
732 Ga0495670_0009917 3300046691 Bacteria 4682
733 Ga0495671_0100925 3300046692 Bacteria 1410
734 Ga0495671_0198778 3300046692 Bacteria 972
735 Ga0495589_0023123 3300046794 Bacteria 3167
736 Ga0495589_0024656 3300046794 Bacteria 3055
737 Ga0495589_0041330 3300046794 Bacteria 2301
738 Ga0495589_0234654 3300046794 Bacteria 859
739 Ga0495589_0372836 3300046794 Bacteria 656
740 Ga0495600_0004713 3300046809 Bacteria 8183
741 Ga0495600_0014003 3300046809 Bacteria 5053
742 Ga0495600_0064229 3300046809 Bacteria 2400
743 Ga0495600_0073662 3300046809 Bacteria 2230
744 Ga0495600_0130407 3300046809 Bacteria 1634
745 Ga0495600_0162253 3300046809 Bacteria 1444
746 Ga0495600_0175349 3300046809 Bacteria 1382
747 Ga0495600_0274535 3300046809 Bacteria 1068
748 Ga0495600_0356478 3300046809 Bacteria 915
749 Ga0495600_0793675 3300046809 Bacteria 564
750 Ga0495581_0000263 3300047315 Bacteria 25263
751 Ga0495581_0012356 3300047315 Bacteria 4947
752 Ga0495581_0020955 3300047315 Bacteria 3792
753 Ga0495581_0042925 3300047315 Bacteria 2616
754 Ga0495581_0082847 3300047315 Bacteria 1858
755 Ga0495581_0134718 3300047315 Bacteria 1440
756 Ga0495581_0141944 3300047315 Bacteria 1401
757 Ga0495604_0000228 3300047317 Bacteria 50550
758 Ga0495604_0000695 3300047317 Bacteria 28567
759 Ga0495604_0006374 3300047317 Bacteria 9358
760 Ga0495604_0017033 3300047317 Bacteria 5812
761 Ga0495604_0051601 3300047317 Bacteria 3187
762 Ga0495604_0063128 3300047317 Bacteria 2826
763 Ga0495604_0253569 3300047317 Bacteria 1198
764 Ga0495604_0282355 3300047317 Bacteria 1121
765 Ga0495636_0001610 3300047318 Bacteria 8578
766 Ga0495636_0080197 3300047318 Bacteria 1404
767 Ga0495636_0287081 3300047318 Bacteria 767
768 Ga0495636_0366904 3300047318 Bacteria 681
769 Ga0495636_0606385 3300047318 Bacteria 535
770 Ga0495674_0002634 3300047319 Bacteria 17459
771 Ga0495674_0033876 3300047319 Bacteria 4622
772 Ga0495674_0166231 3300047319 Bacteria 1843
773 Ga0495674_0270382 3300047319 Bacteria 1394
774 Ga0495674_0291070 3300047319 Bacteria 1336
775 Ga0495672_0116302 3300047320 Bacteria 1428
776 Ga0495676_0000613 3300047321 Bacteria 29512
777 Ga0495676_0001584 3300047321 Bacteria 19734
778 Ga0495676_0008638 3300047321 Bacteria 9326
779 Ga0495676_0011585 3300047321 Bacteria 7956
780 Ga0495676_0012085 3300047321 Bacteria 7787
781 Ga0495676_0026464 3300047321 Bacteria 4992
782 Ga0495676_0037864 3300047321 Bacteria 4010
783 Ga0495676_0093002 3300047321 Bacteria 2249
784 Ga0495676_0238301 3300047321 Bacteria 1247
785 Ga0495676_0269970 3300047321 Bacteria 1154
786 Ga0495676_0790651 3300047321 Bacteria 611
787 Ga0495680_0008276 3300047322 Bacteria 9470
788 Ga0495680_0040434 3300047322 Bacteria 3716
789 Ga0495680_0051429 3300047322 Bacteria 3216
790 Ga0495680_0053569 3300047322 Bacteria 3138
791 Ga0495680_0056799 3300047322 Bacteria 3029
792 Ga0495680_0191237 3300047322 Unclassified 1472
793 Ga0495680_0234970 3300047322 Bacteria 1304
794 Ga0495683_0014216 3300047323 Bacteria 4147
795 Ga0495683_0018255 3300047323 Bacteria 3629
796 Ga0495683_0052837 3300047323 Bacteria 2027
797 Ga0495683_0397756 3300047323 Bacteria 573
798 Ga0495687_002340 3300047443 Bacteria 15395
799 Ga0495687_005422 3300047443 Bacteria 8135
800 Ga0495687_008591 3300047443 Bacteria 5826
801 Ga0495687_027386 3300047443 Bacteria 2668
802 Ga0495687_049101 3300047443 Bacteria 1805
803 Ga0495675_0008872 3300047444 Bacteria 6244
804 Ga0495675_0017990 3300047444 Bacteria 4481
805 Ga0495675_0025200 3300047444 Bacteria 3793
806 Ga0495675_0036401 3300047444 Bacteria 3139
807 Ga0495675_0060131 3300047444 Bacteria 2408
808 Ga0495675_0135897 3300047444 Bacteria 1526
809 Ga0495675_0146715 3300047444 Bacteria 1459
810 Ga0495675_0175951 3300047444 Bacteria 1312
811 Ga0495675_0214530 3300047444 Bacteria 1167
812 Ga0495675_0232126 3300047444 Bacteria 1113
813 Ga0495675_0365335 3300047444 Bacteria 846
814 Ga0495677_0082194 3300047445 Bacteria 1208
815 Ga0495677_0168259 3300047445 Bacteria 847
816 Ga0495685_000339 3300047447 Bacteria 15017
817 Ga0495685_001961 3300047447 Bacteria 6385
818 Ga0495685_006381 3300047447 Bacteria 3857
819 Ga0495685_010526 3300047447 Bacteria 3104
820 Ga0495685_097524 3300047447 Bacteria 971
821 Ga0495681_0000484 3300047470 Bacteria 30579
822 Ga0495681_0001772 3300047470 Bacteria 15902
823 Ga0495681_0189801 3300047470 Bacteria 839
824 Ga0495684_0015310 3300047471 Bacteria 5906
825 Ga0495684_0041460 3300047471 Bacteria 3528
826 Ga0495684_0056280 3300047471 Bacteria 2998
827 Ga0495684_0064161 3300047471 Bacteria 2791
828 Ga0495684_0066516 3300047471 Bacteria 2740
829 Ga0495684_0096501 3300047471 Bacteria 2237
830 Ga0495686_0080126 3300047472 Bacteria 1996
831 Ga0495593_0005276 3300047673 Bacteria 7634
832 Ga0495593_0007464 3300047673 Bacteria 6395
833 Ga0495593_0008191 3300047673 Bacteria 6081
834 Ga0495593_0040376 3300047673 Bacteria 2512
835 Ga0495593_0202988 3300047673 Bacteria 996
836 Ga0495602_0022868 3300048088 Bacteria 6106
837 Ga0495602_0044808 3300048088 Bacteria 4008
838 Ga0495602_0053981 3300048088 Bacteria 3552
839 Ga0495602_0269791 3300048088 Bacteria 1258
840 Ga0495602_0279117 3300048088 Bacteria 1231
841 Ga0495602_0553144 3300048088 Bacteria 797
842 Ga0495602_0608770 3300048088 Bacteria 750
843 Ga0495614_0001002 3300048089 Bacteria 12045
844 Ga0495614_0004532 3300048089 Bacteria 6265
845 Ga0495614_0005784 3300048089 Bacteria 5568
846 Ga0495614_0035816 3300048089 Bacteria 2132
847 Ga0495614_0192407 3300048089 Bacteria 921
848 Ga0495614_0227931 3300048089 Bacteria 848
849 Ga0495626_0005159 3300048091 Bacteria 7746
850 Ga0496100_0297862 3300048903 Bacteria 1206
851 Ga0496102_0115988 3300048905 Bacteria 2499
852 Ga0496102_1807886 3300048905 Bacteria 528
853 Ga0496103_0244855 3300048906 Bacteria 1153
854 Ga0496104_0136698 3300048907 Bacteria 2355
855 Ga0496105_1036754 3300048908 Bacteria 612
856 Ga0496105_1275542 3300048908 Bacteria 537
857 Ga0496106_0047750 3300048909 Bacteria 3223
858 Ga0496107_0330815 3300048910 Bacteria 1134
859 Ga0496108_0575229 3300048911 Bacteria 982
860 Ga0496109_0093686 3300048912 Bacteria 2779
861 Ga0496109_0672790 3300048912 Bacteria 972
862 Ga0496110_0553753 3300048913 Bacteria 1045
863 Ga0496110_1480806 3300048913 Bacteria 588
864 Ga0496111_0075883 3300048914 Bacteria 2449
865 Ga0496112_0605574 3300048915 Bacteria 1027
866 Ga0496112_0736702 3300048915 Bacteria 912
867 Ga0496113_0168979 3300048916 Bacteria 1731
868 Ga0496113_0186014 3300048916 Bacteria 1647
869 Ga0496113_1285904 3300048916 Bacteria 569
870 Ga0496115_0292585 3300048918 Bacteria 1335
871 Ga0496115_1045187 3300048918 Bacteria 622
872 Ga0496119_0090567 3300048922 Bacteria 1739
873 Ga0496126_0590681 3300048929 Bacteria 876
874 Ga0501306_062094 3300049127 Bacteria 617
875 Ga0501310_043368 3300049130 Bacteria 633
876 Ga0501305_074032 3300049161 Bacteria 603
877 Ga0501307_069711 3300049162 Bacteria 559
878 Ga0495678_022455 3300049459 Bacteria 2758
879 Ga0495682_0308441 3300049460 Bacteria 558
880 Ga0501311_024918 3300049527 Bacteria 836
881 Ga0501311_048719 3300049527 Bacteria 659
882 Ga0501316_040440 3300049532 Bacteria 649
883 Ga0501319_013012 3300049535 Bacteria 687
884 Ga0501323_015022 3300049539 Bacteria 973
885 Ga0501031_0035615 3300049568 Bacteria 3246
886 Ga0501031_0055511 3300049568 Bacteria 2581
887 Ga0501031_0086088 3300049568 Bacteria 2049
888 Ga0501031_0123880 3300049568 Bacteria 1688
889 Ga0501032_0009190 3300049569 Bacteria 7164
890 Ga0501032_0017443 3300049569 Bacteria 5043
891 Ga0501032_0046653 3300049569 Bacteria 2928
892 Ga0501032_0341202 3300049569 Bacteria 965
893 Ga0501033_0001721 3300049570 Bacteria 19146
894 Ga0501033_0009637 3300049570 Bacteria 7432
895 Ga0501033_0041732 3300049570 Bacteria 3422
896 Ga0501033_0058628 3300049570 Bacteria 2843
897 Ga0501033_0279130 3300049570 Bacteria 1179
898 Ga0501033_0659052 3300049570 Bacteria 714
899 Ga0501034_0006924 3300049571 Bacteria 12115
900 Ga0501034_0018397 3300049571 Bacteria 7164
901 Ga0501034_0123542 3300049571 Bacteria 2574
902 Ga0501034_0246819 3300049571 Bacteria 1730
903 Ga0501034_0325480 3300049571 Bacteria 1469
904 Ga0501034_0413550 3300049571 Bacteria 1270
905 Ga0501036_0000553 3300049572 Bacteria 26858
906 Ga0501036_0004613 3300049572 Bacteria 11134
907 Ga0501036_0006789 3300049572 Bacteria 9298
908 Ga0501036_0011285 3300049572 Bacteria 7392
909 Ga0501036_0011358 3300049572 Bacteria 7371
910 Ga0501036_0061798 3300049572 Bacteria 3173
911 Ga0501036_0100394 3300049572 Bacteria 2448
912 Ga0501036_0432928 3300049572 Bacteria 1096
913 Ga0501036_1225073 3300049572 Bacteria 611
914 Ga0501037_0000724 3300049573 Bacteria 24999
915 Ga0501037_0011775 3300049573 Bacteria 6442
916 Ga0501037_0032349 3300049573 Bacteria 3862
917 Ga0501037_0136132 3300049573 Bacteria 1759
918 Ga0501037_0253865 3300049573 Bacteria 1230
919 Ga0501038_0012653 3300049574 Bacteria 7713
920 Ga0501038_0014519 3300049574 Bacteria 7177
921 Ga0501038_0014863 3300049574 Bacteria 7089
922 Ga0501038_0015344 3300049574 Bacteria 6965
923 Ga0501038_0027984 3300049574 Bacteria 5008
924 Ga0501038_0031678 3300049574 Bacteria 4670
925 Ga0501039_0038974 3300049575 Bacteria 3670
926 Ga0501039_0047347 3300049575 Bacteria 3323
927 Ga0501039_0055160 3300049575 Bacteria 3077
928 Ga0501039_0073425 3300049575 Bacteria 2658
929 Ga0501039_0177907 3300049575 Bacteria 1673
930 Ga0501040_0032902 3300049576 Bacteria 3509
931 Ga0501041_0003165 3300049577 Bacteria 9469
932 Ga0501042_0051139 3300049578 Bacteria 2947
933 Ga0501042_0222592 3300049578 Bacteria 1361
934 Ga0501042_0275777 3300049578 Bacteria 1214
935 Ga0501043_0006148 3300049579 Bacteria 9644
936 Ga0501043_0010610 3300049579 Bacteria 7214
937 Ga0501043_0017910 3300049579 Bacteria 5555
938 Ga0501043_0020604 3300049579 Bacteria 5173
939 Ga0501043_0062689 3300049579 Bacteria 2919
940 Ga0501043_0075044 3300049579 Bacteria 2656
941 Ga0501043_0172843 3300049579 Bacteria 1685
942 Ga0501046_0009533 3300049580 Bacteria 8386
943 Ga0501046_0011002 3300049580 Bacteria 7755
944 Ga0501046_0032446 3300049580 Bacteria 4229
945 Ga0501046_0177966 3300049580 Bacteria 1592
946 Ga0501046_0974236 3300049580 Bacteria 589
947 Ga0501047_0000029 3300049581 Bacteria 218396
948 Ga0501047_0007463 3300049581 Bacteria 10292
949 Ga0501047_0009513 3300049581 Bacteria 9184
950 Ga0501047_0018629 3300049581 Bacteria 6656
951 Ga0501047_0073029 3300049581 Bacteria 3303
952 Ga0501047_0078399 3300049581 Bacteria 3177
953 Ga0501047_0125064 3300049581 Bacteria 2452
954 Ga0501047_0134580 3300049581 Bacteria 2352
955 Ga0501047_0136074 3300049581 Bacteria 2337
956 Ga0501047_0764791 3300049581 Bacteria 782
957 Ga0501048_0003722 3300049582 Bacteria 11623
958 Ga0501048_0033504 3300049582 Bacteria 3710
959 Ga0501068_0002685 3300049584 Bacteria 9423
960 Ga0501069_0251201 3300049585 Bacteria 1031
961 Ga0501069_0305847 3300049585 Bacteria 933
962 Ga0501070_0003332 3300049586 Bacteria 13957
963 Ga0501070_0012618 3300049586 Bacteria 7127
964 Ga0501070_0217054 3300049586 Bacteria 1569
965 Ga0501070_0226813 3300049586 Bacteria 1531
966 Ga0501070_0469458 3300049586 Bacteria 1013
967 Ga0501071_0000263 3300049587 Bacteria 24706
968 Ga0501072_0017515 3300049588 Bacteria 5506
969 Ga0501072_1197837 3300049588 Bacteria 590
970 Ga0501073_0051632 3300049589 Bacteria 2880
971 Ga0501073_0105674 3300049589 Bacteria 1954
972 Ga0501074_0000685 3300049590 Bacteria 21150
973 Ga0501074_0004802 3300049590 Bacteria 9690
974 Ga0501076_0022529 3300049592 Bacteria 4841
975 Ga0501077_0026110 3300049593 Bacteria 3706
976 Ga0501079_0026744 3300049741 Bacteria 4423
977 Ga0501080_0097712 3300049742 Bacteria 2726
978 Ga0501080_0208337 3300049742 Bacteria 1792
979 Ga0501080_0478862 3300049742 Bacteria 1114
980 Ga0501081_0158903 3300049743 Bacteria 1628
981 Ga0501083_0000994 3300049744 Bacteria 18837
982 Ga0501035_0001374 3300049822 Bacteria 25051
983 Ga0501035_0011222 3300049822 Bacteria 8299
984 Ga0501035_0014707 3300049822 Bacteria 7223
985 Ga0501035_0018838 3300049822 Bacteria 6359
986 Ga0501035_0019714 3300049822 Bacteria 6196
987 Ga0501035_0041594 3300049822 Bacteria 4150
988 Ga0501035_0042286 3300049822 Bacteria 4110
989 Ga0501035_0232963 3300049822 Bacteria 1569
990 Ga0501044_0004484 3300049823 Bacteria 15612
991 Ga0501044_0012903 3300049823 Bacteria 9044
992 Ga0501044_0020219 3300049823 Bacteria 7105
993 Ga0501044_0039348 3300049823 Bacteria 4933
994 Ga0501044_0097016 3300049823 Bacteria 2969
995 Ga0501044_0116755 3300049823 Bacteria 2673
996 Ga0501044_0209971 3300049823 Bacteria 1901
997 Ga0501044_0220220 3300049823 Bacteria 1848
998 Ga0501044_0243058 3300049823 Bacteria 1743
999 Ga0501044_1008791 3300049823 Bacteria 704
1000 Ga0501045_0006168 3300049824 Bacteria 8303
1001 Ga0501045_0094045 3300049824 Bacteria 2217
1002 Ga0501045_0100236 3300049824 Bacteria 2144
1003 Ga0501045_0138757 3300049824 Bacteria 1808
1004 nmdc:mga03n38_23741_c1 3300050490 Bacteria 2499
1005 nmdc:mga03n38_251435_c1 3300050490 Bacteria 934
1006 nmdc:mga03n38_453060_c1 3300050490 Bacteria 714
1007 nmdc:mga06z11_65607_c1 3300050494 Bacteria 1906
1008 nmdc:mga04h51_16963_c1 3300050495 Bacteria 2122
1009 nmdc:mga0n895_628388_c1 3300050512 Bacteria 1074
1010 nmdc:mga0rr50_138433_c1 3300050513 Bacteria 1956
1011 nmdc:mga0rr50_1558017_c1 3300050513 Bacteria 558
1012 nmdc:mga08x19_764773_c1 3300050514 Bacteria 686
1013 nmdc:mga08x19_931952_c1 3300050514 Bacteria 617
1014 Ga0495601_0006639 3300053077 Bacteria 6770
1015 Ga0495601_0177030 3300053077 Bacteria 1394
1016 Ga0495601_0371298 3300053077 Bacteria 929
1017 Ga0495612_0004279 3300053078 Bacteria 5927
1018 Ga0495612_0103034 3300053078 Bacteria 1216
1019 Ga0495612_0256764 3300053078 Bacteria 778
1020 Ga0500610_0055900 3300053079 Bacteria 2060
1021 Ga0495655_0187628 3300053083 Bacteria 670
1022 Ga0495595_0148021 3300053084 Bacteria 1154
1023 Ga0495619_0003141 3300053085 Bacteria 10711
1024 Ga0495619_0040885 3300053085 Bacteria 3031
1025 Ga0495619_0104808 3300053085 Bacteria 1928
1026 Ga0495619_0480572 3300053085 Bacteria 855
1027 Ga0500578_0050722 3300053086 Bacteria 2660
1028 Ga0500566_0017627 3300053094 Bacteria 4195
1029 Ga0500640_044584 3300053095 Bacteria 1946
1030 Ga0500654_024030 3300053099 Bacteria 3827
1031 Ga0500660_027042 3300053100 Bacteria 3019
1032 Ga0500553_035471 3300053101 Bacteria 2472
1033 Ga0500553_095490 3300053101 Bacteria 1295
1034 Ga0500558_245350 3300053106 Bacteria 592
1035 Ga0500560_000476 3300053107 Bacteria 5583
1036 Ga0500569_004487 3300053109 Bacteria 2938
1037 Ga0500594_0121542 3300053118 Bacteria 820
1038 Ga0500621_032891 3300053126 Bacteria 2068
1039 Ga0500628_009354 3300053129 Bacteria 1726
1040 Ga0500652_001101 3300053131 Bacteria 8720
1041 Ga0500561_0000489 3300053137 Bacteria 6439
1042 Ga0500573_0020311 3300053140 Bacteria 3805
1043 Ga0500573_0024558 3300053140 Bacteria 3465
1044 Ga0500573_0087578 3300053140 Bacteria 1763
1045 Ga0500573_0135994 3300053140 Bacteria 1357
1046 Ga0500577_0133659 3300053142 Bacteria 1042
1047 Ga0500579_135801 3300053143 Bacteria 1131
1048 Ga0500600_0211300 3300053149 Bacteria 904
1049 Ga0500603_040610 3300053150 Bacteria 1240
1050 Ga0500633_0001530 3300053160 Bacteria 4404
1051 Ga0500634_0002147 3300053161 Bacteria 8172
1052 Ga0500634_0173400 3300053161 Bacteria 979
1053 Ga0500636_0146717 3300053177 Bacteria 1300
1054 Ga0500656_001615 3300053732 Bacteria 1964
1055 Ga0500565_051760 3300053734 Bacteria 602
1056 Ga0500587_006291 3300053739 Bacteria 1577
1057 Ga0501084_0005179 3300054114 Bacteria 10664
1058 Ga0587073_0213026 3300059492 Bacteria 586
1059 Ga0587073_0321603 3300059492 Bacteria 510
1060 Ga0587080_067915 3300059503 Bacteria 708
1061 Ga0587082_146713 3300059504 Bacteria 555
1062 Ga0587091_151974 3300059511 Bacteria 589
1063 Ga0587098_031491 3300059604 Bacteria 732
1064 Ga0587098_061763 3300059604 Bacteria 590
1065 Ga0587106_060911 3300059605 Bacteria 693
1066 Ga0587122_010712 3300059628 Bacteria 868
1067 Ga0587068_154460 3300059641 Bacteria 521
1068 Ga0501082_0004945 3300060353 Bacteria 11629
1069 Ga0466962_0001135 3300061719 Bacteria 12296
1070 Ga0466962_0037056 3300061719 Bacteria 2334
1071 Ga0466962_0066978 3300061719 Bacteria 1714
1072 Ga0466962_0096516 3300061719 Bacteria 1417

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2751185734 2753069177 138
2 3300021388 Ga0213875_10322704 Ga0213875_103227042 141
3 3300037853 Ga0436364_0585418 Ga0436364_0585418_2116_2595 141
4 3300024227 Ga0228598_1008297 Ga0228598_10082971 142
5 3300031824 Ga0307413_10434098 Ga0307413_104340981 142
6 3300045976 Ga0466967_0137166 Ga0466967_0137166_1230_1709 143
7 3300037853 Ga0436364_1247794 Ga0436364_1247794_896_1375 144
8 3300020080 Ga0206350_11340047 Ga0206350_113400471 145
9 3300025929 Ga0207664_10119578 Ga0207664_101195782 145
10 3300035084 Ga0373928_0106764 Ga0373928_0106764_203_682 145
11 3300035121 Ga0373960_0138682 Ga0373960_0138682_164_643 145
12 3300037068 Ga0373925_0216829 Ga0373925_0216829_124_603 145
13 3300039453 Ga0436362_0983991 Ga0436362_0983991_165_644 146
14 3300046529 Ga0495652_0049924 Ga0495652_0049924_2803_3252 147
15 3300039438 Ga0436360_0208252 Ga0436360_0208252_192_695 148
16 3300041451 Ga0451791_1205736 Ga0451791_1205736_129_605 148
17 iso_pu_bacteria 2675903060 2676487751 148
18 iso_pu_bacteria 2884693830 2884697725 148
19 iso_pu_bacteria 2895427314 2895435565 148
20 iso_pu_bacteria 2895442618 2895444827 148
21 3300035117 Ga0373953_0122074 Ga0373953_0122074_501_980 149
22 3300046463 Ga0495653_0135933 Ga0495653_0135933_1001_1480 149
23 3300046511 Ga0495608_0155355 Ga0495608_0155355_130_609 149
24 3300047471 Ga0495684_0041460 Ga0495684_0041460_565_1044 149
25 iso_pu_bacteria 2899370129 2899376292 149
26 3300014745 Ga0157377_10375702 Ga0157377_103757022 150
27 3300003203 JGI25406J46586_10001472 JGI25406J46586_1000147210 151
28 iso_pu_bacteria 2856741275 2856743393 151
29 iso_pu_bacteria 2891395885 2891402879 151
30 iso_pu_bacteria 2891554331 2891554815 151
31 iso_pu_bacteria 2891562705 2891564773 151
32 3300031456 Ga0307513_10116425 Ga0307513_101164251 152
33 3300032126 Ga0307415_100154543 Ga0307415_1001545433 152
34 3300049572 Ga0501036_1225073 Ga0501036_1225073_116_592 152
35 iso_pu_bacteria 2867369537 2867373888 153
36 iso_pu_bacteria 3006321560 3006322610 153
37 3300049568 Ga0501031_0086088 Ga0501031_0086088_73_543 154
38 3300049569 Ga0501032_0341202 Ga0501032_0341202_220_690 154
39 3300049570 Ga0501033_0009637 Ga0501033_0009637_6908_7378 154
40 3300049570 Ga0501033_0659052 Ga0501033_0659052_180_650 154
41 3300049571 Ga0501034_0246819 Ga0501034_0246819_1153_1623 154
42 3300049572 Ga0501036_0011358 Ga0501036_0011358_5506_5976 154
43 3300049573 Ga0501037_0136132 Ga0501037_0136132_594_1064 154
44 3300049574 Ga0501038_0014863 Ga0501038_0014863_4245_4715 154
45 3300049575 Ga0501039_0047347 Ga0501039_0047347_2832_3302 154
46 3300049579 Ga0501043_0006148 Ga0501043_0006148_8983_9453 154
47 3300049579 Ga0501043_0017910 Ga0501043_0017910_207_677 154
48 3300049581 Ga0501047_0009513 Ga0501047_0009513_6123_6593 154
49 3300049586 Ga0501070_0012618 Ga0501070_0012618_6350_6820 154
50 3300049586 Ga0501070_0226813 Ga0501070_0226813_955_1425 154
51 3300049588 Ga0501072_1197837 Ga0501072_1197837_61_531 154
52 3300049822 Ga0501035_0011222 Ga0501035_0011222_7505_7975 154
53 3300049822 Ga0501035_0018838 Ga0501035_0018838_1408_1878 154
54 3300049823 Ga0501044_0220220 Ga0501044_0220220_980_1450 154
55 3300049824 Ga0501045_0100236 Ga0501045_0100236_1199_1669 154
56 iso_pu_bacteria 2547132111 2547408372 154
57 iso_pu_bacteria 2554235005 2554256212 154
58 iso_pu_bacteria 2582581312 2585296632 154
59 iso_pu_bacteria 2582581313 2585309073 154
60 iso_pu_bacteria 2582581314 2585319261 154
61 iso_pu_bacteria 2616644814 2616697315 154
62 iso_pu_bacteria 2616644941 2616903261 154
63 iso_pu_bacteria 2643221548 2643764037 154
64 iso_pu_bacteria 2643221578 2643902243 154
65 iso_pu_bacteria 2643221587 2643943929 154
66 iso_pu_bacteria 2643221601 2644017705 154
67 iso_pu_bacteria 2643221631 2644173335 154
68 iso_pu_bacteria 2643221647 2644265789 154
69 iso_pu_bacteria 2643221670 2644386912 154
70 iso_pu_bacteria 2643221673 2644403814 154
71 iso_pu_bacteria 2643221677 2644434666 154
72 iso_pu_bacteria 2643221678 2644440069 154
73 iso_pu_bacteria 2643221682 2644461531 154
74 iso_pu_bacteria 2643221714 2644632609 154
75 iso_pu_bacteria 2767802112 2768642964 154
76 iso_pu_bacteria 2784132148 2784590432 154
77 iso_pu_bacteria 2784746763 2785341184 154
78 iso_pu_bacteria 2784746768 2785371520 154
79 iso_pu_bacteria 2786546132 2786672678 154
80 iso_pu_bacteria 2791355406 2793983590 154
81 iso_pu_bacteria 2802429296 2804847924 154
82 iso_pu_bacteria 2808606359 2808844047 154
83 iso_pu_bacteria 2808606375 2808913639 154
84 iso_pu_bacteria 2808606448 2809234105 154
85 iso_pu_bacteria 2808606982 2811844397 154
86 iso_pu_bacteria 2811994879 2812355925 154
87 iso_pu_bacteria 2811994917 2812478734 154
88 iso_pu_bacteria 2818991463 2819694609 154
89 iso_pu_bacteria 2818991472 2819740621 154
90 iso_pu_bacteria 2852635781 2852641040 154
91 iso_pu_bacteria 2862178590 2862186427 154
92 iso_pu_bacteria 2862281513 2862284728 154
93 iso_pu_bacteria 2862290372 2862293512 154
94 iso_pu_bacteria 2862382967 2862384795 154
95 iso_pu_bacteria 2862507626 2862512660 154
96 iso_pu_bacteria 2862574272 2862577489 154
97 iso_pu_bacteria 2862705112 2862707539 154
98 iso_pu_bacteria 2863404153 2863408635 154
99 iso_pu_bacteria 2867346516 2867349148 154
100 iso_pu_bacteria 2867428634 2867430201 154
101 iso_pu_bacteria 2867475112 2867478882 154
102 iso_pu_bacteria 2873151551 2873154036 154
103 iso_pu_bacteria 2875391855 2875396715 154
104 iso_pu_bacteria 2877676314 2877679086 154
105 iso_pu_bacteria 2912715099 2912717599 154
106 iso_pu_bacteria 2912723979 2912730141 154
107 iso_pu_bacteria 2912757875 2912762770 154
108 iso_pu_bacteria 2918501144 2918506521 154
109 iso_pu_bacteria 2919468124 2919471752 154
110 iso_pu_bacteria 2946045630 2946047840 154
111 iso_pu_bacteria 2946064051 2946069862 154
112 iso_pu_bacteria 2946072368 2946077780 154
113 iso_pu_bacteria 2947224130 2947226937 154
114 iso_pu_bacteria 2954002825 2954005483 154
115 iso_pu_bacteria 2954380949 2954383990 154
116 iso_pu_bacteria 2954673503 2954678971 154
117 iso_pu_bacteria 2954682443 2954685181 154
118 iso_pu_bacteria 2954691527 2954694790 154
119 iso_pu_bacteria 2954701450 2954709991 154
120 iso_pu_bacteria 2954711539 2954714298 154
121 iso_pu_bacteria 2954721474 2954724247 154
122 iso_pu_bacteria 2954731030 2954737593 154
123 iso_pu_bacteria 2954740390 2954743144 154
124 iso_pu_bacteria 2954749733 2954756426 154
125 iso_pu_bacteria 2954759201 2954762102 154
126 iso_pu_bacteria 2990044586 2990048265 154
127 iso_pu_bacteria 2990059506 2990062962 154
128 iso_pu_bacteria 2990088156 2990094500 154
129 iso_pu_bacteria 2995463766 2995467111 154
130 iso_pu_bacteria 2997451912 2997452882 154
131 iso_pu_bacteria 2997600082 2997606064 154
132 iso_pu_bacteria 3006393351 3006400041 154
133 iso_pu_bacteria 3006493962 3006500140 154
134 iso_pu_bacteria 8008485437 8008491559 154
135 iso_pu_bacteria 8008558824 8008562806 154
136 iso_pu_bacteria 8008574985 8008577151 154
137 iso_pu_bacteria 8023623736 8023629638 154
138 iso_pu_bacteria 8025413630 8025419431 154
139 iso_pu_bacteria 8025524527 8025524615 154
140 iso_pu_bacteria 8025530807 8025531288 154
141 iso_pu_bacteria 8047893842 8047896087 154
142 iso_pu_bacteria 8048127548 8048132248 154
143 iso_pu_bacteria 8048356638 8048362848 154
144 iso_pu_bacteria 8048369669 8048373112 154
145 iso_pu_bacteria 8048379754 8048382045 154
146 iso_pu_bacteria 8048406513 8048411674 154
147 iso_pu_bacteria 8054160619 8054166430 154
148 iso_pu_bacteria 8056447290 8056453786 154
149 iso_pu_bacteria 8056667051 8056672543 154
150 iso_pu_bacteria 8056829672 8056832217 154
151 3300047322 Ga0495680_0234970 Ga0495680_0234970_475_951 155
152 3300049568 Ga0501031_0035615 Ga0501031_0035615_2159_2635 155
153 3300049569 Ga0501032_0009190 Ga0501032_0009190_671_1147 155
154 3300049570 Ga0501033_0058628 Ga0501033_0058628_2334_2810 155
155 3300049571 Ga0501034_0018397 Ga0501034_0018397_6018_6494 155
156 3300049572 Ga0501036_0011285 Ga0501036_0011285_899_1375 155
157 3300049573 Ga0501037_0000724 Ga0501037_0000724_18506_18982 155
158 3300049574 Ga0501038_0014519 Ga0501038_0014519_684_1160 155
159 3300049576 Ga0501040_0032902 Ga0501040_0032902_2708_3184 155
160 3300049577 Ga0501041_0003165 Ga0501041_0003165_5038_5514 155
161 3300049578 Ga0501042_0051139 Ga0501042_0051139_440_916 155
162 3300049579 Ga0501043_0010610 Ga0501043_0010610_6127_6603 155
163 3300049580 Ga0501046_0009533 Ga0501046_0009533_1893_2369 155
164 3300049581 Ga0501047_0018629 Ga0501047_0018629_5569_6045 155
165 3300049582 Ga0501048_0033504 Ga0501048_0033504_904_1380 155
166 3300049584 Ga0501068_0002685 Ga0501068_0002685_2643_3119 155
167 3300049585 Ga0501069_0251201 Ga0501069_0251201_116_592 155
168 3300049587 Ga0501071_0000263 Ga0501071_0000263_18096_18572 155
169 3300049588 Ga0501072_0017515 Ga0501072_0017515_3921_4397 155
170 3300049590 Ga0501074_0004802 Ga0501074_0004802_6881_7357 155
171 3300049592 Ga0501076_0022529 Ga0501076_0022529_3666_4142 155
172 3300049593 Ga0501077_0026110 Ga0501077_0026110_3125_3601 155
173 3300049741 Ga0501079_0026744 Ga0501079_0026744_1518_1994 155
174 3300049742 Ga0501080_0097712 Ga0501080_0097712_1904_2380 155
175 3300049743 Ga0501081_0158903 Ga0501081_0158903_139_615 155
176 3300049744 Ga0501083_0000994 Ga0501083_0000994_675_1151 155
177 3300049822 Ga0501035_0014707 Ga0501035_0014707_6136_6612 155
178 3300049823 Ga0501044_0020219 Ga0501044_0020219_612_1088 155
179 3300049824 Ga0501045_0006168 Ga0501045_0006168_4049_4525 155
180 3300054114 Ga0501084_0005179 Ga0501084_0005179_7378_7854 155
181 3300060353 Ga0501082_0004945 Ga0501082_0004945_7105_7581 155
182 3300053078 Ga0495612_0256764 Ga0495612_0256764_100_624 156
183 iso_pu_bacteria 8025478263 8025480470 156
184 3300003320 rootH2_10084890 rootH2_100848902 157
185 3300003320 rootH2_10148651 rootH2_101486511 157
186 3300005327 Ga0070658_10171134 Ga0070658_101711342 157
187 3300005329 Ga0070683_100006536 Ga0070683_1000065366 157
188 3300005329 Ga0070683_100095325 Ga0070683_1000953252 157
189 3300005329 Ga0070683_100438750 Ga0070683_1004387501 157
190 3300005330 Ga0070690_100810923 Ga0070690_1008109231 157
191 3300005331 Ga0070670_100802416 Ga0070670_1008024161 157
192 3300005336 Ga0070680_100021287 Ga0070680_1000212872 157
193 3300005339 Ga0070660_100659235 Ga0070660_1006592351 157
194 3300005344 Ga0070661_100367626 Ga0070661_1003676262 157
195 3300005347 Ga0070668_100587733 Ga0070668_1005877331 157
196 3300005356 Ga0070674_100157779 Ga0070674_1001577792 157
197 3300005364 Ga0070673_100187500 Ga0070673_1001875001 157
198 3300005366 Ga0070659_100332214 Ga0070659_1003322142 157
199 3300005367 Ga0070667_100121550 Ga0070667_1001215503 157
200 3300005434 Ga0070709_10039672 Ga0070709_100396723 157
201 3300005434 Ga0070709_10085969 Ga0070709_100859692 157
202 3300005434 Ga0070709_10133484 Ga0070709_101334842 157
203 3300005434 Ga0070709_10868909 Ga0070709_108689092 157
204 3300005435 Ga0070714_100004044 Ga0070714_10000404410 157
205 3300005435 Ga0070714_100127885 Ga0070714_1001278854 157
206 3300005435 Ga0070714_100816644 Ga0070714_1008166442 157
207 3300005435 Ga0070714_100845027 Ga0070714_1008450272 157
208 3300005435 Ga0070714_101161205 Ga0070714_1011612051 157
209 3300005436 Ga0070713_100243560 Ga0070713_1002435602 157
210 3300005436 Ga0070713_100884842 Ga0070713_1008848422 157
211 3300005437 Ga0070710_10103161 Ga0070710_101031612 157
212 3300005437 Ga0070710_10837933 Ga0070710_108379331 157
213 3300005439 Ga0070711_100129637 Ga0070711_1001296372 157
214 3300005439 Ga0070711_100204606 Ga0070711_1002046062 157
215 3300005439 Ga0070711_101011128 Ga0070711_1010111282 157
216 3300005444 Ga0070694_100075814 Ga0070694_1000758142 157
217 3300005445 Ga0070708_100003731 Ga0070708_1000037313 157
218 3300005455 Ga0070663_100125838 Ga0070663_1001258382 157
219 3300005457 Ga0070662_100117947 Ga0070662_1001179472 157
220 3300005466 Ga0070685_10018280 Ga0070685_100182801 157
221 3300005467 Ga0070706_100008655 Ga0070706_1000086559 157
222 3300005467 Ga0070706_100091325 Ga0070706_1000913253 157
223 3300005467 Ga0070706_100183832 Ga0070706_1001838322 157
224 3300005468 Ga0070707_100025575 Ga0070707_1000255754 157
225 3300005468 Ga0070707_100042124 Ga0070707_1000421242 157
226 3300005471 Ga0070698_100034761 Ga0070698_1000347616 157
227 3300005471 Ga0070698_100147517 Ga0070698_1001475172 157
228 3300005471 Ga0070698_100304028 Ga0070698_1003040282 157
229 3300005518 Ga0070699_100001397 Ga0070699_10000139715 157
230 3300005530 Ga0070679_100020257 Ga0070679_1000202572 157
231 3300005535 Ga0070684_100211337 Ga0070684_1002113372 157
232 3300005535 Ga0070684_100307367 Ga0070684_1003073671 157
233 3300005536 Ga0070697_100004674 Ga0070697_1000046744 157
234 3300005543 Ga0070672_100071426 Ga0070672_1000714264 157
235 3300005545 Ga0070695_100133462 Ga0070695_1001334622 157
236 3300005546 Ga0070696_100416789 Ga0070696_1004167892 157
237 3300005548 Ga0070665_100339480 Ga0070665_1003394801 157
238 3300005564 Ga0070664_100017308 Ga0070664_1000173081 157
239 3300005577 Ga0068857_100041495 Ga0068857_1000414955 157
240 3300005578 Ga0068854_100470375 Ga0068854_1004703752 157
241 3300005614 Ga0068856_100679071 Ga0068856_1006790712 157
242 3300005616 Ga0068852_100605205 Ga0068852_1006052051 157
243 3300005617 Ga0068859_101542260 Ga0068859_1015422601 157
244 3300005617 Ga0068859_101875324 Ga0068859_1018753241 157
245 3300005718 Ga0068866_10071750 Ga0068866_100717502 157
246 3300005840 Ga0068870_10598728 Ga0068870_105987281 157
247 3300005843 Ga0068860_100461120 Ga0068860_1004611201 157
248 3300005844 Ga0068862_100825965 Ga0068862_1008259652 157
249 3300005983 Ga0081540_1000009 Ga0081540_100000988 157
250 3300006028 Ga0070717_10007214 Ga0070717_100072145 157
251 3300006028 Ga0070717_10288147 Ga0070717_102881472 157
252 3300006028 Ga0070717_10701645 Ga0070717_107016452 157
253 3300006028 Ga0070717_10958469 Ga0070717_109584692 157
254 3300006028 Ga0070717_10968958 Ga0070717_109689582 157
255 3300006163 Ga0070715_10019913 Ga0070715_100199132 157
256 3300006173 Ga0070716_100121416 Ga0070716_1001214163 157
257 3300006173 Ga0070716_100131151 Ga0070716_1001311513 157
258 3300006175 Ga0070712_100003385 Ga0070712_1000033852 157
259 3300006175 Ga0070712_100031793 Ga0070712_1000317932 157
260 3300006175 Ga0070712_100745901 Ga0070712_1007459012 157
261 3300006871 Ga0075434_100403247 Ga0075434_1004032473 157
262 3300006881 Ga0068865_100851440 Ga0068865_1008514402 157
263 3300006914 Ga0075436_100133238 Ga0075436_1001332382 157
264 3300006914 Ga0075436_100429864 Ga0075436_1004298641 157
265 3300006914 Ga0075436_100514443 Ga0075436_1005144432 157
266 3300006931 Ga0097620_101542226 Ga0097620_1015422261 157
267 3300006931 Ga0097620_101875024 Ga0097620_1018750241 157
268 3300007076 Ga0075435_100227732 Ga0075435_1002277322 157
269 3300009011 Ga0105251_10109922 Ga0105251_101099221 157
270 3300009093 Ga0105240_10229594 Ga0105240_102295942 157
271 3300009098 Ga0105245_10163986 Ga0105245_101639863 157
272 3300009148 Ga0105243_10173590 Ga0105243_101735901 157
273 3300009174 Ga0105241_10415761 Ga0105241_104157612 157
274 3300009177 Ga0105248_10627474 Ga0105248_106274743 157
275 3300009545 Ga0105237_11260386 Ga0105237_112603861 157
276 3300009551 Ga0105238_10569133 Ga0105238_105691332 157
277 3300010375 Ga0105239_10411233 Ga0105239_104112331 157
278 3300010375 Ga0105239_10956721 Ga0105239_109567212 157
279 3300011119 Ga0105246_10575366 Ga0105246_105753662 157
280 3300011119 Ga0105246_10656982 Ga0105246_106569821 157
281 3300012494 Ga0157341_1018722 Ga0157341_10187221 157
282 3300012508 Ga0157315_1004244 Ga0157315_10042441 157
283 3300013100 Ga0157373_10321146 Ga0157373_103211462 157
284 3300013102 Ga0157371_10033294 Ga0157371_100332941 157
285 3300013296 Ga0157374_11277102 Ga0157374_112771021 157
286 3300014325 Ga0163163_10136261 Ga0163163_101362611 157
287 3300014968 Ga0157379_10304147 Ga0157379_103041473 157
288 3300017792 Ga0163161_11007753 Ga0163161_110077531 157
289 3300020070 Ga0206356_10810878 Ga0206356_108108782 157
290 3300020081 Ga0206354_11543200 Ga0206354_115432002 157
291 3300020082 Ga0206353_11306639 Ga0206353_113066392 157
292 3300021388 Ga0213875_10024438 Ga0213875_100244385 157
293 3300025885 Ga0207653_10051332 Ga0207653_100513321 157
294 3300025898 Ga0207692_10022907 Ga0207692_100229072 157
295 3300025899 Ga0207642_10209825 Ga0207642_102098252 157
296 3300025901 Ga0207688_10091412 Ga0207688_100914123 157
297 3300025904 Ga0207647_10082703 Ga0207647_100827032 157
298 3300025906 Ga0207699_10003180 Ga0207699_100031805 157
299 3300025906 Ga0207699_10019000 Ga0207699_100190003 157
300 3300025908 Ga0207643_10007955 Ga0207643_100079552 157
301 3300025910 Ga0207684_10033691 Ga0207684_100336913 157
302 3300025910 Ga0207684_10072689 Ga0207684_100726893 157
303 3300025912 Ga0207707_10200009 Ga0207707_102000093 157
304 3300025914 Ga0207671_10621702 Ga0207671_106217022 157
305 3300025915 Ga0207693_10010984 Ga0207693_100109846 157
306 3300025915 Ga0207693_10020666 Ga0207693_100206663 157
307 3300025917 Ga0207660_10302102 Ga0207660_103021021 157
308 3300025919 Ga0207657_10022671 Ga0207657_100226714 157
309 3300025920 Ga0207649_10220986 Ga0207649_102209862 157
310 3300025921 Ga0207652_10941951 Ga0207652_109419511 157
311 3300025922 Ga0207646_10012425 Ga0207646_100124256 157
312 3300025922 Ga0207646_10023703 Ga0207646_100237033 157
313 3300025923 Ga0207681_11180768 Ga0207681_111807681 157
314 3300025926 Ga0207659_10116885 Ga0207659_101168852 157
315 3300025928 Ga0207700_10016756 Ga0207700_100167562 157
316 3300025928 Ga0207700_10091383 Ga0207700_100913833 157
317 3300025928 Ga0207700_10191375 Ga0207700_101913753 157
318 3300025928 Ga0207700_10243403 Ga0207700_102434032 157
319 3300025928 Ga0207700_10275158 Ga0207700_102751582 157
320 3300025929 Ga0207664_10018165 Ga0207664_100181652 157
321 3300025929 Ga0207664_10019807 Ga0207664_100198073 157
322 3300025929 Ga0207664_10082344 Ga0207664_100823443 157
323 3300025929 Ga0207664_10245304 Ga0207664_102453042 157
324 3300025929 Ga0207664_10291023 Ga0207664_102910233 157
325 3300025931 Ga0207644_10357328 Ga0207644_103573282 157
326 3300025933 Ga0207706_10022821 Ga0207706_100228215 157
327 3300025936 Ga0207670_10022698 Ga0207670_100226985 157
328 3300025937 Ga0207669_10319878 Ga0207669_103198781 157
329 3300025938 Ga0207704_10131259 Ga0207704_101312592 157
330 3300025939 Ga0207665_10010016 Ga0207665_100100165 157
331 3300025939 Ga0207665_10138798 Ga0207665_101387983 157
332 3300025939 Ga0207665_10165343 Ga0207665_101653433 157
333 3300025940 Ga0207691_10031590 Ga0207691_100315904 157
334 3300025941 Ga0207711_10232356 Ga0207711_102323562 157
335 3300025944 Ga0207661_10182912 Ga0207661_101829122 157
336 3300025960 Ga0207651_10351869 Ga0207651_103518692 157
337 3300025972 Ga0207668_10186162 Ga0207668_101861621 157
338 3300025981 Ga0207640_11122703 Ga0207640_111227031 157
339 3300026041 Ga0207639_10614582 Ga0207639_106145821 157
340 3300026075 Ga0207708_10506191 Ga0207708_105061911 157
341 3300026078 Ga0207702_10005527 Ga0207702_100055275 157
342 3300026088 Ga0207641_11908027 Ga0207641_119080271 157
343 3300026095 Ga0207676_11782984 Ga0207676_117829841 157
344 3300026116 Ga0207674_10020822 Ga0207674_100208225 157
345 3300026118 Ga0207675_100091161 Ga0207675_1000911614 157
346 3300026121 Ga0207683_10001450 Ga0207683_1000145017 157
347 3300028379 Ga0268266_10174059 Ga0268266_101740593 157
348 3300028379 Ga0268266_10320364 Ga0268266_103203642 157
349 3300028381 Ga0268264_10335073 Ga0268264_103350731 157
350 3300030836 Ga0265767_101432 Ga0265767_1014322 157
351 3300031090 Ga0265760_10011674 Ga0265760_100116744 157
352 3300031090 Ga0265760_10117098 Ga0265760_101170982 157
353 3300034816 Ga0373930_0004467 Ga0373930_0004467_1252_1731 157
354 3300034817 Ga0373948_0034847 Ga0373948_0034847_331_810 157
355 3300034819 Ga0373958_0161341 Ga0373958_0161341_73_552 157
356 3300034957 Ga0373938_0050244 Ga0373938_0050244_394_873 157
357 3300035083 Ga0373926_0000765 Ga0373926_0000765_4656_5135 157
358 3300035083 Ga0373926_0001515 Ga0373926_0001515_1586_2065 157
359 3300035086 Ga0373934_0003049 Ga0373934_0003049_668_1147 157
360 3300035086 Ga0373934_0009621 Ga0373934_0009621_1174_1653 157
361 3300035089 Ga0373944_0000224 Ga0373944_0000224_6108_6587 157
362 3300035089 Ga0373944_0012535 Ga0373944_0012535_1200_1679 157
363 3300035111 Ga0373923_0001164 Ga0373923_0001164_1714_2193 157
364 3300035111 Ga0373923_0047425 Ga0373923_0047425_505_984 157
365 3300035112 Ga0373932_0031095 Ga0373932_0031095_178_657 157
366 3300035113 Ga0373936_0000334 Ga0373936_0000334_5361_5840 157
367 3300035113 Ga0373936_0013060 Ga0373936_0013060_2287_2766 157
368 3300035113 Ga0373936_0139665 Ga0373936_0139665_153_632 157
369 3300035115 Ga0373941_0353539 Ga0373941_0353539_107_586 157
370 3300035116 Ga0373945_0000228 Ga0373945_0000228_10633_11112 157
371 3300035116 Ga0373945_0011604 Ga0373945_0011604_508_987 157
372 3300035117 Ga0373953_0024122 Ga0373953_0024122_1781_2260 157
373 3300035118 Ga0373954_0017440 Ga0373954_0017440_1577_2056 157
374 3300035119 Ga0373956_0052379 Ga0373956_0052379_1321_1800 157
375 3300035121 Ga0373960_0082514 Ga0373960_0082514_498_977 157
376 3300035170 Ga0373943_0002009 Ga0373943_0002009_5942_6421 157
377 3300035170 Ga0373943_0013785 Ga0373943_0013785_2581_3060 157
378 3300035170 Ga0373943_0390413 Ga0373943_0390413_94_573 157
379 3300035171 Ga0373946_0000096 Ga0373946_0000096_7440_7919 157
380 3300035171 Ga0373946_0000515 Ga0373946_0000515_3025_3504 157
381 3300035172 Ga0373955_0044853 Ga0373955_0044853_535_1014 157
382 3300035172 Ga0373955_0053401 Ga0373955_0053401_1519_1998 157
383 3300035172 Ga0373955_0401001 Ga0373955_0401001_292_771 157
384 3300035172 Ga0373955_0424072 Ga0373955_0424072_176_655 157
385 3300035207 Ga0373942_0020308 Ga0373942_0020308_971_1450 157
386 3300035242 Ga0373962_0184121 Ga0373962_0184121_23_502 157
387 3300035410 Ga0373924_0012279 Ga0373924_0012279_520_999 157
388 3300035691 Ga0373931_0009215 Ga0373931_0009215_2612_3091 157
389 3300035692 Ga0373935_0004359 Ga0373935_0004359_5943_6422 157
390 3300035692 Ga0373935_0039125 Ga0373935_0039125_2383_2862 157
391 3300035695 Ga0373927_0001355 Ga0373927_0001355_10524_11003 157
392 3300035695 Ga0373927_0045993 Ga0373927_0045993_2143_2622 157
393 3300035724 Ga0373933_0018935 Ga0373933_0018935_1952_2431 157
394 3300035724 Ga0373933_0034929 Ga0373933_0034929_673_1152 157
395 3300035725 Ga0373947_0000887 Ga0373947_0000887_10524_11003 157
396 3300035725 Ga0373947_0060518 Ga0373947_0060518_451_930 157
397 3300035725 Ga0373947_0136608 Ga0373947_0136608_619_1098 157
398 3300036401 Ga0373937_0012529 Ga0373937_0012529_2836_3315 157
399 3300036401 Ga0373937_0094505 Ga0373937_0094505_1982_2461 157
400 3300036401 Ga0373937_0123048 Ga0373937_0123048_130_609 157
401 3300036401 Ga0373937_0414883 Ga0373937_0414883_87_566 157
402 3300036459 Ga0372808_025407 Ga0372808_025407_166_645 157
403 3300037068 Ga0373925_0012546 Ga0373925_0012546_4650_5129 157
404 3300037068 Ga0373925_0025268 Ga0373925_0025268_3169_3648 157
405 3300037068 Ga0373925_0248399 Ga0373925_0248399_116_595 157
406 3300037853 Ga0436364_0166036 Ga0436364_0166036_1140_1619 157
407 3300037853 Ga0436364_0340069 Ga0436364_0340069_65_544 157
408 3300037853 Ga0436364_0356204 Ga0436364_0356204_274_753 157
409 3300037853 Ga0436364_0976891 Ga0436364_0976891_450_932 157
410 3300039437 Ga0436365_1421416 Ga0436365_1421416_16_495 157
411 3300039438 Ga0436360_0236768 Ga0436360_0236768_205_684 157
412 3300039438 Ga0436360_0274104 Ga0436360_0274104_131_610 157
413 3300039447 Ga0436361_0046152 Ga0436361_0046152_89_568 157
414 3300039450 Ga0436363_0426389 Ga0436363_0426389_477_956 157
415 3300039450 Ga0436363_1570653 Ga0436363_1570653_1188_1667 157
416 3300039453 Ga0436362_1292336 Ga0436362_1292336_188_667 157
417 3300041486 Ga0451807_1543669 Ga0451807_1543669_109_588 157
418 3300044694 Ga0466963_0028605 Ga0466963_0028605_1186_1665 157
419 3300044706 Ga0466964_0396070 Ga0466964_0396070_123_602 157
420 3300045049 Ga0466959_0758306 Ga0466959_0758306_153_632 157
421 3300045836 Ga0466958_0308253 Ga0466958_0308253_101_580 157
422 3300045976 Ga0466967_0011974 Ga0466967_0011974_4754_5233 157
423 3300045976 Ga0466967_0689780 Ga0466967_0689780_288_770 157
424 3300046454 Ga0495592_0013789 Ga0495592_0013789_4419_4901 157
425 3300046454 Ga0495592_0021680 Ga0495592_0021680_1980_2492 157
426 3300046454 Ga0495592_0162390 Ga0495592_0162390_937_1416 157
427 3300046454 Ga0495592_0185555 Ga0495592_0185555_805_1284 157
428 3300046455 Ga0495603_0003763 Ga0495603_0003763_5886_6365 157
429 3300046455 Ga0495603_0131380 Ga0495603_0131380_52_534 157
430 3300046459 Ga0495629_0002692 Ga0495629_0002692_5976_6455 157
431 3300046459 Ga0495629_0008361 Ga0495629_0008361_5612_6094 157
432 3300046459 Ga0495629_0330914 Ga0495629_0330914_221_700 157
433 3300046461 Ga0495641_0009687 Ga0495641_0009687_3227_3706 157
434 3300046461 Ga0495641_0024612 Ga0495641_0024612_435_914 157
435 3300046462 Ga0495651_0002577 Ga0495651_0002577_8249_8761 157
436 3300046462 Ga0495651_0014489 Ga0495651_0014489_5482_5964 157
437 3300046462 Ga0495651_0049806 Ga0495651_0049806_1554_2033 157
438 3300046462 Ga0495651_0053092 Ga0495651_0053092_794_1273 157
439 3300046462 Ga0495651_0139162 Ga0495651_0139162_668_1147 157
440 3300046462 Ga0495651_0147922 Ga0495651_0147922_176_655 157
441 3300046463 Ga0495653_0004910 Ga0495653_0004910_8228_8707 157
442 3300046463 Ga0495653_0009521 Ga0495653_0009521_5649_6161 157
443 3300046463 Ga0495653_0015160 Ga0495653_0015160_393_872 157
444 3300046463 Ga0495653_0066028 Ga0495653_0066028_1663_2142 157
445 3300046472 Ga0495580_0001943 Ga0495580_0001943_15049_15561 157
446 3300046472 Ga0495580_0026504 Ga0495580_0026504_1912_2391 157
447 3300046473 Ga0495582_0000741 Ga0495582_0000741_11701_12180 157
448 3300046475 Ga0495639_0002161 Ga0495639_0002161_2183_2662 157
449 3300046475 Ga0495639_0103628 Ga0495639_0103628_683_1162 157
450 3300046476 Ga0495662_0003402 Ga0495662_0003402_5874_6386 157
451 3300046476 Ga0495662_0037091 Ga0495662_0037091_844_1326 157
452 3300046476 Ga0495662_0066015 Ga0495662_0066015_655_1134 157
453 3300046477 Ga0495664_0000962 Ga0495664_0000962_3029_3508 157
454 3300046477 Ga0495664_0005505 Ga0495664_0005505_5594_6106 157
455 3300046477 Ga0495664_0013862 Ga0495664_0013862_1909_2388 157
456 3300046477 Ga0495664_0061339 Ga0495664_0061339_1196_1669 157
457 3300046477 Ga0495664_0112678 Ga0495664_0112678_591_1073 157
458 3300046492 Ga0495585_0009401 Ga0495585_0009401_1648_2130 157
459 3300046499 Ga0495594_0106393 Ga0495594_0106393_660_1151 157
460 3300046511 Ga0495608_0000475 Ga0495608_0000475_7996_8508 157
461 3300046511 Ga0495608_0021905 Ga0495608_0021905_1782_2261 157
462 3300046511 Ga0495608_0023637 Ga0495608_0023637_3432_3911 157
463 3300046511 Ga0495608_0109718 Ga0495608_0109718_210_689 157
464 3300046514 Ga0495618_0007301 Ga0495618_0007301_668_1147 157
465 3300046514 Ga0495618_0111160 Ga0495618_0111160_689_1168 157
466 3300046516 Ga0495628_0000710 Ga0495628_0000710_29673_30185 157
467 3300046516 Ga0495628_0011936 Ga0495628_0011936_4666_5145 157
468 3300046516 Ga0495628_0023600 Ga0495628_0023600_932_1414 157
469 3300046516 Ga0495628_0352775 Ga0495628_0352775_148_627 157
470 3300046517 Ga0495630_0001986 Ga0495630_0001986_9800_10279 157
471 3300046517 Ga0495630_0010159 Ga0495630_0010159_1994_2473 157
472 3300046517 Ga0495630_0110163 Ga0495630_0110163_447_959 157
473 3300046517 Ga0495630_0299668 Ga0495630_0299668_158_637 157
474 3300046526 Ga0495666_0002890 Ga0495666_0002890_4663_5142 157
475 3300046526 Ga0495666_0009938 Ga0495666_0009938_3264_3776 157
476 3300046526 Ga0495666_0066325 Ga0495666_0066325_207_689 157
477 3300046529 Ga0495652_0073721 Ga0495652_0073721_2091_2570 157
478 3300046529 Ga0495652_0120132 Ga0495652_0120132_1226_1705 157
479 3300046529 Ga0495652_0135059 Ga0495652_0135059_629_1141 157
480 3300046529 Ga0495652_0234635 Ga0495652_0234635_733_1215 157
481 3300046529 Ga0495652_0261247 Ga0495652_0261247_298_777 157
482 3300046529 Ga0495652_0393119 Ga0495652_0393119_490_969 157
483 3300046529 Ga0495652_0485286 Ga0495652_0485286_100_579 157
484 3300046531 Ga0495665_0000906 Ga0495665_0000906_6673_7152 157
485 3300046531 Ga0495665_0005660 Ga0495665_0005660_4979_5491 157
486 3300046531 Ga0495665_0090627 Ga0495665_0090627_194_673 157
487 3300046533 Ga0495640_0001961 Ga0495640_0001961_12480_12959 157
488 3300046533 Ga0495640_0002320 Ga0495640_0002320_1923_2435 157
489 3300046533 Ga0495640_0015848 Ga0495640_0015848_1421_1903 157
490 3300046533 Ga0495640_0024254 Ga0495640_0024254_1760_2242 157
491 3300046533 Ga0495640_0035145 Ga0495640_0035145_996_1475 157
492 3300046535 Ga0495586_0017357 Ga0495586_0017357_3144_3656 157
493 3300046536 Ga0495587_0038914 Ga0495587_0038914_2316_2795 157
494 3300046536 Ga0495587_0125953 Ga0495587_0125953_746_1258 157
495 3300046536 Ga0495587_0331419 Ga0495587_0331419_230_709 157
496 3300046543 Ga0495645_0003107 Ga0495645_0003107_9246_9758 157
497 3300046543 Ga0495645_0041548 Ga0495645_0041548_966_1445 157
498 3300046543 Ga0495645_0191232 Ga0495645_0191232_668_1147 157
499 3300046557 Ga0495622_0084844 Ga0495622_0084844_605_1096 157
500 3300046557 Ga0495622_0215087 Ga0495622_0215087_24_503 157
501 3300046559 Ga0495667_0010218 Ga0495667_0010218_4781_5260 157
502 3300046559 Ga0495667_0017248 Ga0495667_0017248_393_872 157
503 3300046559 Ga0495667_0101014 Ga0495667_0101014_138_617 157
504 3300046559 Ga0495667_0113481 Ga0495667_0113481_401_883 157
505 3300046559 Ga0495667_0175690 Ga0495667_0175690_60_539 157
506 3300046642 Ga0495634_0001381 Ga0495634_0001381_11934_12416 157
507 3300046642 Ga0495634_0014605 Ga0495634_0014605_4690_5169 157
508 3300046642 Ga0495634_0026394 Ga0495634_0026394_381_860 157
509 3300046642 Ga0495634_0069780 Ga0495634_0069780_807_1319 157
510 3300046663 Ga0495635_0006651 Ga0495635_0006651_6708_7187 157
511 3300046663 Ga0495635_0015815 Ga0495635_0015815_652_1131 157
512 3300046663 Ga0495635_0149885 Ga0495635_0149885_447_959 157
513 3300046663 Ga0495635_0179437 Ga0495635_0179437_668_1147 157
514 3300046663 Ga0495635_0343008 Ga0495635_0343008_98_580 157
515 3300046675 Ga0495657_0004900 Ga0495657_0004900_3879_4361 157
516 3300046675 Ga0495657_0006131 Ga0495657_0006131_5522_6034 157
517 3300046675 Ga0495657_0052689 Ga0495657_0052689_203_682 157
518 3300046675 Ga0495657_0227433 Ga0495657_0227433_275_754 157
519 3300046678 Ga0495599_0043602 Ga0495599_0043602_2183_2662 157
520 3300046678 Ga0495599_0046263 Ga0495599_0046263_1369_1881 157
521 3300046678 Ga0495599_0269375 Ga0495599_0269375_189_668 157
522 3300046679 Ga0495623_0006609 Ga0495623_0006609_3522_4034 157
523 3300046679 Ga0495623_0071154 Ga0495623_0071154_488_967 157
524 3300046679 Ga0495623_0099589 Ga0495623_0099589_1137_1616 157
525 3300046679 Ga0495623_0298636 Ga0495623_0298636_307_789 157
526 3300046680 Ga0495646_0025299 Ga0495646_0025299_1678_2190 157
527 3300046680 Ga0495646_0049198 Ga0495646_0049198_1717_2196 157
528 3300046680 Ga0495646_0050920 Ga0495646_0050920_248_727 157
529 3300046689 Ga0495613_0001650 Ga0495613_0001650_4679_5158 157
530 3300046689 Ga0495613_0006019 Ga0495613_0006019_2690_3202 157
531 3300046689 Ga0495613_0010656 Ga0495613_0010656_5788_6270 157
532 3300046690 Ga0495624_0011180 Ga0495624_0011180_1226_1705 157
533 3300046690 Ga0495624_0014743 Ga0495624_0014743_2823_3302 157
534 3300046690 Ga0495624_0016185 Ga0495624_0016185_2319_2801 157
535 3300046809 Ga0495600_0004713 Ga0495600_0004713_1686_2168 157
536 3300046809 Ga0495600_0014003 Ga0495600_0014003_1980_2492 157
537 3300046809 Ga0495600_0356478 Ga0495600_0356478_189_668 157
538 3300047315 Ga0495581_0000263 Ga0495581_0000263_20110_20589 157
539 3300047315 Ga0495581_0012356 Ga0495581_0012356_2658_3137 157
540 3300047315 Ga0495581_0020955 Ga0495581_0020955_2571_3083 157
541 3300047315 Ga0495581_0082847 Ga0495581_0082847_78_560 157
542 3300047315 Ga0495581_0134718 Ga0495581_0134718_824_1303 157
543 3300047317 Ga0495604_0000228 Ga0495604_0000228_38517_39029 157
544 3300047317 Ga0495604_0017033 Ga0495604_0017033_570_1049 157
545 3300047317 Ga0495604_0253569 Ga0495604_0253569_321_803 157
546 3300047317 Ga0495604_0282355 Ga0495604_0282355_436_915 157
547 3300047319 Ga0495674_0002634 Ga0495674_0002634_6188_6667 157
548 3300047319 Ga0495674_0033876 Ga0495674_0033876_2561_3073 157
549 3300047319 Ga0495674_0270382 Ga0495674_0270382_668_1147 157
550 3300047321 Ga0495676_0000613 Ga0495676_0000613_13040_13522 157
551 3300047321 Ga0495676_0001584 Ga0495676_0001584_10588_11067 157
552 3300047321 Ga0495676_0012085 Ga0495676_0012085_3381_3860 157
553 3300047321 Ga0495676_0790651 Ga0495676_0790651_46_525 157
554 3300047322 Ga0495680_0008276 Ga0495680_0008276_1619_2098 157
555 3300047322 Ga0495680_0040434 Ga0495680_0040434_705_1184 157
556 3300047322 Ga0495680_0051429 Ga0495680_0051429_616_1095 157
557 3300047322 Ga0495680_0191237 Ga0495680_0191237_971_1450 157
558 3300047444 Ga0495675_0060131 Ga0495675_0060131_1593_2072 157
559 3300047444 Ga0495675_0135897 Ga0495675_0135897_208_720 157
560 3300047444 Ga0495675_0146715 Ga0495675_0146715_242_724 157
561 3300047471 Ga0495684_0015310 Ga0495684_0015310_393_872 157
562 3300047471 Ga0495684_0056280 Ga0495684_0056280_990_1502 157
563 3300047471 Ga0495684_0064161 Ga0495684_0064161_2179_2658 157
564 3300047471 Ga0495684_0096501 Ga0495684_0096501_832_1311 157
565 3300047673 Ga0495593_0007464 Ga0495593_0007464_1448_1927 157
566 3300047673 Ga0495593_0040376 Ga0495593_0040376_574_1086 157
567 3300047673 Ga0495593_0202988 Ga0495593_0202988_403_885 157
568 3300048088 Ga0495602_0044808 Ga0495602_0044808_807_1319 157
569 3300048088 Ga0495602_0269791 Ga0495602_0269791_439_918 157
570 3300048088 Ga0495602_0279117 Ga0495602_0279117_423_902 157
571 3300048088 Ga0495602_0553144 Ga0495602_0553144_246_728 157
572 3300048088 Ga0495602_0608770 Ga0495602_0608770_196_675 157
573 3300048089 Ga0495614_0035816 Ga0495614_0035816_322_801 157
574 3300048089 Ga0495614_0227931 Ga0495614_0227931_107_589 157
575 3300048903 Ga0496100_0297862 Ga0496100_0297862_14_493 157
576 3300048906 Ga0496103_0244855 Ga0496103_0244855_649_1128 157
577 3300048907 Ga0496104_0136698 Ga0496104_0136698_1325_1804 157
578 3300048908 Ga0496105_1275542 Ga0496105_1275542_19_498 157
579 3300048910 Ga0496107_0330815 Ga0496107_0330815_641_1120 157
580 3300048912 Ga0496109_0093686 Ga0496109_0093686_2192_2671 157
581 3300048913 Ga0496110_0553753 Ga0496110_0553753_21_500 157
582 3300048913 Ga0496110_1480806 Ga0496110_1480806_19_498 157
583 3300048914 Ga0496111_0075883 Ga0496111_0075883_1259_1738 157
584 3300048915 Ga0496112_0605574 Ga0496112_0605574_264_743 157
585 3300048915 Ga0496112_0736702 Ga0496112_0736702_381_860 157
586 3300048916 Ga0496113_0168979 Ga0496113_0168979_42_521 157
587 3300048916 Ga0496113_0186014 Ga0496113_0186014_217_696 157
588 3300048929 Ga0496126_0590681 Ga0496126_0590681_337_816 157
589 3300049568 Ga0501031_0123880 Ga0501031_0123880_545_1027 157
590 3300049569 Ga0501032_0017443 Ga0501032_0017443_4359_4841 157
591 3300049571 Ga0501034_0325480 Ga0501034_0325480_245_727 157
592 3300049571 Ga0501034_0413550 Ga0501034_0413550_558_1040 157
593 3300049572 Ga0501036_0006789 Ga0501036_0006789_7963_8445 157
594 3300049572 Ga0501036_0432928 Ga0501036_0432928_305_787 157
595 3300049573 Ga0501037_0011775 Ga0501037_0011775_5378_5860 157
596 3300049573 Ga0501037_0253865 Ga0501037_0253865_70_552 157
597 3300049574 Ga0501038_0012653 Ga0501038_0012653_6361_6843 157
598 3300049575 Ga0501039_0055160 Ga0501039_0055160_2415_2897 157
599 3300049575 Ga0501039_0177907 Ga0501039_0177907_1047_1529 157
600 3300049578 Ga0501042_0222592 Ga0501042_0222592_405_887 157
601 3300049579 Ga0501043_0020604 Ga0501043_0020604_2962_3444 157
602 3300049579 Ga0501043_0172843 Ga0501043_0172843_1193_1675 157
603 3300049580 Ga0501046_0974236 Ga0501046_0974236_33_515 157
604 3300049581 Ga0501047_0000029 Ga0501047_0000029_199691_200173 157
605 3300049581 Ga0501047_0007463 Ga0501047_0007463_1942_2424 157
606 3300049581 Ga0501047_0136074 Ga0501047_0136074_688_1170 157
607 3300049581 Ga0501047_0764791 Ga0501047_0764791_130_612 157
608 3300049742 Ga0501080_0478862 Ga0501080_0478862_292_774 157
609 3300049822 Ga0501035_0042286 Ga0501035_0042286_587_1069 157
610 3300049823 Ga0501044_0116755 Ga0501044_0116755_176_658 157
611 3300049823 Ga0501044_0243058 Ga0501044_0243058_621_1103 157
612 3300049823 Ga0501044_1008791 Ga0501044_1008791_61_558 157
613 3300049824 Ga0501045_0138757 Ga0501045_0138757_177_659 157
614 3300050512 nmdc:mga0n895_628388_c1 nmdc:mga0n895_628388_c1_52_531 157
615 3300050513 nmdc:mga0rr50_138433_c1 nmdc:mga0rr50_138433_c1_275_754 157
616 3300050513 nmdc:mga0rr50_1558017_c1 nmdc:mga0rr50_1558017_c1_14_493 157
617 3300050514 nmdc:mga08x19_764773_c1 nmdc:mga08x19_764773_c1_189_668 157
618 3300050514 nmdc:mga08x19_931952_c1 nmdc:mga08x19_931952_c1_85_564 157
619 3300053077 Ga0495601_0006639 Ga0495601_0006639_5256_5768 157
620 3300053077 Ga0495601_0177030 Ga0495601_0177030_668_1147 157
621 3300053078 Ga0495612_0004279 Ga0495612_0004279_4910_5389 157
622 3300053084 Ga0495595_0148021 Ga0495595_0148021_647_1126 157
623 3300053085 Ga0495619_0003141 Ga0495619_0003141_2244_2723 157
624 3300053140 Ga0500573_0087578 Ga0500573_0087578_1189_1701 157
625 3300053140 Ga0500573_0135994 Ga0500573_0135994_315_794 157
626 3300059503 Ga0587080_067915 Ga0587080_067915_106_585 157
627 3300059511 Ga0587091_151974 Ga0587091_151974_65_538 157
628 iso_pu_bacteria 2873314349 2873320643 157
629 iso_pu_bacteria 2935390628 2935391912 157
630 iso_pu_bacteria 8055066027 8055072426 157
631 iso_pu_bacteria 8055172936 8055178588 157
632 3300002075 JGI24738J21930_10008412 JGI24738J21930_100084124 158
633 3300003300 Ga0006758J48902_1016282 Ga0006758J48902_10162821 158
634 3300003308 Ga0006777J48905_1014226 Ga0006777J48905_10142261 158
635 3300003316 rootH1_10005406 rootH1_100054065 158
636 3300003316 rootH1_10035274 rootH1_100352742 158
637 3300003320 rootH2_10018527 rootH2_100185274 158
638 3300003323 rootH1_10091099 rootH1_100910994 158
639 3300003354 JGI25160J50197_1024881 JGI25160J50197_10248812 158
640 3300003354 JGI25160J50197_1032890 JGI25160J50197_10328902 158
641 3300003579 Ga0007429J51699_1022096 Ga0007429J51699_10220961 158
642 3300004800 Ga0058861_12008866 Ga0058861_120088661 158
643 3300005347 Ga0070668_100285973 Ga0070668_1002859732 158
644 3300005366 Ga0070659_100908527 Ga0070659_1009085271 158
645 3300005434 Ga0070709_10025748 Ga0070709_100257481 158
646 3300005435 Ga0070714_100109541 Ga0070714_1001095412 158
647 3300005435 Ga0070714_100523069 Ga0070714_1005230691 158
648 3300005437 Ga0070710_10104590 Ga0070710_101045902 158
649 3300005439 Ga0070711_100113640 Ga0070711_1001136403 158
650 3300005467 Ga0070706_100541154 Ga0070706_1005411542 158
651 3300005468 Ga0070707_100012429 Ga0070707_1000124292 158
652 3300005471 Ga0070698_100001201 Ga0070698_10000120115 158
653 3300005471 Ga0070698_100466314 Ga0070698_1004663142 158
654 3300005535 Ga0070684_101046713 Ga0070684_1010467131 158
655 3300005543 Ga0070672_101586958 Ga0070672_1015869581 158
656 3300005548 Ga0070665_100343290 Ga0070665_1003432902 158
657 3300005614 Ga0068856_100069718 Ga0068856_1000697183 158
658 3300005614 Ga0068856_100182712 Ga0068856_1001827123 158
659 3300005937 Ga0081455_10124405 Ga0081455_101244052 158
660 3300006028 Ga0070717_10268281 Ga0070717_102682812 158
661 3300006028 Ga0070717_10481654 Ga0070717_104816541 158
662 3300006042 Ga0075368_10033951 Ga0075368_100339513 158
663 3300006048 Ga0075363_100249174 Ga0075363_1002491742 158
664 3300006175 Ga0070712_100284293 Ga0070712_1002842931 158
665 3300006175 Ga0070712_100692174 Ga0070712_1006921742 158
666 3300007265 Ga0099794_10337837 Ga0099794_103378371 158
667 3300009011 Ga0105251_10073150 Ga0105251_100731502 158
668 3300009036 Ga0105244_10285605 Ga0105244_102856052 158
669 3300009092 Ga0105250_10045640 Ga0105250_100456403 158
670 3300009101 Ga0105247_10797995 Ga0105247_107979951 158
671 3300009993 Ga0105028_129068 Ga0105028_1290681 158
672 3300010375 Ga0105239_11418126 Ga0105239_114181261 158
673 3300011119 Ga0105246_10006671 Ga0105246_100066713 158
674 3300011119 Ga0105246_10891373 Ga0105246_108913732 158
675 3300013105 Ga0157369_10034777 Ga0157369_100347773 158
676 3300013105 Ga0157369_10175083 Ga0157369_101750833 158
677 3300013307 Ga0157372_10371645 Ga0157372_103716452 158
678 3300014497 Ga0182008_10001523 Ga0182008_1000152314 158
679 3300015261 Ga0182006_1024939 Ga0182006_10249393 158
680 3300015262 Ga0182007_10005632 Ga0182007_100056324 158
681 3300015265 Ga0182005_1017915 Ga0182005_10179152 158
682 3300015688 Ga0183367_1002 Ga0183367_100250 158
683 3300020069 Ga0197907_11416890 Ga0197907_114168902 158
684 3300020070 Ga0206356_11359384 Ga0206356_113593841 158
685 3300020077 Ga0206351_10861184 Ga0206351_108611841 158
686 3300020078 Ga0206352_10879267 Ga0206352_108792672 158
687 3300020080 Ga0206350_10981988 Ga0206350_109819881 158
688 3300020082 Ga0206353_10730323 Ga0206353_107303232 158
689 3300020610 Ga0154015_1480972 Ga0154015_14809721 158
690 3300021388 Ga0213875_10002694 Ga0213875_100026944 158
691 3300021388 Ga0213875_10003336 Ga0213875_100033366 158
692 3300021388 Ga0213875_10022923 Ga0213875_100229233 158
693 3300022467 Ga0224712_10445971 Ga0224712_104459711 158
694 3300025297 Ga0209758_1002043 Ga0209758_100204313 158
695 3300025302 Ga0207426_1002336 Ga0207426_10023362 158
696 3300025302 Ga0207426_1007124 Ga0207426_10071243 158
697 3300025302 Ga0207426_1029138 Ga0207426_10291382 158
698 3300025302 Ga0207426_1068987 Ga0207426_10689871 158
699 3300025728 Ga0207655_1179439 Ga0207655_11794391 158
700 3300025735 Ga0207713_1038278 Ga0207713_10382782 158
701 3300025898 Ga0207692_10845615 Ga0207692_108456151 158
702 3300025904 Ga0207647_10006463 Ga0207647_100064639 158
703 3300025906 Ga0207699_10009261 Ga0207699_100092614 158
704 3300025910 Ga0207684_10618009 Ga0207684_106180091 158
705 3300025915 Ga0207693_10346259 Ga0207693_103462592 158
706 3300025916 Ga0207663_10008261 Ga0207663_100082613 158
707 3300025922 Ga0207646_10042204 Ga0207646_100422043 158
708 3300025929 Ga0207664_10049825 Ga0207664_100498251 158
709 3300025932 Ga0207690_10602544 Ga0207690_106025441 158
710 3300025935 Ga0207709_10034710 Ga0207709_100347104 158
711 3300025939 Ga0207665_10037081 Ga0207665_100370812 158
712 3300025940 Ga0207691_10112106 Ga0207691_101121062 158
713 3300025949 Ga0207667_10681492 Ga0207667_106814921 158
714 3300026041 Ga0207639_10117241 Ga0207639_101172413 158
715 3300026067 Ga0207678_11124097 Ga0207678_111240971 158
716 3300026078 Ga0207702_10479286 Ga0207702_104792861 158
717 3300027312 Ga0209371_1022012 Ga0209371_10220122 158
718 3300027312 Ga0209371_1046036 Ga0209371_10460361 158
719 3300027866 Ga0209813_10009115 Ga0209813_100091153 158
720 3300028379 Ga0268266_10387713 Ga0268266_103877132 158
721 3300028786 Ga0307517_10006432 Ga0307517_100064326 158
722 3300028786 Ga0307517_10013995 Ga0307517_100139956 158
723 3300028794 Ga0307515_10019441 Ga0307515_100194414 158
724 3300028794 Ga0307515_10054034 Ga0307515_100540346 158
725 3300028800 Ga0265338_10038691 Ga0265338_100386915 158
726 3300030500 Ga0268256_1024711 Ga0268256_10247112 158
727 3300030500 Ga0268256_1044065 Ga0268256_10440651 158
728 3300030521 Ga0307511_10002529 Ga0307511_1000252916 158
729 3300030521 Ga0307511_10062255 Ga0307511_100622553 158
730 3300030521 Ga0307511_10156723 Ga0307511_101567232 158
731 3300030522 Ga0307512_10018157 Ga0307512_100181576 158
732 3300030522 Ga0307512_10035855 Ga0307512_100358554 158
733 3300031456 Ga0307513_10017315 Ga0307513_100173158 158
734 3300031456 Ga0307513_10123568 Ga0307513_101235682 158
735 3300031507 Ga0307509_10020553 Ga0307509_100205535 158
736 3300031507 Ga0307509_10111935 Ga0307509_101119352 158
737 3300031616 Ga0307508_10021810 Ga0307508_100218104 158
738 3300031616 Ga0307508_10041733 Ga0307508_100417335 158
739 3300031616 Ga0307508_10048027 Ga0307508_100480274 158
740 3300031616 Ga0307508_10171956 Ga0307508_101719563 158
741 3300031616 Ga0307508_10215710 Ga0307508_102157102 158
742 3300031616 Ga0307508_10351689 Ga0307508_103516892 158
743 3300031649 Ga0307514_10017130 Ga0307514_100171304 158
744 3300031649 Ga0307514_10034987 Ga0307514_100349873 158
745 3300031649 Ga0307514_10115479 Ga0307514_101154793 158
746 3300031649 Ga0307514_10180619 Ga0307514_101806192 158
747 3300031730 Ga0307516_10001694 Ga0307516_1000169412 158
748 3300031730 Ga0307516_10069325 Ga0307516_100693254 158
749 3300031730 Ga0307516_10259869 Ga0307516_102598691 158
750 3300031838 Ga0307518_10234128 Ga0307518_102341282 158
751 3300031838 Ga0307518_10267199 Ga0307518_102671992 158
752 3300031995 Ga0307409_101042037 Ga0307409_1010420372 158
753 3300032002 Ga0307416_102577154 Ga0307416_1025771541 158
754 3300033179 Ga0307507_10065610 Ga0307507_100656103 158
755 3300033179 Ga0307507_10094796 Ga0307507_100947963 158
756 3300033180 Ga0307510_10047845 Ga0307510_100478454 158
757 3300033180 Ga0307510_10075253 Ga0307510_100752533 158
758 3300033180 Ga0307510_10414676 Ga0307510_104146761 158
759 3300035111 Ga0373923_0015531 Ga0373923_0015531_2013_2516 158
760 3300035117 Ga0373953_0064125 Ga0373953_0064125_63_566 158
761 3300035118 Ga0373954_0017279 Ga0373954_0017279_2400_2903 158
762 3300035119 Ga0373956_0003365 Ga0373956_0003365_3707_4210 158
763 3300035120 Ga0373957_0019021 Ga0373957_0019021_217_720 158
764 3300035172 Ga0373955_0135427 Ga0373955_0135427_575_1078 158
765 3300035410 Ga0373924_0035196 Ga0373924_0035196_641_1144 158
766 3300035724 Ga0373933_0431084 Ga0373933_0431084_275_778 158
767 3300035725 Ga0373947_0419450 Ga0373947_0419450_326_829 158
768 3300036401 Ga0373937_0128069 Ga0373937_0128069_676_1179 158
769 3300037418 Ga0395900_0493198 Ga0395900_0493198_567_1043 158
770 3300037466 Ga0395898_0005934 Ga0395898_0005934_2779_3255 158
771 3300037466 Ga0395898_0029812 Ga0395898_0029812_2784_3260 158
772 3300037466 Ga0395898_1085852 Ga0395898_1085852_17_493 158
773 3300037853 Ga0436364_0321419 Ga0436364_0321419_1350_1853 158
774 3300037853 Ga0436364_0584067 Ga0436364_0584067_146730_147236 158
775 3300037853 Ga0436364_0667270 Ga0436364_0667270_123655_124158 158
776 3300037853 Ga0436364_0894301 Ga0436364_0894301_3464_3940 158
777 3300038443 Ga0395901_0004321 Ga0395901_0004321_4886_5362 158
778 3300039450 Ga0436363_1443462 Ga0436363_1443462_281_784 158
779 3300041404 Ga0439436_0012288 Ga0439436_0012288_2038_2514 158
780 3300041404 Ga0439436_0019687 Ga0439436_0019687_1314_1790 158
781 3300041406 Ga0439439_0001796 Ga0439439_0001796_1592_2068 158
782 3300041441 Ga0451787_359134 Ga0451787_359134_107_583 158
783 3300041460 Ga0451802_1987063 Ga0451802_1987063_398_874 158
784 3300041463 Ga0451804_0436132 Ga0451804_0436132_148_624 158
785 3300041491 Ga0451833_0239514 Ga0451833_0239514_56_532 158
786 3300041494 Ga0451837_0778280 Ga0451837_0778280_552_1028 158
787 3300041498 Ga0451841_0429692 Ga0451841_0429692_882_1358 158
788 3300041501 Ga0451845_0895553 Ga0451845_0895553_184_660 158
789 3300041512 Ga0451853_2320900 Ga0451853_2320900_571_1047 158
790 3300041512 Ga0451853_2374569 Ga0451853_2374569_5272_5748 158
791 3300041512 Ga0451853_2502482 Ga0451853_2502482_47_523 158
792 3300041512 Ga0451853_2847812 Ga0451853_2847812_267_743 158
793 3300041999 Ga0439433_0000279 Ga0439433_0000279_5058_5534 158
794 3300042002 Ga0439442_003766 Ga0439442_003766_367_843 158
795 3300042005 Ga0439448_0046552 Ga0439448_0046552_256_732 158
796 3300042007 Ga0439449_0047343 Ga0439449_0047343_912_1388 158
797 3300042007 Ga0439449_0101207 Ga0439449_0101207_574_1050 158
798 3300042007 Ga0439449_0121145 Ga0439449_0121145_418_894 158
799 3300042008 Ga0439450_063864 Ga0439450_063864_381_857 158
800 3300042012 Ga0439455_0039978 Ga0439455_0039978_459_935 158
801 3300042014 Ga0439457_000721 Ga0439457_000721_6558_7034 158
802 3300042014 Ga0439457_002443 Ga0439457_002443_3239_3715 158
803 3300042014 Ga0439457_045983 Ga0439457_045983_376_852 158
804 3300042015 Ga0439462_0002910 Ga0439462_0002910_1945_2421 158
805 3300042122 Ga0450920_044482 Ga0450920_044482_166_642 158
806 3300042127 Ga0450890_059547 Ga0450890_059547_65_541 158
807 3300042134 Ga0450898_013530 Ga0450898_013530_774_1250 158
808 3300042135 Ga0450899_000745 Ga0450899_000745_3168_3644 158
809 3300042136 Ga0450900_019218 Ga0450900_019218_26_502 158
810 3300042138 Ga0450903_001883 Ga0450903_001883_1035_1511 158
811 3300042145 Ga0450906_000226 Ga0450906_000226_7808_8284 158
812 3300042157 Ga0439458_0005506 Ga0439458_0005506_68_544 158
813 3300042184 Ga0450908_016280 Ga0450908_016280_662_1138 158
814 3300044656 Ga0466969_0002485 Ga0466969_0002485_341_865 158
815 3300044656 Ga0466969_0003241 Ga0466969_0003241_6087_6617 158
816 3300044656 Ga0466969_0050663 Ga0466969_0050663_105_581 158
817 3300044656 Ga0466969_0055615 Ga0466969_0055615_124_618 158
818 3300044656 Ga0466969_0404869 Ga0466969_0404869_24_500 158
819 3300044658 Ga0466972_0003351 Ga0466972_0003351_5553_6029 158
820 3300044658 Ga0466972_0017124 Ga0466972_0017124_32_508 158
821 3300044658 Ga0466972_0025927 Ga0466972_0025927_1122_1598 158
822 3300044658 Ga0466972_0193031 Ga0466972_0193031_10_486 158
823 3300044658 Ga0466972_0431652 Ga0466972_0431652_122_598 158
824 3300044683 Ga0466965_0109129 Ga0466965_0109129_74_550 158
825 3300044684 Ga0466966_0003158 Ga0466966_0003158_4360_4890 158
826 3300044684 Ga0466966_0006738 Ga0466966_0006738_5164_5640 158
827 3300044684 Ga0466966_0012255 Ga0466966_0012255_5046_5540 158
828 3300044693 Ga0466961_0024718 Ga0466961_0024718_1048_1524 158
829 3300044693 Ga0466961_0025584 Ga0466961_0025584_3289_3765 158
830 3300044693 Ga0466961_0037580 Ga0466961_0037580_279_803 158
831 3300044693 Ga0466961_0055353 Ga0466961_0055353_679_1155 158
832 3300044694 Ga0466963_0005506 Ga0466963_0005506_3434_3910 158
833 3300044694 Ga0466963_0025453 Ga0466963_0025453_3260_3736 158
834 3300044706 Ga0466964_0030772 Ga0466964_0030772_10_486 158
835 3300044706 Ga0466964_0067983 Ga0466964_0067983_969_1445 158
836 3300044719 Ga0466971_0001389 Ga0466971_0001389_6402_6878 158
837 3300044719 Ga0466971_0053086 Ga0466971_0053086_164_640 158
838 3300044719 Ga0466971_0054585 Ga0466971_0054585_1180_1674 158
839 3300044735 Ga0466968_0479983 Ga0466968_0479983_22_498 158
840 3300044765 Ga0466970_0002309 Ga0466970_0002309_1364_1840 158
841 3300044765 Ga0466970_0116074 Ga0466970_0116074_870_1346 158
842 3300044765 Ga0466970_0117800 Ga0466970_0117800_749_1225 158
843 3300044842 Ga0466957_0232532 Ga0466957_0232532_196_690 158
844 3300044842 Ga0466957_0337788 Ga0466957_0337788_475_951 158
845 3300044901 Ga0466960_0004566 Ga0466960_0004566_1565_2041 158
846 3300044901 Ga0466960_0180345 Ga0466960_0180345_340_816 158
847 3300045049 Ga0466959_0001895 Ga0466959_0001895_2739_3233 158
848 3300045049 Ga0466959_0003319 Ga0466959_0003319_2621_3097 158
849 3300045049 Ga0466959_0004806 Ga0466959_0004806_6835_7365 158
850 3300045836 Ga0466958_0070757 Ga0466958_0070757_492_968 158
851 3300045836 Ga0466958_0660370 Ga0466958_0660370_152_646 158
852 3300045836 Ga0466958_0784552 Ga0466958_0784552_53_577 158
853 3300045836 Ga0466958_0802254 Ga0466958_0802254_88_564 158
854 3300045976 Ga0466967_0025672 Ga0466967_0025672_4209_4685 158
855 3300045976 Ga0466967_0049282 Ga0466967_0049282_2206_2682 158
856 3300045976 Ga0466967_0664839 Ga0466967_0664839_28_504 158
857 3300046452 Ga0495617_214352 Ga0495617_214352_46_522 158
858 3300046454 Ga0495592_0017207 Ga0495592_0017207_584_1060 158
859 3300046454 Ga0495592_0064286 Ga0495592_0064286_1393_1896 158
860 3300046455 Ga0495603_0001170 Ga0495603_0001170_9101_9577 158
861 3300046455 Ga0495603_0001759 Ga0495603_0001759_147_623 158
862 3300046455 Ga0495603_0007613 Ga0495603_0007613_3128_3604 158
863 3300046455 Ga0495603_0138178 Ga0495603_0138178_590_1114 158
864 3300046455 Ga0495603_0212275 Ga0495603_0212275_608_1084 158
865 3300046457 Ga0495590_0024466 Ga0495590_0024466_872_1348 158
866 3300046457 Ga0495590_0161883 Ga0495590_0161883_62_538 158
867 3300046459 Ga0495629_0005448 Ga0495629_0005448_7490_7966 158
868 3300046459 Ga0495629_0008455 Ga0495629_0008455_6372_6848 158
869 3300046459 Ga0495629_0014435 Ga0495629_0014435_1799_2275 158
870 3300046459 Ga0495629_0032184 Ga0495629_0032184_2033_2527 158
871 3300046459 Ga0495629_0041614 Ga0495629_0041614_675_1151 158
872 3300046459 Ga0495629_0101167 Ga0495629_0101167_1397_1873 158
873 3300046459 Ga0495629_0156787 Ga0495629_0156787_501_977 158
874 3300046459 Ga0495629_0206749 Ga0495629_0206749_441_917 158
875 3300046460 Ga0495638_0095648 Ga0495638_0095648_724_1200 158
876 3300046460 Ga0495638_0247645 Ga0495638_0247645_419_913 158
877 3300046462 Ga0495651_0001653 Ga0495651_0001653_2112_2588 158
878 3300046462 Ga0495651_0040615 Ga0495651_0040615_2047_2550 158
879 3300046463 Ga0495653_0168432 Ga0495653_0168432_361_864 158
880 3300046463 Ga0495653_0414898 Ga0495653_0414898_328_804 158
881 3300046471 Ga0495650_0169531 Ga0495650_0169531_275_751 158
882 3300046473 Ga0495582_0105904 Ga0495582_0105904_937_1413 158
883 3300046474 Ga0495605_0008865 Ga0495605_0008865_4189_4665 158
884 3300046476 Ga0495662_0001192 Ga0495662_0001192_6493_6969 158
885 3300046476 Ga0495662_0045311 Ga0495662_0045311_1095_1598 158
886 3300046476 Ga0495662_0063821 Ga0495662_0063821_274_750 158
887 3300046476 Ga0495662_0077396 Ga0495662_0077396_187_663 158
888 3300046476 Ga0495662_0082165 Ga0495662_0082165_832_1308 158
889 3300046476 Ga0495662_0191117 Ga0495662_0191117_79_594 158
890 3300046477 Ga0495664_0000282 Ga0495664_0000282_22835_23311 158
891 3300046477 Ga0495664_0157756 Ga0495664_0157756_483_986 158
892 3300046492 Ga0495585_0182554 Ga0495585_0182554_523_999 158
893 3300046492 Ga0495585_0378970 Ga0495585_0378970_28_504 158
894 3300046499 Ga0495594_0002260 Ga0495594_0002260_3366_3842 158
895 3300046499 Ga0495594_0026432 Ga0495594_0026432_1355_1831 158
896 3300046499 Ga0495594_0046749 Ga0495594_0046749_592_1068 158
897 3300046499 Ga0495594_0058145 Ga0495594_0058145_1166_1642 158
898 3300046500 Ga0495596_0055282 Ga0495596_0055282_205_681 158
899 3300046501 Ga0495607_0021008 Ga0495607_0021008_813_1289 158
900 3300046501 Ga0495607_0069409 Ga0495607_0069409_203_679 158
901 3300046501 Ga0495607_0140903 Ga0495607_0140903_662_1156 158
902 3300046506 Ga0495583_0101987 Ga0495583_0101987_732_1208 158
903 3300046507 Ga0495606_0201596 Ga0495606_0201596_180_656 158
904 3300046511 Ga0495608_0050637 Ga0495608_0050637_833_1336 158
905 3300046511 Ga0495608_0313751 Ga0495608_0313751_72_548 158
906 3300046512 Ga0495610_0026281 Ga0495610_0026281_1454_1930 158
907 3300046514 Ga0495618_0107407 Ga0495618_0107407_575_1078 158
908 3300046514 Ga0495618_0107503 Ga0495618_0107503_607_1083 158
909 3300046514 Ga0495618_0123278 Ga0495618_0123278_132_608 158
910 3300046515 Ga0495620_0121679 Ga0495620_0121679_502_978 158
911 3300046516 Ga0495628_0040088 Ga0495628_0040088_703_1179 158
912 3300046516 Ga0495628_0125974 Ga0495628_0125974_804_1280 158
913 3300046516 Ga0495628_0517841 Ga0495628_0517841_316_819 158
914 3300046517 Ga0495630_0029888 Ga0495630_0029888_3449_3925 158
915 3300046517 Ga0495630_0058729 Ga0495630_0058729_993_1496 158
916 3300046518 Ga0495631_0003642 Ga0495631_0003642_7231_7707 158
917 3300046518 Ga0495631_0129231 Ga0495631_0129231_514_990 158
918 3300046518 Ga0495631_0212547 Ga0495631_0212547_304_780 158
919 3300046520 Ga0495637_0024557 Ga0495637_0024557_2191_2667 158
920 3300046522 Ga0495643_0001554 Ga0495643_0001554_10749_11225 158
921 3300046522 Ga0495643_0001610 Ga0495643_0001610_15937_16431 158
922 3300046523 Ga0495644_0334376 Ga0495644_0334376_86_562 158
923 3300046524 Ga0495648_0104390 Ga0495648_0104390_872_1348 158
924 3300046526 Ga0495666_0101342 Ga0495666_0101342_440_916 158
925 3300046529 Ga0495652_0115282 Ga0495652_0115282_1542_2018 158
926 3300046530 Ga0495654_0022533 Ga0495654_0022533_1883_2359 158
927 3300046531 Ga0495665_0460580 Ga0495665_0460580_132_608 158
928 3300046533 Ga0495640_0067264 Ga0495640_0067264_1473_1949 158
929 3300046533 Ga0495640_0115581 Ga0495640_0115581_312_815 158
930 3300046533 Ga0495640_0158249 Ga0495640_0158249_703_1179 158
931 3300046535 Ga0495586_0435644 Ga0495586_0435644_221_724 158
932 3300046536 Ga0495587_0003804 Ga0495587_0003804_4944_5420 158
933 3300046536 Ga0495587_0026748 Ga0495587_0026748_2561_3064 158
934 3300046536 Ga0495587_0055943 Ga0495587_0055943_1354_1830 158
935 3300046538 Ga0495609_0004574 Ga0495609_0004574_6194_6670 158
936 3300046538 Ga0495609_0058435 Ga0495609_0058435_96_572 158
937 3300046542 Ga0495597_0062272 Ga0495597_0062272_377_853 158
938 3300046543 Ga0495645_0040226 Ga0495645_0040226_731_1252 158
939 3300046543 Ga0495645_0040384 Ga0495645_0040384_2230_2706 158
940 3300046543 Ga0495645_0055725 Ga0495645_0055725_2319_2822 158
941 3300046543 Ga0495645_0102662 Ga0495645_0102662_1479_1955 158
942 3300046557 Ga0495622_0005508 Ga0495622_0005508_3034_3510 158
943 3300046557 Ga0495622_0374443 Ga0495622_0374443_54_581 158
944 3300046558 Ga0495633_0095427 Ga0495633_0095427_413_889 158
945 3300046559 Ga0495667_0089327 Ga0495667_0089327_911_1414 158
946 3300046559 Ga0495667_0136192 Ga0495667_0136192_891_1367 158
947 3300046559 Ga0495667_0209159 Ga0495667_0209159_440_916 158
948 3300046559 Ga0495667_0534015 Ga0495667_0534015_19_495 158
949 3300046615 Ga0495656_0266167 Ga0495656_0266167_367_843 158
950 3300046615 Ga0495656_0490228 Ga0495656_0490228_35_529 158
951 3300046642 Ga0495634_0015448 Ga0495634_0015448_4911_5387 158
952 3300046642 Ga0495634_0060612 Ga0495634_0060612_488_991 158
953 3300046642 Ga0495634_0066359 Ga0495634_0066359_332_808 158
954 3300046642 Ga0495634_0221785 Ga0495634_0221785_163_657 158
955 3300046648 Ga0495611_0028329 Ga0495611_0028329_1344_1820 158
956 3300046648 Ga0495611_0041868 Ga0495611_0041868_781_1275 158
957 3300046660 Ga0495625_0007829 Ga0495625_0007829_5241_5717 158
958 3300046660 Ga0495625_0018691 Ga0495625_0018691_4043_4519 158
959 3300046660 Ga0495625_0183510 Ga0495625_0183510_77_553 158
960 3300046663 Ga0495635_0026450 Ga0495635_0026450_2247_2723 158
961 3300046663 Ga0495635_0042810 Ga0495635_0042810_311_814 158
962 3300046663 Ga0495635_0143959 Ga0495635_0143959_99_575 158
963 3300046663 Ga0495635_0294182 Ga0495635_0294182_300_776 158
964 3300046665 Ga0495661_0163666 Ga0495661_0163666_350_826 158
965 3300046674 Ga0495588_0006288 Ga0495588_0006288_2643_3119 158
966 3300046674 Ga0495588_0019662 Ga0495588_0019662_932_1408 158
967 3300046674 Ga0495588_0119137 Ga0495588_0119137_310_786 158
968 3300046674 Ga0495588_0275311 Ga0495588_0275311_394_870 158
969 3300046674 Ga0495588_0361310 Ga0495588_0361310_23_499 158
970 3300046674 Ga0495588_0364185 Ga0495588_0364185_93_569 158
971 3300046675 Ga0495657_0002972 Ga0495657_0002972_1323_1799 158
972 3300046675 Ga0495657_0026711 Ga0495657_0026711_48_551 158
973 3300046675 Ga0495657_0050139 Ga0495657_0050139_40_516 158
974 3300046675 Ga0495657_0067834 Ga0495657_0067834_1539_2015 158
975 3300046678 Ga0495599_0035030 Ga0495599_0035030_2557_3033 158
976 3300046679 Ga0495623_0007559 Ga0495623_0007559_3984_4499 158
977 3300046679 Ga0495623_0063138 Ga0495623_0063138_498_974 158
978 3300046679 Ga0495623_0095716 Ga0495623_0095716_408_911 158
979 3300046679 Ga0495623_0222253 Ga0495623_0222253_397_873 158
980 3300046680 Ga0495646_0025806 Ga0495646_0025806_1130_1606 158
981 3300046680 Ga0495646_0078571 Ga0495646_0078571_1055_1558 158
982 3300046680 Ga0495646_0592601 Ga0495646_0592601_63_539 158
983 3300046689 Ga0495613_0007869 Ga0495613_0007869_6368_6844 158
984 3300046689 Ga0495613_0027108 Ga0495613_0027108_2209_2685 158
985 3300046689 Ga0495613_0036074 Ga0495613_0036074_840_1316 158
986 3300046689 Ga0495613_0046407 Ga0495613_0046407_2436_2939 158
987 3300046689 Ga0495613_0056515 Ga0495613_0056515_1579_2055 158
988 3300046689 Ga0495613_0941571 Ga0495613_0941571_42_527 158
989 3300046690 Ga0495624_0270769 Ga0495624_0270769_67_570 158
990 3300046691 Ga0495670_0009917 Ga0495670_0009917_3243_3737 158
991 3300046692 Ga0495671_0100925 Ga0495671_0100925_740_1216 158
992 3300046692 Ga0495671_0198778 Ga0495671_0198778_178_654 158
993 3300046794 Ga0495589_0023123 Ga0495589_0023123_504_980 158
994 3300046794 Ga0495589_0024656 Ga0495589_0024656_580_1056 158
995 3300046794 Ga0495589_0041330 Ga0495589_0041330_1526_2002 158
996 3300046794 Ga0495589_0234654 Ga0495589_0234654_22_498 158
997 3300046794 Ga0495589_0372836 Ga0495589_0372836_18_512 158
998 3300046809 Ga0495600_0064229 Ga0495600_0064229_405_926 158
999 3300046809 Ga0495600_0073662 Ga0495600_0073662_1740_2216 158
1000 3300046809 Ga0495600_0130407 Ga0495600_0130407_368_844 158
1001 3300046809 Ga0495600_0162253 Ga0495600_0162253_619_1122 158
1002 3300046809 Ga0495600_0175349 Ga0495600_0175349_36_512 158
1003 3300046809 Ga0495600_0274535 Ga0495600_0274535_535_1050 158
1004 3300046809 Ga0495600_0793675 Ga0495600_0793675_76_552 158
1005 3300047315 Ga0495581_0042925 Ga0495581_0042925_173_649 158
1006 3300047315 Ga0495581_0141944 Ga0495581_0141944_877_1353 158
1007 3300047317 Ga0495604_0000695 Ga0495604_0000695_22508_22984 158
1008 3300047317 Ga0495604_0006374 Ga0495604_0006374_3010_3516 158
1009 3300047317 Ga0495604_0051601 Ga0495604_0051601_2159_2635 158
1010 3300047317 Ga0495604_0063128 Ga0495604_0063128_1522_2025 158
1011 3300047318 Ga0495636_0001610 Ga0495636_0001610_1569_2045 158
1012 3300047318 Ga0495636_0080197 Ga0495636_0080197_246_722 158
1013 3300047318 Ga0495636_0287081 Ga0495636_0287081_243_719 158
1014 3300047318 Ga0495636_0366904 Ga0495636_0366904_21_497 158
1015 3300047318 Ga0495636_0606385 Ga0495636_0606385_48_524 158
1016 3300047319 Ga0495674_0166231 Ga0495674_0166231_394_870 158
1017 3300047319 Ga0495674_0291070 Ga0495674_0291070_521_1024 158
1018 3300047320 Ga0495672_0116302 Ga0495672_0116302_871_1347 158
1019 3300047321 Ga0495676_0008638 Ga0495676_0008638_933_1409 158
1020 3300047321 Ga0495676_0011585 Ga0495676_0011585_1866_2342 158
1021 3300047321 Ga0495676_0026464 Ga0495676_0026464_1537_2013 158
1022 3300047321 Ga0495676_0037864 Ga0495676_0037864_501_977 158
1023 3300047321 Ga0495676_0093002 Ga0495676_0093002_378_854 158
1024 3300047321 Ga0495676_0238301 Ga0495676_0238301_349_825 158
1025 3300047321 Ga0495676_0269970 Ga0495676_0269970_239_715 158
1026 3300047322 Ga0495680_0053569 Ga0495680_0053569_1004_1480 158
1027 3300047322 Ga0495680_0056799 Ga0495680_0056799_1943_2446 158
1028 3300047323 Ga0495683_0014216 Ga0495683_0014216_2383_2877 158
1029 3300047323 Ga0495683_0018255 Ga0495683_0018255_226_702 158
1030 3300047323 Ga0495683_0052837 Ga0495683_0052837_1048_1524 158
1031 3300047323 Ga0495683_0397756 Ga0495683_0397756_41_517 158
1032 3300047443 Ga0495687_002340 Ga0495687_002340_5037_5513 158
1033 3300047443 Ga0495687_005422 Ga0495687_005422_7522_7998 158
1034 3300047443 Ga0495687_008591 Ga0495687_008591_4331_4825 158
1035 3300047443 Ga0495687_027386 Ga0495687_027386_238_732 158
1036 3300047443 Ga0495687_049101 Ga0495687_049101_932_1408 158
1037 3300047444 Ga0495675_0008872 Ga0495675_0008872_1623_2099 158
1038 3300047444 Ga0495675_0017990 Ga0495675_0017990_3441_3956 158
1039 3300047444 Ga0495675_0025200 Ga0495675_0025200_2158_2634 158
1040 3300047444 Ga0495675_0036401 Ga0495675_0036401_697_1218 158
1041 3300047444 Ga0495675_0175951 Ga0495675_0175951_23_499 158
1042 3300047444 Ga0495675_0214530 Ga0495675_0214530_23_544 158
1043 3300047444 Ga0495675_0232126 Ga0495675_0232126_238_741 158
1044 3300047444 Ga0495675_0365335 Ga0495675_0365335_172_696 158
1045 3300047445 Ga0495677_0082194 Ga0495677_0082194_128_604 158
1046 3300047445 Ga0495677_0168259 Ga0495677_0168259_53_529 158
1047 3300047447 Ga0495685_000339 Ga0495685_000339_11974_12468 158
1048 3300047447 Ga0495685_001961 Ga0495685_001961_293_769 158
1049 3300047447 Ga0495685_006381 Ga0495685_006381_3348_3824 158
1050 3300047447 Ga0495685_010526 Ga0495685_010526_1060_1536 158
1051 3300047447 Ga0495685_097524 Ga0495685_097524_417_893 158
1052 3300047470 Ga0495681_0000484 Ga0495681_0000484_11748_12224 158
1053 3300047470 Ga0495681_0001772 Ga0495681_0001772_3647_4141 158
1054 3300047470 Ga0495681_0189801 Ga0495681_0189801_21_497 158
1055 3300047471 Ga0495684_0066516 Ga0495684_0066516_2099_2602 158
1056 3300047472 Ga0495686_0080126 Ga0495686_0080126_243_719 158
1057 3300047673 Ga0495593_0005276 Ga0495593_0005276_4986_5462 158
1058 3300047673 Ga0495593_0008191 Ga0495593_0008191_1408_1884 158
1059 3300048088 Ga0495602_0022868 Ga0495602_0022868_4223_4699 158
1060 3300048088 Ga0495602_0053981 Ga0495602_0053981_2304_2807 158
1061 3300048089 Ga0495614_0001002 Ga0495614_0001002_1552_2028 158
1062 3300048089 Ga0495614_0004532 Ga0495614_0004532_4005_4481 158
1063 3300048089 Ga0495614_0005784 Ga0495614_0005784_2096_2572 158
1064 3300048089 Ga0495614_0192407 Ga0495614_0192407_239_715 158
1065 3300048091 Ga0495626_0005159 Ga0495626_0005159_6246_6722 158
1066 3300048905 Ga0496102_0115988 Ga0496102_0115988_1559_2059 158
1067 3300048905 Ga0496102_1807886 Ga0496102_1807886_21_497 158
1068 3300048908 Ga0496105_1036754 Ga0496105_1036754_90_566 158
1069 3300048909 Ga0496106_0047750 Ga0496106_0047750_626_1102 158
1070 3300048911 Ga0496108_0575229 Ga0496108_0575229_436_912 158
1071 3300048912 Ga0496109_0672790 Ga0496109_0672790_448_924 158
1072 3300048916 Ga0496113_1285904 Ga0496113_1285904_32_508 158
1073 3300048918 Ga0496115_0292585 Ga0496115_0292585_695_1201 158
1074 3300048918 Ga0496115_1045187 Ga0496115_1045187_129_605 158
1075 3300048922 Ga0496119_0090567 Ga0496119_0090567_932_1432 158
1076 3300049127 Ga0501306_062094 Ga0501306_062094_60_536 158
1077 3300049130 Ga0501310_043368 Ga0501310_043368_59_535 158
1078 3300049161 Ga0501305_074032 Ga0501305_074032_82_558 158
1079 3300049162 Ga0501307_069711 Ga0501307_069711_50_526 158
1080 3300049459 Ga0495678_022455 Ga0495678_022455_1596_2072 158
1081 3300049460 Ga0495682_0308441 Ga0495682_0308441_30_506 158
1082 3300049527 Ga0501311_024918 Ga0501311_024918_301_819 158
1083 3300049527 Ga0501311_048719 Ga0501311_048719_126_602 158
1084 3300049532 Ga0501316_040440 Ga0501316_040440_34_510 158
1085 3300049535 Ga0501319_013012 Ga0501319_013012_77_553 158
1086 3300049539 Ga0501323_015022 Ga0501323_015022_416_934 158
1087 3300049568 Ga0501031_0055511 Ga0501031_0055511_1628_2104 158
1088 3300049569 Ga0501032_0046653 Ga0501032_0046653_1618_2094 158
1089 3300049570 Ga0501033_0001721 Ga0501033_0001721_11336_11812 158
1090 3300049570 Ga0501033_0041732 Ga0501033_0041732_686_1162 158
1091 3300049570 Ga0501033_0279130 Ga0501033_0279130_177_653 158
1092 3300049571 Ga0501034_0006924 Ga0501034_0006924_1398_1874 158
1093 3300049571 Ga0501034_0123542 Ga0501034_0123542_749_1225 158
1094 3300049572 Ga0501036_0000553 Ga0501036_0000553_1694_2170 158
1095 3300049572 Ga0501036_0004613 Ga0501036_0004613_7298_7774 158
1096 3300049572 Ga0501036_0061798 Ga0501036_0061798_2439_2915 158
1097 3300049572 Ga0501036_0100394 Ga0501036_0100394_1408_1884 158
1098 3300049573 Ga0501037_0032349 Ga0501037_0032349_849_1325 158
1099 3300049574 Ga0501038_0015344 Ga0501038_0015344_4459_4935 158
1100 3300049574 Ga0501038_0027984 Ga0501038_0027984_2217_2693 158
1101 3300049574 Ga0501038_0031678 Ga0501038_0031678_3418_3894 158
1102 3300049575 Ga0501039_0038974 Ga0501039_0038974_855_1331 158
1103 3300049575 Ga0501039_0073425 Ga0501039_0073425_551_1027 158
1104 3300049578 Ga0501042_0275777 Ga0501042_0275777_389_865 158
1105 3300049579 Ga0501043_0062689 Ga0501043_0062689_2291_2767 158
1106 3300049579 Ga0501043_0075044 Ga0501043_0075044_865_1341 158
1107 3300049580 Ga0501046_0011002 Ga0501046_0011002_673_1149 158
1108 3300049580 Ga0501046_0032446 Ga0501046_0032446_1527_2003 158
1109 3300049580 Ga0501046_0177966 Ga0501046_0177966_998_1474 158
1110 3300049581 Ga0501047_0073029 Ga0501047_0073029_912_1409 158
1111 3300049581 Ga0501047_0078399 Ga0501047_0078399_164_640 158
1112 3300049581 Ga0501047_0125064 Ga0501047_0125064_809_1285 158
1113 3300049581 Ga0501047_0134580 Ga0501047_0134580_850_1326 158
1114 3300049582 Ga0501048_0003722 Ga0501048_0003722_9409_9885 158
1115 3300049585 Ga0501069_0305847 Ga0501069_0305847_128_604 158
1116 3300049586 Ga0501070_0003332 Ga0501070_0003332_11956_12432 158
1117 3300049586 Ga0501070_0217054 Ga0501070_0217054_14_490 158
1118 3300049586 Ga0501070_0469458 Ga0501070_0469458_175_651 158
1119 3300049589 Ga0501073_0051632 Ga0501073_0051632_324_800 158
1120 3300049589 Ga0501073_0105674 Ga0501073_0105674_1011_1487 158
1121 3300049590 Ga0501074_0000685 Ga0501074_0000685_5816_6292 158
1122 3300049742 Ga0501080_0208337 Ga0501080_0208337_1266_1742 158
1123 3300049822 Ga0501035_0001374 Ga0501035_0001374_14134_14610 158
1124 3300049822 Ga0501035_0019714 Ga0501035_0019714_3781_4257 158
1125 3300049822 Ga0501035_0041594 Ga0501035_0041594_598_1083 158
1126 3300049822 Ga0501035_0232963 Ga0501035_0232963_296_772 158
1127 3300049823 Ga0501044_0004484 Ga0501044_0004484_14039_14515 158
1128 3300049823 Ga0501044_0012903 Ga0501044_0012903_3839_4315 158
1129 3300049823 Ga0501044_0039348 Ga0501044_0039348_687_1163 158
1130 3300049823 Ga0501044_0097016 Ga0501044_0097016_244_729 158
1131 3300049823 Ga0501044_0209971 Ga0501044_0209971_632_1108 158
1132 3300049824 Ga0501045_0094045 Ga0501045_0094045_1016_1492 158
1133 3300050490 nmdc:mga03n38_23741_c1 nmdc:mga03n38_23741_c1_1795_2271 158
1134 3300050490 nmdc:mga03n38_251435_c1 nmdc:mga03n38_251435_c1_164_640 158
1135 3300050490 nmdc:mga03n38_453060_c1 nmdc:mga03n38_453060_c1_55_531 158
1136 3300050494 nmdc:mga06z11_65607_c1 nmdc:mga06z11_65607_c1_1194_1670 158
1137 3300050495 nmdc:mga04h51_16963_c1 nmdc:mga04h51_16963_c1_237_713 158
1138 3300053077 Ga0495601_0371298 Ga0495601_0371298_301_777 158
1139 3300053078 Ga0495612_0103034 Ga0495612_0103034_295_771 158
1140 3300053079 Ga0500610_0055900 Ga0500610_0055900_1274_1750 158
1141 3300053083 Ga0495655_0187628 Ga0495655_0187628_71_565 158
1142 3300053085 Ga0495619_0040885 Ga0495619_0040885_2314_2817 158
1143 3300053085 Ga0495619_0104808 Ga0495619_0104808_619_1095 158
1144 3300053085 Ga0495619_0480572 Ga0495619_0480572_242_736 158
1145 3300053086 Ga0500578_0050722 Ga0500578_0050722_1873_2367 158
1146 3300053094 Ga0500566_0017627 Ga0500566_0017627_2557_3051 158
1147 3300053095 Ga0500640_044584 Ga0500640_044584_755_1231 158
1148 3300053099 Ga0500654_024030 Ga0500654_024030_1502_1996 158
1149 3300053100 Ga0500660_027042 Ga0500660_027042_2463_2957 158
1150 3300053101 Ga0500553_035471 Ga0500553_035471_487_963 158
1151 3300053101 Ga0500553_095490 Ga0500553_095490_530_1024 158
1152 3300053106 Ga0500558_245350 Ga0500558_245350_39_533 158
1153 3300053107 Ga0500560_000476 Ga0500560_000476_2156_2632 158
1154 3300053109 Ga0500569_004487 Ga0500569_004487_2329_2823 158
1155 3300053118 Ga0500594_0121542 Ga0500594_0121542_19_513 158
1156 3300053126 Ga0500621_032891 Ga0500621_032891_223_717 158
1157 3300053129 Ga0500628_009354 Ga0500628_009354_1085_1579 158
1158 3300053131 Ga0500652_001101 Ga0500652_001101_5665_6159 158
1159 3300053137 Ga0500561_0000489 Ga0500561_0000489_3147_3641 158
1160 3300053140 Ga0500573_0020311 Ga0500573_0020311_1070_1546 158
1161 3300053140 Ga0500573_0024558 Ga0500573_0024558_1122_1616 158
1162 3300053142 Ga0500577_0133659 Ga0500577_0133659_261_755 158
1163 3300053143 Ga0500579_135801 Ga0500579_135801_487_981 158
1164 3300053149 Ga0500600_0211300 Ga0500600_0211300_207_683 158
1165 3300053150 Ga0500603_040610 Ga0500603_040610_388_882 158
1166 3300053160 Ga0500633_0001530 Ga0500633_0001530_238_732 158
1167 3300053161 Ga0500634_0002147 Ga0500634_0002147_2003_2497 158
1168 3300053161 Ga0500634_0173400 Ga0500634_0173400_99_575 158
1169 3300053177 Ga0500636_0146717 Ga0500636_0146717_686_1180 158
1170 3300053732 Ga0500656_001615 Ga0500656_001615_1109_1603 158
1171 3300053734 Ga0500565_051760 Ga0500565_051760_82_558 158
1172 3300053739 Ga0500587_006291 Ga0500587_006291_381_875 158
1173 3300059492 Ga0587073_0213026 Ga0587073_0213026_29_505 158
1174 3300059492 Ga0587073_0321603 Ga0587073_0321603_20_496 158
1175 3300059504 Ga0587082_146713 Ga0587082_146713_54_530 158
1176 3300059604 Ga0587098_031491 Ga0587098_031491_10_486 158
1177 3300059604 Ga0587098_061763 Ga0587098_061763_92_568 158
1178 3300059605 Ga0587106_060911 Ga0587106_060911_20_496 158
1179 3300059628 Ga0587122_010712 Ga0587122_010712_372_848 158
1180 3300059641 Ga0587068_154460 Ga0587068_154460_26_502 158
1181 3300061719 Ga0466962_0001135 Ga0466962_0001135_2621_3097 158
1182 3300061719 Ga0466962_0037056 Ga0466962_0037056_1068_1544 158
1183 3300061719 Ga0466962_0066978 Ga0466962_0066978_1075_1551 158
1184 3300061719 Ga0466962_0096516 Ga0466962_0096516_103_627 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

57

118

0.98

PF01047

MarR

MarR family

59

119

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zmd-assembly2.cif.gz_D crystal structure of absc, a marr family transcriptional regulator from streptomyces coelicolor 0.9846 7 153
3zmd-assembly2.cif.gz_D crystal structure of absc, a marr family transcriptional regulator from streptomyces coelicolor 0.9715 7 153
3zpl-assembly2.cif.gz_F crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9689 9 151
3zpl-assembly1.cif.gz_B crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9686 8 151
3zpl-assembly2.cif.gz_E crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9681 8 151
ID Description Score Start End Superfamily
3zmdA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.971 7 153 1.10.10.10
3zplA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9684 8 151 1.10.10.10
3zmdA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9583 7 153 1.10.10.10
1s3jB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9269 41 106 1.10.10.10
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9238 46 114 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A423V109-F1-model_v4 MarR family transcriptional regulator 0.9874 1 156 GO:0003700
GO:0006950
AF-A0A1Q5H6D2-F1-model_v4 MarR family transcriptional regulator 0.985 1 156 GO:0003700
GO:0006950
AF-A0A3D8NDA0-F1-model_v4 deleted 0.9849 1 158
AF-F3Z5T0-F1-model_v4 Putative transcriptional regulator 0.9842 25 155 GO:0003700
GO:0006950
AF-A0A2G7DAY1-F1-model_v4 deleted 0.9816 16 153

Feature Viewer

pLDDT pTM Quality
93.7 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map