F491355
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1184 | 565 | 1072 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0003241|Ga0466969_0003241_6087_6617 |
| Length | 176 |
| Sequence | MDTTAAPAVLSEPSTDPSEAAVEDAPWLTAAEQRLWRAHLEVSRLLMYQLERELQPYGLSNNDYTILVELSEAPQRRMRMTDLAVATLQSKSRLSHQITRMEAAGLVTRDTCPGDRRGLFAVLTEQGWQTMRRVAPHHVRSVREHFIDRFDEDQLASMYEALAPVAEHLRELRGRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 3 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 4 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 5 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 6 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 7 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 8 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 9 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 10 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 11 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 12 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 13 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 14 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 15 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 16 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 17 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 18 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 19 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 20 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 21 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 22 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 23 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 24 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 25 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 26 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 27 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 28 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 29 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 30 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 31 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 32 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 33 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 34 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 35 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 36 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 37 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 38 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 39 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 40 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 41 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 42 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 43 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 44 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 45 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 46 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 47 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 48 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 49 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 50 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 51 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 52 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 53 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 54 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 55 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 56 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 57 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 58 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 59 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 60 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 61 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 62 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 63 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 64 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 65 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 66 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 67 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 68 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 69 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 70 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 71 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 72 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 73 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 74 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 75 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 76 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 77 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 78 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 79 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 80 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 81 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 82 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 83 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 84 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 85 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 86 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 87 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 88 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 89 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 90 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 91 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 92 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 93 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 94 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 96 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 97 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 98 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 99 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 100 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 101 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 102 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 106 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 108 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 125 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 128 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 130 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 131 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 138 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 139 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 140 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 141 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 142 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 143 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 144 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 145 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 146 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 147 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 148 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 150 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 151 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 152 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 153 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 154 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 155 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 156 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 157 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 159 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 160 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 172 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 175 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 176 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 183 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 186 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 187 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 188 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 189 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 191 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 192 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 193 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 194 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 195 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 196 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 197 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 199 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 200 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 201 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 255 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 256 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 258 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 259 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 260 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 263 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 264 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 265 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 266 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 267 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 268 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 269 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 270 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 271 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 272 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 273 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 274 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 275 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 276 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 277 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 278 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 279 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 280 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 281 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 285 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 286 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 287 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 288 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 289 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 291 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 292 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 293 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 294 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 295 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 297 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 298 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 299 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 300 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 301 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 302 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 303 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 305 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 307 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 308 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 309 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 310 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 311 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 312 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 313 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 314 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 315 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 316 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 317 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 320 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 322 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 323 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 324 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 325 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 326 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 327 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 328 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 329 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 330 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 331 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 332 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 333 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 334 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 335 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 336 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 337 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 338 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 339 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 340 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 341 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 342 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 343 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 344 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 345 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 346 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 347 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 348 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 349 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 350 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 351 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 352 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 353 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 354 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 355 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 356 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 357 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 358 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 359 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 443 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 444 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 445 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 446 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 447 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 448 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 449 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 450 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 451 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 452 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 453 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 454 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 455 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 456 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 457 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 499 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 500 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 501 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 507 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 511 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 512 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 513 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 515 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 516 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 517 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 518 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 519 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 520 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 521 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 522 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 523 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 524 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 525 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 526 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 527 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 528 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 529 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 530 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 531 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 532 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 533 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 534 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 535 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 536 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 545 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 546 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 547 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 548 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 549 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 550 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 551 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 552 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 553 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 554 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 555 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 556 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 557 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 558 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 559 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 560 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 561 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 562 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 563 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 564 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 565 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.25 |
| Metatranscriptomes | 3.29 |
| Isolates | 9.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.89 |
| Nodule | 0.25 |
| Rhizoplane | 2.36 |
| Rhizosphere | 83.19 |
| Stem | 0 |
| Stem Tuber | 0.08 |
| Unclassified | 10.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10008412 | 3300002075 | Bacteria | 2348 |
| 2 | JGI25406J46586_10001472 | 3300003203 | Bacteria | 11106 |
| 3 | Ga0006758J48902_1016282 | 3300003300 | Bacteria | 539 |
| 4 | Ga0006777J48905_1014226 | 3300003308 | Bacteria | 807 |
| 5 | rootH1_10005406 | 3300003316 | Bacteria | 4715 |
| 6 | rootH1_10035274 | 3300003316 | Bacteria | 3206 |
| 7 | rootH2_10018527 | 3300003320 | Bacteria | 4980 |
| 8 | rootH2_10084890 | 3300003320 | Bacteria | 1129 |
| 9 | rootH2_10148651 | 3300003320 | Bacteria | 2078 |
| 10 | rootH1_10091099 | 3300003323 | Bacteria | 3489 |
| 11 | JGI25160J50197_1024881 | 3300003354 | Bacteria | 1689 |
| 12 | JGI25160J50197_1032890 | 3300003354 | Bacteria | 1312 |
| 13 | Ga0007429J51699_1022096 | 3300003579 | Bacteria | 566 |
| 14 | Ga0058861_12008866 | 3300004800 | Bacteria | 836 |
| 15 | Ga0070658_10171134 | 3300005327 | Bacteria | 1824 |
| 16 | Ga0070683_100006536 | 3300005329 | Bacteria | 9790 |
| 17 | Ga0070683_100095325 | 3300005329 | Bacteria | 2798 |
| 18 | Ga0070683_100438750 | 3300005329 | Bacteria | 1246 |
| 19 | Ga0070690_100810923 | 3300005330 | Unclassified | 726 |
| 20 | Ga0070670_100802416 | 3300005331 | Bacteria | 850 |
| 21 | Ga0070680_100021287 | 3300005336 | Bacteria | 5152 |
| 22 | Ga0070660_100659235 | 3300005339 | Bacteria | 876 |
| 23 | Ga0070661_100367626 | 3300005344 | Bacteria | 1131 |
| 24 | Ga0070668_100285973 | 3300005347 | Bacteria | 1379 |
| 25 | Ga0070668_100587733 | 3300005347 | Bacteria | 973 |
| 26 | Ga0070674_100157779 | 3300005356 | Bacteria | 1718 |
| 27 | Ga0070673_100187500 | 3300005364 | Bacteria | 1774 |
| 28 | Ga0070659_100332214 | 3300005366 | Bacteria | 1272 |
| 29 | Ga0070659_100908527 | 3300005366 | Bacteria | 770 |
| 30 | Ga0070667_100121550 | 3300005367 | Bacteria | 2271 |
| 31 | Ga0070709_10025748 | 3300005434 | Bacteria | 3478 |
| 32 | Ga0070709_10039672 | 3300005434 | Bacteria | 2890 |
| 33 | Ga0070709_10085969 | 3300005434 | Bacteria | 2063 |
| 34 | Ga0070709_10133484 | 3300005434 | Bacteria | 1697 |
| 35 | Ga0070709_10868909 | 3300005434 | Bacteria | 711 |
| 36 | Ga0070714_100004044 | 3300005435 | Bacteria | 11021 |
| 37 | Ga0070714_100109541 | 3300005435 | Bacteria | 2443 |
| 38 | Ga0070714_100127885 | 3300005435 | Bacteria | 2267 |
| 39 | Ga0070714_100523069 | 3300005435 | Bacteria | 1133 |
| 40 | Ga0070714_100816644 | 3300005435 | Bacteria | 903 |
| 41 | Ga0070714_100845027 | 3300005435 | Bacteria | 888 |
| 42 | Ga0070714_101161205 | 3300005435 | Bacteria | 753 |
| 43 | Ga0070713_100243560 | 3300005436 | Bacteria | 1638 |
| 44 | Ga0070713_100884842 | 3300005436 | Bacteria | 858 |
| 45 | Ga0070710_10103161 | 3300005437 | Bacteria | 1702 |
| 46 | Ga0070710_10104590 | 3300005437 | Bacteria | 1691 |
| 47 | Ga0070710_10837933 | 3300005437 | Bacteria | 659 |
| 48 | Ga0070711_100113640 | 3300005439 | Bacteria | 1991 |
| 49 | Ga0070711_100129637 | 3300005439 | Bacteria | 1877 |
| 50 | Ga0070711_100204606 | 3300005439 | Bacteria | 1525 |
| 51 | Ga0070711_101011128 | 3300005439 | Bacteria | 713 |
| 52 | Ga0070694_100075814 | 3300005444 | Bacteria | 2327 |
| 53 | Ga0070708_100003731 | 3300005445 | Bacteria | 11945 |
| 54 | Ga0070663_100125838 | 3300005455 | Bacteria | 1941 |
| 55 | Ga0070662_100117947 | 3300005457 | Bacteria | 2031 |
| 56 | Ga0070685_10018280 | 3300005466 | Bacteria | 3767 |
| 57 | Ga0070706_100008655 | 3300005467 | Bacteria | 9484 |
| 58 | Ga0070706_100091325 | 3300005467 | Bacteria | 2824 |
| 59 | Ga0070706_100183832 | 3300005467 | Bacteria | 1952 |
| 60 | Ga0070706_100541154 | 3300005467 | Bacteria | 1083 |
| 61 | Ga0070707_100012429 | 3300005468 | Bacteria | 7951 |
| 62 | Ga0070707_100025575 | 3300005468 | Bacteria | 5603 |
| 63 | Ga0070707_100042124 | 3300005468 | Bacteria | 4370 |
| 64 | Ga0070698_100001201 | 3300005471 | Bacteria | 28730 |
| 65 | Ga0070698_100034761 | 3300005471 | Bacteria | 5215 |
| 66 | Ga0070698_100147517 | 3300005471 | Bacteria | 2301 |
| 67 | Ga0070698_100304028 | 3300005471 | Bacteria | 1526 |
| 68 | Ga0070698_100466314 | 3300005471 | Bacteria | 1199 |
| 69 | Ga0070699_100001397 | 3300005518 | Bacteria | 22204 |
| 70 | Ga0070679_100020257 | 3300005530 | Bacteria | 6482 |
| 71 | Ga0070684_100211337 | 3300005535 | Bacteria | 1768 |
| 72 | Ga0070684_100307367 | 3300005535 | Bacteria | 1456 |
| 73 | Ga0070684_101046713 | 3300005535 | Bacteria | 766 |
| 74 | Ga0070697_100004674 | 3300005536 | Bacteria | 10498 |
| 75 | Ga0070672_100071426 | 3300005543 | Bacteria | 2762 |
| 76 | Ga0070672_101586958 | 3300005543 | Bacteria | 587 |
| 77 | Ga0070695_100133462 | 3300005545 | Bacteria | 1713 |
| 78 | Ga0070696_100416789 | 3300005546 | Bacteria | 1053 |
| 79 | Ga0070665_100339480 | 3300005548 | Bacteria | 1507 |
| 80 | Ga0070665_100343290 | 3300005548 | Bacteria | 1498 |
| 81 | Ga0070664_100017308 | 3300005564 | Bacteria | 5917 |
| 82 | Ga0068857_100041495 | 3300005577 | Bacteria | 4080 |
| 83 | Ga0068854_100470375 | 3300005578 | Bacteria | 1053 |
| 84 | Ga0068856_100069718 | 3300005614 | Bacteria | 3477 |
| 85 | Ga0068856_100182712 | 3300005614 | Bacteria | 2111 |
| 86 | Ga0068856_100679071 | 3300005614 | Bacteria | 1050 |
| 87 | Ga0068852_100605205 | 3300005616 | Bacteria | 1100 |
| 88 | Ga0068859_101542260 | 3300005617 | Bacteria | 733 |
| 89 | Ga0068859_101875324 | 3300005617 | Bacteria | 662 |
| 90 | Ga0068866_10071750 | 3300005718 | Bacteria | 1832 |
| 91 | Ga0068870_10598728 | 3300005840 | Bacteria | 749 |
| 92 | Ga0068860_100461120 | 3300005843 | Bacteria | 1264 |
| 93 | Ga0068862_100825965 | 3300005844 | Bacteria | 907 |
| 94 | Ga0081455_10124405 | 3300005937 | Bacteria | 2026 |
| 95 | Ga0081540_1000009 | 3300005983 | Bacteria | 193562 |
| 96 | Ga0070717_10007214 | 3300006028 | Bacteria | 8244 |
| 97 | Ga0070717_10268281 | 3300006028 | Bacteria | 1511 |
| 98 | Ga0070717_10288147 | 3300006028 | Bacteria | 1457 |
| 99 | Ga0070717_10481654 | 3300006028 | Bacteria | 1120 |
| 100 | Ga0070717_10701645 | 3300006028 | Bacteria | 919 |
| 101 | Ga0070717_10958469 | 3300006028 | Bacteria | 779 |
| 102 | Ga0070717_10968958 | 3300006028 | Unclassified | 774 |
| 103 | Ga0075368_10033951 | 3300006042 | Bacteria | 1986 |
| 104 | Ga0075363_100249174 | 3300006048 | Bacteria | 1022 |
| 105 | Ga0070715_10019913 | 3300006163 | Bacteria | 2580 |
| 106 | Ga0070716_100121416 | 3300006173 | Bacteria | 1636 |
| 107 | Ga0070716_100131151 | 3300006173 | Bacteria | 1584 |
| 108 | Ga0070712_100003385 | 3300006175 | Bacteria | 9809 |
| 109 | Ga0070712_100031793 | 3300006175 | Bacteria | 3558 |
| 110 | Ga0070712_100284293 | 3300006175 | Bacteria | 1333 |
| 111 | Ga0070712_100692174 | 3300006175 | Bacteria | 868 |
| 112 | Ga0070712_100745901 | 3300006175 | Bacteria | 837 |
| 113 | Ga0075434_100403247 | 3300006871 | Bacteria | 1388 |
| 114 | Ga0068865_100851440 | 3300006881 | Bacteria | 790 |
| 115 | Ga0075436_100133238 | 3300006914 | Bacteria | 1743 |
| 116 | Ga0075436_100429864 | 3300006914 | Bacteria | 960 |
| 117 | Ga0075436_100514443 | 3300006914 | Unclassified | 877 |
| 118 | Ga0097620_101542226 | 3300006931 | Bacteria | 733 |
| 119 | Ga0097620_101875024 | 3300006931 | Bacteria | 662 |
| 120 | Ga0075435_100227732 | 3300007076 | Bacteria | 1583 |
| 121 | Ga0099794_10337837 | 3300007265 | Bacteria | 782 |
| 122 | Ga0105251_10073150 | 3300009011 | Bacteria | 1593 |
| 123 | Ga0105251_10109922 | 3300009011 | Bacteria | 1256 |
| 124 | Ga0105244_10285605 | 3300009036 | Bacteria | 765 |
| 125 | Ga0105250_10045640 | 3300009092 | Bacteria | 1757 |
| 126 | Ga0105240_10229594 | 3300009093 | Bacteria | 2158 |
| 127 | Ga0105245_10163986 | 3300009098 | Bacteria | 2111 |
| 128 | Ga0105247_10797995 | 3300009101 | Bacteria | 720 |
| 129 | Ga0105243_10173590 | 3300009148 | Bacteria | 1869 |
| 130 | Ga0105241_10415761 | 3300009174 | Bacteria | 1182 |
| 131 | Ga0105248_10627474 | 3300009177 | Bacteria | 1213 |
| 132 | Ga0105237_11260386 | 3300009545 | Bacteria | 746 |
| 133 | Ga0105238_10569133 | 3300009551 | Bacteria | 1138 |
| 134 | Ga0105028_129068 | 3300009993 | Bacteria | 614 |
| 135 | Ga0105239_10411233 | 3300010375 | Bacteria | 1532 |
| 136 | Ga0105239_10956721 | 3300010375 | Bacteria | 984 |
| 137 | Ga0105239_11418126 | 3300010375 | Bacteria | 802 |
| 138 | Ga0105246_10006671 | 3300011119 | Bacteria | 7059 |
| 139 | Ga0105246_10575366 | 3300011119 | Bacteria | 969 |
| 140 | Ga0105246_10656982 | 3300011119 | Bacteria | 913 |
| 141 | Ga0105246_10891373 | 3300011119 | Bacteria | 797 |
| 142 | Ga0157341_1018722 | 3300012494 | Bacteria | 665 |
| 143 | Ga0157315_1004244 | 3300012508 | Bacteria | 1015 |
| 144 | Ga0157373_10321146 | 3300013100 | Bacteria | 1101 |
| 145 | Ga0157371_10033294 | 3300013102 | Bacteria | 3703 |
| 146 | Ga0157369_10034777 | 3300013105 | Bacteria | 5527 |
| 147 | Ga0157369_10175083 | 3300013105 | Bacteria | 2259 |
| 148 | Ga0157374_11277102 | 3300013296 | Bacteria | 756 |
| 149 | Ga0157372_10371645 | 3300013307 | Bacteria | 1666 |
| 150 | Ga0163163_10136261 | 3300014325 | Bacteria | 2496 |
| 151 | Ga0182008_10001523 | 3300014497 | Bacteria | 15449 |
| 152 | Ga0157377_10375702 | 3300014745 | Bacteria | 961 |
| 153 | Ga0157379_10304147 | 3300014968 | Bacteria | 1454 |
| 154 | Ga0182006_1024939 | 3300015261 | Bacteria | 2461 |
| 155 | Ga0182007_10005632 | 3300015262 | Bacteria | 5469 |
| 156 | Ga0182005_1017915 | 3300015265 | Bacteria | 1958 |
| 157 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 158 | Ga0163161_11007753 | 3300017792 | Bacteria | 711 |
| 159 | Ga0197907_11416890 | 3300020069 | Bacteria | 869 |
| 160 | Ga0206356_10810878 | 3300020070 | Bacteria | 2156 |
| 161 | Ga0206356_11359384 | 3300020070 | Bacteria | 1113 |
| 162 | Ga0206351_10861184 | 3300020077 | Bacteria | 728 |
| 163 | Ga0206352_10879267 | 3300020078 | Bacteria | 936 |
| 164 | Ga0206350_10981988 | 3300020080 | Bacteria | 899 |
| 165 | Ga0206350_11340047 | 3300020080 | Bacteria | 953 |
| 166 | Ga0206354_11543200 | 3300020081 | Bacteria | 1028 |
| 167 | Ga0206353_10730323 | 3300020082 | Bacteria | 1924 |
| 168 | Ga0206353_11306639 | 3300020082 | Bacteria | 1205 |
| 169 | Ga0154015_1480972 | 3300020610 | Bacteria | 623 |
| 170 | Ga0213875_10002694 | 3300021388 | Bacteria | 10486 |
| 171 | Ga0213875_10003336 | 3300021388 | Bacteria | 9163 |
| 172 | Ga0213875_10022923 | 3300021388 | Bacteria | 2985 |
| 173 | Ga0213875_10024438 | 3300021388 | Bacteria | 2881 |
| 174 | Ga0213875_10322704 | 3300021388 | Bacteria | 732 |
| 175 | Ga0224712_10445971 | 3300022467 | Bacteria | 621 |
| 176 | Ga0228598_1008297 | 3300024227 | Bacteria | 2101 |
| 177 | Ga0209758_1002043 | 3300025297 | Bacteria | 21643 |
| 178 | Ga0207426_1002336 | 3300025302 | Bacteria | 12383 |
| 179 | Ga0207426_1007124 | 3300025302 | Bacteria | 4727 |
| 180 | Ga0207426_1029138 | 3300025302 | Bacteria | 1824 |
| 181 | Ga0207426_1068987 | 3300025302 | Bacteria | 992 |
| 182 | Ga0207655_1179439 | 3300025728 | Bacteria | 648 |
| 183 | Ga0207713_1038278 | 3300025735 | Bacteria | 2036 |
| 184 | Ga0207653_10051332 | 3300025885 | Unclassified | 1373 |
| 185 | Ga0207692_10022907 | 3300025898 | Bacteria | 2881 |
| 186 | Ga0207692_10845615 | 3300025898 | Bacteria | 600 |
| 187 | Ga0207642_10209825 | 3300025899 | Bacteria | 1081 |
| 188 | Ga0207688_10091412 | 3300025901 | Bacteria | 1748 |
| 189 | Ga0207647_10006463 | 3300025904 | Bacteria | 8519 |
| 190 | Ga0207647_10082703 | 3300025904 | Bacteria | 1923 |
| 191 | Ga0207699_10003180 | 3300025906 | Bacteria | 7813 |
| 192 | Ga0207699_10009261 | 3300025906 | Bacteria | 4895 |
| 193 | Ga0207699_10019000 | 3300025906 | Bacteria | 3654 |
| 194 | Ga0207643_10007955 | 3300025908 | Bacteria | 5689 |
| 195 | Ga0207684_10033691 | 3300025910 | Bacteria | 4357 |
| 196 | Ga0207684_10072689 | 3300025910 | Bacteria | 2921 |
| 197 | Ga0207684_10618009 | 3300025910 | Bacteria | 925 |
| 198 | Ga0207707_10200009 | 3300025912 | Bacteria | 1742 |
| 199 | Ga0207671_10621702 | 3300025914 | Bacteria | 861 |
| 200 | Ga0207693_10010984 | 3300025915 | Bacteria | 7339 |
| 201 | Ga0207693_10020666 | 3300025915 | Bacteria | 5235 |
| 202 | Ga0207693_10346259 | 3300025915 | Bacteria | 1163 |
| 203 | Ga0207663_10008261 | 3300025916 | Bacteria | 5434 |
| 204 | Ga0207660_10302102 | 3300025917 | Bacteria | 1274 |
| 205 | Ga0207657_10022671 | 3300025919 | Bacteria | 5868 |
| 206 | Ga0207649_10220986 | 3300025920 | Bacteria | 1349 |
| 207 | Ga0207652_10941951 | 3300025921 | Bacteria | 761 |
| 208 | Ga0207646_10012425 | 3300025922 | Bacteria | 8184 |
| 209 | Ga0207646_10023703 | 3300025922 | Bacteria | 5634 |
| 210 | Ga0207646_10042204 | 3300025922 | Bacteria | 4099 |
| 211 | Ga0207681_11180768 | 3300025923 | Bacteria | 643 |
| 212 | Ga0207659_10116885 | 3300025926 | Bacteria | 2037 |
| 213 | Ga0207700_10016756 | 3300025928 | Bacteria | 4878 |
| 214 | Ga0207700_10091383 | 3300025928 | Bacteria | 2404 |
| 215 | Ga0207700_10191375 | 3300025928 | Bacteria | 1719 |
| 216 | Ga0207700_10243403 | 3300025928 | Bacteria | 1534 |
| 217 | Ga0207700_10275158 | 3300025928 | Bacteria | 1446 |
| 218 | Ga0207664_10018165 | 3300025929 | Bacteria | 5168 |
| 219 | Ga0207664_10019807 | 3300025929 | Bacteria | 4979 |
| 220 | Ga0207664_10049825 | 3300025929 | Bacteria | 3299 |
| 221 | Ga0207664_10082344 | 3300025929 | Bacteria | 2621 |
| 222 | Ga0207664_10119578 | 3300025929 | Bacteria | 2203 |
| 223 | Ga0207664_10245304 | 3300025929 | Bacteria | 1561 |
| 224 | Ga0207664_10291023 | 3300025929 | Bacteria | 1435 |
| 225 | Ga0207644_10357328 | 3300025931 | Bacteria | 1187 |
| 226 | Ga0207690_10602544 | 3300025932 | Bacteria | 897 |
| 227 | Ga0207706_10022821 | 3300025933 | Bacteria | 5614 |
| 228 | Ga0207709_10034710 | 3300025935 | Bacteria | 2975 |
| 229 | Ga0207670_10022698 | 3300025936 | Bacteria | 3893 |
| 230 | Ga0207669_10319878 | 3300025937 | Bacteria | 1187 |
| 231 | Ga0207704_10131259 | 3300025938 | Bacteria | 1735 |
| 232 | Ga0207665_10010016 | 3300025939 | Bacteria | 6224 |
| 233 | Ga0207665_10037081 | 3300025939 | Bacteria | 3243 |
| 234 | Ga0207665_10138798 | 3300025939 | Bacteria | 1731 |
| 235 | Ga0207665_10165343 | 3300025939 | Bacteria | 1594 |
| 236 | Ga0207691_10031590 | 3300025940 | Bacteria | 4940 |
| 237 | Ga0207691_10112106 | 3300025940 | Bacteria | 2425 |
| 238 | Ga0207711_10232356 | 3300025941 | Bacteria | 1689 |
| 239 | Ga0207661_10182912 | 3300025944 | Bacteria | 1832 |
| 240 | Ga0207667_10681492 | 3300025949 | Bacteria | 1031 |
| 241 | Ga0207651_10351869 | 3300025960 | Bacteria | 1241 |
| 242 | Ga0207668_10186162 | 3300025972 | Unclassified | 1642 |
| 243 | Ga0207640_11122703 | 3300025981 | Bacteria | 696 |
| 244 | Ga0207639_10117241 | 3300026041 | Bacteria | 2182 |
| 245 | Ga0207639_10614582 | 3300026041 | Bacteria | 1003 |
| 246 | Ga0207678_11124097 | 3300026067 | Bacteria | 696 |
| 247 | Ga0207708_10506191 | 3300026075 | Bacteria | 1013 |
| 248 | Ga0207702_10005527 | 3300026078 | Bacteria | 11045 |
| 249 | Ga0207702_10479286 | 3300026078 | Bacteria | 1210 |
| 250 | Ga0207641_11908027 | 3300026088 | Bacteria | 595 |
| 251 | Ga0207676_11782984 | 3300026095 | Bacteria | 614 |
| 252 | Ga0207674_10020822 | 3300026116 | Bacteria | 7079 |
| 253 | Ga0207675_100091161 | 3300026118 | Bacteria | 2866 |
| 254 | Ga0207683_10001450 | 3300026121 | Bacteria | 21423 |
| 255 | Ga0209371_1022012 | 3300027312 | Bacteria | 1533 |
| 256 | Ga0209371_1046036 | 3300027312 | Bacteria | 859 |
| 257 | Ga0209813_10009115 | 3300027866 | Bacteria | 2528 |
| 258 | Ga0268266_10174059 | 3300028379 | Bacteria | 1955 |
| 259 | Ga0268266_10320364 | 3300028379 | Bacteria | 1451 |
| 260 | Ga0268266_10387713 | 3300028379 | Bacteria | 1319 |
| 261 | Ga0268264_10335073 | 3300028381 | Bacteria | 1435 |
| 262 | Ga0307517_10006432 | 3300028786 | Bacteria | 17390 |
| 263 | Ga0307517_10013995 | 3300028786 | Bacteria | 10829 |
| 264 | Ga0307515_10019441 | 3300028794 | Bacteria | 12219 |
| 265 | Ga0307515_10054034 | 3300028794 | Bacteria | 5907 |
| 266 | Ga0265338_10038691 | 3300028800 | Bacteria | 4513 |
| 267 | Ga0268256_1024711 | 3300030500 | Bacteria | 1537 |
| 268 | Ga0268256_1044065 | 3300030500 | Bacteria | 980 |
| 269 | Ga0307511_10002529 | 3300030521 | Bacteria | 19097 |
| 270 | Ga0307511_10062255 | 3300030521 | Bacteria | 2834 |
| 271 | Ga0307511_10156723 | 3300030521 | Bacteria | 1290 |
| 272 | Ga0307512_10018157 | 3300030522 | Bacteria | 6432 |
| 273 | Ga0307512_10035855 | 3300030522 | Bacteria | 4218 |
| 274 | Ga0265767_101432 | 3300030836 | Bacteria | 1170 |
| 275 | Ga0265760_10011674 | 3300031090 | Bacteria | 2510 |
| 276 | Ga0265760_10117098 | 3300031090 | Bacteria | 853 |
| 277 | Ga0307513_10017315 | 3300031456 | Bacteria | 8643 |
| 278 | Ga0307513_10116425 | 3300031456 | Bacteria | 2652 |
| 279 | Ga0307513_10123568 | 3300031456 | Bacteria | 2549 |
| 280 | Ga0307509_10020553 | 3300031507 | Bacteria | 7486 |
| 281 | Ga0307509_10111935 | 3300031507 | Bacteria | 2731 |
| 282 | Ga0307508_10021810 | 3300031616 | Bacteria | 5827 |
| 283 | Ga0307508_10041733 | 3300031616 | Bacteria | 4116 |
| 284 | Ga0307508_10048027 | 3300031616 | Bacteria | 3803 |
| 285 | Ga0307508_10171956 | 3300031616 | Bacteria | 1769 |
| 286 | Ga0307508_10215710 | 3300031616 | Bacteria | 1519 |
| 287 | Ga0307508_10351689 | 3300031616 | Bacteria | 1065 |
| 288 | Ga0307514_10017130 | 3300031649 | Bacteria | 5964 |
| 289 | Ga0307514_10034987 | 3300031649 | Bacteria | 4001 |
| 290 | Ga0307514_10115479 | 3300031649 | Bacteria | 1889 |
| 291 | Ga0307514_10180619 | 3300031649 | Bacteria | 1361 |
| 292 | Ga0307516_10001694 | 3300031730 | Bacteria | 30318 |
| 293 | Ga0307516_10069325 | 3300031730 | Bacteria | 3392 |
| 294 | Ga0307516_10259869 | 3300031730 | Bacteria | 1427 |
| 295 | Ga0307413_10434098 | 3300031824 | Bacteria | 1038 |
| 296 | Ga0307518_10234128 | 3300031838 | Bacteria | 1185 |
| 297 | Ga0307518_10267199 | 3300031838 | Bacteria | 1071 |
| 298 | Ga0307409_101042037 | 3300031995 | Bacteria | 837 |
| 299 | Ga0307416_102577154 | 3300032002 | Bacteria | 606 |
| 300 | Ga0307415_100154543 | 3300032126 | Bacteria | 1770 |
| 301 | Ga0307507_10065610 | 3300033179 | Bacteria | 3336 |
| 302 | Ga0307507_10094796 | 3300033179 | Bacteria | 2535 |
| 303 | Ga0307510_10047845 | 3300033180 | Bacteria | 4572 |
| 304 | Ga0307510_10075253 | 3300033180 | Bacteria | 3330 |
| 305 | Ga0307510_10414676 | 3300033180 | Bacteria | 789 |
| 306 | Ga0373930_0004467 | 3300034816 | Bacteria | 2279 |
| 307 | Ga0373948_0034847 | 3300034817 | Bacteria | 1031 |
| 308 | Ga0373958_0161341 | 3300034819 | Bacteria | 567 |
| 309 | Ga0373938_0050244 | 3300034957 | Bacteria | 951 |
| 310 | Ga0373926_0000765 | 3300035083 | Bacteria | 9006 |
| 311 | Ga0373926_0001515 | 3300035083 | Bacteria | 7113 |
| 312 | Ga0373928_0106764 | 3300035084 | Bacteria | 737 |
| 313 | Ga0373934_0003049 | 3300035086 | Bacteria | 6118 |
| 314 | Ga0373934_0009621 | 3300035086 | Bacteria | 3623 |
| 315 | Ga0373944_0000224 | 3300035089 | Bacteria | 12254 |
| 316 | Ga0373944_0012535 | 3300035089 | Bacteria | 2338 |
| 317 | Ga0373923_0001164 | 3300035111 | Bacteria | 7315 |
| 318 | Ga0373923_0015531 | 3300035111 | Bacteria | 2876 |
| 319 | Ga0373923_0047425 | 3300035111 | Bacteria | 1790 |
| 320 | Ga0373932_0031095 | 3300035112 | Bacteria | 1485 |
| 321 | Ga0373936_0000334 | 3300035113 | Bacteria | 15965 |
| 322 | Ga0373936_0013060 | 3300035113 | Bacteria | 3167 |
| 323 | Ga0373936_0139665 | 3300035113 | Bacteria | 1045 |
| 324 | Ga0373941_0353539 | 3300035115 | Bacteria | 598 |
| 325 | Ga0373945_0000228 | 3300035116 | Bacteria | 15386 |
| 326 | Ga0373945_0011604 | 3300035116 | Bacteria | 2915 |
| 327 | Ga0373953_0024122 | 3300035117 | Bacteria | 2309 |
| 328 | Ga0373953_0064125 | 3300035117 | Bacteria | 1506 |
| 329 | Ga0373953_0122074 | 3300035117 | Bacteria | 1107 |
| 330 | Ga0373954_0017279 | 3300035118 | Bacteria | 3238 |
| 331 | Ga0373954_0017440 | 3300035118 | Bacteria | 3225 |
| 332 | Ga0373956_0003365 | 3300035119 | Bacteria | 6439 |
| 333 | Ga0373956_0052379 | 3300035119 | Bacteria | 1835 |
| 334 | Ga0373957_0019021 | 3300035120 | Bacteria | 2411 |
| 335 | Ga0373960_0082514 | 3300035121 | Bacteria | 1015 |
| 336 | Ga0373960_0138682 | 3300035121 | Bacteria | 822 |
| 337 | Ga0373943_0002009 | 3300035170 | Bacteria | 9214 |
| 338 | Ga0373943_0013785 | 3300035170 | Bacteria | 3654 |
| 339 | Ga0373943_0390413 | 3300035170 | Bacteria | 802 |
| 340 | Ga0373946_0000096 | 3300035171 | Bacteria | 24568 |
| 341 | Ga0373946_0000515 | 3300035171 | Bacteria | 12831 |
| 342 | Ga0373955_0044853 | 3300035172 | Bacteria | 2383 |
| 343 | Ga0373955_0053401 | 3300035172 | Bacteria | 2206 |
| 344 | Ga0373955_0135427 | 3300035172 | Bacteria | 1440 |
| 345 | Ga0373955_0401001 | 3300035172 | Bacteria | 833 |
| 346 | Ga0373955_0424072 | 3300035172 | Bacteria | 809 |
| 347 | Ga0373942_0020308 | 3300035207 | Bacteria | 1667 |
| 348 | Ga0373962_0184121 | 3300035242 | Unclassified | 700 |
| 349 | Ga0373924_0012279 | 3300035410 | Bacteria | 3197 |
| 350 | Ga0373924_0035196 | 3300035410 | Bacteria | 2030 |
| 351 | Ga0373931_0009215 | 3300035691 | Bacteria | 4714 |
| 352 | Ga0373935_0004359 | 3300035692 | Bacteria | 8306 |
| 353 | Ga0373935_0039125 | 3300035692 | Bacteria | 2972 |
| 354 | Ga0373927_0001355 | 3300035695 | Bacteria | 18458 |
| 355 | Ga0373927_0045993 | 3300035695 | Bacteria | 2824 |
| 356 | Ga0373933_0018935 | 3300035724 | Bacteria | 3878 |
| 357 | Ga0373933_0034929 | 3300035724 | Bacteria | 2933 |
| 358 | Ga0373933_0431084 | 3300035724 | Bacteria | 861 |
| 359 | Ga0373947_0000887 | 3300035725 | Bacteria | 18078 |
| 360 | Ga0373947_0060518 | 3300035725 | Bacteria | 2299 |
| 361 | Ga0373947_0136608 | 3300035725 | Bacteria | 1569 |
| 362 | Ga0373947_0419450 | 3300035725 | Bacteria | 904 |
| 363 | Ga0373937_0012529 | 3300036401 | Bacteria | 7460 |
| 364 | Ga0373937_0094505 | 3300036401 | Bacteria | 2772 |
| 365 | Ga0373937_0123048 | 3300036401 | Bacteria | 2418 |
| 366 | Ga0373937_0128069 | 3300036401 | Bacteria | 2369 |
| 367 | Ga0373937_0414883 | 3300036401 | Bacteria | 1277 |
| 368 | Ga0372808_025407 | 3300036459 | Bacteria | 851 |
| 369 | Ga0373925_0012546 | 3300037068 | Bacteria | 6140 |
| 370 | Ga0373925_0025268 | 3300037068 | Bacteria | 4338 |
| 371 | Ga0373925_0216829 | 3300037068 | Bacteria | 1526 |
| 372 | Ga0373925_0248399 | 3300037068 | Bacteria | 1426 |
| 373 | Ga0395900_0493198 | 3300037418 | Bacteria | 1176 |
| 374 | Ga0395898_0005934 | 3300037466 | Bacteria | 13118 |
| 375 | Ga0395898_0029812 | 3300037466 | Bacteria | 5461 |
| 376 | Ga0395898_1085852 | 3300037466 | Bacteria | 734 |
| 377 | Ga0436364_0166036 | 3300037853 | Bacteria | 1699 |
| 378 | Ga0436364_0321419 | 3300037853 | Bacteria | 2008 |
| 379 | Ga0436364_0340069 | 3300037853 | Bacteria | 1323 |
| 380 | Ga0436364_0356204 | 3300037853 | Bacteria | 846 |
| 381 | Ga0436364_0584067 | 3300037853 | Bacteria | 157477 |
| 382 | Ga0436364_0585418 | 3300037853 | Bacteria | 2999 |
| 383 | Ga0436364_0667270 | 3300037853 | Bacteria | 158868 |
| 384 | Ga0436364_0894301 | 3300037853 | Bacteria | 12265 |
| 385 | Ga0436364_0976891 | 3300037853 | Bacteria | 1862 |
| 386 | Ga0436364_1247794 | 3300037853 | Bacteria | 1433 |
| 387 | Ga0395901_0004321 | 3300038443 | Bacteria | 14345 |
| 388 | Ga0436365_1421416 | 3300039437 | Bacteria | 597 |
| 389 | Ga0436360_0208252 | 3300039438 | Bacteria | 797 |
| 390 | Ga0436360_0236768 | 3300039438 | Bacteria | 733 |
| 391 | Ga0436360_0274104 | 3300039438 | Unclassified | 664 |
| 392 | Ga0436361_0046152 | 3300039447 | Bacteria | 706 |
| 393 | Ga0436363_0426389 | 3300039450 | Bacteria | 1014 |
| 394 | Ga0436363_1443462 | 3300039450 | Bacteria | 885 |
| 395 | Ga0436363_1570653 | 3300039450 | Bacteria | 2115 |
| 396 | Ga0436362_0983991 | 3300039453 | Bacteria | 792 |
| 397 | Ga0436362_1292336 | 3300039453 | Unclassified | 882 |
| 398 | Ga0439436_0012288 | 3300041404 | Bacteria | 2599 |
| 399 | Ga0439436_0019687 | 3300041404 | Bacteria | 2013 |
| 400 | Ga0439439_0001796 | 3300041406 | Bacteria | 4383 |
| 401 | Ga0451787_359134 | 3300041441 | Bacteria | 599 |
| 402 | Ga0451791_1205736 | 3300041451 | Bacteria | 732 |
| 403 | Ga0451802_1987063 | 3300041460 | Bacteria | 1019 |
| 404 | Ga0451804_0436132 | 3300041463 | Bacteria | 1031 |
| 405 | Ga0451807_1543669 | 3300041486 | Unclassified | 690 |
| 406 | Ga0451833_0239514 | 3300041491 | Bacteria | 773 |
| 407 | Ga0451837_0778280 | 3300041494 | Bacteria | 2269 |
| 408 | Ga0451841_0429692 | 3300041498 | Bacteria | 1634 |
| 409 | Ga0451845_0895553 | 3300041501 | Bacteria | 732 |
| 410 | Ga0451853_2320900 | 3300041512 | Bacteria | 3539 |
| 411 | Ga0451853_2374569 | 3300041512 | Bacteria | 6049 |
| 412 | Ga0451853_2502482 | 3300041512 | Bacteria | 785 |
| 413 | Ga0451853_2847812 | 3300041512 | Bacteria | 1174 |
| 414 | Ga0439433_0000279 | 3300041999 | Bacteria | 8738 |
| 415 | Ga0439442_003766 | 3300042002 | Bacteria | 3002 |
| 416 | Ga0439448_0046552 | 3300042005 | Bacteria | 1413 |
| 417 | Ga0439449_0047343 | 3300042007 | Bacteria | 1592 |
| 418 | Ga0439449_0101207 | 3300042007 | Bacteria | 1065 |
| 419 | Ga0439449_0121145 | 3300042007 | Bacteria | 971 |
| 420 | Ga0439450_063864 | 3300042008 | Bacteria | 894 |
| 421 | Ga0439455_0039978 | 3300042012 | Bacteria | 1198 |
| 422 | Ga0439457_000721 | 3300042014 | Bacteria | 9804 |
| 423 | Ga0439457_002443 | 3300042014 | Bacteria | 5312 |
| 424 | Ga0439457_045983 | 3300042014 | Bacteria | 976 |
| 425 | Ga0439462_0002910 | 3300042015 | Bacteria | 4054 |
| 426 | Ga0450920_044482 | 3300042122 | Bacteria | 887 |
| 427 | Ga0450890_059547 | 3300042127 | Bacteria | 596 |
| 428 | Ga0450898_013530 | 3300042134 | Bacteria | 1361 |
| 429 | Ga0450899_000745 | 3300042135 | Bacteria | 3706 |
| 430 | Ga0450900_019218 | 3300042136 | Bacteria | 942 |
| 431 | Ga0450903_001883 | 3300042138 | Bacteria | 3807 |
| 432 | Ga0450906_000226 | 3300042145 | Bacteria | 10823 |
| 433 | Ga0439458_0005506 | 3300042157 | Bacteria | 2847 |
| 434 | Ga0450908_016280 | 3300042184 | Bacteria | 1327 |
| 435 | Ga0466969_0002485 | 3300044656 | Bacteria | 9841 |
| 436 | Ga0466969_0003241 | 3300044656 | Bacteria | 8659 |
| 437 | Ga0466969_0050663 | 3300044656 | Bacteria | 2046 |
| 438 | Ga0466969_0055615 | 3300044656 | Bacteria | 1935 |
| 439 | Ga0466969_0404869 | 3300044656 | Bacteria | 619 |
| 440 | Ga0466972_0003351 | 3300044658 | Bacteria | 7937 |
| 441 | Ga0466972_0017124 | 3300044658 | Bacteria | 3624 |
| 442 | Ga0466972_0025927 | 3300044658 | Bacteria | 2904 |
| 443 | Ga0466972_0193031 | 3300044658 | Bacteria | 954 |
| 444 | Ga0466972_0431652 | 3300044658 | Bacteria | 618 |
| 445 | Ga0466965_0109129 | 3300044683 | Bacteria | 1421 |
| 446 | Ga0466966_0003158 | 3300044684 | Bacteria | 10843 |
| 447 | Ga0466966_0006738 | 3300044684 | Bacteria | 7607 |
| 448 | Ga0466966_0012255 | 3300044684 | Bacteria | 5680 |
| 449 | Ga0466961_0024718 | 3300044693 | Bacteria | 3864 |
| 450 | Ga0466961_0025584 | 3300044693 | Bacteria | 3795 |
| 451 | Ga0466961_0037580 | 3300044693 | Bacteria | 3106 |
| 452 | Ga0466961_0055353 | 3300044693 | Bacteria | 2529 |
| 453 | Ga0466963_0005506 | 3300044694 | Bacteria | 7410 |
| 454 | Ga0466963_0025453 | 3300044694 | Bacteria | 3774 |
| 455 | Ga0466963_0028605 | 3300044694 | Bacteria | 3581 |
| 456 | Ga0466964_0030772 | 3300044706 | Bacteria | 2125 |
| 457 | Ga0466964_0067983 | 3300044706 | Bacteria | 1499 |
| 458 | Ga0466964_0396070 | 3300044706 | Bacteria | 720 |
| 459 | Ga0466971_0001389 | 3300044719 | Bacteria | 10160 |
| 460 | Ga0466971_0053086 | 3300044719 | Bacteria | 1826 |
| 461 | Ga0466971_0054585 | 3300044719 | Bacteria | 1800 |
| 462 | Ga0466968_0479983 | 3300044735 | Bacteria | 617 |
| 463 | Ga0466970_0002309 | 3300044765 | Bacteria | 9221 |
| 464 | Ga0466970_0116074 | 3300044765 | Bacteria | 1464 |
| 465 | Ga0466970_0117800 | 3300044765 | Bacteria | 1453 |
| 466 | Ga0466957_0232532 | 3300044842 | Bacteria | 1221 |
| 467 | Ga0466957_0337788 | 3300044842 | Bacteria | 1019 |
| 468 | Ga0466960_0004566 | 3300044901 | Bacteria | 5427 |
| 469 | Ga0466960_0180345 | 3300044901 | Bacteria | 1144 |
| 470 | Ga0466959_0001895 | 3300045049 | Bacteria | 13168 |
| 471 | Ga0466959_0003319 | 3300045049 | Bacteria | 10505 |
| 472 | Ga0466959_0004806 | 3300045049 | Bacteria | 9122 |
| 473 | Ga0466959_0758306 | 3300045049 | Unclassified | 649 |
| 474 | Ga0466958_0070757 | 3300045836 | Bacteria | 2135 |
| 475 | Ga0466958_0308253 | 3300045836 | Bacteria | 1017 |
| 476 | Ga0466958_0660370 | 3300045836 | Bacteria | 681 |
| 477 | Ga0466958_0784552 | 3300045836 | Bacteria | 621 |
| 478 | Ga0466958_0802254 | 3300045836 | Bacteria | 614 |
| 479 | Ga0466967_0011974 | 3300045976 | Bacteria | 6609 |
| 480 | Ga0466967_0025672 | 3300045976 | Bacteria | 4861 |
| 481 | Ga0466967_0049282 | 3300045976 | Bacteria | 3682 |
| 482 | Ga0466967_0137166 | 3300045976 | Bacteria | 2276 |
| 483 | Ga0466967_0664839 | 3300045976 | Bacteria | 1031 |
| 484 | Ga0466967_0689780 | 3300045976 | Bacteria | 1011 |
| 485 | Ga0495617_214352 | 3300046452 | Bacteria | 599 |
| 486 | Ga0495592_0013789 | 3300046454 | Bacteria | 6145 |
| 487 | Ga0495592_0017207 | 3300046454 | Bacteria | 5490 |
| 488 | Ga0495592_0021680 | 3300046454 | Bacteria | 4886 |
| 489 | Ga0495592_0064286 | 3300046454 | Bacteria | 2689 |
| 490 | Ga0495592_0162390 | 3300046454 | Bacteria | 1536 |
| 491 | Ga0495592_0185555 | 3300046454 | Bacteria | 1413 |
| 492 | Ga0495603_0001170 | 3300046455 | Bacteria | 15283 |
| 493 | Ga0495603_0001759 | 3300046455 | Bacteria | 12757 |
| 494 | Ga0495603_0003763 | 3300046455 | Bacteria | 9021 |
| 495 | Ga0495603_0007613 | 3300046455 | Bacteria | 6518 |
| 496 | Ga0495603_0131380 | 3300046455 | Bacteria | 1458 |
| 497 | Ga0495603_0138178 | 3300046455 | Bacteria | 1418 |
| 498 | Ga0495603_0212275 | 3300046455 | Bacteria | 1117 |
| 499 | Ga0495590_0024466 | 3300046457 | Bacteria | 2127 |
| 500 | Ga0495590_0161883 | 3300046457 | Bacteria | 814 |
| 501 | Ga0495629_0002692 | 3300046459 | Bacteria | 13615 |
| 502 | Ga0495629_0005448 | 3300046459 | Bacteria | 9489 |
| 503 | Ga0495629_0008361 | 3300046459 | Bacteria | 7612 |
| 504 | Ga0495629_0008455 | 3300046459 | Bacteria | 7577 |
| 505 | Ga0495629_0014435 | 3300046459 | Bacteria | 5683 |
| 506 | Ga0495629_0032184 | 3300046459 | Bacteria | 3714 |
| 507 | Ga0495629_0041614 | 3300046459 | Bacteria | 3233 |
| 508 | Ga0495629_0101167 | 3300046459 | Bacteria | 2011 |
| 509 | Ga0495629_0156787 | 3300046459 | Bacteria | 1581 |
| 510 | Ga0495629_0206749 | 3300046459 | Bacteria | 1356 |
| 511 | Ga0495629_0330914 | 3300046459 | Bacteria | 1041 |
| 512 | Ga0495638_0095648 | 3300046460 | Bacteria | 1783 |
| 513 | Ga0495638_0247645 | 3300046460 | Bacteria | 984 |
| 514 | Ga0495641_0009687 | 3300046461 | Bacteria | 5694 |
| 515 | Ga0495641_0024612 | 3300046461 | Bacteria | 2968 |
| 516 | Ga0495651_0001653 | 3300046462 | Bacteria | 17272 |
| 517 | Ga0495651_0002577 | 3300046462 | Bacteria | 14014 |
| 518 | Ga0495651_0014489 | 3300046462 | Bacteria | 6094 |
| 519 | Ga0495651_0040615 | 3300046462 | Bacteria | 3617 |
| 520 | Ga0495651_0049806 | 3300046462 | Bacteria | 3233 |
| 521 | Ga0495651_0053092 | 3300046462 | Bacteria | 3121 |
| 522 | Ga0495651_0139162 | 3300046462 | Bacteria | 1762 |
| 523 | Ga0495651_0147922 | 3300046462 | Bacteria | 1696 |
| 524 | Ga0495653_0004910 | 3300046463 | Bacteria | 10854 |
| 525 | Ga0495653_0009521 | 3300046463 | Bacteria | 7946 |
| 526 | Ga0495653_0015160 | 3300046463 | Bacteria | 6283 |
| 527 | Ga0495653_0066028 | 3300046463 | Bacteria | 2722 |
| 528 | Ga0495653_0135933 | 3300046463 | Bacteria | 1734 |
| 529 | Ga0495653_0168432 | 3300046463 | Bacteria | 1514 |
| 530 | Ga0495653_0414898 | 3300046463 | Bacteria | 853 |
| 531 | Ga0495650_0169531 | 3300046471 | Bacteria | 774 |
| 532 | Ga0495580_0001943 | 3300046472 | Bacteria | 18146 |
| 533 | Ga0495580_0026504 | 3300046472 | Bacteria | 4225 |
| 534 | Ga0495582_0000741 | 3300046473 | Bacteria | 18037 |
| 535 | Ga0495582_0105904 | 3300046473 | Bacteria | 1577 |
| 536 | Ga0495605_0008865 | 3300046474 | Bacteria | 5670 |
| 537 | Ga0495639_0002161 | 3300046475 | Bacteria | 8668 |
| 538 | Ga0495639_0103628 | 3300046475 | Bacteria | 1345 |
| 539 | Ga0495662_0001192 | 3300046476 | Bacteria | 12825 |
| 540 | Ga0495662_0003402 | 3300046476 | Bacteria | 8063 |
| 541 | Ga0495662_0037091 | 3300046476 | Bacteria | 2354 |
| 542 | Ga0495662_0045311 | 3300046476 | Bacteria | 2123 |
| 543 | Ga0495662_0063821 | 3300046476 | Bacteria | 1779 |
| 544 | Ga0495662_0066015 | 3300046476 | Bacteria | 1749 |
| 545 | Ga0495662_0077396 | 3300046476 | Bacteria | 1615 |
| 546 | Ga0495662_0082165 | 3300046476 | Bacteria | 1567 |
| 547 | Ga0495662_0191117 | 3300046476 | Bacteria | 1009 |
| 548 | Ga0495664_0000282 | 3300046477 | Bacteria | 24266 |
| 549 | Ga0495664_0000962 | 3300046477 | Bacteria | 14809 |
| 550 | Ga0495664_0005505 | 3300046477 | Bacteria | 6953 |
| 551 | Ga0495664_0013862 | 3300046477 | Bacteria | 4570 |
| 552 | Ga0495664_0061339 | 3300046477 | Bacteria | 2239 |
| 553 | Ga0495664_0112678 | 3300046477 | Bacteria | 1642 |
| 554 | Ga0495664_0157756 | 3300046477 | Bacteria | 1376 |
| 555 | Ga0495585_0009401 | 3300046492 | Bacteria | 5864 |
| 556 | Ga0495585_0182554 | 3300046492 | Bacteria | 1078 |
| 557 | Ga0495585_0378970 | 3300046492 | Bacteria | 683 |
| 558 | Ga0495594_0002260 | 3300046499 | Bacteria | 10036 |
| 559 | Ga0495594_0026432 | 3300046499 | Bacteria | 3122 |
| 560 | Ga0495594_0046749 | 3300046499 | Bacteria | 2377 |
| 561 | Ga0495594_0058145 | 3300046499 | Bacteria | 2135 |
| 562 | Ga0495594_0106393 | 3300046499 | Bacteria | 1580 |
| 563 | Ga0495596_0055282 | 3300046500 | Bacteria | 1551 |
| 564 | Ga0495607_0021008 | 3300046501 | Bacteria | 4113 |
| 565 | Ga0495607_0069409 | 3300046501 | Bacteria | 1972 |
| 566 | Ga0495607_0140903 | 3300046501 | Bacteria | 1244 |
| 567 | Ga0495583_0101987 | 3300046506 | Bacteria | 1224 |
| 568 | Ga0495606_0201596 | 3300046507 | Bacteria | 1133 |
| 569 | Ga0495608_0000475 | 3300046511 | Bacteria | 27866 |
| 570 | Ga0495608_0021905 | 3300046511 | Bacteria | 4382 |
| 571 | Ga0495608_0023637 | 3300046511 | Bacteria | 4210 |
| 572 | Ga0495608_0050637 | 3300046511 | Bacteria | 2755 |
| 573 | Ga0495608_0109718 | 3300046511 | Bacteria | 1774 |
| 574 | Ga0495608_0155355 | 3300046511 | Bacteria | 1456 |
| 575 | Ga0495608_0313751 | 3300046511 | Bacteria | 969 |
| 576 | Ga0495610_0026281 | 3300046512 | Bacteria | 3110 |
| 577 | Ga0495618_0007301 | 3300046514 | Bacteria | 6686 |
| 578 | Ga0495618_0107407 | 3300046514 | Bacteria | 1787 |
| 579 | Ga0495618_0107503 | 3300046514 | Bacteria | 1786 |
| 580 | Ga0495618_0111160 | 3300046514 | Bacteria | 1754 |
| 581 | Ga0495618_0123278 | 3300046514 | Bacteria | 1659 |
| 582 | Ga0495620_0121679 | 3300046515 | Bacteria | 1028 |
| 583 | Ga0495628_0000710 | 3300046516 | Bacteria | 30813 |
| 584 | Ga0495628_0011936 | 3300046516 | Bacteria | 7327 |
| 585 | Ga0495628_0023600 | 3300046516 | Bacteria | 5047 |
| 586 | Ga0495628_0040088 | 3300046516 | Bacteria | 3744 |
| 587 | Ga0495628_0125974 | 3300046516 | Bacteria | 1962 |
| 588 | Ga0495628_0352775 | 3300046516 | Bacteria | 1081 |
| 589 | Ga0495628_0517841 | 3300046516 | Bacteria | 859 |
| 590 | Ga0495630_0001986 | 3300046517 | Bacteria | 14252 |
| 591 | Ga0495630_0010159 | 3300046517 | Bacteria | 6785 |
| 592 | Ga0495630_0029888 | 3300046517 | Bacteria | 4052 |
| 593 | Ga0495630_0058729 | 3300046517 | Bacteria | 2884 |
| 594 | Ga0495630_0110163 | 3300046517 | Bacteria | 2085 |
| 595 | Ga0495630_0299668 | 3300046517 | Bacteria | 1228 |
| 596 | Ga0495631_0003642 | 3300046518 | Bacteria | 8409 |
| 597 | Ga0495631_0129231 | 3300046518 | Bacteria | 1086 |
| 598 | Ga0495631_0212547 | 3300046518 | Bacteria | 826 |
| 599 | Ga0495637_0024557 | 3300046520 | Bacteria | 2727 |
| 600 | Ga0495643_0001554 | 3300046522 | Bacteria | 20479 |
| 601 | Ga0495643_0001610 | 3300046522 | Bacteria | 19994 |
| 602 | Ga0495644_0334376 | 3300046523 | Bacteria | 595 |
| 603 | Ga0495648_0104390 | 3300046524 | Bacteria | 1556 |
| 604 | Ga0495666_0002890 | 3300046526 | Bacteria | 8600 |
| 605 | Ga0495666_0009938 | 3300046526 | Bacteria | 4751 |
| 606 | Ga0495666_0066325 | 3300046526 | Bacteria | 1721 |
| 607 | Ga0495666_0101342 | 3300046526 | Bacteria | 1356 |
| 608 | Ga0495652_0049924 | 3300046529 | Bacteria | 3579 |
| 609 | Ga0495652_0073721 | 3300046529 | Bacteria | 2841 |
| 610 | Ga0495652_0115282 | 3300046529 | Bacteria | 2153 |
| 611 | Ga0495652_0120132 | 3300046529 | Bacteria | 2097 |
| 612 | Ga0495652_0135059 | 3300046529 | Bacteria | 1947 |
| 613 | Ga0495652_0234635 | 3300046529 | Bacteria | 1369 |
| 614 | Ga0495652_0261247 | 3300046529 | Bacteria | 1278 |
| 615 | Ga0495652_0393119 | 3300046529 | Unclassified | 983 |
| 616 | Ga0495652_0485286 | 3300046529 | Bacteria | 859 |
| 617 | Ga0495654_0022533 | 3300046530 | Bacteria | 3269 |
| 618 | Ga0495665_0000906 | 3300046531 | Bacteria | 15593 |
| 619 | Ga0495665_0005660 | 3300046531 | Bacteria | 6742 |
| 620 | Ga0495665_0090627 | 3300046531 | Bacteria | 1606 |
| 621 | Ga0495665_0460580 | 3300046531 | Bacteria | 642 |
| 622 | Ga0495640_0001961 | 3300046533 | Bacteria | 16417 |
| 623 | Ga0495640_0002320 | 3300046533 | Bacteria | 15277 |
| 624 | Ga0495640_0015848 | 3300046533 | Bacteria | 5656 |
| 625 | Ga0495640_0024254 | 3300046533 | Bacteria | 4414 |
| 626 | Ga0495640_0035145 | 3300046533 | Bacteria | 3548 |
| 627 | Ga0495640_0067264 | 3300046533 | Bacteria | 2413 |
| 628 | Ga0495640_0115581 | 3300046533 | Bacteria | 1748 |
| 629 | Ga0495640_0158249 | 3300046533 | Bacteria | 1453 |
| 630 | Ga0495586_0017357 | 3300046535 | Bacteria | 3826 |
| 631 | Ga0495586_0435644 | 3300046535 | Bacteria | 755 |
| 632 | Ga0495587_0003804 | 3300046536 | Bacteria | 10013 |
| 633 | Ga0495587_0026748 | 3300046536 | Bacteria | 3514 |
| 634 | Ga0495587_0038914 | 3300046536 | Bacteria | 2849 |
| 635 | Ga0495587_0055943 | 3300046536 | Bacteria | 2322 |
| 636 | Ga0495587_0125953 | 3300046536 | Bacteria | 1465 |
| 637 | Ga0495587_0331419 | 3300046536 | Bacteria | 849 |
| 638 | Ga0495609_0004574 | 3300046538 | Bacteria | 7518 |
| 639 | Ga0495609_0058435 | 3300046538 | Bacteria | 1706 |
| 640 | Ga0495597_0062272 | 3300046542 | Bacteria | 1623 |
| 641 | Ga0495645_0003107 | 3300046543 | Bacteria | 11254 |
| 642 | Ga0495645_0040226 | 3300046543 | Bacteria | 3411 |
| 643 | Ga0495645_0040384 | 3300046543 | Bacteria | 3404 |
| 644 | Ga0495645_0041548 | 3300046543 | Bacteria | 3353 |
| 645 | Ga0495645_0055725 | 3300046543 | Bacteria | 2870 |
| 646 | Ga0495645_0102662 | 3300046543 | Bacteria | 2032 |
| 647 | Ga0495645_0191232 | 3300046543 | Bacteria | 1394 |
| 648 | Ga0495622_0005508 | 3300046557 | Bacteria | 5870 |
| 649 | Ga0495622_0084844 | 3300046557 | Bacteria | 1457 |
| 650 | Ga0495622_0215087 | 3300046557 | Bacteria | 853 |
| 651 | Ga0495622_0374443 | 3300046557 | Bacteria | 615 |
| 652 | Ga0495633_0095427 | 3300046558 | Bacteria | 1381 |
| 653 | Ga0495667_0010218 | 3300046559 | Bacteria | 6353 |
| 654 | Ga0495667_0017248 | 3300046559 | Bacteria | 4877 |
| 655 | Ga0495667_0089327 | 3300046559 | Bacteria | 1997 |
| 656 | Ga0495667_0101014 | 3300046559 | Bacteria | 1866 |
| 657 | Ga0495667_0113481 | 3300046559 | Bacteria | 1751 |
| 658 | Ga0495667_0136192 | 3300046559 | Bacteria | 1583 |
| 659 | Ga0495667_0175690 | 3300046559 | Bacteria | 1375 |
| 660 | Ga0495667_0209159 | 3300046559 | Bacteria | 1247 |
| 661 | Ga0495667_0534015 | 3300046559 | Bacteria | 733 |
| 662 | Ga0495656_0266167 | 3300046615 | Bacteria | 870 |
| 663 | Ga0495656_0490228 | 3300046615 | Bacteria | 651 |
| 664 | Ga0495634_0001381 | 3300046642 | Bacteria | 21858 |
| 665 | Ga0495634_0014605 | 3300046642 | Bacteria | 5656 |
| 666 | Ga0495634_0015448 | 3300046642 | Bacteria | 5486 |
| 667 | Ga0495634_0026394 | 3300046642 | Bacteria | 4054 |
| 668 | Ga0495634_0060612 | 3300046642 | Bacteria | 2517 |
| 669 | Ga0495634_0066359 | 3300046642 | Bacteria | 2389 |
| 670 | Ga0495634_0069780 | 3300046642 | Bacteria | 2317 |
| 671 | Ga0495634_0221785 | 3300046642 | Bacteria | 1167 |
| 672 | Ga0495611_0028329 | 3300046648 | Bacteria | 2451 |
| 673 | Ga0495611_0041868 | 3300046648 | Bacteria | 2044 |
| 674 | Ga0495625_0007829 | 3300046660 | Bacteria | 9211 |
| 675 | Ga0495625_0018691 | 3300046660 | Bacteria | 5399 |
| 676 | Ga0495625_0183510 | 3300046660 | Bacteria | 1390 |
| 677 | Ga0495635_0006651 | 3300046663 | Bacteria | 8072 |
| 678 | Ga0495635_0015815 | 3300046663 | Bacteria | 5270 |
| 679 | Ga0495635_0026450 | 3300046663 | Bacteria | 4036 |
| 680 | Ga0495635_0042810 | 3300046663 | Bacteria | 3125 |
| 681 | Ga0495635_0143959 | 3300046663 | Bacteria | 1623 |
| 682 | Ga0495635_0149885 | 3300046663 | Bacteria | 1587 |
| 683 | Ga0495635_0179437 | 3300046663 | Bacteria | 1439 |
| 684 | Ga0495635_0294182 | 3300046663 | Bacteria | 1089 |
| 685 | Ga0495635_0343008 | 3300046663 | Bacteria | 997 |
| 686 | Ga0495661_0163666 | 3300046665 | Bacteria | 1192 |
| 687 | Ga0495588_0006288 | 3300046674 | Bacteria | 5342 |
| 688 | Ga0495588_0019662 | 3300046674 | Bacteria | 3310 |
| 689 | Ga0495588_0119137 | 3300046674 | Bacteria | 1391 |
| 690 | Ga0495588_0275311 | 3300046674 | Bacteria | 887 |
| 691 | Ga0495588_0361310 | 3300046674 | Bacteria | 763 |
| 692 | Ga0495588_0364185 | 3300046674 | Bacteria | 759 |
| 693 | Ga0495657_0002972 | 3300046675 | Bacteria | 14033 |
| 694 | Ga0495657_0004900 | 3300046675 | Bacteria | 10656 |
| 695 | Ga0495657_0006131 | 3300046675 | Bacteria | 9419 |
| 696 | Ga0495657_0026711 | 3300046675 | Bacteria | 4086 |
| 697 | Ga0495657_0050139 | 3300046675 | Bacteria | 2807 |
| 698 | Ga0495657_0052689 | 3300046675 | Bacteria | 2726 |
| 699 | Ga0495657_0067834 | 3300046675 | Bacteria | 2340 |
| 700 | Ga0495657_0227433 | 3300046675 | Bacteria | 1129 |
| 701 | Ga0495599_0035030 | 3300046678 | Bacteria | 3152 |
| 702 | Ga0495599_0043602 | 3300046678 | Bacteria | 2815 |
| 703 | Ga0495599_0046263 | 3300046678 | Bacteria | 2728 |
| 704 | Ga0495599_0269375 | 3300046678 | Bacteria | 1033 |
| 705 | Ga0495623_0006609 | 3300046679 | Bacteria | 7547 |
| 706 | Ga0495623_0007559 | 3300046679 | Bacteria | 7053 |
| 707 | Ga0495623_0063138 | 3300046679 | Bacteria | 2320 |
| 708 | Ga0495623_0071154 | 3300046679 | Bacteria | 2165 |
| 709 | Ga0495623_0095716 | 3300046679 | Bacteria | 1815 |
| 710 | Ga0495623_0099589 | 3300046679 | Bacteria | 1772 |
| 711 | Ga0495623_0222253 | 3300046679 | Bacteria | 1075 |
| 712 | Ga0495623_0298636 | 3300046679 | Bacteria | 891 |
| 713 | Ga0495646_0025299 | 3300046680 | Bacteria | 3734 |
| 714 | Ga0495646_0025806 | 3300046680 | Bacteria | 3694 |
| 715 | Ga0495646_0049198 | 3300046680 | Bacteria | 2559 |
| 716 | Ga0495646_0050920 | 3300046680 | Bacteria | 2507 |
| 717 | Ga0495646_0078571 | 3300046680 | Bacteria | 1928 |
| 718 | Ga0495646_0592601 | 3300046680 | Bacteria | 563 |
| 719 | Ga0495613_0001650 | 3300046689 | Bacteria | 16986 |
| 720 | Ga0495613_0006019 | 3300046689 | Bacteria | 9075 |
| 721 | Ga0495613_0007869 | 3300046689 | Bacteria | 7926 |
| 722 | Ga0495613_0010656 | 3300046689 | Bacteria | 6818 |
| 723 | Ga0495613_0027108 | 3300046689 | Bacteria | 4263 |
| 724 | Ga0495613_0036074 | 3300046689 | Bacteria | 3666 |
| 725 | Ga0495613_0046407 | 3300046689 | Bacteria | 3213 |
| 726 | Ga0495613_0056515 | 3300046689 | Bacteria | 2881 |
| 727 | Ga0495613_0941571 | 3300046689 | Bacteria | 557 |
| 728 | Ga0495624_0011180 | 3300046690 | Bacteria | 6176 |
| 729 | Ga0495624_0014743 | 3300046690 | Bacteria | 5293 |
| 730 | Ga0495624_0016185 | 3300046690 | Bacteria | 5022 |
| 731 | Ga0495624_0270769 | 3300046690 | Bacteria | 1026 |
| 732 | Ga0495670_0009917 | 3300046691 | Bacteria | 4682 |
| 733 | Ga0495671_0100925 | 3300046692 | Bacteria | 1410 |
| 734 | Ga0495671_0198778 | 3300046692 | Bacteria | 972 |
| 735 | Ga0495589_0023123 | 3300046794 | Bacteria | 3167 |
| 736 | Ga0495589_0024656 | 3300046794 | Bacteria | 3055 |
| 737 | Ga0495589_0041330 | 3300046794 | Bacteria | 2301 |
| 738 | Ga0495589_0234654 | 3300046794 | Bacteria | 859 |
| 739 | Ga0495589_0372836 | 3300046794 | Bacteria | 656 |
| 740 | Ga0495600_0004713 | 3300046809 | Bacteria | 8183 |
| 741 | Ga0495600_0014003 | 3300046809 | Bacteria | 5053 |
| 742 | Ga0495600_0064229 | 3300046809 | Bacteria | 2400 |
| 743 | Ga0495600_0073662 | 3300046809 | Bacteria | 2230 |
| 744 | Ga0495600_0130407 | 3300046809 | Bacteria | 1634 |
| 745 | Ga0495600_0162253 | 3300046809 | Bacteria | 1444 |
| 746 | Ga0495600_0175349 | 3300046809 | Bacteria | 1382 |
| 747 | Ga0495600_0274535 | 3300046809 | Bacteria | 1068 |
| 748 | Ga0495600_0356478 | 3300046809 | Bacteria | 915 |
| 749 | Ga0495600_0793675 | 3300046809 | Bacteria | 564 |
| 750 | Ga0495581_0000263 | 3300047315 | Bacteria | 25263 |
| 751 | Ga0495581_0012356 | 3300047315 | Bacteria | 4947 |
| 752 | Ga0495581_0020955 | 3300047315 | Bacteria | 3792 |
| 753 | Ga0495581_0042925 | 3300047315 | Bacteria | 2616 |
| 754 | Ga0495581_0082847 | 3300047315 | Bacteria | 1858 |
| 755 | Ga0495581_0134718 | 3300047315 | Bacteria | 1440 |
| 756 | Ga0495581_0141944 | 3300047315 | Bacteria | 1401 |
| 757 | Ga0495604_0000228 | 3300047317 | Bacteria | 50550 |
| 758 | Ga0495604_0000695 | 3300047317 | Bacteria | 28567 |
| 759 | Ga0495604_0006374 | 3300047317 | Bacteria | 9358 |
| 760 | Ga0495604_0017033 | 3300047317 | Bacteria | 5812 |
| 761 | Ga0495604_0051601 | 3300047317 | Bacteria | 3187 |
| 762 | Ga0495604_0063128 | 3300047317 | Bacteria | 2826 |
| 763 | Ga0495604_0253569 | 3300047317 | Bacteria | 1198 |
| 764 | Ga0495604_0282355 | 3300047317 | Bacteria | 1121 |
| 765 | Ga0495636_0001610 | 3300047318 | Bacteria | 8578 |
| 766 | Ga0495636_0080197 | 3300047318 | Bacteria | 1404 |
| 767 | Ga0495636_0287081 | 3300047318 | Bacteria | 767 |
| 768 | Ga0495636_0366904 | 3300047318 | Bacteria | 681 |
| 769 | Ga0495636_0606385 | 3300047318 | Bacteria | 535 |
| 770 | Ga0495674_0002634 | 3300047319 | Bacteria | 17459 |
| 771 | Ga0495674_0033876 | 3300047319 | Bacteria | 4622 |
| 772 | Ga0495674_0166231 | 3300047319 | Bacteria | 1843 |
| 773 | Ga0495674_0270382 | 3300047319 | Bacteria | 1394 |
| 774 | Ga0495674_0291070 | 3300047319 | Bacteria | 1336 |
| 775 | Ga0495672_0116302 | 3300047320 | Bacteria | 1428 |
| 776 | Ga0495676_0000613 | 3300047321 | Bacteria | 29512 |
| 777 | Ga0495676_0001584 | 3300047321 | Bacteria | 19734 |
| 778 | Ga0495676_0008638 | 3300047321 | Bacteria | 9326 |
| 779 | Ga0495676_0011585 | 3300047321 | Bacteria | 7956 |
| 780 | Ga0495676_0012085 | 3300047321 | Bacteria | 7787 |
| 781 | Ga0495676_0026464 | 3300047321 | Bacteria | 4992 |
| 782 | Ga0495676_0037864 | 3300047321 | Bacteria | 4010 |
| 783 | Ga0495676_0093002 | 3300047321 | Bacteria | 2249 |
| 784 | Ga0495676_0238301 | 3300047321 | Bacteria | 1247 |
| 785 | Ga0495676_0269970 | 3300047321 | Bacteria | 1154 |
| 786 | Ga0495676_0790651 | 3300047321 | Bacteria | 611 |
| 787 | Ga0495680_0008276 | 3300047322 | Bacteria | 9470 |
| 788 | Ga0495680_0040434 | 3300047322 | Bacteria | 3716 |
| 789 | Ga0495680_0051429 | 3300047322 | Bacteria | 3216 |
| 790 | Ga0495680_0053569 | 3300047322 | Bacteria | 3138 |
| 791 | Ga0495680_0056799 | 3300047322 | Bacteria | 3029 |
| 792 | Ga0495680_0191237 | 3300047322 | Unclassified | 1472 |
| 793 | Ga0495680_0234970 | 3300047322 | Bacteria | 1304 |
| 794 | Ga0495683_0014216 | 3300047323 | Bacteria | 4147 |
| 795 | Ga0495683_0018255 | 3300047323 | Bacteria | 3629 |
| 796 | Ga0495683_0052837 | 3300047323 | Bacteria | 2027 |
| 797 | Ga0495683_0397756 | 3300047323 | Bacteria | 573 |
| 798 | Ga0495687_002340 | 3300047443 | Bacteria | 15395 |
| 799 | Ga0495687_005422 | 3300047443 | Bacteria | 8135 |
| 800 | Ga0495687_008591 | 3300047443 | Bacteria | 5826 |
| 801 | Ga0495687_027386 | 3300047443 | Bacteria | 2668 |
| 802 | Ga0495687_049101 | 3300047443 | Bacteria | 1805 |
| 803 | Ga0495675_0008872 | 3300047444 | Bacteria | 6244 |
| 804 | Ga0495675_0017990 | 3300047444 | Bacteria | 4481 |
| 805 | Ga0495675_0025200 | 3300047444 | Bacteria | 3793 |
| 806 | Ga0495675_0036401 | 3300047444 | Bacteria | 3139 |
| 807 | Ga0495675_0060131 | 3300047444 | Bacteria | 2408 |
| 808 | Ga0495675_0135897 | 3300047444 | Bacteria | 1526 |
| 809 | Ga0495675_0146715 | 3300047444 | Bacteria | 1459 |
| 810 | Ga0495675_0175951 | 3300047444 | Bacteria | 1312 |
| 811 | Ga0495675_0214530 | 3300047444 | Bacteria | 1167 |
| 812 | Ga0495675_0232126 | 3300047444 | Bacteria | 1113 |
| 813 | Ga0495675_0365335 | 3300047444 | Bacteria | 846 |
| 814 | Ga0495677_0082194 | 3300047445 | Bacteria | 1208 |
| 815 | Ga0495677_0168259 | 3300047445 | Bacteria | 847 |
| 816 | Ga0495685_000339 | 3300047447 | Bacteria | 15017 |
| 817 | Ga0495685_001961 | 3300047447 | Bacteria | 6385 |
| 818 | Ga0495685_006381 | 3300047447 | Bacteria | 3857 |
| 819 | Ga0495685_010526 | 3300047447 | Bacteria | 3104 |
| 820 | Ga0495685_097524 | 3300047447 | Bacteria | 971 |
| 821 | Ga0495681_0000484 | 3300047470 | Bacteria | 30579 |
| 822 | Ga0495681_0001772 | 3300047470 | Bacteria | 15902 |
| 823 | Ga0495681_0189801 | 3300047470 | Bacteria | 839 |
| 824 | Ga0495684_0015310 | 3300047471 | Bacteria | 5906 |
| 825 | Ga0495684_0041460 | 3300047471 | Bacteria | 3528 |
| 826 | Ga0495684_0056280 | 3300047471 | Bacteria | 2998 |
| 827 | Ga0495684_0064161 | 3300047471 | Bacteria | 2791 |
| 828 | Ga0495684_0066516 | 3300047471 | Bacteria | 2740 |
| 829 | Ga0495684_0096501 | 3300047471 | Bacteria | 2237 |
| 830 | Ga0495686_0080126 | 3300047472 | Bacteria | 1996 |
| 831 | Ga0495593_0005276 | 3300047673 | Bacteria | 7634 |
| 832 | Ga0495593_0007464 | 3300047673 | Bacteria | 6395 |
| 833 | Ga0495593_0008191 | 3300047673 | Bacteria | 6081 |
| 834 | Ga0495593_0040376 | 3300047673 | Bacteria | 2512 |
| 835 | Ga0495593_0202988 | 3300047673 | Bacteria | 996 |
| 836 | Ga0495602_0022868 | 3300048088 | Bacteria | 6106 |
| 837 | Ga0495602_0044808 | 3300048088 | Bacteria | 4008 |
| 838 | Ga0495602_0053981 | 3300048088 | Bacteria | 3552 |
| 839 | Ga0495602_0269791 | 3300048088 | Bacteria | 1258 |
| 840 | Ga0495602_0279117 | 3300048088 | Bacteria | 1231 |
| 841 | Ga0495602_0553144 | 3300048088 | Bacteria | 797 |
| 842 | Ga0495602_0608770 | 3300048088 | Bacteria | 750 |
| 843 | Ga0495614_0001002 | 3300048089 | Bacteria | 12045 |
| 844 | Ga0495614_0004532 | 3300048089 | Bacteria | 6265 |
| 845 | Ga0495614_0005784 | 3300048089 | Bacteria | 5568 |
| 846 | Ga0495614_0035816 | 3300048089 | Bacteria | 2132 |
| 847 | Ga0495614_0192407 | 3300048089 | Bacteria | 921 |
| 848 | Ga0495614_0227931 | 3300048089 | Bacteria | 848 |
| 849 | Ga0495626_0005159 | 3300048091 | Bacteria | 7746 |
| 850 | Ga0496100_0297862 | 3300048903 | Bacteria | 1206 |
| 851 | Ga0496102_0115988 | 3300048905 | Bacteria | 2499 |
| 852 | Ga0496102_1807886 | 3300048905 | Bacteria | 528 |
| 853 | Ga0496103_0244855 | 3300048906 | Bacteria | 1153 |
| 854 | Ga0496104_0136698 | 3300048907 | Bacteria | 2355 |
| 855 | Ga0496105_1036754 | 3300048908 | Bacteria | 612 |
| 856 | Ga0496105_1275542 | 3300048908 | Bacteria | 537 |
| 857 | Ga0496106_0047750 | 3300048909 | Bacteria | 3223 |
| 858 | Ga0496107_0330815 | 3300048910 | Bacteria | 1134 |
| 859 | Ga0496108_0575229 | 3300048911 | Bacteria | 982 |
| 860 | Ga0496109_0093686 | 3300048912 | Bacteria | 2779 |
| 861 | Ga0496109_0672790 | 3300048912 | Bacteria | 972 |
| 862 | Ga0496110_0553753 | 3300048913 | Bacteria | 1045 |
| 863 | Ga0496110_1480806 | 3300048913 | Bacteria | 588 |
| 864 | Ga0496111_0075883 | 3300048914 | Bacteria | 2449 |
| 865 | Ga0496112_0605574 | 3300048915 | Bacteria | 1027 |
| 866 | Ga0496112_0736702 | 3300048915 | Bacteria | 912 |
| 867 | Ga0496113_0168979 | 3300048916 | Bacteria | 1731 |
| 868 | Ga0496113_0186014 | 3300048916 | Bacteria | 1647 |
| 869 | Ga0496113_1285904 | 3300048916 | Bacteria | 569 |
| 870 | Ga0496115_0292585 | 3300048918 | Bacteria | 1335 |
| 871 | Ga0496115_1045187 | 3300048918 | Bacteria | 622 |
| 872 | Ga0496119_0090567 | 3300048922 | Bacteria | 1739 |
| 873 | Ga0496126_0590681 | 3300048929 | Bacteria | 876 |
| 874 | Ga0501306_062094 | 3300049127 | Bacteria | 617 |
| 875 | Ga0501310_043368 | 3300049130 | Bacteria | 633 |
| 876 | Ga0501305_074032 | 3300049161 | Bacteria | 603 |
| 877 | Ga0501307_069711 | 3300049162 | Bacteria | 559 |
| 878 | Ga0495678_022455 | 3300049459 | Bacteria | 2758 |
| 879 | Ga0495682_0308441 | 3300049460 | Bacteria | 558 |
| 880 | Ga0501311_024918 | 3300049527 | Bacteria | 836 |
| 881 | Ga0501311_048719 | 3300049527 | Bacteria | 659 |
| 882 | Ga0501316_040440 | 3300049532 | Bacteria | 649 |
| 883 | Ga0501319_013012 | 3300049535 | Bacteria | 687 |
| 884 | Ga0501323_015022 | 3300049539 | Bacteria | 973 |
| 885 | Ga0501031_0035615 | 3300049568 | Bacteria | 3246 |
| 886 | Ga0501031_0055511 | 3300049568 | Bacteria | 2581 |
| 887 | Ga0501031_0086088 | 3300049568 | Bacteria | 2049 |
| 888 | Ga0501031_0123880 | 3300049568 | Bacteria | 1688 |
| 889 | Ga0501032_0009190 | 3300049569 | Bacteria | 7164 |
| 890 | Ga0501032_0017443 | 3300049569 | Bacteria | 5043 |
| 891 | Ga0501032_0046653 | 3300049569 | Bacteria | 2928 |
| 892 | Ga0501032_0341202 | 3300049569 | Bacteria | 965 |
| 893 | Ga0501033_0001721 | 3300049570 | Bacteria | 19146 |
| 894 | Ga0501033_0009637 | 3300049570 | Bacteria | 7432 |
| 895 | Ga0501033_0041732 | 3300049570 | Bacteria | 3422 |
| 896 | Ga0501033_0058628 | 3300049570 | Bacteria | 2843 |
| 897 | Ga0501033_0279130 | 3300049570 | Bacteria | 1179 |
| 898 | Ga0501033_0659052 | 3300049570 | Bacteria | 714 |
| 899 | Ga0501034_0006924 | 3300049571 | Bacteria | 12115 |
| 900 | Ga0501034_0018397 | 3300049571 | Bacteria | 7164 |
| 901 | Ga0501034_0123542 | 3300049571 | Bacteria | 2574 |
| 902 | Ga0501034_0246819 | 3300049571 | Bacteria | 1730 |
| 903 | Ga0501034_0325480 | 3300049571 | Bacteria | 1469 |
| 904 | Ga0501034_0413550 | 3300049571 | Bacteria | 1270 |
| 905 | Ga0501036_0000553 | 3300049572 | Bacteria | 26858 |
| 906 | Ga0501036_0004613 | 3300049572 | Bacteria | 11134 |
| 907 | Ga0501036_0006789 | 3300049572 | Bacteria | 9298 |
| 908 | Ga0501036_0011285 | 3300049572 | Bacteria | 7392 |
| 909 | Ga0501036_0011358 | 3300049572 | Bacteria | 7371 |
| 910 | Ga0501036_0061798 | 3300049572 | Bacteria | 3173 |
| 911 | Ga0501036_0100394 | 3300049572 | Bacteria | 2448 |
| 912 | Ga0501036_0432928 | 3300049572 | Bacteria | 1096 |
| 913 | Ga0501036_1225073 | 3300049572 | Bacteria | 611 |
| 914 | Ga0501037_0000724 | 3300049573 | Bacteria | 24999 |
| 915 | Ga0501037_0011775 | 3300049573 | Bacteria | 6442 |
| 916 | Ga0501037_0032349 | 3300049573 | Bacteria | 3862 |
| 917 | Ga0501037_0136132 | 3300049573 | Bacteria | 1759 |
| 918 | Ga0501037_0253865 | 3300049573 | Bacteria | 1230 |
| 919 | Ga0501038_0012653 | 3300049574 | Bacteria | 7713 |
| 920 | Ga0501038_0014519 | 3300049574 | Bacteria | 7177 |
| 921 | Ga0501038_0014863 | 3300049574 | Bacteria | 7089 |
| 922 | Ga0501038_0015344 | 3300049574 | Bacteria | 6965 |
| 923 | Ga0501038_0027984 | 3300049574 | Bacteria | 5008 |
| 924 | Ga0501038_0031678 | 3300049574 | Bacteria | 4670 |
| 925 | Ga0501039_0038974 | 3300049575 | Bacteria | 3670 |
| 926 | Ga0501039_0047347 | 3300049575 | Bacteria | 3323 |
| 927 | Ga0501039_0055160 | 3300049575 | Bacteria | 3077 |
| 928 | Ga0501039_0073425 | 3300049575 | Bacteria | 2658 |
| 929 | Ga0501039_0177907 | 3300049575 | Bacteria | 1673 |
| 930 | Ga0501040_0032902 | 3300049576 | Bacteria | 3509 |
| 931 | Ga0501041_0003165 | 3300049577 | Bacteria | 9469 |
| 932 | Ga0501042_0051139 | 3300049578 | Bacteria | 2947 |
| 933 | Ga0501042_0222592 | 3300049578 | Bacteria | 1361 |
| 934 | Ga0501042_0275777 | 3300049578 | Bacteria | 1214 |
| 935 | Ga0501043_0006148 | 3300049579 | Bacteria | 9644 |
| 936 | Ga0501043_0010610 | 3300049579 | Bacteria | 7214 |
| 937 | Ga0501043_0017910 | 3300049579 | Bacteria | 5555 |
| 938 | Ga0501043_0020604 | 3300049579 | Bacteria | 5173 |
| 939 | Ga0501043_0062689 | 3300049579 | Bacteria | 2919 |
| 940 | Ga0501043_0075044 | 3300049579 | Bacteria | 2656 |
| 941 | Ga0501043_0172843 | 3300049579 | Bacteria | 1685 |
| 942 | Ga0501046_0009533 | 3300049580 | Bacteria | 8386 |
| 943 | Ga0501046_0011002 | 3300049580 | Bacteria | 7755 |
| 944 | Ga0501046_0032446 | 3300049580 | Bacteria | 4229 |
| 945 | Ga0501046_0177966 | 3300049580 | Bacteria | 1592 |
| 946 | Ga0501046_0974236 | 3300049580 | Bacteria | 589 |
| 947 | Ga0501047_0000029 | 3300049581 | Bacteria | 218396 |
| 948 | Ga0501047_0007463 | 3300049581 | Bacteria | 10292 |
| 949 | Ga0501047_0009513 | 3300049581 | Bacteria | 9184 |
| 950 | Ga0501047_0018629 | 3300049581 | Bacteria | 6656 |
| 951 | Ga0501047_0073029 | 3300049581 | Bacteria | 3303 |
| 952 | Ga0501047_0078399 | 3300049581 | Bacteria | 3177 |
| 953 | Ga0501047_0125064 | 3300049581 | Bacteria | 2452 |
| 954 | Ga0501047_0134580 | 3300049581 | Bacteria | 2352 |
| 955 | Ga0501047_0136074 | 3300049581 | Bacteria | 2337 |
| 956 | Ga0501047_0764791 | 3300049581 | Bacteria | 782 |
| 957 | Ga0501048_0003722 | 3300049582 | Bacteria | 11623 |
| 958 | Ga0501048_0033504 | 3300049582 | Bacteria | 3710 |
| 959 | Ga0501068_0002685 | 3300049584 | Bacteria | 9423 |
| 960 | Ga0501069_0251201 | 3300049585 | Bacteria | 1031 |
| 961 | Ga0501069_0305847 | 3300049585 | Bacteria | 933 |
| 962 | Ga0501070_0003332 | 3300049586 | Bacteria | 13957 |
| 963 | Ga0501070_0012618 | 3300049586 | Bacteria | 7127 |
| 964 | Ga0501070_0217054 | 3300049586 | Bacteria | 1569 |
| 965 | Ga0501070_0226813 | 3300049586 | Bacteria | 1531 |
| 966 | Ga0501070_0469458 | 3300049586 | Bacteria | 1013 |
| 967 | Ga0501071_0000263 | 3300049587 | Bacteria | 24706 |
| 968 | Ga0501072_0017515 | 3300049588 | Bacteria | 5506 |
| 969 | Ga0501072_1197837 | 3300049588 | Bacteria | 590 |
| 970 | Ga0501073_0051632 | 3300049589 | Bacteria | 2880 |
| 971 | Ga0501073_0105674 | 3300049589 | Bacteria | 1954 |
| 972 | Ga0501074_0000685 | 3300049590 | Bacteria | 21150 |
| 973 | Ga0501074_0004802 | 3300049590 | Bacteria | 9690 |
| 974 | Ga0501076_0022529 | 3300049592 | Bacteria | 4841 |
| 975 | Ga0501077_0026110 | 3300049593 | Bacteria | 3706 |
| 976 | Ga0501079_0026744 | 3300049741 | Bacteria | 4423 |
| 977 | Ga0501080_0097712 | 3300049742 | Bacteria | 2726 |
| 978 | Ga0501080_0208337 | 3300049742 | Bacteria | 1792 |
| 979 | Ga0501080_0478862 | 3300049742 | Bacteria | 1114 |
| 980 | Ga0501081_0158903 | 3300049743 | Bacteria | 1628 |
| 981 | Ga0501083_0000994 | 3300049744 | Bacteria | 18837 |
| 982 | Ga0501035_0001374 | 3300049822 | Bacteria | 25051 |
| 983 | Ga0501035_0011222 | 3300049822 | Bacteria | 8299 |
| 984 | Ga0501035_0014707 | 3300049822 | Bacteria | 7223 |
| 985 | Ga0501035_0018838 | 3300049822 | Bacteria | 6359 |
| 986 | Ga0501035_0019714 | 3300049822 | Bacteria | 6196 |
| 987 | Ga0501035_0041594 | 3300049822 | Bacteria | 4150 |
| 988 | Ga0501035_0042286 | 3300049822 | Bacteria | 4110 |
| 989 | Ga0501035_0232963 | 3300049822 | Bacteria | 1569 |
| 990 | Ga0501044_0004484 | 3300049823 | Bacteria | 15612 |
| 991 | Ga0501044_0012903 | 3300049823 | Bacteria | 9044 |
| 992 | Ga0501044_0020219 | 3300049823 | Bacteria | 7105 |
| 993 | Ga0501044_0039348 | 3300049823 | Bacteria | 4933 |
| 994 | Ga0501044_0097016 | 3300049823 | Bacteria | 2969 |
| 995 | Ga0501044_0116755 | 3300049823 | Bacteria | 2673 |
| 996 | Ga0501044_0209971 | 3300049823 | Bacteria | 1901 |
| 997 | Ga0501044_0220220 | 3300049823 | Bacteria | 1848 |
| 998 | Ga0501044_0243058 | 3300049823 | Bacteria | 1743 |
| 999 | Ga0501044_1008791 | 3300049823 | Bacteria | 704 |
| 1000 | Ga0501045_0006168 | 3300049824 | Bacteria | 8303 |
| 1001 | Ga0501045_0094045 | 3300049824 | Bacteria | 2217 |
| 1002 | Ga0501045_0100236 | 3300049824 | Bacteria | 2144 |
| 1003 | Ga0501045_0138757 | 3300049824 | Bacteria | 1808 |
| 1004 | nmdc:mga03n38_23741_c1 | 3300050490 | Bacteria | 2499 |
| 1005 | nmdc:mga03n38_251435_c1 | 3300050490 | Bacteria | 934 |
| 1006 | nmdc:mga03n38_453060_c1 | 3300050490 | Bacteria | 714 |
| 1007 | nmdc:mga06z11_65607_c1 | 3300050494 | Bacteria | 1906 |
| 1008 | nmdc:mga04h51_16963_c1 | 3300050495 | Bacteria | 2122 |
| 1009 | nmdc:mga0n895_628388_c1 | 3300050512 | Bacteria | 1074 |
| 1010 | nmdc:mga0rr50_138433_c1 | 3300050513 | Bacteria | 1956 |
| 1011 | nmdc:mga0rr50_1558017_c1 | 3300050513 | Bacteria | 558 |
| 1012 | nmdc:mga08x19_764773_c1 | 3300050514 | Bacteria | 686 |
| 1013 | nmdc:mga08x19_931952_c1 | 3300050514 | Bacteria | 617 |
| 1014 | Ga0495601_0006639 | 3300053077 | Bacteria | 6770 |
| 1015 | Ga0495601_0177030 | 3300053077 | Bacteria | 1394 |
| 1016 | Ga0495601_0371298 | 3300053077 | Bacteria | 929 |
| 1017 | Ga0495612_0004279 | 3300053078 | Bacteria | 5927 |
| 1018 | Ga0495612_0103034 | 3300053078 | Bacteria | 1216 |
| 1019 | Ga0495612_0256764 | 3300053078 | Bacteria | 778 |
| 1020 | Ga0500610_0055900 | 3300053079 | Bacteria | 2060 |
| 1021 | Ga0495655_0187628 | 3300053083 | Bacteria | 670 |
| 1022 | Ga0495595_0148021 | 3300053084 | Bacteria | 1154 |
| 1023 | Ga0495619_0003141 | 3300053085 | Bacteria | 10711 |
| 1024 | Ga0495619_0040885 | 3300053085 | Bacteria | 3031 |
| 1025 | Ga0495619_0104808 | 3300053085 | Bacteria | 1928 |
| 1026 | Ga0495619_0480572 | 3300053085 | Bacteria | 855 |
| 1027 | Ga0500578_0050722 | 3300053086 | Bacteria | 2660 |
| 1028 | Ga0500566_0017627 | 3300053094 | Bacteria | 4195 |
| 1029 | Ga0500640_044584 | 3300053095 | Bacteria | 1946 |
| 1030 | Ga0500654_024030 | 3300053099 | Bacteria | 3827 |
| 1031 | Ga0500660_027042 | 3300053100 | Bacteria | 3019 |
| 1032 | Ga0500553_035471 | 3300053101 | Bacteria | 2472 |
| 1033 | Ga0500553_095490 | 3300053101 | Bacteria | 1295 |
| 1034 | Ga0500558_245350 | 3300053106 | Bacteria | 592 |
| 1035 | Ga0500560_000476 | 3300053107 | Bacteria | 5583 |
| 1036 | Ga0500569_004487 | 3300053109 | Bacteria | 2938 |
| 1037 | Ga0500594_0121542 | 3300053118 | Bacteria | 820 |
| 1038 | Ga0500621_032891 | 3300053126 | Bacteria | 2068 |
| 1039 | Ga0500628_009354 | 3300053129 | Bacteria | 1726 |
| 1040 | Ga0500652_001101 | 3300053131 | Bacteria | 8720 |
| 1041 | Ga0500561_0000489 | 3300053137 | Bacteria | 6439 |
| 1042 | Ga0500573_0020311 | 3300053140 | Bacteria | 3805 |
| 1043 | Ga0500573_0024558 | 3300053140 | Bacteria | 3465 |
| 1044 | Ga0500573_0087578 | 3300053140 | Bacteria | 1763 |
| 1045 | Ga0500573_0135994 | 3300053140 | Bacteria | 1357 |
| 1046 | Ga0500577_0133659 | 3300053142 | Bacteria | 1042 |
| 1047 | Ga0500579_135801 | 3300053143 | Bacteria | 1131 |
| 1048 | Ga0500600_0211300 | 3300053149 | Bacteria | 904 |
| 1049 | Ga0500603_040610 | 3300053150 | Bacteria | 1240 |
| 1050 | Ga0500633_0001530 | 3300053160 | Bacteria | 4404 |
| 1051 | Ga0500634_0002147 | 3300053161 | Bacteria | 8172 |
| 1052 | Ga0500634_0173400 | 3300053161 | Bacteria | 979 |
| 1053 | Ga0500636_0146717 | 3300053177 | Bacteria | 1300 |
| 1054 | Ga0500656_001615 | 3300053732 | Bacteria | 1964 |
| 1055 | Ga0500565_051760 | 3300053734 | Bacteria | 602 |
| 1056 | Ga0500587_006291 | 3300053739 | Bacteria | 1577 |
| 1057 | Ga0501084_0005179 | 3300054114 | Bacteria | 10664 |
| 1058 | Ga0587073_0213026 | 3300059492 | Bacteria | 586 |
| 1059 | Ga0587073_0321603 | 3300059492 | Bacteria | 510 |
| 1060 | Ga0587080_067915 | 3300059503 | Bacteria | 708 |
| 1061 | Ga0587082_146713 | 3300059504 | Bacteria | 555 |
| 1062 | Ga0587091_151974 | 3300059511 | Bacteria | 589 |
| 1063 | Ga0587098_031491 | 3300059604 | Bacteria | 732 |
| 1064 | Ga0587098_061763 | 3300059604 | Bacteria | 590 |
| 1065 | Ga0587106_060911 | 3300059605 | Bacteria | 693 |
| 1066 | Ga0587122_010712 | 3300059628 | Bacteria | 868 |
| 1067 | Ga0587068_154460 | 3300059641 | Bacteria | 521 |
| 1068 | Ga0501082_0004945 | 3300060353 | Bacteria | 11629 |
| 1069 | Ga0466962_0001135 | 3300061719 | Bacteria | 12296 |
| 1070 | Ga0466962_0037056 | 3300061719 | Bacteria | 2334 |
| 1071 | Ga0466962_0066978 | 3300061719 | Bacteria | 1714 |
| 1072 | Ga0466962_0096516 | 3300061719 | Bacteria | 1417 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2751185734 | 2753069177 | 138 |
| 2 | 3300021388 | Ga0213875_10322704 | Ga0213875_103227042 | 141 |
| 3 | 3300037853 | Ga0436364_0585418 | Ga0436364_0585418_2116_2595 | 141 |
| 4 | 3300024227 | Ga0228598_1008297 | Ga0228598_10082971 | 142 |
| 5 | 3300031824 | Ga0307413_10434098 | Ga0307413_104340981 | 142 |
| 6 | 3300045976 | Ga0466967_0137166 | Ga0466967_0137166_1230_1709 | 143 |
| 7 | 3300037853 | Ga0436364_1247794 | Ga0436364_1247794_896_1375 | 144 |
| 8 | 3300020080 | Ga0206350_11340047 | Ga0206350_113400471 | 145 |
| 9 | 3300025929 | Ga0207664_10119578 | Ga0207664_101195782 | 145 |
| 10 | 3300035084 | Ga0373928_0106764 | Ga0373928_0106764_203_682 | 145 |
| 11 | 3300035121 | Ga0373960_0138682 | Ga0373960_0138682_164_643 | 145 |
| 12 | 3300037068 | Ga0373925_0216829 | Ga0373925_0216829_124_603 | 145 |
| 13 | 3300039453 | Ga0436362_0983991 | Ga0436362_0983991_165_644 | 146 |
| 14 | 3300046529 | Ga0495652_0049924 | Ga0495652_0049924_2803_3252 | 147 |
| 15 | 3300039438 | Ga0436360_0208252 | Ga0436360_0208252_192_695 | 148 |
| 16 | 3300041451 | Ga0451791_1205736 | Ga0451791_1205736_129_605 | 148 |
| 17 | iso_pu_bacteria | 2675903060 | 2676487751 | 148 |
| 18 | iso_pu_bacteria | 2884693830 | 2884697725 | 148 |
| 19 | iso_pu_bacteria | 2895427314 | 2895435565 | 148 |
| 20 | iso_pu_bacteria | 2895442618 | 2895444827 | 148 |
| 21 | 3300035117 | Ga0373953_0122074 | Ga0373953_0122074_501_980 | 149 |
| 22 | 3300046463 | Ga0495653_0135933 | Ga0495653_0135933_1001_1480 | 149 |
| 23 | 3300046511 | Ga0495608_0155355 | Ga0495608_0155355_130_609 | 149 |
| 24 | 3300047471 | Ga0495684_0041460 | Ga0495684_0041460_565_1044 | 149 |
| 25 | iso_pu_bacteria | 2899370129 | 2899376292 | 149 |
| 26 | 3300014745 | Ga0157377_10375702 | Ga0157377_103757022 | 150 |
| 27 | 3300003203 | JGI25406J46586_10001472 | JGI25406J46586_1000147210 | 151 |
| 28 | iso_pu_bacteria | 2856741275 | 2856743393 | 151 |
| 29 | iso_pu_bacteria | 2891395885 | 2891402879 | 151 |
| 30 | iso_pu_bacteria | 2891554331 | 2891554815 | 151 |
| 31 | iso_pu_bacteria | 2891562705 | 2891564773 | 151 |
| 32 | 3300031456 | Ga0307513_10116425 | Ga0307513_101164251 | 152 |
| 33 | 3300032126 | Ga0307415_100154543 | Ga0307415_1001545433 | 152 |
| 34 | 3300049572 | Ga0501036_1225073 | Ga0501036_1225073_116_592 | 152 |
| 35 | iso_pu_bacteria | 2867369537 | 2867373888 | 153 |
| 36 | iso_pu_bacteria | 3006321560 | 3006322610 | 153 |
| 37 | 3300049568 | Ga0501031_0086088 | Ga0501031_0086088_73_543 | 154 |
| 38 | 3300049569 | Ga0501032_0341202 | Ga0501032_0341202_220_690 | 154 |
| 39 | 3300049570 | Ga0501033_0009637 | Ga0501033_0009637_6908_7378 | 154 |
| 40 | 3300049570 | Ga0501033_0659052 | Ga0501033_0659052_180_650 | 154 |
| 41 | 3300049571 | Ga0501034_0246819 | Ga0501034_0246819_1153_1623 | 154 |
| 42 | 3300049572 | Ga0501036_0011358 | Ga0501036_0011358_5506_5976 | 154 |
| 43 | 3300049573 | Ga0501037_0136132 | Ga0501037_0136132_594_1064 | 154 |
| 44 | 3300049574 | Ga0501038_0014863 | Ga0501038_0014863_4245_4715 | 154 |
| 45 | 3300049575 | Ga0501039_0047347 | Ga0501039_0047347_2832_3302 | 154 |
| 46 | 3300049579 | Ga0501043_0006148 | Ga0501043_0006148_8983_9453 | 154 |
| 47 | 3300049579 | Ga0501043_0017910 | Ga0501043_0017910_207_677 | 154 |
| 48 | 3300049581 | Ga0501047_0009513 | Ga0501047_0009513_6123_6593 | 154 |
| 49 | 3300049586 | Ga0501070_0012618 | Ga0501070_0012618_6350_6820 | 154 |
| 50 | 3300049586 | Ga0501070_0226813 | Ga0501070_0226813_955_1425 | 154 |
| 51 | 3300049588 | Ga0501072_1197837 | Ga0501072_1197837_61_531 | 154 |
| 52 | 3300049822 | Ga0501035_0011222 | Ga0501035_0011222_7505_7975 | 154 |
| 53 | 3300049822 | Ga0501035_0018838 | Ga0501035_0018838_1408_1878 | 154 |
| 54 | 3300049823 | Ga0501044_0220220 | Ga0501044_0220220_980_1450 | 154 |
| 55 | 3300049824 | Ga0501045_0100236 | Ga0501045_0100236_1199_1669 | 154 |
| 56 | iso_pu_bacteria | 2547132111 | 2547408372 | 154 |
| 57 | iso_pu_bacteria | 2554235005 | 2554256212 | 154 |
| 58 | iso_pu_bacteria | 2582581312 | 2585296632 | 154 |
| 59 | iso_pu_bacteria | 2582581313 | 2585309073 | 154 |
| 60 | iso_pu_bacteria | 2582581314 | 2585319261 | 154 |
| 61 | iso_pu_bacteria | 2616644814 | 2616697315 | 154 |
| 62 | iso_pu_bacteria | 2616644941 | 2616903261 | 154 |
| 63 | iso_pu_bacteria | 2643221548 | 2643764037 | 154 |
| 64 | iso_pu_bacteria | 2643221578 | 2643902243 | 154 |
| 65 | iso_pu_bacteria | 2643221587 | 2643943929 | 154 |
| 66 | iso_pu_bacteria | 2643221601 | 2644017705 | 154 |
| 67 | iso_pu_bacteria | 2643221631 | 2644173335 | 154 |
| 68 | iso_pu_bacteria | 2643221647 | 2644265789 | 154 |
| 69 | iso_pu_bacteria | 2643221670 | 2644386912 | 154 |
| 70 | iso_pu_bacteria | 2643221673 | 2644403814 | 154 |
| 71 | iso_pu_bacteria | 2643221677 | 2644434666 | 154 |
| 72 | iso_pu_bacteria | 2643221678 | 2644440069 | 154 |
| 73 | iso_pu_bacteria | 2643221682 | 2644461531 | 154 |
| 74 | iso_pu_bacteria | 2643221714 | 2644632609 | 154 |
| 75 | iso_pu_bacteria | 2767802112 | 2768642964 | 154 |
| 76 | iso_pu_bacteria | 2784132148 | 2784590432 | 154 |
| 77 | iso_pu_bacteria | 2784746763 | 2785341184 | 154 |
| 78 | iso_pu_bacteria | 2784746768 | 2785371520 | 154 |
| 79 | iso_pu_bacteria | 2786546132 | 2786672678 | 154 |
| 80 | iso_pu_bacteria | 2791355406 | 2793983590 | 154 |
| 81 | iso_pu_bacteria | 2802429296 | 2804847924 | 154 |
| 82 | iso_pu_bacteria | 2808606359 | 2808844047 | 154 |
| 83 | iso_pu_bacteria | 2808606375 | 2808913639 | 154 |
| 84 | iso_pu_bacteria | 2808606448 | 2809234105 | 154 |
| 85 | iso_pu_bacteria | 2808606982 | 2811844397 | 154 |
| 86 | iso_pu_bacteria | 2811994879 | 2812355925 | 154 |
| 87 | iso_pu_bacteria | 2811994917 | 2812478734 | 154 |
| 88 | iso_pu_bacteria | 2818991463 | 2819694609 | 154 |
| 89 | iso_pu_bacteria | 2818991472 | 2819740621 | 154 |
| 90 | iso_pu_bacteria | 2852635781 | 2852641040 | 154 |
| 91 | iso_pu_bacteria | 2862178590 | 2862186427 | 154 |
| 92 | iso_pu_bacteria | 2862281513 | 2862284728 | 154 |
| 93 | iso_pu_bacteria | 2862290372 | 2862293512 | 154 |
| 94 | iso_pu_bacteria | 2862382967 | 2862384795 | 154 |
| 95 | iso_pu_bacteria | 2862507626 | 2862512660 | 154 |
| 96 | iso_pu_bacteria | 2862574272 | 2862577489 | 154 |
| 97 | iso_pu_bacteria | 2862705112 | 2862707539 | 154 |
| 98 | iso_pu_bacteria | 2863404153 | 2863408635 | 154 |
| 99 | iso_pu_bacteria | 2867346516 | 2867349148 | 154 |
| 100 | iso_pu_bacteria | 2867428634 | 2867430201 | 154 |
| 101 | iso_pu_bacteria | 2867475112 | 2867478882 | 154 |
| 102 | iso_pu_bacteria | 2873151551 | 2873154036 | 154 |
| 103 | iso_pu_bacteria | 2875391855 | 2875396715 | 154 |
| 104 | iso_pu_bacteria | 2877676314 | 2877679086 | 154 |
| 105 | iso_pu_bacteria | 2912715099 | 2912717599 | 154 |
| 106 | iso_pu_bacteria | 2912723979 | 2912730141 | 154 |
| 107 | iso_pu_bacteria | 2912757875 | 2912762770 | 154 |
| 108 | iso_pu_bacteria | 2918501144 | 2918506521 | 154 |
| 109 | iso_pu_bacteria | 2919468124 | 2919471752 | 154 |
| 110 | iso_pu_bacteria | 2946045630 | 2946047840 | 154 |
| 111 | iso_pu_bacteria | 2946064051 | 2946069862 | 154 |
| 112 | iso_pu_bacteria | 2946072368 | 2946077780 | 154 |
| 113 | iso_pu_bacteria | 2947224130 | 2947226937 | 154 |
| 114 | iso_pu_bacteria | 2954002825 | 2954005483 | 154 |
| 115 | iso_pu_bacteria | 2954380949 | 2954383990 | 154 |
| 116 | iso_pu_bacteria | 2954673503 | 2954678971 | 154 |
| 117 | iso_pu_bacteria | 2954682443 | 2954685181 | 154 |
| 118 | iso_pu_bacteria | 2954691527 | 2954694790 | 154 |
| 119 | iso_pu_bacteria | 2954701450 | 2954709991 | 154 |
| 120 | iso_pu_bacteria | 2954711539 | 2954714298 | 154 |
| 121 | iso_pu_bacteria | 2954721474 | 2954724247 | 154 |
| 122 | iso_pu_bacteria | 2954731030 | 2954737593 | 154 |
| 123 | iso_pu_bacteria | 2954740390 | 2954743144 | 154 |
| 124 | iso_pu_bacteria | 2954749733 | 2954756426 | 154 |
| 125 | iso_pu_bacteria | 2954759201 | 2954762102 | 154 |
| 126 | iso_pu_bacteria | 2990044586 | 2990048265 | 154 |
| 127 | iso_pu_bacteria | 2990059506 | 2990062962 | 154 |
| 128 | iso_pu_bacteria | 2990088156 | 2990094500 | 154 |
| 129 | iso_pu_bacteria | 2995463766 | 2995467111 | 154 |
| 130 | iso_pu_bacteria | 2997451912 | 2997452882 | 154 |
| 131 | iso_pu_bacteria | 2997600082 | 2997606064 | 154 |
| 132 | iso_pu_bacteria | 3006393351 | 3006400041 | 154 |
| 133 | iso_pu_bacteria | 3006493962 | 3006500140 | 154 |
| 134 | iso_pu_bacteria | 8008485437 | 8008491559 | 154 |
| 135 | iso_pu_bacteria | 8008558824 | 8008562806 | 154 |
| 136 | iso_pu_bacteria | 8008574985 | 8008577151 | 154 |
| 137 | iso_pu_bacteria | 8023623736 | 8023629638 | 154 |
| 138 | iso_pu_bacteria | 8025413630 | 8025419431 | 154 |
| 139 | iso_pu_bacteria | 8025524527 | 8025524615 | 154 |
| 140 | iso_pu_bacteria | 8025530807 | 8025531288 | 154 |
| 141 | iso_pu_bacteria | 8047893842 | 8047896087 | 154 |
| 142 | iso_pu_bacteria | 8048127548 | 8048132248 | 154 |
| 143 | iso_pu_bacteria | 8048356638 | 8048362848 | 154 |
| 144 | iso_pu_bacteria | 8048369669 | 8048373112 | 154 |
| 145 | iso_pu_bacteria | 8048379754 | 8048382045 | 154 |
| 146 | iso_pu_bacteria | 8048406513 | 8048411674 | 154 |
| 147 | iso_pu_bacteria | 8054160619 | 8054166430 | 154 |
| 148 | iso_pu_bacteria | 8056447290 | 8056453786 | 154 |
| 149 | iso_pu_bacteria | 8056667051 | 8056672543 | 154 |
| 150 | iso_pu_bacteria | 8056829672 | 8056832217 | 154 |
| 151 | 3300047322 | Ga0495680_0234970 | Ga0495680_0234970_475_951 | 155 |
| 152 | 3300049568 | Ga0501031_0035615 | Ga0501031_0035615_2159_2635 | 155 |
| 153 | 3300049569 | Ga0501032_0009190 | Ga0501032_0009190_671_1147 | 155 |
| 154 | 3300049570 | Ga0501033_0058628 | Ga0501033_0058628_2334_2810 | 155 |
| 155 | 3300049571 | Ga0501034_0018397 | Ga0501034_0018397_6018_6494 | 155 |
| 156 | 3300049572 | Ga0501036_0011285 | Ga0501036_0011285_899_1375 | 155 |
| 157 | 3300049573 | Ga0501037_0000724 | Ga0501037_0000724_18506_18982 | 155 |
| 158 | 3300049574 | Ga0501038_0014519 | Ga0501038_0014519_684_1160 | 155 |
| 159 | 3300049576 | Ga0501040_0032902 | Ga0501040_0032902_2708_3184 | 155 |
| 160 | 3300049577 | Ga0501041_0003165 | Ga0501041_0003165_5038_5514 | 155 |
| 161 | 3300049578 | Ga0501042_0051139 | Ga0501042_0051139_440_916 | 155 |
| 162 | 3300049579 | Ga0501043_0010610 | Ga0501043_0010610_6127_6603 | 155 |
| 163 | 3300049580 | Ga0501046_0009533 | Ga0501046_0009533_1893_2369 | 155 |
| 164 | 3300049581 | Ga0501047_0018629 | Ga0501047_0018629_5569_6045 | 155 |
| 165 | 3300049582 | Ga0501048_0033504 | Ga0501048_0033504_904_1380 | 155 |
| 166 | 3300049584 | Ga0501068_0002685 | Ga0501068_0002685_2643_3119 | 155 |
| 167 | 3300049585 | Ga0501069_0251201 | Ga0501069_0251201_116_592 | 155 |
| 168 | 3300049587 | Ga0501071_0000263 | Ga0501071_0000263_18096_18572 | 155 |
| 169 | 3300049588 | Ga0501072_0017515 | Ga0501072_0017515_3921_4397 | 155 |
| 170 | 3300049590 | Ga0501074_0004802 | Ga0501074_0004802_6881_7357 | 155 |
| 171 | 3300049592 | Ga0501076_0022529 | Ga0501076_0022529_3666_4142 | 155 |
| 172 | 3300049593 | Ga0501077_0026110 | Ga0501077_0026110_3125_3601 | 155 |
| 173 | 3300049741 | Ga0501079_0026744 | Ga0501079_0026744_1518_1994 | 155 |
| 174 | 3300049742 | Ga0501080_0097712 | Ga0501080_0097712_1904_2380 | 155 |
| 175 | 3300049743 | Ga0501081_0158903 | Ga0501081_0158903_139_615 | 155 |
| 176 | 3300049744 | Ga0501083_0000994 | Ga0501083_0000994_675_1151 | 155 |
| 177 | 3300049822 | Ga0501035_0014707 | Ga0501035_0014707_6136_6612 | 155 |
| 178 | 3300049823 | Ga0501044_0020219 | Ga0501044_0020219_612_1088 | 155 |
| 179 | 3300049824 | Ga0501045_0006168 | Ga0501045_0006168_4049_4525 | 155 |
| 180 | 3300054114 | Ga0501084_0005179 | Ga0501084_0005179_7378_7854 | 155 |
| 181 | 3300060353 | Ga0501082_0004945 | Ga0501082_0004945_7105_7581 | 155 |
| 182 | 3300053078 | Ga0495612_0256764 | Ga0495612_0256764_100_624 | 156 |
| 183 | iso_pu_bacteria | 8025478263 | 8025480470 | 156 |
| 184 | 3300003320 | rootH2_10084890 | rootH2_100848902 | 157 |
| 185 | 3300003320 | rootH2_10148651 | rootH2_101486511 | 157 |
| 186 | 3300005327 | Ga0070658_10171134 | Ga0070658_101711342 | 157 |
| 187 | 3300005329 | Ga0070683_100006536 | Ga0070683_1000065366 | 157 |
| 188 | 3300005329 | Ga0070683_100095325 | Ga0070683_1000953252 | 157 |
| 189 | 3300005329 | Ga0070683_100438750 | Ga0070683_1004387501 | 157 |
| 190 | 3300005330 | Ga0070690_100810923 | Ga0070690_1008109231 | 157 |
| 191 | 3300005331 | Ga0070670_100802416 | Ga0070670_1008024161 | 157 |
| 192 | 3300005336 | Ga0070680_100021287 | Ga0070680_1000212872 | 157 |
| 193 | 3300005339 | Ga0070660_100659235 | Ga0070660_1006592351 | 157 |
| 194 | 3300005344 | Ga0070661_100367626 | Ga0070661_1003676262 | 157 |
| 195 | 3300005347 | Ga0070668_100587733 | Ga0070668_1005877331 | 157 |
| 196 | 3300005356 | Ga0070674_100157779 | Ga0070674_1001577792 | 157 |
| 197 | 3300005364 | Ga0070673_100187500 | Ga0070673_1001875001 | 157 |
| 198 | 3300005366 | Ga0070659_100332214 | Ga0070659_1003322142 | 157 |
| 199 | 3300005367 | Ga0070667_100121550 | Ga0070667_1001215503 | 157 |
| 200 | 3300005434 | Ga0070709_10039672 | Ga0070709_100396723 | 157 |
| 201 | 3300005434 | Ga0070709_10085969 | Ga0070709_100859692 | 157 |
| 202 | 3300005434 | Ga0070709_10133484 | Ga0070709_101334842 | 157 |
| 203 | 3300005434 | Ga0070709_10868909 | Ga0070709_108689092 | 157 |
| 204 | 3300005435 | Ga0070714_100004044 | Ga0070714_10000404410 | 157 |
| 205 | 3300005435 | Ga0070714_100127885 | Ga0070714_1001278854 | 157 |
| 206 | 3300005435 | Ga0070714_100816644 | Ga0070714_1008166442 | 157 |
| 207 | 3300005435 | Ga0070714_100845027 | Ga0070714_1008450272 | 157 |
| 208 | 3300005435 | Ga0070714_101161205 | Ga0070714_1011612051 | 157 |
| 209 | 3300005436 | Ga0070713_100243560 | Ga0070713_1002435602 | 157 |
| 210 | 3300005436 | Ga0070713_100884842 | Ga0070713_1008848422 | 157 |
| 211 | 3300005437 | Ga0070710_10103161 | Ga0070710_101031612 | 157 |
| 212 | 3300005437 | Ga0070710_10837933 | Ga0070710_108379331 | 157 |
| 213 | 3300005439 | Ga0070711_100129637 | Ga0070711_1001296372 | 157 |
| 214 | 3300005439 | Ga0070711_100204606 | Ga0070711_1002046062 | 157 |
| 215 | 3300005439 | Ga0070711_101011128 | Ga0070711_1010111282 | 157 |
| 216 | 3300005444 | Ga0070694_100075814 | Ga0070694_1000758142 | 157 |
| 217 | 3300005445 | Ga0070708_100003731 | Ga0070708_1000037313 | 157 |
| 218 | 3300005455 | Ga0070663_100125838 | Ga0070663_1001258382 | 157 |
| 219 | 3300005457 | Ga0070662_100117947 | Ga0070662_1001179472 | 157 |
| 220 | 3300005466 | Ga0070685_10018280 | Ga0070685_100182801 | 157 |
| 221 | 3300005467 | Ga0070706_100008655 | Ga0070706_1000086559 | 157 |
| 222 | 3300005467 | Ga0070706_100091325 | Ga0070706_1000913253 | 157 |
| 223 | 3300005467 | Ga0070706_100183832 | Ga0070706_1001838322 | 157 |
| 224 | 3300005468 | Ga0070707_100025575 | Ga0070707_1000255754 | 157 |
| 225 | 3300005468 | Ga0070707_100042124 | Ga0070707_1000421242 | 157 |
| 226 | 3300005471 | Ga0070698_100034761 | Ga0070698_1000347616 | 157 |
| 227 | 3300005471 | Ga0070698_100147517 | Ga0070698_1001475172 | 157 |
| 228 | 3300005471 | Ga0070698_100304028 | Ga0070698_1003040282 | 157 |
| 229 | 3300005518 | Ga0070699_100001397 | Ga0070699_10000139715 | 157 |
| 230 | 3300005530 | Ga0070679_100020257 | Ga0070679_1000202572 | 157 |
| 231 | 3300005535 | Ga0070684_100211337 | Ga0070684_1002113372 | 157 |
| 232 | 3300005535 | Ga0070684_100307367 | Ga0070684_1003073671 | 157 |
| 233 | 3300005536 | Ga0070697_100004674 | Ga0070697_1000046744 | 157 |
| 234 | 3300005543 | Ga0070672_100071426 | Ga0070672_1000714264 | 157 |
| 235 | 3300005545 | Ga0070695_100133462 | Ga0070695_1001334622 | 157 |
| 236 | 3300005546 | Ga0070696_100416789 | Ga0070696_1004167892 | 157 |
| 237 | 3300005548 | Ga0070665_100339480 | Ga0070665_1003394801 | 157 |
| 238 | 3300005564 | Ga0070664_100017308 | Ga0070664_1000173081 | 157 |
| 239 | 3300005577 | Ga0068857_100041495 | Ga0068857_1000414955 | 157 |
| 240 | 3300005578 | Ga0068854_100470375 | Ga0068854_1004703752 | 157 |
| 241 | 3300005614 | Ga0068856_100679071 | Ga0068856_1006790712 | 157 |
| 242 | 3300005616 | Ga0068852_100605205 | Ga0068852_1006052051 | 157 |
| 243 | 3300005617 | Ga0068859_101542260 | Ga0068859_1015422601 | 157 |
| 244 | 3300005617 | Ga0068859_101875324 | Ga0068859_1018753241 | 157 |
| 245 | 3300005718 | Ga0068866_10071750 | Ga0068866_100717502 | 157 |
| 246 | 3300005840 | Ga0068870_10598728 | Ga0068870_105987281 | 157 |
| 247 | 3300005843 | Ga0068860_100461120 | Ga0068860_1004611201 | 157 |
| 248 | 3300005844 | Ga0068862_100825965 | Ga0068862_1008259652 | 157 |
| 249 | 3300005983 | Ga0081540_1000009 | Ga0081540_100000988 | 157 |
| 250 | 3300006028 | Ga0070717_10007214 | Ga0070717_100072145 | 157 |
| 251 | 3300006028 | Ga0070717_10288147 | Ga0070717_102881472 | 157 |
| 252 | 3300006028 | Ga0070717_10701645 | Ga0070717_107016452 | 157 |
| 253 | 3300006028 | Ga0070717_10958469 | Ga0070717_109584692 | 157 |
| 254 | 3300006028 | Ga0070717_10968958 | Ga0070717_109689582 | 157 |
| 255 | 3300006163 | Ga0070715_10019913 | Ga0070715_100199132 | 157 |
| 256 | 3300006173 | Ga0070716_100121416 | Ga0070716_1001214163 | 157 |
| 257 | 3300006173 | Ga0070716_100131151 | Ga0070716_1001311513 | 157 |
| 258 | 3300006175 | Ga0070712_100003385 | Ga0070712_1000033852 | 157 |
| 259 | 3300006175 | Ga0070712_100031793 | Ga0070712_1000317932 | 157 |
| 260 | 3300006175 | Ga0070712_100745901 | Ga0070712_1007459012 | 157 |
| 261 | 3300006871 | Ga0075434_100403247 | Ga0075434_1004032473 | 157 |
| 262 | 3300006881 | Ga0068865_100851440 | Ga0068865_1008514402 | 157 |
| 263 | 3300006914 | Ga0075436_100133238 | Ga0075436_1001332382 | 157 |
| 264 | 3300006914 | Ga0075436_100429864 | Ga0075436_1004298641 | 157 |
| 265 | 3300006914 | Ga0075436_100514443 | Ga0075436_1005144432 | 157 |
| 266 | 3300006931 | Ga0097620_101542226 | Ga0097620_1015422261 | 157 |
| 267 | 3300006931 | Ga0097620_101875024 | Ga0097620_1018750241 | 157 |
| 268 | 3300007076 | Ga0075435_100227732 | Ga0075435_1002277322 | 157 |
| 269 | 3300009011 | Ga0105251_10109922 | Ga0105251_101099221 | 157 |
| 270 | 3300009093 | Ga0105240_10229594 | Ga0105240_102295942 | 157 |
| 271 | 3300009098 | Ga0105245_10163986 | Ga0105245_101639863 | 157 |
| 272 | 3300009148 | Ga0105243_10173590 | Ga0105243_101735901 | 157 |
| 273 | 3300009174 | Ga0105241_10415761 | Ga0105241_104157612 | 157 |
| 274 | 3300009177 | Ga0105248_10627474 | Ga0105248_106274743 | 157 |
| 275 | 3300009545 | Ga0105237_11260386 | Ga0105237_112603861 | 157 |
| 276 | 3300009551 | Ga0105238_10569133 | Ga0105238_105691332 | 157 |
| 277 | 3300010375 | Ga0105239_10411233 | Ga0105239_104112331 | 157 |
| 278 | 3300010375 | Ga0105239_10956721 | Ga0105239_109567212 | 157 |
| 279 | 3300011119 | Ga0105246_10575366 | Ga0105246_105753662 | 157 |
| 280 | 3300011119 | Ga0105246_10656982 | Ga0105246_106569821 | 157 |
| 281 | 3300012494 | Ga0157341_1018722 | Ga0157341_10187221 | 157 |
| 282 | 3300012508 | Ga0157315_1004244 | Ga0157315_10042441 | 157 |
| 283 | 3300013100 | Ga0157373_10321146 | Ga0157373_103211462 | 157 |
| 284 | 3300013102 | Ga0157371_10033294 | Ga0157371_100332941 | 157 |
| 285 | 3300013296 | Ga0157374_11277102 | Ga0157374_112771021 | 157 |
| 286 | 3300014325 | Ga0163163_10136261 | Ga0163163_101362611 | 157 |
| 287 | 3300014968 | Ga0157379_10304147 | Ga0157379_103041473 | 157 |
| 288 | 3300017792 | Ga0163161_11007753 | Ga0163161_110077531 | 157 |
| 289 | 3300020070 | Ga0206356_10810878 | Ga0206356_108108782 | 157 |
| 290 | 3300020081 | Ga0206354_11543200 | Ga0206354_115432002 | 157 |
| 291 | 3300020082 | Ga0206353_11306639 | Ga0206353_113066392 | 157 |
| 292 | 3300021388 | Ga0213875_10024438 | Ga0213875_100244385 | 157 |
| 293 | 3300025885 | Ga0207653_10051332 | Ga0207653_100513321 | 157 |
| 294 | 3300025898 | Ga0207692_10022907 | Ga0207692_100229072 | 157 |
| 295 | 3300025899 | Ga0207642_10209825 | Ga0207642_102098252 | 157 |
| 296 | 3300025901 | Ga0207688_10091412 | Ga0207688_100914123 | 157 |
| 297 | 3300025904 | Ga0207647_10082703 | Ga0207647_100827032 | 157 |
| 298 | 3300025906 | Ga0207699_10003180 | Ga0207699_100031805 | 157 |
| 299 | 3300025906 | Ga0207699_10019000 | Ga0207699_100190003 | 157 |
| 300 | 3300025908 | Ga0207643_10007955 | Ga0207643_100079552 | 157 |
| 301 | 3300025910 | Ga0207684_10033691 | Ga0207684_100336913 | 157 |
| 302 | 3300025910 | Ga0207684_10072689 | Ga0207684_100726893 | 157 |
| 303 | 3300025912 | Ga0207707_10200009 | Ga0207707_102000093 | 157 |
| 304 | 3300025914 | Ga0207671_10621702 | Ga0207671_106217022 | 157 |
| 305 | 3300025915 | Ga0207693_10010984 | Ga0207693_100109846 | 157 |
| 306 | 3300025915 | Ga0207693_10020666 | Ga0207693_100206663 | 157 |
| 307 | 3300025917 | Ga0207660_10302102 | Ga0207660_103021021 | 157 |
| 308 | 3300025919 | Ga0207657_10022671 | Ga0207657_100226714 | 157 |
| 309 | 3300025920 | Ga0207649_10220986 | Ga0207649_102209862 | 157 |
| 310 | 3300025921 | Ga0207652_10941951 | Ga0207652_109419511 | 157 |
| 311 | 3300025922 | Ga0207646_10012425 | Ga0207646_100124256 | 157 |
| 312 | 3300025922 | Ga0207646_10023703 | Ga0207646_100237033 | 157 |
| 313 | 3300025923 | Ga0207681_11180768 | Ga0207681_111807681 | 157 |
| 314 | 3300025926 | Ga0207659_10116885 | Ga0207659_101168852 | 157 |
| 315 | 3300025928 | Ga0207700_10016756 | Ga0207700_100167562 | 157 |
| 316 | 3300025928 | Ga0207700_10091383 | Ga0207700_100913833 | 157 |
| 317 | 3300025928 | Ga0207700_10191375 | Ga0207700_101913753 | 157 |
| 318 | 3300025928 | Ga0207700_10243403 | Ga0207700_102434032 | 157 |
| 319 | 3300025928 | Ga0207700_10275158 | Ga0207700_102751582 | 157 |
| 320 | 3300025929 | Ga0207664_10018165 | Ga0207664_100181652 | 157 |
| 321 | 3300025929 | Ga0207664_10019807 | Ga0207664_100198073 | 157 |
| 322 | 3300025929 | Ga0207664_10082344 | Ga0207664_100823443 | 157 |
| 323 | 3300025929 | Ga0207664_10245304 | Ga0207664_102453042 | 157 |
| 324 | 3300025929 | Ga0207664_10291023 | Ga0207664_102910233 | 157 |
| 325 | 3300025931 | Ga0207644_10357328 | Ga0207644_103573282 | 157 |
| 326 | 3300025933 | Ga0207706_10022821 | Ga0207706_100228215 | 157 |
| 327 | 3300025936 | Ga0207670_10022698 | Ga0207670_100226985 | 157 |
| 328 | 3300025937 | Ga0207669_10319878 | Ga0207669_103198781 | 157 |
| 329 | 3300025938 | Ga0207704_10131259 | Ga0207704_101312592 | 157 |
| 330 | 3300025939 | Ga0207665_10010016 | Ga0207665_100100165 | 157 |
| 331 | 3300025939 | Ga0207665_10138798 | Ga0207665_101387983 | 157 |
| 332 | 3300025939 | Ga0207665_10165343 | Ga0207665_101653433 | 157 |
| 333 | 3300025940 | Ga0207691_10031590 | Ga0207691_100315904 | 157 |
| 334 | 3300025941 | Ga0207711_10232356 | Ga0207711_102323562 | 157 |
| 335 | 3300025944 | Ga0207661_10182912 | Ga0207661_101829122 | 157 |
| 336 | 3300025960 | Ga0207651_10351869 | Ga0207651_103518692 | 157 |
| 337 | 3300025972 | Ga0207668_10186162 | Ga0207668_101861621 | 157 |
| 338 | 3300025981 | Ga0207640_11122703 | Ga0207640_111227031 | 157 |
| 339 | 3300026041 | Ga0207639_10614582 | Ga0207639_106145821 | 157 |
| 340 | 3300026075 | Ga0207708_10506191 | Ga0207708_105061911 | 157 |
| 341 | 3300026078 | Ga0207702_10005527 | Ga0207702_100055275 | 157 |
| 342 | 3300026088 | Ga0207641_11908027 | Ga0207641_119080271 | 157 |
| 343 | 3300026095 | Ga0207676_11782984 | Ga0207676_117829841 | 157 |
| 344 | 3300026116 | Ga0207674_10020822 | Ga0207674_100208225 | 157 |
| 345 | 3300026118 | Ga0207675_100091161 | Ga0207675_1000911614 | 157 |
| 346 | 3300026121 | Ga0207683_10001450 | Ga0207683_1000145017 | 157 |
| 347 | 3300028379 | Ga0268266_10174059 | Ga0268266_101740593 | 157 |
| 348 | 3300028379 | Ga0268266_10320364 | Ga0268266_103203642 | 157 |
| 349 | 3300028381 | Ga0268264_10335073 | Ga0268264_103350731 | 157 |
| 350 | 3300030836 | Ga0265767_101432 | Ga0265767_1014322 | 157 |
| 351 | 3300031090 | Ga0265760_10011674 | Ga0265760_100116744 | 157 |
| 352 | 3300031090 | Ga0265760_10117098 | Ga0265760_101170982 | 157 |
| 353 | 3300034816 | Ga0373930_0004467 | Ga0373930_0004467_1252_1731 | 157 |
| 354 | 3300034817 | Ga0373948_0034847 | Ga0373948_0034847_331_810 | 157 |
| 355 | 3300034819 | Ga0373958_0161341 | Ga0373958_0161341_73_552 | 157 |
| 356 | 3300034957 | Ga0373938_0050244 | Ga0373938_0050244_394_873 | 157 |
| 357 | 3300035083 | Ga0373926_0000765 | Ga0373926_0000765_4656_5135 | 157 |
| 358 | 3300035083 | Ga0373926_0001515 | Ga0373926_0001515_1586_2065 | 157 |
| 359 | 3300035086 | Ga0373934_0003049 | Ga0373934_0003049_668_1147 | 157 |
| 360 | 3300035086 | Ga0373934_0009621 | Ga0373934_0009621_1174_1653 | 157 |
| 361 | 3300035089 | Ga0373944_0000224 | Ga0373944_0000224_6108_6587 | 157 |
| 362 | 3300035089 | Ga0373944_0012535 | Ga0373944_0012535_1200_1679 | 157 |
| 363 | 3300035111 | Ga0373923_0001164 | Ga0373923_0001164_1714_2193 | 157 |
| 364 | 3300035111 | Ga0373923_0047425 | Ga0373923_0047425_505_984 | 157 |
| 365 | 3300035112 | Ga0373932_0031095 | Ga0373932_0031095_178_657 | 157 |
| 366 | 3300035113 | Ga0373936_0000334 | Ga0373936_0000334_5361_5840 | 157 |
| 367 | 3300035113 | Ga0373936_0013060 | Ga0373936_0013060_2287_2766 | 157 |
| 368 | 3300035113 | Ga0373936_0139665 | Ga0373936_0139665_153_632 | 157 |
| 369 | 3300035115 | Ga0373941_0353539 | Ga0373941_0353539_107_586 | 157 |
| 370 | 3300035116 | Ga0373945_0000228 | Ga0373945_0000228_10633_11112 | 157 |
| 371 | 3300035116 | Ga0373945_0011604 | Ga0373945_0011604_508_987 | 157 |
| 372 | 3300035117 | Ga0373953_0024122 | Ga0373953_0024122_1781_2260 | 157 |
| 373 | 3300035118 | Ga0373954_0017440 | Ga0373954_0017440_1577_2056 | 157 |
| 374 | 3300035119 | Ga0373956_0052379 | Ga0373956_0052379_1321_1800 | 157 |
| 375 | 3300035121 | Ga0373960_0082514 | Ga0373960_0082514_498_977 | 157 |
| 376 | 3300035170 | Ga0373943_0002009 | Ga0373943_0002009_5942_6421 | 157 |
| 377 | 3300035170 | Ga0373943_0013785 | Ga0373943_0013785_2581_3060 | 157 |
| 378 | 3300035170 | Ga0373943_0390413 | Ga0373943_0390413_94_573 | 157 |
| 379 | 3300035171 | Ga0373946_0000096 | Ga0373946_0000096_7440_7919 | 157 |
| 380 | 3300035171 | Ga0373946_0000515 | Ga0373946_0000515_3025_3504 | 157 |
| 381 | 3300035172 | Ga0373955_0044853 | Ga0373955_0044853_535_1014 | 157 |
| 382 | 3300035172 | Ga0373955_0053401 | Ga0373955_0053401_1519_1998 | 157 |
| 383 | 3300035172 | Ga0373955_0401001 | Ga0373955_0401001_292_771 | 157 |
| 384 | 3300035172 | Ga0373955_0424072 | Ga0373955_0424072_176_655 | 157 |
| 385 | 3300035207 | Ga0373942_0020308 | Ga0373942_0020308_971_1450 | 157 |
| 386 | 3300035242 | Ga0373962_0184121 | Ga0373962_0184121_23_502 | 157 |
| 387 | 3300035410 | Ga0373924_0012279 | Ga0373924_0012279_520_999 | 157 |
| 388 | 3300035691 | Ga0373931_0009215 | Ga0373931_0009215_2612_3091 | 157 |
| 389 | 3300035692 | Ga0373935_0004359 | Ga0373935_0004359_5943_6422 | 157 |
| 390 | 3300035692 | Ga0373935_0039125 | Ga0373935_0039125_2383_2862 | 157 |
| 391 | 3300035695 | Ga0373927_0001355 | Ga0373927_0001355_10524_11003 | 157 |
| 392 | 3300035695 | Ga0373927_0045993 | Ga0373927_0045993_2143_2622 | 157 |
| 393 | 3300035724 | Ga0373933_0018935 | Ga0373933_0018935_1952_2431 | 157 |
| 394 | 3300035724 | Ga0373933_0034929 | Ga0373933_0034929_673_1152 | 157 |
| 395 | 3300035725 | Ga0373947_0000887 | Ga0373947_0000887_10524_11003 | 157 |
| 396 | 3300035725 | Ga0373947_0060518 | Ga0373947_0060518_451_930 | 157 |
| 397 | 3300035725 | Ga0373947_0136608 | Ga0373947_0136608_619_1098 | 157 |
| 398 | 3300036401 | Ga0373937_0012529 | Ga0373937_0012529_2836_3315 | 157 |
| 399 | 3300036401 | Ga0373937_0094505 | Ga0373937_0094505_1982_2461 | 157 |
| 400 | 3300036401 | Ga0373937_0123048 | Ga0373937_0123048_130_609 | 157 |
| 401 | 3300036401 | Ga0373937_0414883 | Ga0373937_0414883_87_566 | 157 |
| 402 | 3300036459 | Ga0372808_025407 | Ga0372808_025407_166_645 | 157 |
| 403 | 3300037068 | Ga0373925_0012546 | Ga0373925_0012546_4650_5129 | 157 |
| 404 | 3300037068 | Ga0373925_0025268 | Ga0373925_0025268_3169_3648 | 157 |
| 405 | 3300037068 | Ga0373925_0248399 | Ga0373925_0248399_116_595 | 157 |
| 406 | 3300037853 | Ga0436364_0166036 | Ga0436364_0166036_1140_1619 | 157 |
| 407 | 3300037853 | Ga0436364_0340069 | Ga0436364_0340069_65_544 | 157 |
| 408 | 3300037853 | Ga0436364_0356204 | Ga0436364_0356204_274_753 | 157 |
| 409 | 3300037853 | Ga0436364_0976891 | Ga0436364_0976891_450_932 | 157 |
| 410 | 3300039437 | Ga0436365_1421416 | Ga0436365_1421416_16_495 | 157 |
| 411 | 3300039438 | Ga0436360_0236768 | Ga0436360_0236768_205_684 | 157 |
| 412 | 3300039438 | Ga0436360_0274104 | Ga0436360_0274104_131_610 | 157 |
| 413 | 3300039447 | Ga0436361_0046152 | Ga0436361_0046152_89_568 | 157 |
| 414 | 3300039450 | Ga0436363_0426389 | Ga0436363_0426389_477_956 | 157 |
| 415 | 3300039450 | Ga0436363_1570653 | Ga0436363_1570653_1188_1667 | 157 |
| 416 | 3300039453 | Ga0436362_1292336 | Ga0436362_1292336_188_667 | 157 |
| 417 | 3300041486 | Ga0451807_1543669 | Ga0451807_1543669_109_588 | 157 |
| 418 | 3300044694 | Ga0466963_0028605 | Ga0466963_0028605_1186_1665 | 157 |
| 419 | 3300044706 | Ga0466964_0396070 | Ga0466964_0396070_123_602 | 157 |
| 420 | 3300045049 | Ga0466959_0758306 | Ga0466959_0758306_153_632 | 157 |
| 421 | 3300045836 | Ga0466958_0308253 | Ga0466958_0308253_101_580 | 157 |
| 422 | 3300045976 | Ga0466967_0011974 | Ga0466967_0011974_4754_5233 | 157 |
| 423 | 3300045976 | Ga0466967_0689780 | Ga0466967_0689780_288_770 | 157 |
| 424 | 3300046454 | Ga0495592_0013789 | Ga0495592_0013789_4419_4901 | 157 |
| 425 | 3300046454 | Ga0495592_0021680 | Ga0495592_0021680_1980_2492 | 157 |
| 426 | 3300046454 | Ga0495592_0162390 | Ga0495592_0162390_937_1416 | 157 |
| 427 | 3300046454 | Ga0495592_0185555 | Ga0495592_0185555_805_1284 | 157 |
| 428 | 3300046455 | Ga0495603_0003763 | Ga0495603_0003763_5886_6365 | 157 |
| 429 | 3300046455 | Ga0495603_0131380 | Ga0495603_0131380_52_534 | 157 |
| 430 | 3300046459 | Ga0495629_0002692 | Ga0495629_0002692_5976_6455 | 157 |
| 431 | 3300046459 | Ga0495629_0008361 | Ga0495629_0008361_5612_6094 | 157 |
| 432 | 3300046459 | Ga0495629_0330914 | Ga0495629_0330914_221_700 | 157 |
| 433 | 3300046461 | Ga0495641_0009687 | Ga0495641_0009687_3227_3706 | 157 |
| 434 | 3300046461 | Ga0495641_0024612 | Ga0495641_0024612_435_914 | 157 |
| 435 | 3300046462 | Ga0495651_0002577 | Ga0495651_0002577_8249_8761 | 157 |
| 436 | 3300046462 | Ga0495651_0014489 | Ga0495651_0014489_5482_5964 | 157 |
| 437 | 3300046462 | Ga0495651_0049806 | Ga0495651_0049806_1554_2033 | 157 |
| 438 | 3300046462 | Ga0495651_0053092 | Ga0495651_0053092_794_1273 | 157 |
| 439 | 3300046462 | Ga0495651_0139162 | Ga0495651_0139162_668_1147 | 157 |
| 440 | 3300046462 | Ga0495651_0147922 | Ga0495651_0147922_176_655 | 157 |
| 441 | 3300046463 | Ga0495653_0004910 | Ga0495653_0004910_8228_8707 | 157 |
| 442 | 3300046463 | Ga0495653_0009521 | Ga0495653_0009521_5649_6161 | 157 |
| 443 | 3300046463 | Ga0495653_0015160 | Ga0495653_0015160_393_872 | 157 |
| 444 | 3300046463 | Ga0495653_0066028 | Ga0495653_0066028_1663_2142 | 157 |
| 445 | 3300046472 | Ga0495580_0001943 | Ga0495580_0001943_15049_15561 | 157 |
| 446 | 3300046472 | Ga0495580_0026504 | Ga0495580_0026504_1912_2391 | 157 |
| 447 | 3300046473 | Ga0495582_0000741 | Ga0495582_0000741_11701_12180 | 157 |
| 448 | 3300046475 | Ga0495639_0002161 | Ga0495639_0002161_2183_2662 | 157 |
| 449 | 3300046475 | Ga0495639_0103628 | Ga0495639_0103628_683_1162 | 157 |
| 450 | 3300046476 | Ga0495662_0003402 | Ga0495662_0003402_5874_6386 | 157 |
| 451 | 3300046476 | Ga0495662_0037091 | Ga0495662_0037091_844_1326 | 157 |
| 452 | 3300046476 | Ga0495662_0066015 | Ga0495662_0066015_655_1134 | 157 |
| 453 | 3300046477 | Ga0495664_0000962 | Ga0495664_0000962_3029_3508 | 157 |
| 454 | 3300046477 | Ga0495664_0005505 | Ga0495664_0005505_5594_6106 | 157 |
| 455 | 3300046477 | Ga0495664_0013862 | Ga0495664_0013862_1909_2388 | 157 |
| 456 | 3300046477 | Ga0495664_0061339 | Ga0495664_0061339_1196_1669 | 157 |
| 457 | 3300046477 | Ga0495664_0112678 | Ga0495664_0112678_591_1073 | 157 |
| 458 | 3300046492 | Ga0495585_0009401 | Ga0495585_0009401_1648_2130 | 157 |
| 459 | 3300046499 | Ga0495594_0106393 | Ga0495594_0106393_660_1151 | 157 |
| 460 | 3300046511 | Ga0495608_0000475 | Ga0495608_0000475_7996_8508 | 157 |
| 461 | 3300046511 | Ga0495608_0021905 | Ga0495608_0021905_1782_2261 | 157 |
| 462 | 3300046511 | Ga0495608_0023637 | Ga0495608_0023637_3432_3911 | 157 |
| 463 | 3300046511 | Ga0495608_0109718 | Ga0495608_0109718_210_689 | 157 |
| 464 | 3300046514 | Ga0495618_0007301 | Ga0495618_0007301_668_1147 | 157 |
| 465 | 3300046514 | Ga0495618_0111160 | Ga0495618_0111160_689_1168 | 157 |
| 466 | 3300046516 | Ga0495628_0000710 | Ga0495628_0000710_29673_30185 | 157 |
| 467 | 3300046516 | Ga0495628_0011936 | Ga0495628_0011936_4666_5145 | 157 |
| 468 | 3300046516 | Ga0495628_0023600 | Ga0495628_0023600_932_1414 | 157 |
| 469 | 3300046516 | Ga0495628_0352775 | Ga0495628_0352775_148_627 | 157 |
| 470 | 3300046517 | Ga0495630_0001986 | Ga0495630_0001986_9800_10279 | 157 |
| 471 | 3300046517 | Ga0495630_0010159 | Ga0495630_0010159_1994_2473 | 157 |
| 472 | 3300046517 | Ga0495630_0110163 | Ga0495630_0110163_447_959 | 157 |
| 473 | 3300046517 | Ga0495630_0299668 | Ga0495630_0299668_158_637 | 157 |
| 474 | 3300046526 | Ga0495666_0002890 | Ga0495666_0002890_4663_5142 | 157 |
| 475 | 3300046526 | Ga0495666_0009938 | Ga0495666_0009938_3264_3776 | 157 |
| 476 | 3300046526 | Ga0495666_0066325 | Ga0495666_0066325_207_689 | 157 |
| 477 | 3300046529 | Ga0495652_0073721 | Ga0495652_0073721_2091_2570 | 157 |
| 478 | 3300046529 | Ga0495652_0120132 | Ga0495652_0120132_1226_1705 | 157 |
| 479 | 3300046529 | Ga0495652_0135059 | Ga0495652_0135059_629_1141 | 157 |
| 480 | 3300046529 | Ga0495652_0234635 | Ga0495652_0234635_733_1215 | 157 |
| 481 | 3300046529 | Ga0495652_0261247 | Ga0495652_0261247_298_777 | 157 |
| 482 | 3300046529 | Ga0495652_0393119 | Ga0495652_0393119_490_969 | 157 |
| 483 | 3300046529 | Ga0495652_0485286 | Ga0495652_0485286_100_579 | 157 |
| 484 | 3300046531 | Ga0495665_0000906 | Ga0495665_0000906_6673_7152 | 157 |
| 485 | 3300046531 | Ga0495665_0005660 | Ga0495665_0005660_4979_5491 | 157 |
| 486 | 3300046531 | Ga0495665_0090627 | Ga0495665_0090627_194_673 | 157 |
| 487 | 3300046533 | Ga0495640_0001961 | Ga0495640_0001961_12480_12959 | 157 |
| 488 | 3300046533 | Ga0495640_0002320 | Ga0495640_0002320_1923_2435 | 157 |
| 489 | 3300046533 | Ga0495640_0015848 | Ga0495640_0015848_1421_1903 | 157 |
| 490 | 3300046533 | Ga0495640_0024254 | Ga0495640_0024254_1760_2242 | 157 |
| 491 | 3300046533 | Ga0495640_0035145 | Ga0495640_0035145_996_1475 | 157 |
| 492 | 3300046535 | Ga0495586_0017357 | Ga0495586_0017357_3144_3656 | 157 |
| 493 | 3300046536 | Ga0495587_0038914 | Ga0495587_0038914_2316_2795 | 157 |
| 494 | 3300046536 | Ga0495587_0125953 | Ga0495587_0125953_746_1258 | 157 |
| 495 | 3300046536 | Ga0495587_0331419 | Ga0495587_0331419_230_709 | 157 |
| 496 | 3300046543 | Ga0495645_0003107 | Ga0495645_0003107_9246_9758 | 157 |
| 497 | 3300046543 | Ga0495645_0041548 | Ga0495645_0041548_966_1445 | 157 |
| 498 | 3300046543 | Ga0495645_0191232 | Ga0495645_0191232_668_1147 | 157 |
| 499 | 3300046557 | Ga0495622_0084844 | Ga0495622_0084844_605_1096 | 157 |
| 500 | 3300046557 | Ga0495622_0215087 | Ga0495622_0215087_24_503 | 157 |
| 501 | 3300046559 | Ga0495667_0010218 | Ga0495667_0010218_4781_5260 | 157 |
| 502 | 3300046559 | Ga0495667_0017248 | Ga0495667_0017248_393_872 | 157 |
| 503 | 3300046559 | Ga0495667_0101014 | Ga0495667_0101014_138_617 | 157 |
| 504 | 3300046559 | Ga0495667_0113481 | Ga0495667_0113481_401_883 | 157 |
| 505 | 3300046559 | Ga0495667_0175690 | Ga0495667_0175690_60_539 | 157 |
| 506 | 3300046642 | Ga0495634_0001381 | Ga0495634_0001381_11934_12416 | 157 |
| 507 | 3300046642 | Ga0495634_0014605 | Ga0495634_0014605_4690_5169 | 157 |
| 508 | 3300046642 | Ga0495634_0026394 | Ga0495634_0026394_381_860 | 157 |
| 509 | 3300046642 | Ga0495634_0069780 | Ga0495634_0069780_807_1319 | 157 |
| 510 | 3300046663 | Ga0495635_0006651 | Ga0495635_0006651_6708_7187 | 157 |
| 511 | 3300046663 | Ga0495635_0015815 | Ga0495635_0015815_652_1131 | 157 |
| 512 | 3300046663 | Ga0495635_0149885 | Ga0495635_0149885_447_959 | 157 |
| 513 | 3300046663 | Ga0495635_0179437 | Ga0495635_0179437_668_1147 | 157 |
| 514 | 3300046663 | Ga0495635_0343008 | Ga0495635_0343008_98_580 | 157 |
| 515 | 3300046675 | Ga0495657_0004900 | Ga0495657_0004900_3879_4361 | 157 |
| 516 | 3300046675 | Ga0495657_0006131 | Ga0495657_0006131_5522_6034 | 157 |
| 517 | 3300046675 | Ga0495657_0052689 | Ga0495657_0052689_203_682 | 157 |
| 518 | 3300046675 | Ga0495657_0227433 | Ga0495657_0227433_275_754 | 157 |
| 519 | 3300046678 | Ga0495599_0043602 | Ga0495599_0043602_2183_2662 | 157 |
| 520 | 3300046678 | Ga0495599_0046263 | Ga0495599_0046263_1369_1881 | 157 |
| 521 | 3300046678 | Ga0495599_0269375 | Ga0495599_0269375_189_668 | 157 |
| 522 | 3300046679 | Ga0495623_0006609 | Ga0495623_0006609_3522_4034 | 157 |
| 523 | 3300046679 | Ga0495623_0071154 | Ga0495623_0071154_488_967 | 157 |
| 524 | 3300046679 | Ga0495623_0099589 | Ga0495623_0099589_1137_1616 | 157 |
| 525 | 3300046679 | Ga0495623_0298636 | Ga0495623_0298636_307_789 | 157 |
| 526 | 3300046680 | Ga0495646_0025299 | Ga0495646_0025299_1678_2190 | 157 |
| 527 | 3300046680 | Ga0495646_0049198 | Ga0495646_0049198_1717_2196 | 157 |
| 528 | 3300046680 | Ga0495646_0050920 | Ga0495646_0050920_248_727 | 157 |
| 529 | 3300046689 | Ga0495613_0001650 | Ga0495613_0001650_4679_5158 | 157 |
| 530 | 3300046689 | Ga0495613_0006019 | Ga0495613_0006019_2690_3202 | 157 |
| 531 | 3300046689 | Ga0495613_0010656 | Ga0495613_0010656_5788_6270 | 157 |
| 532 | 3300046690 | Ga0495624_0011180 | Ga0495624_0011180_1226_1705 | 157 |
| 533 | 3300046690 | Ga0495624_0014743 | Ga0495624_0014743_2823_3302 | 157 |
| 534 | 3300046690 | Ga0495624_0016185 | Ga0495624_0016185_2319_2801 | 157 |
| 535 | 3300046809 | Ga0495600_0004713 | Ga0495600_0004713_1686_2168 | 157 |
| 536 | 3300046809 | Ga0495600_0014003 | Ga0495600_0014003_1980_2492 | 157 |
| 537 | 3300046809 | Ga0495600_0356478 | Ga0495600_0356478_189_668 | 157 |
| 538 | 3300047315 | Ga0495581_0000263 | Ga0495581_0000263_20110_20589 | 157 |
| 539 | 3300047315 | Ga0495581_0012356 | Ga0495581_0012356_2658_3137 | 157 |
| 540 | 3300047315 | Ga0495581_0020955 | Ga0495581_0020955_2571_3083 | 157 |
| 541 | 3300047315 | Ga0495581_0082847 | Ga0495581_0082847_78_560 | 157 |
| 542 | 3300047315 | Ga0495581_0134718 | Ga0495581_0134718_824_1303 | 157 |
| 543 | 3300047317 | Ga0495604_0000228 | Ga0495604_0000228_38517_39029 | 157 |
| 544 | 3300047317 | Ga0495604_0017033 | Ga0495604_0017033_570_1049 | 157 |
| 545 | 3300047317 | Ga0495604_0253569 | Ga0495604_0253569_321_803 | 157 |
| 546 | 3300047317 | Ga0495604_0282355 | Ga0495604_0282355_436_915 | 157 |
| 547 | 3300047319 | Ga0495674_0002634 | Ga0495674_0002634_6188_6667 | 157 |
| 548 | 3300047319 | Ga0495674_0033876 | Ga0495674_0033876_2561_3073 | 157 |
| 549 | 3300047319 | Ga0495674_0270382 | Ga0495674_0270382_668_1147 | 157 |
| 550 | 3300047321 | Ga0495676_0000613 | Ga0495676_0000613_13040_13522 | 157 |
| 551 | 3300047321 | Ga0495676_0001584 | Ga0495676_0001584_10588_11067 | 157 |
| 552 | 3300047321 | Ga0495676_0012085 | Ga0495676_0012085_3381_3860 | 157 |
| 553 | 3300047321 | Ga0495676_0790651 | Ga0495676_0790651_46_525 | 157 |
| 554 | 3300047322 | Ga0495680_0008276 | Ga0495680_0008276_1619_2098 | 157 |
| 555 | 3300047322 | Ga0495680_0040434 | Ga0495680_0040434_705_1184 | 157 |
| 556 | 3300047322 | Ga0495680_0051429 | Ga0495680_0051429_616_1095 | 157 |
| 557 | 3300047322 | Ga0495680_0191237 | Ga0495680_0191237_971_1450 | 157 |
| 558 | 3300047444 | Ga0495675_0060131 | Ga0495675_0060131_1593_2072 | 157 |
| 559 | 3300047444 | Ga0495675_0135897 | Ga0495675_0135897_208_720 | 157 |
| 560 | 3300047444 | Ga0495675_0146715 | Ga0495675_0146715_242_724 | 157 |
| 561 | 3300047471 | Ga0495684_0015310 | Ga0495684_0015310_393_872 | 157 |
| 562 | 3300047471 | Ga0495684_0056280 | Ga0495684_0056280_990_1502 | 157 |
| 563 | 3300047471 | Ga0495684_0064161 | Ga0495684_0064161_2179_2658 | 157 |
| 564 | 3300047471 | Ga0495684_0096501 | Ga0495684_0096501_832_1311 | 157 |
| 565 | 3300047673 | Ga0495593_0007464 | Ga0495593_0007464_1448_1927 | 157 |
| 566 | 3300047673 | Ga0495593_0040376 | Ga0495593_0040376_574_1086 | 157 |
| 567 | 3300047673 | Ga0495593_0202988 | Ga0495593_0202988_403_885 | 157 |
| 568 | 3300048088 | Ga0495602_0044808 | Ga0495602_0044808_807_1319 | 157 |
| 569 | 3300048088 | Ga0495602_0269791 | Ga0495602_0269791_439_918 | 157 |
| 570 | 3300048088 | Ga0495602_0279117 | Ga0495602_0279117_423_902 | 157 |
| 571 | 3300048088 | Ga0495602_0553144 | Ga0495602_0553144_246_728 | 157 |
| 572 | 3300048088 | Ga0495602_0608770 | Ga0495602_0608770_196_675 | 157 |
| 573 | 3300048089 | Ga0495614_0035816 | Ga0495614_0035816_322_801 | 157 |
| 574 | 3300048089 | Ga0495614_0227931 | Ga0495614_0227931_107_589 | 157 |
| 575 | 3300048903 | Ga0496100_0297862 | Ga0496100_0297862_14_493 | 157 |
| 576 | 3300048906 | Ga0496103_0244855 | Ga0496103_0244855_649_1128 | 157 |
| 577 | 3300048907 | Ga0496104_0136698 | Ga0496104_0136698_1325_1804 | 157 |
| 578 | 3300048908 | Ga0496105_1275542 | Ga0496105_1275542_19_498 | 157 |
| 579 | 3300048910 | Ga0496107_0330815 | Ga0496107_0330815_641_1120 | 157 |
| 580 | 3300048912 | Ga0496109_0093686 | Ga0496109_0093686_2192_2671 | 157 |
| 581 | 3300048913 | Ga0496110_0553753 | Ga0496110_0553753_21_500 | 157 |
| 582 | 3300048913 | Ga0496110_1480806 | Ga0496110_1480806_19_498 | 157 |
| 583 | 3300048914 | Ga0496111_0075883 | Ga0496111_0075883_1259_1738 | 157 |
| 584 | 3300048915 | Ga0496112_0605574 | Ga0496112_0605574_264_743 | 157 |
| 585 | 3300048915 | Ga0496112_0736702 | Ga0496112_0736702_381_860 | 157 |
| 586 | 3300048916 | Ga0496113_0168979 | Ga0496113_0168979_42_521 | 157 |
| 587 | 3300048916 | Ga0496113_0186014 | Ga0496113_0186014_217_696 | 157 |
| 588 | 3300048929 | Ga0496126_0590681 | Ga0496126_0590681_337_816 | 157 |
| 589 | 3300049568 | Ga0501031_0123880 | Ga0501031_0123880_545_1027 | 157 |
| 590 | 3300049569 | Ga0501032_0017443 | Ga0501032_0017443_4359_4841 | 157 |
| 591 | 3300049571 | Ga0501034_0325480 | Ga0501034_0325480_245_727 | 157 |
| 592 | 3300049571 | Ga0501034_0413550 | Ga0501034_0413550_558_1040 | 157 |
| 593 | 3300049572 | Ga0501036_0006789 | Ga0501036_0006789_7963_8445 | 157 |
| 594 | 3300049572 | Ga0501036_0432928 | Ga0501036_0432928_305_787 | 157 |
| 595 | 3300049573 | Ga0501037_0011775 | Ga0501037_0011775_5378_5860 | 157 |
| 596 | 3300049573 | Ga0501037_0253865 | Ga0501037_0253865_70_552 | 157 |
| 597 | 3300049574 | Ga0501038_0012653 | Ga0501038_0012653_6361_6843 | 157 |
| 598 | 3300049575 | Ga0501039_0055160 | Ga0501039_0055160_2415_2897 | 157 |
| 599 | 3300049575 | Ga0501039_0177907 | Ga0501039_0177907_1047_1529 | 157 |
| 600 | 3300049578 | Ga0501042_0222592 | Ga0501042_0222592_405_887 | 157 |
| 601 | 3300049579 | Ga0501043_0020604 | Ga0501043_0020604_2962_3444 | 157 |
| 602 | 3300049579 | Ga0501043_0172843 | Ga0501043_0172843_1193_1675 | 157 |
| 603 | 3300049580 | Ga0501046_0974236 | Ga0501046_0974236_33_515 | 157 |
| 604 | 3300049581 | Ga0501047_0000029 | Ga0501047_0000029_199691_200173 | 157 |
| 605 | 3300049581 | Ga0501047_0007463 | Ga0501047_0007463_1942_2424 | 157 |
| 606 | 3300049581 | Ga0501047_0136074 | Ga0501047_0136074_688_1170 | 157 |
| 607 | 3300049581 | Ga0501047_0764791 | Ga0501047_0764791_130_612 | 157 |
| 608 | 3300049742 | Ga0501080_0478862 | Ga0501080_0478862_292_774 | 157 |
| 609 | 3300049822 | Ga0501035_0042286 | Ga0501035_0042286_587_1069 | 157 |
| 610 | 3300049823 | Ga0501044_0116755 | Ga0501044_0116755_176_658 | 157 |
| 611 | 3300049823 | Ga0501044_0243058 | Ga0501044_0243058_621_1103 | 157 |
| 612 | 3300049823 | Ga0501044_1008791 | Ga0501044_1008791_61_558 | 157 |
| 613 | 3300049824 | Ga0501045_0138757 | Ga0501045_0138757_177_659 | 157 |
| 614 | 3300050512 | nmdc:mga0n895_628388_c1 | nmdc:mga0n895_628388_c1_52_531 | 157 |
| 615 | 3300050513 | nmdc:mga0rr50_138433_c1 | nmdc:mga0rr50_138433_c1_275_754 | 157 |
| 616 | 3300050513 | nmdc:mga0rr50_1558017_c1 | nmdc:mga0rr50_1558017_c1_14_493 | 157 |
| 617 | 3300050514 | nmdc:mga08x19_764773_c1 | nmdc:mga08x19_764773_c1_189_668 | 157 |
| 618 | 3300050514 | nmdc:mga08x19_931952_c1 | nmdc:mga08x19_931952_c1_85_564 | 157 |
| 619 | 3300053077 | Ga0495601_0006639 | Ga0495601_0006639_5256_5768 | 157 |
| 620 | 3300053077 | Ga0495601_0177030 | Ga0495601_0177030_668_1147 | 157 |
| 621 | 3300053078 | Ga0495612_0004279 | Ga0495612_0004279_4910_5389 | 157 |
| 622 | 3300053084 | Ga0495595_0148021 | Ga0495595_0148021_647_1126 | 157 |
| 623 | 3300053085 | Ga0495619_0003141 | Ga0495619_0003141_2244_2723 | 157 |
| 624 | 3300053140 | Ga0500573_0087578 | Ga0500573_0087578_1189_1701 | 157 |
| 625 | 3300053140 | Ga0500573_0135994 | Ga0500573_0135994_315_794 | 157 |
| 626 | 3300059503 | Ga0587080_067915 | Ga0587080_067915_106_585 | 157 |
| 627 | 3300059511 | Ga0587091_151974 | Ga0587091_151974_65_538 | 157 |
| 628 | iso_pu_bacteria | 2873314349 | 2873320643 | 157 |
| 629 | iso_pu_bacteria | 2935390628 | 2935391912 | 157 |
| 630 | iso_pu_bacteria | 8055066027 | 8055072426 | 157 |
| 631 | iso_pu_bacteria | 8055172936 | 8055178588 | 157 |
| 632 | 3300002075 | JGI24738J21930_10008412 | JGI24738J21930_100084124 | 158 |
| 633 | 3300003300 | Ga0006758J48902_1016282 | Ga0006758J48902_10162821 | 158 |
| 634 | 3300003308 | Ga0006777J48905_1014226 | Ga0006777J48905_10142261 | 158 |
| 635 | 3300003316 | rootH1_10005406 | rootH1_100054065 | 158 |
| 636 | 3300003316 | rootH1_10035274 | rootH1_100352742 | 158 |
| 637 | 3300003320 | rootH2_10018527 | rootH2_100185274 | 158 |
| 638 | 3300003323 | rootH1_10091099 | rootH1_100910994 | 158 |
| 639 | 3300003354 | JGI25160J50197_1024881 | JGI25160J50197_10248812 | 158 |
| 640 | 3300003354 | JGI25160J50197_1032890 | JGI25160J50197_10328902 | 158 |
| 641 | 3300003579 | Ga0007429J51699_1022096 | Ga0007429J51699_10220961 | 158 |
| 642 | 3300004800 | Ga0058861_12008866 | Ga0058861_120088661 | 158 |
| 643 | 3300005347 | Ga0070668_100285973 | Ga0070668_1002859732 | 158 |
| 644 | 3300005366 | Ga0070659_100908527 | Ga0070659_1009085271 | 158 |
| 645 | 3300005434 | Ga0070709_10025748 | Ga0070709_100257481 | 158 |
| 646 | 3300005435 | Ga0070714_100109541 | Ga0070714_1001095412 | 158 |
| 647 | 3300005435 | Ga0070714_100523069 | Ga0070714_1005230691 | 158 |
| 648 | 3300005437 | Ga0070710_10104590 | Ga0070710_101045902 | 158 |
| 649 | 3300005439 | Ga0070711_100113640 | Ga0070711_1001136403 | 158 |
| 650 | 3300005467 | Ga0070706_100541154 | Ga0070706_1005411542 | 158 |
| 651 | 3300005468 | Ga0070707_100012429 | Ga0070707_1000124292 | 158 |
| 652 | 3300005471 | Ga0070698_100001201 | Ga0070698_10000120115 | 158 |
| 653 | 3300005471 | Ga0070698_100466314 | Ga0070698_1004663142 | 158 |
| 654 | 3300005535 | Ga0070684_101046713 | Ga0070684_1010467131 | 158 |
| 655 | 3300005543 | Ga0070672_101586958 | Ga0070672_1015869581 | 158 |
| 656 | 3300005548 | Ga0070665_100343290 | Ga0070665_1003432902 | 158 |
| 657 | 3300005614 | Ga0068856_100069718 | Ga0068856_1000697183 | 158 |
| 658 | 3300005614 | Ga0068856_100182712 | Ga0068856_1001827123 | 158 |
| 659 | 3300005937 | Ga0081455_10124405 | Ga0081455_101244052 | 158 |
| 660 | 3300006028 | Ga0070717_10268281 | Ga0070717_102682812 | 158 |
| 661 | 3300006028 | Ga0070717_10481654 | Ga0070717_104816541 | 158 |
| 662 | 3300006042 | Ga0075368_10033951 | Ga0075368_100339513 | 158 |
| 663 | 3300006048 | Ga0075363_100249174 | Ga0075363_1002491742 | 158 |
| 664 | 3300006175 | Ga0070712_100284293 | Ga0070712_1002842931 | 158 |
| 665 | 3300006175 | Ga0070712_100692174 | Ga0070712_1006921742 | 158 |
| 666 | 3300007265 | Ga0099794_10337837 | Ga0099794_103378371 | 158 |
| 667 | 3300009011 | Ga0105251_10073150 | Ga0105251_100731502 | 158 |
| 668 | 3300009036 | Ga0105244_10285605 | Ga0105244_102856052 | 158 |
| 669 | 3300009092 | Ga0105250_10045640 | Ga0105250_100456403 | 158 |
| 670 | 3300009101 | Ga0105247_10797995 | Ga0105247_107979951 | 158 |
| 671 | 3300009993 | Ga0105028_129068 | Ga0105028_1290681 | 158 |
| 672 | 3300010375 | Ga0105239_11418126 | Ga0105239_114181261 | 158 |
| 673 | 3300011119 | Ga0105246_10006671 | Ga0105246_100066713 | 158 |
| 674 | 3300011119 | Ga0105246_10891373 | Ga0105246_108913732 | 158 |
| 675 | 3300013105 | Ga0157369_10034777 | Ga0157369_100347773 | 158 |
| 676 | 3300013105 | Ga0157369_10175083 | Ga0157369_101750833 | 158 |
| 677 | 3300013307 | Ga0157372_10371645 | Ga0157372_103716452 | 158 |
| 678 | 3300014497 | Ga0182008_10001523 | Ga0182008_1000152314 | 158 |
| 679 | 3300015261 | Ga0182006_1024939 | Ga0182006_10249393 | 158 |
| 680 | 3300015262 | Ga0182007_10005632 | Ga0182007_100056324 | 158 |
| 681 | 3300015265 | Ga0182005_1017915 | Ga0182005_10179152 | 158 |
| 682 | 3300015688 | Ga0183367_1002 | Ga0183367_100250 | 158 |
| 683 | 3300020069 | Ga0197907_11416890 | Ga0197907_114168902 | 158 |
| 684 | 3300020070 | Ga0206356_11359384 | Ga0206356_113593841 | 158 |
| 685 | 3300020077 | Ga0206351_10861184 | Ga0206351_108611841 | 158 |
| 686 | 3300020078 | Ga0206352_10879267 | Ga0206352_108792672 | 158 |
| 687 | 3300020080 | Ga0206350_10981988 | Ga0206350_109819881 | 158 |
| 688 | 3300020082 | Ga0206353_10730323 | Ga0206353_107303232 | 158 |
| 689 | 3300020610 | Ga0154015_1480972 | Ga0154015_14809721 | 158 |
| 690 | 3300021388 | Ga0213875_10002694 | Ga0213875_100026944 | 158 |
| 691 | 3300021388 | Ga0213875_10003336 | Ga0213875_100033366 | 158 |
| 692 | 3300021388 | Ga0213875_10022923 | Ga0213875_100229233 | 158 |
| 693 | 3300022467 | Ga0224712_10445971 | Ga0224712_104459711 | 158 |
| 694 | 3300025297 | Ga0209758_1002043 | Ga0209758_100204313 | 158 |
| 695 | 3300025302 | Ga0207426_1002336 | Ga0207426_10023362 | 158 |
| 696 | 3300025302 | Ga0207426_1007124 | Ga0207426_10071243 | 158 |
| 697 | 3300025302 | Ga0207426_1029138 | Ga0207426_10291382 | 158 |
| 698 | 3300025302 | Ga0207426_1068987 | Ga0207426_10689871 | 158 |
| 699 | 3300025728 | Ga0207655_1179439 | Ga0207655_11794391 | 158 |
| 700 | 3300025735 | Ga0207713_1038278 | Ga0207713_10382782 | 158 |
| 701 | 3300025898 | Ga0207692_10845615 | Ga0207692_108456151 | 158 |
| 702 | 3300025904 | Ga0207647_10006463 | Ga0207647_100064639 | 158 |
| 703 | 3300025906 | Ga0207699_10009261 | Ga0207699_100092614 | 158 |
| 704 | 3300025910 | Ga0207684_10618009 | Ga0207684_106180091 | 158 |
| 705 | 3300025915 | Ga0207693_10346259 | Ga0207693_103462592 | 158 |
| 706 | 3300025916 | Ga0207663_10008261 | Ga0207663_100082613 | 158 |
| 707 | 3300025922 | Ga0207646_10042204 | Ga0207646_100422043 | 158 |
| 708 | 3300025929 | Ga0207664_10049825 | Ga0207664_100498251 | 158 |
| 709 | 3300025932 | Ga0207690_10602544 | Ga0207690_106025441 | 158 |
| 710 | 3300025935 | Ga0207709_10034710 | Ga0207709_100347104 | 158 |
| 711 | 3300025939 | Ga0207665_10037081 | Ga0207665_100370812 | 158 |
| 712 | 3300025940 | Ga0207691_10112106 | Ga0207691_101121062 | 158 |
| 713 | 3300025949 | Ga0207667_10681492 | Ga0207667_106814921 | 158 |
| 714 | 3300026041 | Ga0207639_10117241 | Ga0207639_101172413 | 158 |
| 715 | 3300026067 | Ga0207678_11124097 | Ga0207678_111240971 | 158 |
| 716 | 3300026078 | Ga0207702_10479286 | Ga0207702_104792861 | 158 |
| 717 | 3300027312 | Ga0209371_1022012 | Ga0209371_10220122 | 158 |
| 718 | 3300027312 | Ga0209371_1046036 | Ga0209371_10460361 | 158 |
| 719 | 3300027866 | Ga0209813_10009115 | Ga0209813_100091153 | 158 |
| 720 | 3300028379 | Ga0268266_10387713 | Ga0268266_103877132 | 158 |
| 721 | 3300028786 | Ga0307517_10006432 | Ga0307517_100064326 | 158 |
| 722 | 3300028786 | Ga0307517_10013995 | Ga0307517_100139956 | 158 |
| 723 | 3300028794 | Ga0307515_10019441 | Ga0307515_100194414 | 158 |
| 724 | 3300028794 | Ga0307515_10054034 | Ga0307515_100540346 | 158 |
| 725 | 3300028800 | Ga0265338_10038691 | Ga0265338_100386915 | 158 |
| 726 | 3300030500 | Ga0268256_1024711 | Ga0268256_10247112 | 158 |
| 727 | 3300030500 | Ga0268256_1044065 | Ga0268256_10440651 | 158 |
| 728 | 3300030521 | Ga0307511_10002529 | Ga0307511_1000252916 | 158 |
| 729 | 3300030521 | Ga0307511_10062255 | Ga0307511_100622553 | 158 |
| 730 | 3300030521 | Ga0307511_10156723 | Ga0307511_101567232 | 158 |
| 731 | 3300030522 | Ga0307512_10018157 | Ga0307512_100181576 | 158 |
| 732 | 3300030522 | Ga0307512_10035855 | Ga0307512_100358554 | 158 |
| 733 | 3300031456 | Ga0307513_10017315 | Ga0307513_100173158 | 158 |
| 734 | 3300031456 | Ga0307513_10123568 | Ga0307513_101235682 | 158 |
| 735 | 3300031507 | Ga0307509_10020553 | Ga0307509_100205535 | 158 |
| 736 | 3300031507 | Ga0307509_10111935 | Ga0307509_101119352 | 158 |
| 737 | 3300031616 | Ga0307508_10021810 | Ga0307508_100218104 | 158 |
| 738 | 3300031616 | Ga0307508_10041733 | Ga0307508_100417335 | 158 |
| 739 | 3300031616 | Ga0307508_10048027 | Ga0307508_100480274 | 158 |
| 740 | 3300031616 | Ga0307508_10171956 | Ga0307508_101719563 | 158 |
| 741 | 3300031616 | Ga0307508_10215710 | Ga0307508_102157102 | 158 |
| 742 | 3300031616 | Ga0307508_10351689 | Ga0307508_103516892 | 158 |
| 743 | 3300031649 | Ga0307514_10017130 | Ga0307514_100171304 | 158 |
| 744 | 3300031649 | Ga0307514_10034987 | Ga0307514_100349873 | 158 |
| 745 | 3300031649 | Ga0307514_10115479 | Ga0307514_101154793 | 158 |
| 746 | 3300031649 | Ga0307514_10180619 | Ga0307514_101806192 | 158 |
| 747 | 3300031730 | Ga0307516_10001694 | Ga0307516_1000169412 | 158 |
| 748 | 3300031730 | Ga0307516_10069325 | Ga0307516_100693254 | 158 |
| 749 | 3300031730 | Ga0307516_10259869 | Ga0307516_102598691 | 158 |
| 750 | 3300031838 | Ga0307518_10234128 | Ga0307518_102341282 | 158 |
| 751 | 3300031838 | Ga0307518_10267199 | Ga0307518_102671992 | 158 |
| 752 | 3300031995 | Ga0307409_101042037 | Ga0307409_1010420372 | 158 |
| 753 | 3300032002 | Ga0307416_102577154 | Ga0307416_1025771541 | 158 |
| 754 | 3300033179 | Ga0307507_10065610 | Ga0307507_100656103 | 158 |
| 755 | 3300033179 | Ga0307507_10094796 | Ga0307507_100947963 | 158 |
| 756 | 3300033180 | Ga0307510_10047845 | Ga0307510_100478454 | 158 |
| 757 | 3300033180 | Ga0307510_10075253 | Ga0307510_100752533 | 158 |
| 758 | 3300033180 | Ga0307510_10414676 | Ga0307510_104146761 | 158 |
| 759 | 3300035111 | Ga0373923_0015531 | Ga0373923_0015531_2013_2516 | 158 |
| 760 | 3300035117 | Ga0373953_0064125 | Ga0373953_0064125_63_566 | 158 |
| 761 | 3300035118 | Ga0373954_0017279 | Ga0373954_0017279_2400_2903 | 158 |
| 762 | 3300035119 | Ga0373956_0003365 | Ga0373956_0003365_3707_4210 | 158 |
| 763 | 3300035120 | Ga0373957_0019021 | Ga0373957_0019021_217_720 | 158 |
| 764 | 3300035172 | Ga0373955_0135427 | Ga0373955_0135427_575_1078 | 158 |
| 765 | 3300035410 | Ga0373924_0035196 | Ga0373924_0035196_641_1144 | 158 |
| 766 | 3300035724 | Ga0373933_0431084 | Ga0373933_0431084_275_778 | 158 |
| 767 | 3300035725 | Ga0373947_0419450 | Ga0373947_0419450_326_829 | 158 |
| 768 | 3300036401 | Ga0373937_0128069 | Ga0373937_0128069_676_1179 | 158 |
| 769 | 3300037418 | Ga0395900_0493198 | Ga0395900_0493198_567_1043 | 158 |
| 770 | 3300037466 | Ga0395898_0005934 | Ga0395898_0005934_2779_3255 | 158 |
| 771 | 3300037466 | Ga0395898_0029812 | Ga0395898_0029812_2784_3260 | 158 |
| 772 | 3300037466 | Ga0395898_1085852 | Ga0395898_1085852_17_493 | 158 |
| 773 | 3300037853 | Ga0436364_0321419 | Ga0436364_0321419_1350_1853 | 158 |
| 774 | 3300037853 | Ga0436364_0584067 | Ga0436364_0584067_146730_147236 | 158 |
| 775 | 3300037853 | Ga0436364_0667270 | Ga0436364_0667270_123655_124158 | 158 |
| 776 | 3300037853 | Ga0436364_0894301 | Ga0436364_0894301_3464_3940 | 158 |
| 777 | 3300038443 | Ga0395901_0004321 | Ga0395901_0004321_4886_5362 | 158 |
| 778 | 3300039450 | Ga0436363_1443462 | Ga0436363_1443462_281_784 | 158 |
| 779 | 3300041404 | Ga0439436_0012288 | Ga0439436_0012288_2038_2514 | 158 |
| 780 | 3300041404 | Ga0439436_0019687 | Ga0439436_0019687_1314_1790 | 158 |
| 781 | 3300041406 | Ga0439439_0001796 | Ga0439439_0001796_1592_2068 | 158 |
| 782 | 3300041441 | Ga0451787_359134 | Ga0451787_359134_107_583 | 158 |
| 783 | 3300041460 | Ga0451802_1987063 | Ga0451802_1987063_398_874 | 158 |
| 784 | 3300041463 | Ga0451804_0436132 | Ga0451804_0436132_148_624 | 158 |
| 785 | 3300041491 | Ga0451833_0239514 | Ga0451833_0239514_56_532 | 158 |
| 786 | 3300041494 | Ga0451837_0778280 | Ga0451837_0778280_552_1028 | 158 |
| 787 | 3300041498 | Ga0451841_0429692 | Ga0451841_0429692_882_1358 | 158 |
| 788 | 3300041501 | Ga0451845_0895553 | Ga0451845_0895553_184_660 | 158 |
| 789 | 3300041512 | Ga0451853_2320900 | Ga0451853_2320900_571_1047 | 158 |
| 790 | 3300041512 | Ga0451853_2374569 | Ga0451853_2374569_5272_5748 | 158 |
| 791 | 3300041512 | Ga0451853_2502482 | Ga0451853_2502482_47_523 | 158 |
| 792 | 3300041512 | Ga0451853_2847812 | Ga0451853_2847812_267_743 | 158 |
| 793 | 3300041999 | Ga0439433_0000279 | Ga0439433_0000279_5058_5534 | 158 |
| 794 | 3300042002 | Ga0439442_003766 | Ga0439442_003766_367_843 | 158 |
| 795 | 3300042005 | Ga0439448_0046552 | Ga0439448_0046552_256_732 | 158 |
| 796 | 3300042007 | Ga0439449_0047343 | Ga0439449_0047343_912_1388 | 158 |
| 797 | 3300042007 | Ga0439449_0101207 | Ga0439449_0101207_574_1050 | 158 |
| 798 | 3300042007 | Ga0439449_0121145 | Ga0439449_0121145_418_894 | 158 |
| 799 | 3300042008 | Ga0439450_063864 | Ga0439450_063864_381_857 | 158 |
| 800 | 3300042012 | Ga0439455_0039978 | Ga0439455_0039978_459_935 | 158 |
| 801 | 3300042014 | Ga0439457_000721 | Ga0439457_000721_6558_7034 | 158 |
| 802 | 3300042014 | Ga0439457_002443 | Ga0439457_002443_3239_3715 | 158 |
| 803 | 3300042014 | Ga0439457_045983 | Ga0439457_045983_376_852 | 158 |
| 804 | 3300042015 | Ga0439462_0002910 | Ga0439462_0002910_1945_2421 | 158 |
| 805 | 3300042122 | Ga0450920_044482 | Ga0450920_044482_166_642 | 158 |
| 806 | 3300042127 | Ga0450890_059547 | Ga0450890_059547_65_541 | 158 |
| 807 | 3300042134 | Ga0450898_013530 | Ga0450898_013530_774_1250 | 158 |
| 808 | 3300042135 | Ga0450899_000745 | Ga0450899_000745_3168_3644 | 158 |
| 809 | 3300042136 | Ga0450900_019218 | Ga0450900_019218_26_502 | 158 |
| 810 | 3300042138 | Ga0450903_001883 | Ga0450903_001883_1035_1511 | 158 |
| 811 | 3300042145 | Ga0450906_000226 | Ga0450906_000226_7808_8284 | 158 |
| 812 | 3300042157 | Ga0439458_0005506 | Ga0439458_0005506_68_544 | 158 |
| 813 | 3300042184 | Ga0450908_016280 | Ga0450908_016280_662_1138 | 158 |
| 814 | 3300044656 | Ga0466969_0002485 | Ga0466969_0002485_341_865 | 158 |
| 815 | 3300044656 | Ga0466969_0003241 | Ga0466969_0003241_6087_6617 | 158 |
| 816 | 3300044656 | Ga0466969_0050663 | Ga0466969_0050663_105_581 | 158 |
| 817 | 3300044656 | Ga0466969_0055615 | Ga0466969_0055615_124_618 | 158 |
| 818 | 3300044656 | Ga0466969_0404869 | Ga0466969_0404869_24_500 | 158 |
| 819 | 3300044658 | Ga0466972_0003351 | Ga0466972_0003351_5553_6029 | 158 |
| 820 | 3300044658 | Ga0466972_0017124 | Ga0466972_0017124_32_508 | 158 |
| 821 | 3300044658 | Ga0466972_0025927 | Ga0466972_0025927_1122_1598 | 158 |
| 822 | 3300044658 | Ga0466972_0193031 | Ga0466972_0193031_10_486 | 158 |
| 823 | 3300044658 | Ga0466972_0431652 | Ga0466972_0431652_122_598 | 158 |
| 824 | 3300044683 | Ga0466965_0109129 | Ga0466965_0109129_74_550 | 158 |
| 825 | 3300044684 | Ga0466966_0003158 | Ga0466966_0003158_4360_4890 | 158 |
| 826 | 3300044684 | Ga0466966_0006738 | Ga0466966_0006738_5164_5640 | 158 |
| 827 | 3300044684 | Ga0466966_0012255 | Ga0466966_0012255_5046_5540 | 158 |
| 828 | 3300044693 | Ga0466961_0024718 | Ga0466961_0024718_1048_1524 | 158 |
| 829 | 3300044693 | Ga0466961_0025584 | Ga0466961_0025584_3289_3765 | 158 |
| 830 | 3300044693 | Ga0466961_0037580 | Ga0466961_0037580_279_803 | 158 |
| 831 | 3300044693 | Ga0466961_0055353 | Ga0466961_0055353_679_1155 | 158 |
| 832 | 3300044694 | Ga0466963_0005506 | Ga0466963_0005506_3434_3910 | 158 |
| 833 | 3300044694 | Ga0466963_0025453 | Ga0466963_0025453_3260_3736 | 158 |
| 834 | 3300044706 | Ga0466964_0030772 | Ga0466964_0030772_10_486 | 158 |
| 835 | 3300044706 | Ga0466964_0067983 | Ga0466964_0067983_969_1445 | 158 |
| 836 | 3300044719 | Ga0466971_0001389 | Ga0466971_0001389_6402_6878 | 158 |
| 837 | 3300044719 | Ga0466971_0053086 | Ga0466971_0053086_164_640 | 158 |
| 838 | 3300044719 | Ga0466971_0054585 | Ga0466971_0054585_1180_1674 | 158 |
| 839 | 3300044735 | Ga0466968_0479983 | Ga0466968_0479983_22_498 | 158 |
| 840 | 3300044765 | Ga0466970_0002309 | Ga0466970_0002309_1364_1840 | 158 |
| 841 | 3300044765 | Ga0466970_0116074 | Ga0466970_0116074_870_1346 | 158 |
| 842 | 3300044765 | Ga0466970_0117800 | Ga0466970_0117800_749_1225 | 158 |
| 843 | 3300044842 | Ga0466957_0232532 | Ga0466957_0232532_196_690 | 158 |
| 844 | 3300044842 | Ga0466957_0337788 | Ga0466957_0337788_475_951 | 158 |
| 845 | 3300044901 | Ga0466960_0004566 | Ga0466960_0004566_1565_2041 | 158 |
| 846 | 3300044901 | Ga0466960_0180345 | Ga0466960_0180345_340_816 | 158 |
| 847 | 3300045049 | Ga0466959_0001895 | Ga0466959_0001895_2739_3233 | 158 |
| 848 | 3300045049 | Ga0466959_0003319 | Ga0466959_0003319_2621_3097 | 158 |
| 849 | 3300045049 | Ga0466959_0004806 | Ga0466959_0004806_6835_7365 | 158 |
| 850 | 3300045836 | Ga0466958_0070757 | Ga0466958_0070757_492_968 | 158 |
| 851 | 3300045836 | Ga0466958_0660370 | Ga0466958_0660370_152_646 | 158 |
| 852 | 3300045836 | Ga0466958_0784552 | Ga0466958_0784552_53_577 | 158 |
| 853 | 3300045836 | Ga0466958_0802254 | Ga0466958_0802254_88_564 | 158 |
| 854 | 3300045976 | Ga0466967_0025672 | Ga0466967_0025672_4209_4685 | 158 |
| 855 | 3300045976 | Ga0466967_0049282 | Ga0466967_0049282_2206_2682 | 158 |
| 856 | 3300045976 | Ga0466967_0664839 | Ga0466967_0664839_28_504 | 158 |
| 857 | 3300046452 | Ga0495617_214352 | Ga0495617_214352_46_522 | 158 |
| 858 | 3300046454 | Ga0495592_0017207 | Ga0495592_0017207_584_1060 | 158 |
| 859 | 3300046454 | Ga0495592_0064286 | Ga0495592_0064286_1393_1896 | 158 |
| 860 | 3300046455 | Ga0495603_0001170 | Ga0495603_0001170_9101_9577 | 158 |
| 861 | 3300046455 | Ga0495603_0001759 | Ga0495603_0001759_147_623 | 158 |
| 862 | 3300046455 | Ga0495603_0007613 | Ga0495603_0007613_3128_3604 | 158 |
| 863 | 3300046455 | Ga0495603_0138178 | Ga0495603_0138178_590_1114 | 158 |
| 864 | 3300046455 | Ga0495603_0212275 | Ga0495603_0212275_608_1084 | 158 |
| 865 | 3300046457 | Ga0495590_0024466 | Ga0495590_0024466_872_1348 | 158 |
| 866 | 3300046457 | Ga0495590_0161883 | Ga0495590_0161883_62_538 | 158 |
| 867 | 3300046459 | Ga0495629_0005448 | Ga0495629_0005448_7490_7966 | 158 |
| 868 | 3300046459 | Ga0495629_0008455 | Ga0495629_0008455_6372_6848 | 158 |
| 869 | 3300046459 | Ga0495629_0014435 | Ga0495629_0014435_1799_2275 | 158 |
| 870 | 3300046459 | Ga0495629_0032184 | Ga0495629_0032184_2033_2527 | 158 |
| 871 | 3300046459 | Ga0495629_0041614 | Ga0495629_0041614_675_1151 | 158 |
| 872 | 3300046459 | Ga0495629_0101167 | Ga0495629_0101167_1397_1873 | 158 |
| 873 | 3300046459 | Ga0495629_0156787 | Ga0495629_0156787_501_977 | 158 |
| 874 | 3300046459 | Ga0495629_0206749 | Ga0495629_0206749_441_917 | 158 |
| 875 | 3300046460 | Ga0495638_0095648 | Ga0495638_0095648_724_1200 | 158 |
| 876 | 3300046460 | Ga0495638_0247645 | Ga0495638_0247645_419_913 | 158 |
| 877 | 3300046462 | Ga0495651_0001653 | Ga0495651_0001653_2112_2588 | 158 |
| 878 | 3300046462 | Ga0495651_0040615 | Ga0495651_0040615_2047_2550 | 158 |
| 879 | 3300046463 | Ga0495653_0168432 | Ga0495653_0168432_361_864 | 158 |
| 880 | 3300046463 | Ga0495653_0414898 | Ga0495653_0414898_328_804 | 158 |
| 881 | 3300046471 | Ga0495650_0169531 | Ga0495650_0169531_275_751 | 158 |
| 882 | 3300046473 | Ga0495582_0105904 | Ga0495582_0105904_937_1413 | 158 |
| 883 | 3300046474 | Ga0495605_0008865 | Ga0495605_0008865_4189_4665 | 158 |
| 884 | 3300046476 | Ga0495662_0001192 | Ga0495662_0001192_6493_6969 | 158 |
| 885 | 3300046476 | Ga0495662_0045311 | Ga0495662_0045311_1095_1598 | 158 |
| 886 | 3300046476 | Ga0495662_0063821 | Ga0495662_0063821_274_750 | 158 |
| 887 | 3300046476 | Ga0495662_0077396 | Ga0495662_0077396_187_663 | 158 |
| 888 | 3300046476 | Ga0495662_0082165 | Ga0495662_0082165_832_1308 | 158 |
| 889 | 3300046476 | Ga0495662_0191117 | Ga0495662_0191117_79_594 | 158 |
| 890 | 3300046477 | Ga0495664_0000282 | Ga0495664_0000282_22835_23311 | 158 |
| 891 | 3300046477 | Ga0495664_0157756 | Ga0495664_0157756_483_986 | 158 |
| 892 | 3300046492 | Ga0495585_0182554 | Ga0495585_0182554_523_999 | 158 |
| 893 | 3300046492 | Ga0495585_0378970 | Ga0495585_0378970_28_504 | 158 |
| 894 | 3300046499 | Ga0495594_0002260 | Ga0495594_0002260_3366_3842 | 158 |
| 895 | 3300046499 | Ga0495594_0026432 | Ga0495594_0026432_1355_1831 | 158 |
| 896 | 3300046499 | Ga0495594_0046749 | Ga0495594_0046749_592_1068 | 158 |
| 897 | 3300046499 | Ga0495594_0058145 | Ga0495594_0058145_1166_1642 | 158 |
| 898 | 3300046500 | Ga0495596_0055282 | Ga0495596_0055282_205_681 | 158 |
| 899 | 3300046501 | Ga0495607_0021008 | Ga0495607_0021008_813_1289 | 158 |
| 900 | 3300046501 | Ga0495607_0069409 | Ga0495607_0069409_203_679 | 158 |
| 901 | 3300046501 | Ga0495607_0140903 | Ga0495607_0140903_662_1156 | 158 |
| 902 | 3300046506 | Ga0495583_0101987 | Ga0495583_0101987_732_1208 | 158 |
| 903 | 3300046507 | Ga0495606_0201596 | Ga0495606_0201596_180_656 | 158 |
| 904 | 3300046511 | Ga0495608_0050637 | Ga0495608_0050637_833_1336 | 158 |
| 905 | 3300046511 | Ga0495608_0313751 | Ga0495608_0313751_72_548 | 158 |
| 906 | 3300046512 | Ga0495610_0026281 | Ga0495610_0026281_1454_1930 | 158 |
| 907 | 3300046514 | Ga0495618_0107407 | Ga0495618_0107407_575_1078 | 158 |
| 908 | 3300046514 | Ga0495618_0107503 | Ga0495618_0107503_607_1083 | 158 |
| 909 | 3300046514 | Ga0495618_0123278 | Ga0495618_0123278_132_608 | 158 |
| 910 | 3300046515 | Ga0495620_0121679 | Ga0495620_0121679_502_978 | 158 |
| 911 | 3300046516 | Ga0495628_0040088 | Ga0495628_0040088_703_1179 | 158 |
| 912 | 3300046516 | Ga0495628_0125974 | Ga0495628_0125974_804_1280 | 158 |
| 913 | 3300046516 | Ga0495628_0517841 | Ga0495628_0517841_316_819 | 158 |
| 914 | 3300046517 | Ga0495630_0029888 | Ga0495630_0029888_3449_3925 | 158 |
| 915 | 3300046517 | Ga0495630_0058729 | Ga0495630_0058729_993_1496 | 158 |
| 916 | 3300046518 | Ga0495631_0003642 | Ga0495631_0003642_7231_7707 | 158 |
| 917 | 3300046518 | Ga0495631_0129231 | Ga0495631_0129231_514_990 | 158 |
| 918 | 3300046518 | Ga0495631_0212547 | Ga0495631_0212547_304_780 | 158 |
| 919 | 3300046520 | Ga0495637_0024557 | Ga0495637_0024557_2191_2667 | 158 |
| 920 | 3300046522 | Ga0495643_0001554 | Ga0495643_0001554_10749_11225 | 158 |
| 921 | 3300046522 | Ga0495643_0001610 | Ga0495643_0001610_15937_16431 | 158 |
| 922 | 3300046523 | Ga0495644_0334376 | Ga0495644_0334376_86_562 | 158 |
| 923 | 3300046524 | Ga0495648_0104390 | Ga0495648_0104390_872_1348 | 158 |
| 924 | 3300046526 | Ga0495666_0101342 | Ga0495666_0101342_440_916 | 158 |
| 925 | 3300046529 | Ga0495652_0115282 | Ga0495652_0115282_1542_2018 | 158 |
| 926 | 3300046530 | Ga0495654_0022533 | Ga0495654_0022533_1883_2359 | 158 |
| 927 | 3300046531 | Ga0495665_0460580 | Ga0495665_0460580_132_608 | 158 |
| 928 | 3300046533 | Ga0495640_0067264 | Ga0495640_0067264_1473_1949 | 158 |
| 929 | 3300046533 | Ga0495640_0115581 | Ga0495640_0115581_312_815 | 158 |
| 930 | 3300046533 | Ga0495640_0158249 | Ga0495640_0158249_703_1179 | 158 |
| 931 | 3300046535 | Ga0495586_0435644 | Ga0495586_0435644_221_724 | 158 |
| 932 | 3300046536 | Ga0495587_0003804 | Ga0495587_0003804_4944_5420 | 158 |
| 933 | 3300046536 | Ga0495587_0026748 | Ga0495587_0026748_2561_3064 | 158 |
| 934 | 3300046536 | Ga0495587_0055943 | Ga0495587_0055943_1354_1830 | 158 |
| 935 | 3300046538 | Ga0495609_0004574 | Ga0495609_0004574_6194_6670 | 158 |
| 936 | 3300046538 | Ga0495609_0058435 | Ga0495609_0058435_96_572 | 158 |
| 937 | 3300046542 | Ga0495597_0062272 | Ga0495597_0062272_377_853 | 158 |
| 938 | 3300046543 | Ga0495645_0040226 | Ga0495645_0040226_731_1252 | 158 |
| 939 | 3300046543 | Ga0495645_0040384 | Ga0495645_0040384_2230_2706 | 158 |
| 940 | 3300046543 | Ga0495645_0055725 | Ga0495645_0055725_2319_2822 | 158 |
| 941 | 3300046543 | Ga0495645_0102662 | Ga0495645_0102662_1479_1955 | 158 |
| 942 | 3300046557 | Ga0495622_0005508 | Ga0495622_0005508_3034_3510 | 158 |
| 943 | 3300046557 | Ga0495622_0374443 | Ga0495622_0374443_54_581 | 158 |
| 944 | 3300046558 | Ga0495633_0095427 | Ga0495633_0095427_413_889 | 158 |
| 945 | 3300046559 | Ga0495667_0089327 | Ga0495667_0089327_911_1414 | 158 |
| 946 | 3300046559 | Ga0495667_0136192 | Ga0495667_0136192_891_1367 | 158 |
| 947 | 3300046559 | Ga0495667_0209159 | Ga0495667_0209159_440_916 | 158 |
| 948 | 3300046559 | Ga0495667_0534015 | Ga0495667_0534015_19_495 | 158 |
| 949 | 3300046615 | Ga0495656_0266167 | Ga0495656_0266167_367_843 | 158 |
| 950 | 3300046615 | Ga0495656_0490228 | Ga0495656_0490228_35_529 | 158 |
| 951 | 3300046642 | Ga0495634_0015448 | Ga0495634_0015448_4911_5387 | 158 |
| 952 | 3300046642 | Ga0495634_0060612 | Ga0495634_0060612_488_991 | 158 |
| 953 | 3300046642 | Ga0495634_0066359 | Ga0495634_0066359_332_808 | 158 |
| 954 | 3300046642 | Ga0495634_0221785 | Ga0495634_0221785_163_657 | 158 |
| 955 | 3300046648 | Ga0495611_0028329 | Ga0495611_0028329_1344_1820 | 158 |
| 956 | 3300046648 | Ga0495611_0041868 | Ga0495611_0041868_781_1275 | 158 |
| 957 | 3300046660 | Ga0495625_0007829 | Ga0495625_0007829_5241_5717 | 158 |
| 958 | 3300046660 | Ga0495625_0018691 | Ga0495625_0018691_4043_4519 | 158 |
| 959 | 3300046660 | Ga0495625_0183510 | Ga0495625_0183510_77_553 | 158 |
| 960 | 3300046663 | Ga0495635_0026450 | Ga0495635_0026450_2247_2723 | 158 |
| 961 | 3300046663 | Ga0495635_0042810 | Ga0495635_0042810_311_814 | 158 |
| 962 | 3300046663 | Ga0495635_0143959 | Ga0495635_0143959_99_575 | 158 |
| 963 | 3300046663 | Ga0495635_0294182 | Ga0495635_0294182_300_776 | 158 |
| 964 | 3300046665 | Ga0495661_0163666 | Ga0495661_0163666_350_826 | 158 |
| 965 | 3300046674 | Ga0495588_0006288 | Ga0495588_0006288_2643_3119 | 158 |
| 966 | 3300046674 | Ga0495588_0019662 | Ga0495588_0019662_932_1408 | 158 |
| 967 | 3300046674 | Ga0495588_0119137 | Ga0495588_0119137_310_786 | 158 |
| 968 | 3300046674 | Ga0495588_0275311 | Ga0495588_0275311_394_870 | 158 |
| 969 | 3300046674 | Ga0495588_0361310 | Ga0495588_0361310_23_499 | 158 |
| 970 | 3300046674 | Ga0495588_0364185 | Ga0495588_0364185_93_569 | 158 |
| 971 | 3300046675 | Ga0495657_0002972 | Ga0495657_0002972_1323_1799 | 158 |
| 972 | 3300046675 | Ga0495657_0026711 | Ga0495657_0026711_48_551 | 158 |
| 973 | 3300046675 | Ga0495657_0050139 | Ga0495657_0050139_40_516 | 158 |
| 974 | 3300046675 | Ga0495657_0067834 | Ga0495657_0067834_1539_2015 | 158 |
| 975 | 3300046678 | Ga0495599_0035030 | Ga0495599_0035030_2557_3033 | 158 |
| 976 | 3300046679 | Ga0495623_0007559 | Ga0495623_0007559_3984_4499 | 158 |
| 977 | 3300046679 | Ga0495623_0063138 | Ga0495623_0063138_498_974 | 158 |
| 978 | 3300046679 | Ga0495623_0095716 | Ga0495623_0095716_408_911 | 158 |
| 979 | 3300046679 | Ga0495623_0222253 | Ga0495623_0222253_397_873 | 158 |
| 980 | 3300046680 | Ga0495646_0025806 | Ga0495646_0025806_1130_1606 | 158 |
| 981 | 3300046680 | Ga0495646_0078571 | Ga0495646_0078571_1055_1558 | 158 |
| 982 | 3300046680 | Ga0495646_0592601 | Ga0495646_0592601_63_539 | 158 |
| 983 | 3300046689 | Ga0495613_0007869 | Ga0495613_0007869_6368_6844 | 158 |
| 984 | 3300046689 | Ga0495613_0027108 | Ga0495613_0027108_2209_2685 | 158 |
| 985 | 3300046689 | Ga0495613_0036074 | Ga0495613_0036074_840_1316 | 158 |
| 986 | 3300046689 | Ga0495613_0046407 | Ga0495613_0046407_2436_2939 | 158 |
| 987 | 3300046689 | Ga0495613_0056515 | Ga0495613_0056515_1579_2055 | 158 |
| 988 | 3300046689 | Ga0495613_0941571 | Ga0495613_0941571_42_527 | 158 |
| 989 | 3300046690 | Ga0495624_0270769 | Ga0495624_0270769_67_570 | 158 |
| 990 | 3300046691 | Ga0495670_0009917 | Ga0495670_0009917_3243_3737 | 158 |
| 991 | 3300046692 | Ga0495671_0100925 | Ga0495671_0100925_740_1216 | 158 |
| 992 | 3300046692 | Ga0495671_0198778 | Ga0495671_0198778_178_654 | 158 |
| 993 | 3300046794 | Ga0495589_0023123 | Ga0495589_0023123_504_980 | 158 |
| 994 | 3300046794 | Ga0495589_0024656 | Ga0495589_0024656_580_1056 | 158 |
| 995 | 3300046794 | Ga0495589_0041330 | Ga0495589_0041330_1526_2002 | 158 |
| 996 | 3300046794 | Ga0495589_0234654 | Ga0495589_0234654_22_498 | 158 |
| 997 | 3300046794 | Ga0495589_0372836 | Ga0495589_0372836_18_512 | 158 |
| 998 | 3300046809 | Ga0495600_0064229 | Ga0495600_0064229_405_926 | 158 |
| 999 | 3300046809 | Ga0495600_0073662 | Ga0495600_0073662_1740_2216 | 158 |
| 1000 | 3300046809 | Ga0495600_0130407 | Ga0495600_0130407_368_844 | 158 |
| 1001 | 3300046809 | Ga0495600_0162253 | Ga0495600_0162253_619_1122 | 158 |
| 1002 | 3300046809 | Ga0495600_0175349 | Ga0495600_0175349_36_512 | 158 |
| 1003 | 3300046809 | Ga0495600_0274535 | Ga0495600_0274535_535_1050 | 158 |
| 1004 | 3300046809 | Ga0495600_0793675 | Ga0495600_0793675_76_552 | 158 |
| 1005 | 3300047315 | Ga0495581_0042925 | Ga0495581_0042925_173_649 | 158 |
| 1006 | 3300047315 | Ga0495581_0141944 | Ga0495581_0141944_877_1353 | 158 |
| 1007 | 3300047317 | Ga0495604_0000695 | Ga0495604_0000695_22508_22984 | 158 |
| 1008 | 3300047317 | Ga0495604_0006374 | Ga0495604_0006374_3010_3516 | 158 |
| 1009 | 3300047317 | Ga0495604_0051601 | Ga0495604_0051601_2159_2635 | 158 |
| 1010 | 3300047317 | Ga0495604_0063128 | Ga0495604_0063128_1522_2025 | 158 |
| 1011 | 3300047318 | Ga0495636_0001610 | Ga0495636_0001610_1569_2045 | 158 |
| 1012 | 3300047318 | Ga0495636_0080197 | Ga0495636_0080197_246_722 | 158 |
| 1013 | 3300047318 | Ga0495636_0287081 | Ga0495636_0287081_243_719 | 158 |
| 1014 | 3300047318 | Ga0495636_0366904 | Ga0495636_0366904_21_497 | 158 |
| 1015 | 3300047318 | Ga0495636_0606385 | Ga0495636_0606385_48_524 | 158 |
| 1016 | 3300047319 | Ga0495674_0166231 | Ga0495674_0166231_394_870 | 158 |
| 1017 | 3300047319 | Ga0495674_0291070 | Ga0495674_0291070_521_1024 | 158 |
| 1018 | 3300047320 | Ga0495672_0116302 | Ga0495672_0116302_871_1347 | 158 |
| 1019 | 3300047321 | Ga0495676_0008638 | Ga0495676_0008638_933_1409 | 158 |
| 1020 | 3300047321 | Ga0495676_0011585 | Ga0495676_0011585_1866_2342 | 158 |
| 1021 | 3300047321 | Ga0495676_0026464 | Ga0495676_0026464_1537_2013 | 158 |
| 1022 | 3300047321 | Ga0495676_0037864 | Ga0495676_0037864_501_977 | 158 |
| 1023 | 3300047321 | Ga0495676_0093002 | Ga0495676_0093002_378_854 | 158 |
| 1024 | 3300047321 | Ga0495676_0238301 | Ga0495676_0238301_349_825 | 158 |
| 1025 | 3300047321 | Ga0495676_0269970 | Ga0495676_0269970_239_715 | 158 |
| 1026 | 3300047322 | Ga0495680_0053569 | Ga0495680_0053569_1004_1480 | 158 |
| 1027 | 3300047322 | Ga0495680_0056799 | Ga0495680_0056799_1943_2446 | 158 |
| 1028 | 3300047323 | Ga0495683_0014216 | Ga0495683_0014216_2383_2877 | 158 |
| 1029 | 3300047323 | Ga0495683_0018255 | Ga0495683_0018255_226_702 | 158 |
| 1030 | 3300047323 | Ga0495683_0052837 | Ga0495683_0052837_1048_1524 | 158 |
| 1031 | 3300047323 | Ga0495683_0397756 | Ga0495683_0397756_41_517 | 158 |
| 1032 | 3300047443 | Ga0495687_002340 | Ga0495687_002340_5037_5513 | 158 |
| 1033 | 3300047443 | Ga0495687_005422 | Ga0495687_005422_7522_7998 | 158 |
| 1034 | 3300047443 | Ga0495687_008591 | Ga0495687_008591_4331_4825 | 158 |
| 1035 | 3300047443 | Ga0495687_027386 | Ga0495687_027386_238_732 | 158 |
| 1036 | 3300047443 | Ga0495687_049101 | Ga0495687_049101_932_1408 | 158 |
| 1037 | 3300047444 | Ga0495675_0008872 | Ga0495675_0008872_1623_2099 | 158 |
| 1038 | 3300047444 | Ga0495675_0017990 | Ga0495675_0017990_3441_3956 | 158 |
| 1039 | 3300047444 | Ga0495675_0025200 | Ga0495675_0025200_2158_2634 | 158 |
| 1040 | 3300047444 | Ga0495675_0036401 | Ga0495675_0036401_697_1218 | 158 |
| 1041 | 3300047444 | Ga0495675_0175951 | Ga0495675_0175951_23_499 | 158 |
| 1042 | 3300047444 | Ga0495675_0214530 | Ga0495675_0214530_23_544 | 158 |
| 1043 | 3300047444 | Ga0495675_0232126 | Ga0495675_0232126_238_741 | 158 |
| 1044 | 3300047444 | Ga0495675_0365335 | Ga0495675_0365335_172_696 | 158 |
| 1045 | 3300047445 | Ga0495677_0082194 | Ga0495677_0082194_128_604 | 158 |
| 1046 | 3300047445 | Ga0495677_0168259 | Ga0495677_0168259_53_529 | 158 |
| 1047 | 3300047447 | Ga0495685_000339 | Ga0495685_000339_11974_12468 | 158 |
| 1048 | 3300047447 | Ga0495685_001961 | Ga0495685_001961_293_769 | 158 |
| 1049 | 3300047447 | Ga0495685_006381 | Ga0495685_006381_3348_3824 | 158 |
| 1050 | 3300047447 | Ga0495685_010526 | Ga0495685_010526_1060_1536 | 158 |
| 1051 | 3300047447 | Ga0495685_097524 | Ga0495685_097524_417_893 | 158 |
| 1052 | 3300047470 | Ga0495681_0000484 | Ga0495681_0000484_11748_12224 | 158 |
| 1053 | 3300047470 | Ga0495681_0001772 | Ga0495681_0001772_3647_4141 | 158 |
| 1054 | 3300047470 | Ga0495681_0189801 | Ga0495681_0189801_21_497 | 158 |
| 1055 | 3300047471 | Ga0495684_0066516 | Ga0495684_0066516_2099_2602 | 158 |
| 1056 | 3300047472 | Ga0495686_0080126 | Ga0495686_0080126_243_719 | 158 |
| 1057 | 3300047673 | Ga0495593_0005276 | Ga0495593_0005276_4986_5462 | 158 |
| 1058 | 3300047673 | Ga0495593_0008191 | Ga0495593_0008191_1408_1884 | 158 |
| 1059 | 3300048088 | Ga0495602_0022868 | Ga0495602_0022868_4223_4699 | 158 |
| 1060 | 3300048088 | Ga0495602_0053981 | Ga0495602_0053981_2304_2807 | 158 |
| 1061 | 3300048089 | Ga0495614_0001002 | Ga0495614_0001002_1552_2028 | 158 |
| 1062 | 3300048089 | Ga0495614_0004532 | Ga0495614_0004532_4005_4481 | 158 |
| 1063 | 3300048089 | Ga0495614_0005784 | Ga0495614_0005784_2096_2572 | 158 |
| 1064 | 3300048089 | Ga0495614_0192407 | Ga0495614_0192407_239_715 | 158 |
| 1065 | 3300048091 | Ga0495626_0005159 | Ga0495626_0005159_6246_6722 | 158 |
| 1066 | 3300048905 | Ga0496102_0115988 | Ga0496102_0115988_1559_2059 | 158 |
| 1067 | 3300048905 | Ga0496102_1807886 | Ga0496102_1807886_21_497 | 158 |
| 1068 | 3300048908 | Ga0496105_1036754 | Ga0496105_1036754_90_566 | 158 |
| 1069 | 3300048909 | Ga0496106_0047750 | Ga0496106_0047750_626_1102 | 158 |
| 1070 | 3300048911 | Ga0496108_0575229 | Ga0496108_0575229_436_912 | 158 |
| 1071 | 3300048912 | Ga0496109_0672790 | Ga0496109_0672790_448_924 | 158 |
| 1072 | 3300048916 | Ga0496113_1285904 | Ga0496113_1285904_32_508 | 158 |
| 1073 | 3300048918 | Ga0496115_0292585 | Ga0496115_0292585_695_1201 | 158 |
| 1074 | 3300048918 | Ga0496115_1045187 | Ga0496115_1045187_129_605 | 158 |
| 1075 | 3300048922 | Ga0496119_0090567 | Ga0496119_0090567_932_1432 | 158 |
| 1076 | 3300049127 | Ga0501306_062094 | Ga0501306_062094_60_536 | 158 |
| 1077 | 3300049130 | Ga0501310_043368 | Ga0501310_043368_59_535 | 158 |
| 1078 | 3300049161 | Ga0501305_074032 | Ga0501305_074032_82_558 | 158 |
| 1079 | 3300049162 | Ga0501307_069711 | Ga0501307_069711_50_526 | 158 |
| 1080 | 3300049459 | Ga0495678_022455 | Ga0495678_022455_1596_2072 | 158 |
| 1081 | 3300049460 | Ga0495682_0308441 | Ga0495682_0308441_30_506 | 158 |
| 1082 | 3300049527 | Ga0501311_024918 | Ga0501311_024918_301_819 | 158 |
| 1083 | 3300049527 | Ga0501311_048719 | Ga0501311_048719_126_602 | 158 |
| 1084 | 3300049532 | Ga0501316_040440 | Ga0501316_040440_34_510 | 158 |
| 1085 | 3300049535 | Ga0501319_013012 | Ga0501319_013012_77_553 | 158 |
| 1086 | 3300049539 | Ga0501323_015022 | Ga0501323_015022_416_934 | 158 |
| 1087 | 3300049568 | Ga0501031_0055511 | Ga0501031_0055511_1628_2104 | 158 |
| 1088 | 3300049569 | Ga0501032_0046653 | Ga0501032_0046653_1618_2094 | 158 |
| 1089 | 3300049570 | Ga0501033_0001721 | Ga0501033_0001721_11336_11812 | 158 |
| 1090 | 3300049570 | Ga0501033_0041732 | Ga0501033_0041732_686_1162 | 158 |
| 1091 | 3300049570 | Ga0501033_0279130 | Ga0501033_0279130_177_653 | 158 |
| 1092 | 3300049571 | Ga0501034_0006924 | Ga0501034_0006924_1398_1874 | 158 |
| 1093 | 3300049571 | Ga0501034_0123542 | Ga0501034_0123542_749_1225 | 158 |
| 1094 | 3300049572 | Ga0501036_0000553 | Ga0501036_0000553_1694_2170 | 158 |
| 1095 | 3300049572 | Ga0501036_0004613 | Ga0501036_0004613_7298_7774 | 158 |
| 1096 | 3300049572 | Ga0501036_0061798 | Ga0501036_0061798_2439_2915 | 158 |
| 1097 | 3300049572 | Ga0501036_0100394 | Ga0501036_0100394_1408_1884 | 158 |
| 1098 | 3300049573 | Ga0501037_0032349 | Ga0501037_0032349_849_1325 | 158 |
| 1099 | 3300049574 | Ga0501038_0015344 | Ga0501038_0015344_4459_4935 | 158 |
| 1100 | 3300049574 | Ga0501038_0027984 | Ga0501038_0027984_2217_2693 | 158 |
| 1101 | 3300049574 | Ga0501038_0031678 | Ga0501038_0031678_3418_3894 | 158 |
| 1102 | 3300049575 | Ga0501039_0038974 | Ga0501039_0038974_855_1331 | 158 |
| 1103 | 3300049575 | Ga0501039_0073425 | Ga0501039_0073425_551_1027 | 158 |
| 1104 | 3300049578 | Ga0501042_0275777 | Ga0501042_0275777_389_865 | 158 |
| 1105 | 3300049579 | Ga0501043_0062689 | Ga0501043_0062689_2291_2767 | 158 |
| 1106 | 3300049579 | Ga0501043_0075044 | Ga0501043_0075044_865_1341 | 158 |
| 1107 | 3300049580 | Ga0501046_0011002 | Ga0501046_0011002_673_1149 | 158 |
| 1108 | 3300049580 | Ga0501046_0032446 | Ga0501046_0032446_1527_2003 | 158 |
| 1109 | 3300049580 | Ga0501046_0177966 | Ga0501046_0177966_998_1474 | 158 |
| 1110 | 3300049581 | Ga0501047_0073029 | Ga0501047_0073029_912_1409 | 158 |
| 1111 | 3300049581 | Ga0501047_0078399 | Ga0501047_0078399_164_640 | 158 |
| 1112 | 3300049581 | Ga0501047_0125064 | Ga0501047_0125064_809_1285 | 158 |
| 1113 | 3300049581 | Ga0501047_0134580 | Ga0501047_0134580_850_1326 | 158 |
| 1114 | 3300049582 | Ga0501048_0003722 | Ga0501048_0003722_9409_9885 | 158 |
| 1115 | 3300049585 | Ga0501069_0305847 | Ga0501069_0305847_128_604 | 158 |
| 1116 | 3300049586 | Ga0501070_0003332 | Ga0501070_0003332_11956_12432 | 158 |
| 1117 | 3300049586 | Ga0501070_0217054 | Ga0501070_0217054_14_490 | 158 |
| 1118 | 3300049586 | Ga0501070_0469458 | Ga0501070_0469458_175_651 | 158 |
| 1119 | 3300049589 | Ga0501073_0051632 | Ga0501073_0051632_324_800 | 158 |
| 1120 | 3300049589 | Ga0501073_0105674 | Ga0501073_0105674_1011_1487 | 158 |
| 1121 | 3300049590 | Ga0501074_0000685 | Ga0501074_0000685_5816_6292 | 158 |
| 1122 | 3300049742 | Ga0501080_0208337 | Ga0501080_0208337_1266_1742 | 158 |
| 1123 | 3300049822 | Ga0501035_0001374 | Ga0501035_0001374_14134_14610 | 158 |
| 1124 | 3300049822 | Ga0501035_0019714 | Ga0501035_0019714_3781_4257 | 158 |
| 1125 | 3300049822 | Ga0501035_0041594 | Ga0501035_0041594_598_1083 | 158 |
| 1126 | 3300049822 | Ga0501035_0232963 | Ga0501035_0232963_296_772 | 158 |
| 1127 | 3300049823 | Ga0501044_0004484 | Ga0501044_0004484_14039_14515 | 158 |
| 1128 | 3300049823 | Ga0501044_0012903 | Ga0501044_0012903_3839_4315 | 158 |
| 1129 | 3300049823 | Ga0501044_0039348 | Ga0501044_0039348_687_1163 | 158 |
| 1130 | 3300049823 | Ga0501044_0097016 | Ga0501044_0097016_244_729 | 158 |
| 1131 | 3300049823 | Ga0501044_0209971 | Ga0501044_0209971_632_1108 | 158 |
| 1132 | 3300049824 | Ga0501045_0094045 | Ga0501045_0094045_1016_1492 | 158 |
| 1133 | 3300050490 | nmdc:mga03n38_23741_c1 | nmdc:mga03n38_23741_c1_1795_2271 | 158 |
| 1134 | 3300050490 | nmdc:mga03n38_251435_c1 | nmdc:mga03n38_251435_c1_164_640 | 158 |
| 1135 | 3300050490 | nmdc:mga03n38_453060_c1 | nmdc:mga03n38_453060_c1_55_531 | 158 |
| 1136 | 3300050494 | nmdc:mga06z11_65607_c1 | nmdc:mga06z11_65607_c1_1194_1670 | 158 |
| 1137 | 3300050495 | nmdc:mga04h51_16963_c1 | nmdc:mga04h51_16963_c1_237_713 | 158 |
| 1138 | 3300053077 | Ga0495601_0371298 | Ga0495601_0371298_301_777 | 158 |
| 1139 | 3300053078 | Ga0495612_0103034 | Ga0495612_0103034_295_771 | 158 |
| 1140 | 3300053079 | Ga0500610_0055900 | Ga0500610_0055900_1274_1750 | 158 |
| 1141 | 3300053083 | Ga0495655_0187628 | Ga0495655_0187628_71_565 | 158 |
| 1142 | 3300053085 | Ga0495619_0040885 | Ga0495619_0040885_2314_2817 | 158 |
| 1143 | 3300053085 | Ga0495619_0104808 | Ga0495619_0104808_619_1095 | 158 |
| 1144 | 3300053085 | Ga0495619_0480572 | Ga0495619_0480572_242_736 | 158 |
| 1145 | 3300053086 | Ga0500578_0050722 | Ga0500578_0050722_1873_2367 | 158 |
| 1146 | 3300053094 | Ga0500566_0017627 | Ga0500566_0017627_2557_3051 | 158 |
| 1147 | 3300053095 | Ga0500640_044584 | Ga0500640_044584_755_1231 | 158 |
| 1148 | 3300053099 | Ga0500654_024030 | Ga0500654_024030_1502_1996 | 158 |
| 1149 | 3300053100 | Ga0500660_027042 | Ga0500660_027042_2463_2957 | 158 |
| 1150 | 3300053101 | Ga0500553_035471 | Ga0500553_035471_487_963 | 158 |
| 1151 | 3300053101 | Ga0500553_095490 | Ga0500553_095490_530_1024 | 158 |
| 1152 | 3300053106 | Ga0500558_245350 | Ga0500558_245350_39_533 | 158 |
| 1153 | 3300053107 | Ga0500560_000476 | Ga0500560_000476_2156_2632 | 158 |
| 1154 | 3300053109 | Ga0500569_004487 | Ga0500569_004487_2329_2823 | 158 |
| 1155 | 3300053118 | Ga0500594_0121542 | Ga0500594_0121542_19_513 | 158 |
| 1156 | 3300053126 | Ga0500621_032891 | Ga0500621_032891_223_717 | 158 |
| 1157 | 3300053129 | Ga0500628_009354 | Ga0500628_009354_1085_1579 | 158 |
| 1158 | 3300053131 | Ga0500652_001101 | Ga0500652_001101_5665_6159 | 158 |
| 1159 | 3300053137 | Ga0500561_0000489 | Ga0500561_0000489_3147_3641 | 158 |
| 1160 | 3300053140 | Ga0500573_0020311 | Ga0500573_0020311_1070_1546 | 158 |
| 1161 | 3300053140 | Ga0500573_0024558 | Ga0500573_0024558_1122_1616 | 158 |
| 1162 | 3300053142 | Ga0500577_0133659 | Ga0500577_0133659_261_755 | 158 |
| 1163 | 3300053143 | Ga0500579_135801 | Ga0500579_135801_487_981 | 158 |
| 1164 | 3300053149 | Ga0500600_0211300 | Ga0500600_0211300_207_683 | 158 |
| 1165 | 3300053150 | Ga0500603_040610 | Ga0500603_040610_388_882 | 158 |
| 1166 | 3300053160 | Ga0500633_0001530 | Ga0500633_0001530_238_732 | 158 |
| 1167 | 3300053161 | Ga0500634_0002147 | Ga0500634_0002147_2003_2497 | 158 |
| 1168 | 3300053161 | Ga0500634_0173400 | Ga0500634_0173400_99_575 | 158 |
| 1169 | 3300053177 | Ga0500636_0146717 | Ga0500636_0146717_686_1180 | 158 |
| 1170 | 3300053732 | Ga0500656_001615 | Ga0500656_001615_1109_1603 | 158 |
| 1171 | 3300053734 | Ga0500565_051760 | Ga0500565_051760_82_558 | 158 |
| 1172 | 3300053739 | Ga0500587_006291 | Ga0500587_006291_381_875 | 158 |
| 1173 | 3300059492 | Ga0587073_0213026 | Ga0587073_0213026_29_505 | 158 |
| 1174 | 3300059492 | Ga0587073_0321603 | Ga0587073_0321603_20_496 | 158 |
| 1175 | 3300059504 | Ga0587082_146713 | Ga0587082_146713_54_530 | 158 |
| 1176 | 3300059604 | Ga0587098_031491 | Ga0587098_031491_10_486 | 158 |
| 1177 | 3300059604 | Ga0587098_061763 | Ga0587098_061763_92_568 | 158 |
| 1178 | 3300059605 | Ga0587106_060911 | Ga0587106_060911_20_496 | 158 |
| 1179 | 3300059628 | Ga0587122_010712 | Ga0587122_010712_372_848 | 158 |
| 1180 | 3300059641 | Ga0587068_154460 | Ga0587068_154460_26_502 | 158 |
| 1181 | 3300061719 | Ga0466962_0001135 | Ga0466962_0001135_2621_3097 | 158 |
| 1182 | 3300061719 | Ga0466962_0037056 | Ga0466962_0037056_1068_1544 | 158 |
| 1183 | 3300061719 | Ga0466962_0066978 | Ga0466962_0066978_1075_1551 | 158 |
| 1184 | 3300061719 | Ga0466962_0096516 | Ga0466962_0096516_103_627 | 158 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zmd-assembly2.cif.gz_D | crystal structure of absc, a marr family transcriptional regulator from streptomyces coelicolor | 0.9846 | 7 | 153 |
| 3zmd-assembly2.cif.gz_D | crystal structure of absc, a marr family transcriptional regulator from streptomyces coelicolor | 0.9715 | 7 | 153 |
| 3zpl-assembly2.cif.gz_F | crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna | 0.9689 | 9 | 151 |
| 3zpl-assembly1.cif.gz_B | crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna | 0.9686 | 8 | 151 |
| 3zpl-assembly2.cif.gz_E | crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna | 0.9681 | 8 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3zmdA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.971 | 7 | 153 | 1.10.10.10 |
| 3zplA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9684 | 8 | 151 | 1.10.10.10 |
| 3zmdA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9583 | 7 | 153 | 1.10.10.10 |
| 1s3jB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9269 | 41 | 106 | 1.10.10.10 |
| af_Q57693_7_69_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9238 | 46 | 114 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A423V109-F1-model_v4 | MarR family transcriptional regulator | 0.9874 | 1 | 156 |
GO:0003700
GO:0006950 |
| AF-A0A1Q5H6D2-F1-model_v4 | MarR family transcriptional regulator | 0.985 | 1 | 156 |
GO:0003700
GO:0006950 |
| AF-A0A3D8NDA0-F1-model_v4 | deleted | 0.9849 | 1 | 158 |
|
| AF-F3Z5T0-F1-model_v4 | Putative transcriptional regulator | 0.9842 | 25 | 155 |
GO:0003700
GO:0006950 |
| AF-A0A2G7DAY1-F1-model_v4 | deleted | 0.9816 | 16 | 153 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar