F491267
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1177 | 362 | 2354 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300049576|Ga0501040_0184988|Ga0501040_0184988_301_1137 |
| Length | 278 |
| Sequence | MSLEIDLSGRVALVTGGSRGLGRADALTLARAGADVVIADIQVESETTDEEAERYGPLAQVARAQGLVFTEATAQEIQAIGRRAAAVKCDVTDREQVATTVARTVEELGSVDILVNNAGTLDHVAQLGDQSPELWERDLRVNLTGAFNCAQAVWPHMQERGWGRIVNMASVAGTLGGFGQSSYSTTKAGLLGLTKSLALEGARHGITVNAIVPGIIGTEAFSFGNPEMNERMVKRTALRRVGEPQDIANAIAFLCSDLAAYITGVGLNVSGGIELFTF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 206 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 229 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 230 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 231 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 232 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 233 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 234 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 235 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 236 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 237 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 238 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 239 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 240 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 241 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 245 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 246 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 300 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 301 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 302 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 303 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 304 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 305 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 308 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 311 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 312 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 313 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 346 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 361 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 362 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.81 |
| Metatranscriptomes | 1.1 |
| Isolates | 0.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.51 |
| Nodule | 0 |
| Rhizoplane | 8.75 |
| Rhizosphere | 90.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501040_0184988 | 3300049576 | Bacteria | 1477 |
| 2 | JGI24747J21853_1005485 | 3300001978 | Bacteria | 1172 |
| 3 | JGI24749J21850_1009238 | 3300002076 | Bacteria | 1378 |
| 4 | JGI24744J21845_10003353 | 3300002077 | Bacteria | 3290 |
| 5 | JGI25407J50210_10000579 | 3300003373 | Bacteria | 7403 |
| 6 | JGI25407J50210_10005452 | 3300003373 | Bacteria | 3128 |
| 7 | Ga0070658_10010114 | 3300005327 | Bacteria | 7571 |
| 8 | Ga0070658_10028070 | 3300005327 | Bacteria | 4517 |
| 9 | Ga0070658_10071971 | 3300005327 | Bacteria | 2832 |
| 10 | Ga0070658_10072608 | 3300005327 | Bacteria | 2820 |
| 11 | Ga0070658_10471760 | 3300005327 | Bacteria | 1082 |
| 12 | Ga0070676_10045076 | 3300005328 | Bacteria | 2568 |
| 13 | Ga0070683_100004095 | 3300005329 | Bacteria | 11949 |
| 14 | Ga0070683_100231028 | 3300005329 | Bacteria | 1759 |
| 15 | Ga0070683_100256172 | 3300005329 | Bacteria | 1664 |
| 16 | Ga0070683_100514878 | 3300005329 | Bacteria | 1143 |
| 17 | Ga0070670_100018158 | 3300005331 | Bacteria | 6036 |
| 18 | Ga0070666_10114532 | 3300005335 | Bacteria | 1867 |
| 19 | Ga0070680_100005086 | 3300005336 | Bacteria | 9922 |
| 20 | Ga0070680_100007837 | 3300005336 | Bacteria | 8143 |
| 21 | Ga0070680_100008703 | 3300005336 | Bacteria | 7780 |
| 22 | Ga0070680_100200540 | 3300005336 | Bacteria | 1682 |
| 23 | Ga0070682_100024789 | 3300005337 | Bacteria | 3573 |
| 24 | Ga0070682_100061448 | 3300005337 | Bacteria | 2378 |
| 25 | Ga0070682_100188816 | 3300005337 | Bacteria | 1445 |
| 26 | Ga0068868_100040658 | 3300005338 | Bacteria | 3619 |
| 27 | Ga0068868_100062012 | 3300005338 | Bacteria | 2963 |
| 28 | Ga0070660_100003574 | 3300005339 | Bacteria | 10734 |
| 29 | Ga0070660_100004622 | 3300005339 | Bacteria | 9530 |
| 30 | Ga0070660_100154823 | 3300005339 | Bacteria | 1845 |
| 31 | Ga0070660_100331784 | 3300005339 | Bacteria | 1251 |
| 32 | Ga0070689_100047182 | 3300005340 | Bacteria | 3321 |
| 33 | Ga0070691_10032809 | 3300005341 | Bacteria | 2441 |
| 34 | Ga0070687_100037970 | 3300005343 | Bacteria | 2411 |
| 35 | Ga0070687_100177880 | 3300005343 | Bacteria | 1272 |
| 36 | Ga0070661_100016782 | 3300005344 | Bacteria | 5184 |
| 37 | Ga0070661_100030295 | 3300005344 | Bacteria | 3908 |
| 38 | Ga0070661_100065760 | 3300005344 | Bacteria | 2664 |
| 39 | Ga0070661_100066365 | 3300005344 | Bacteria | 2651 |
| 40 | Ga0070661_100125465 | 3300005344 | Bacteria | 1925 |
| 41 | Ga0070692_10219176 | 3300005345 | Bacteria | 1124 |
| 42 | Ga0070668_100064152 | 3300005347 | Bacteria | 2848 |
| 43 | Ga0070668_100181922 | 3300005347 | Bacteria | 1717 |
| 44 | Ga0070668_100354194 | 3300005347 | Bacteria | 1243 |
| 45 | Ga0070675_100013851 | 3300005354 | Bacteria | 6349 |
| 46 | Ga0070675_100093911 | 3300005354 | Bacteria | 2516 |
| 47 | Ga0070671_100016930 | 3300005355 | Bacteria | 5896 |
| 48 | Ga0070671_100060084 | 3300005355 | Bacteria | 3164 |
| 49 | Ga0070674_100001772 | 3300005356 | Bacteria | 11704 |
| 50 | Ga0070674_100014593 | 3300005356 | Bacteria | 4887 |
| 51 | Ga0070674_100024872 | 3300005356 | Bacteria | 3890 |
| 52 | Ga0070674_100032598 | 3300005356 | Bacteria | 3460 |
| 53 | Ga0070673_100017348 | 3300005364 | Bacteria | 5117 |
| 54 | Ga0070688_100002947 | 3300005365 | Bacteria | 8684 |
| 55 | Ga0070688_100025703 | 3300005365 | Bacteria | 3489 |
| 56 | Ga0070659_100054433 | 3300005366 | Bacteria | 3151 |
| 57 | Ga0070659_100129110 | 3300005366 | Bacteria | 2052 |
| 58 | Ga0070703_10070945 | 3300005406 | Bacteria | 1164 |
| 59 | Ga0070709_10136862 | 3300005434 | Bacteria | 1678 |
| 60 | Ga0070714_100004907 | 3300005435 | Bacteria | 10160 |
| 61 | Ga0070714_100069502 | 3300005435 | Bacteria | 3042 |
| 62 | Ga0070714_100303136 | 3300005435 | Bacteria | 1490 |
| 63 | Ga0070714_100417020 | 3300005435 | Bacteria | 1271 |
| 64 | Ga0070714_100580937 | 3300005435 | Bacteria | 1075 |
| 65 | Ga0070713_100171490 | 3300005436 | Bacteria | 1944 |
| 66 | Ga0070710_10045044 | 3300005437 | Bacteria | 2450 |
| 67 | Ga0070701_10012352 | 3300005438 | Bacteria | 3849 |
| 68 | Ga0070701_10093551 | 3300005438 | Bacteria | 1652 |
| 69 | Ga0070711_100219247 | 3300005439 | Bacteria | 1478 |
| 70 | Ga0070711_100262425 | 3300005439 | Bacteria | 1359 |
| 71 | Ga0070700_100008291 | 3300005441 | Bacteria | 5655 |
| 72 | Ga0070694_100049597 | 3300005444 | Bacteria | 2828 |
| 73 | Ga0070708_100272235 | 3300005445 | Bacteria | 1593 |
| 74 | Ga0070663_100042192 | 3300005455 | Bacteria | 3205 |
| 75 | Ga0070663_100054447 | 3300005455 | Bacteria | 2860 |
| 76 | Ga0070663_100142404 | 3300005455 | Bacteria | 1832 |
| 77 | Ga0070678_100021853 | 3300005456 | Bacteria | 4229 |
| 78 | Ga0070678_100233863 | 3300005456 | Bacteria | 1533 |
| 79 | Ga0070662_100026269 | 3300005457 | Bacteria | 4031 |
| 80 | Ga0070662_100089419 | 3300005457 | Bacteria | 2310 |
| 81 | Ga0070681_10000749 | 3300005458 | Bacteria | 26980 |
| 82 | Ga0070681_10002438 | 3300005458 | Bacteria | 17023 |
| 83 | Ga0070681_10006655 | 3300005458 | Bacteria | 11248 |
| 84 | Ga0070681_10010692 | 3300005458 | Bacteria | 9072 |
| 85 | Ga0070681_10020308 | 3300005458 | Bacteria | 6658 |
| 86 | Ga0070681_10145901 | 3300005458 | Bacteria | 2295 |
| 87 | Ga0070681_10198909 | 3300005458 | Bacteria | 1923 |
| 88 | Ga0070681_10210855 | 3300005458 | Bacteria | 1859 |
| 89 | Ga0070681_10484398 | 3300005458 | Bacteria | 1150 |
| 90 | Ga0068867_100053297 | 3300005459 | Bacteria | 2987 |
| 91 | Ga0070685_10003250 | 3300005466 | Bacteria | 8257 |
| 92 | Ga0070685_10004853 | 3300005466 | Bacteria | 6803 |
| 93 | Ga0070706_100024656 | 3300005467 | Bacteria | 5538 |
| 94 | Ga0070706_100033735 | 3300005467 | Bacteria | 4726 |
| 95 | Ga0070706_100088077 | 3300005467 | Bacteria | 2878 |
| 96 | Ga0070707_100024051 | 3300005468 | Bacteria | 5766 |
| 97 | Ga0070707_100170370 | 3300005468 | Bacteria | 2122 |
| 98 | Ga0070707_100224763 | 3300005468 | Bacteria | 1828 |
| 99 | Ga0070707_100270323 | 3300005468 | Bacteria | 1653 |
| 100 | Ga0070707_100344456 | 3300005468 | Bacteria | 1448 |
| 101 | Ga0070698_100010130 | 3300005471 | Bacteria | 10068 |
| 102 | Ga0070698_100038621 | 3300005471 | Bacteria | 4918 |
| 103 | Ga0070698_100099283 | 3300005471 | Bacteria | 2885 |
| 104 | Ga0070698_100120471 | 3300005471 | Bacteria | 2584 |
| 105 | Ga0070698_100242003 | 3300005471 | Bacteria | 1737 |
| 106 | Ga0070699_100033541 | 3300005518 | Bacteria | 4435 |
| 107 | Ga0070699_100085618 | 3300005518 | Unclassified | 2750 |
| 108 | Ga0070699_100287386 | 3300005518 | Bacteria | 1474 |
| 109 | Ga0070679_100016743 | 3300005530 | Bacteria | 7084 |
| 110 | Ga0070679_100032625 | 3300005530 | Bacteria | 5153 |
| 111 | Ga0070679_100038005 | 3300005530 | Bacteria | 4784 |
| 112 | Ga0070679_100038029 | 3300005530 | Bacteria | 4782 |
| 113 | Ga0070679_100066304 | 3300005530 | Bacteria | 3598 |
| 114 | Ga0070679_100085126 | 3300005530 | Bacteria | 3148 |
| 115 | Ga0070679_100152562 | 3300005530 | Bacteria | 2287 |
| 116 | Ga0070679_100513908 | 3300005530 | Bacteria | 1142 |
| 117 | Ga0070684_100007703 | 3300005535 | Bacteria | 8395 |
| 118 | Ga0070684_100008812 | 3300005535 | Bacteria | 7908 |
| 119 | Ga0070684_100016168 | 3300005535 | Bacteria | 6095 |
| 120 | Ga0070684_100024755 | 3300005535 | Bacteria | 5038 |
| 121 | Ga0070684_100027123 | 3300005535 | Unclassified | 4831 |
| 122 | Ga0070684_100135701 | 3300005535 | Bacteria | 2222 |
| 123 | Ga0070684_100186885 | 3300005535 | Bacteria | 1884 |
| 124 | Ga0070684_100242356 | 3300005535 | Bacteria | 1647 |
| 125 | Ga0070684_100385272 | 3300005535 | Bacteria | 1291 |
| 126 | Ga0070684_100522997 | 3300005535 | Bacteria | 1100 |
| 127 | Ga0068853_100062429 | 3300005539 | Bacteria | 3224 |
| 128 | Ga0070672_100017544 | 3300005543 | Bacteria | 5155 |
| 129 | Ga0070672_100039052 | 3300005543 | Bacteria | 3633 |
| 130 | Ga0070686_100017035 | 3300005544 | Bacteria | 4239 |
| 131 | Ga0070686_100100217 | 3300005544 | Bacteria | 1955 |
| 132 | Ga0070696_100030807 | 3300005546 | Bacteria | 3674 |
| 133 | Ga0070696_100039316 | 3300005546 | Bacteria | 3266 |
| 134 | Ga0070693_100005691 | 3300005547 | Bacteria | 6011 |
| 135 | Ga0070693_100010318 | 3300005547 | Bacteria | 4676 |
| 136 | Ga0070693_100028214 | 3300005547 | Bacteria | 3050 |
| 137 | Ga0070665_100019078 | 3300005548 | Bacteria | 6879 |
| 138 | Ga0070665_100020625 | 3300005548 | Bacteria | 6621 |
| 139 | Ga0070665_100022583 | 3300005548 | Bacteria | 6333 |
| 140 | Ga0070704_100022283 | 3300005549 | Bacteria | 4120 |
| 141 | Ga0070704_100121350 | 3300005549 | Bacteria | 2008 |
| 142 | Ga0068855_100013479 | 3300005563 | Bacteria | 9854 |
| 143 | Ga0068855_100017889 | 3300005563 | Bacteria | 8517 |
| 144 | Ga0068855_100043921 | 3300005563 | Bacteria | 5291 |
| 145 | Ga0068855_100105880 | 3300005563 | Bacteria | 3233 |
| 146 | Ga0068855_100198402 | 3300005563 | Bacteria | 2260 |
| 147 | Ga0070664_100004370 | 3300005564 | Bacteria | 11352 |
| 148 | Ga0070664_100213325 | 3300005564 | Bacteria | 1726 |
| 149 | Ga0070664_100497186 | 3300005564 | Bacteria | 1124 |
| 150 | Ga0068857_100056589 | 3300005577 | Bacteria | 3481 |
| 151 | Ga0068857_100128737 | 3300005577 | Bacteria | 2282 |
| 152 | Ga0068857_100133197 | 3300005577 | Bacteria | 2243 |
| 153 | Ga0068856_100157818 | 3300005614 | Bacteria | 2278 |
| 154 | Ga0068856_100233310 | 3300005614 | Bacteria | 1855 |
| 155 | Ga0068856_100417472 | 3300005614 | Bacteria | 1362 |
| 156 | Ga0070702_100049892 | 3300005615 | Bacteria | 2389 |
| 157 | Ga0070702_100079449 | 3300005615 | Bacteria | 1960 |
| 158 | Ga0070702_100091583 | 3300005615 | Bacteria | 1845 |
| 159 | Ga0068852_100038105 | 3300005616 | Bacteria | 4037 |
| 160 | Ga0068852_100322301 | 3300005616 | Bacteria | 1501 |
| 161 | Ga0068859_100350113 | 3300005617 | Bacteria | 1572 |
| 162 | Ga0068859_100382935 | 3300005617 | Bacteria | 1502 |
| 163 | Ga0068864_100013928 | 3300005618 | Bacteria | 6666 |
| 164 | Ga0068866_10021168 | 3300005718 | Bacteria | 2992 |
| 165 | Ga0068866_10025200 | 3300005718 | Bacteria | 2794 |
| 166 | Ga0068866_10190184 | 3300005718 | Bacteria | 1219 |
| 167 | Ga0068851_10223941 | 3300005834 | Unclassified | 1058 |
| 168 | Ga0068870_10158297 | 3300005840 | Bacteria | 1341 |
| 169 | Ga0068870_10272311 | 3300005840 | Bacteria | 1058 |
| 170 | Ga0068862_100277854 | 3300005844 | Bacteria | 1534 |
| 171 | Ga0081455_10027165 | 3300005937 | Bacteria | 5247 |
| 172 | Ga0081455_10027400 | 3300005937 | Bacteria | 5222 |
| 173 | Ga0081455_10040735 | 3300005937 | Unclassified | 4094 |
| 174 | Ga0081455_10049314 | 3300005937 | Bacteria | 3630 |
| 175 | Ga0081455_10052841 | 3300005937 | Bacteria | 3475 |
| 176 | Ga0081455_10092006 | 3300005937 | Bacteria | 2455 |
| 177 | Ga0081455_10095463 | 3300005937 | Bacteria | 2400 |
| 178 | Ga0081455_10162487 | 3300005937 | Bacteria | 1710 |
| 179 | Ga0081455_10206461 | 3300005937 | Bacteria | 1467 |
| 180 | Ga0081455_10265364 | 3300005937 | Bacteria | 1248 |
| 181 | Ga0081538_10000455 | 3300005981 | Bacteria | 45816 |
| 182 | Ga0081538_10000458 | 3300005981 | Bacteria | 45661 |
| 183 | Ga0081538_10000515 | 3300005981 | Bacteria | 43219 |
| 184 | Ga0081538_10010281 | 3300005981 | Bacteria | 7684 |
| 185 | Ga0081538_10018466 | 3300005981 | Bacteria | 5235 |
| 186 | Ga0081539_10001762 | 3300005985 | Bacteria | 34518 |
| 187 | Ga0081539_10003734 | 3300005985 | Bacteria | 18115 |
| 188 | Ga0081539_10063314 | 3300005985 | Bacteria | 2018 |
| 189 | Ga0075365_10165455 | 3300006038 | Bacteria | 1543 |
| 190 | Ga0075363_100059917 | 3300006048 | Bacteria | 2048 |
| 191 | Ga0075432_10002033 | 3300006058 | Bacteria | 6728 |
| 192 | Ga0070716_100138938 | 3300006173 | Bacteria | 1546 |
| 193 | Ga0070716_100269572 | 3300006173 | Bacteria | 1169 |
| 194 | Ga0070712_100010028 | 3300006175 | Bacteria | 5972 |
| 195 | Ga0070712_100068415 | 3300006175 | Bacteria | 2530 |
| 196 | Ga0075362_10037521 | 3300006177 | Bacteria | 2125 |
| 197 | Ga0075367_10021905 | 3300006178 | Bacteria | 3578 |
| 198 | Ga0097621_100016451 | 3300006237 | Bacteria | 5592 |
| 199 | Ga0068871_100008154 | 3300006358 | Bacteria | 7524 |
| 200 | Ga0068871_100187969 | 3300006358 | Bacteria | 1778 |
| 201 | Ga0068871_100279383 | 3300006358 | Bacteria | 1460 |
| 202 | Ga0075428_100003088 | 3300006844 | Bacteria | 18172 |
| 203 | Ga0075428_100010638 | 3300006844 | Bacteria | 10227 |
| 204 | Ga0075430_100031259 | 3300006846 | Bacteria | 4519 |
| 205 | Ga0075431_100100516 | 3300006847 | Bacteria | 2984 |
| 206 | Ga0075431_100152582 | 3300006847 | Bacteria | 2378 |
| 207 | Ga0075433_10015575 | 3300006852 | Bacteria | 6243 |
| 208 | Ga0075433_10112863 | 3300006852 | Bacteria | 2411 |
| 209 | Ga0075434_100042180 | 3300006871 | Bacteria | 4522 |
| 210 | Ga0075429_100001412 | 3300006880 | Bacteria | 19667 |
| 211 | Ga0068865_100039665 | 3300006881 | Bacteria | 3195 |
| 212 | Ga0068865_100187153 | 3300006881 | Bacteria | 1598 |
| 213 | Ga0097620_100350113 | 3300006931 | Bacteria | 1572 |
| 214 | Ga0097620_100382938 | 3300006931 | Bacteria | 1502 |
| 215 | Ga0075435_100149343 | 3300007076 | Bacteria | 1964 |
| 216 | Ga0105240_10004372 | 3300009093 | Bacteria | 21577 |
| 217 | Ga0105240_10062989 | 3300009093 | Bacteria | 4615 |
| 218 | Ga0105240_10079949 | 3300009093 | Bacteria | 4022 |
| 219 | Ga0105240_10099590 | 3300009093 | Bacteria | 3538 |
| 220 | Ga0105240_10181998 | 3300009093 | Bacteria | 2479 |
| 221 | Ga0111539_10017279 | 3300009094 | Bacteria | 8927 |
| 222 | Ga0111539_10095782 | 3300009094 | Bacteria | 3486 |
| 223 | Ga0111539_10238313 | 3300009094 | Bacteria | 2117 |
| 224 | Ga0105245_10009977 | 3300009098 | Bacteria | 8271 |
| 225 | Ga0105245_10026745 | 3300009098 | Bacteria | 5080 |
| 226 | Ga0105245_10035862 | 3300009098 | Bacteria | 4403 |
| 227 | Ga0105245_10074826 | 3300009098 | Bacteria | 3082 |
| 228 | Ga0105245_10120838 | 3300009098 | Bacteria | 2447 |
| 229 | Ga0105245_10127228 | 3300009098 | Bacteria | 2386 |
| 230 | Ga0105245_10234160 | 3300009098 | Bacteria | 1777 |
| 231 | Ga0105247_10095101 | 3300009101 | Bacteria | 1897 |
| 232 | Ga0114129_10012486 | 3300009147 | Bacteria | 12094 |
| 233 | Ga0114129_10020559 | 3300009147 | Bacteria | 9387 |
| 234 | Ga0114129_10021264 | 3300009147 | Bacteria | 9212 |
| 235 | Ga0114129_10029801 | 3300009147 | Bacteria | 7727 |
| 236 | Ga0114129_10052837 | 3300009147 | Bacteria | 5702 |
| 237 | Ga0114129_10622484 | 3300009147 | Bacteria | 1396 |
| 238 | Ga0105243_10133205 | 3300009148 | Bacteria | 2111 |
| 239 | Ga0105243_10153483 | 3300009148 | Bacteria | 1978 |
| 240 | Ga0105241_10101612 | 3300009174 | Bacteria | 2286 |
| 241 | Ga0105241_10245744 | 3300009174 | Bacteria | 1515 |
| 242 | Ga0105241_10280763 | 3300009174 | Bacteria | 1422 |
| 243 | Ga0105241_10311481 | 3300009174 | Bacteria | 1354 |
| 244 | Ga0105241_10558167 | 3300009174 | Bacteria | 1029 |
| 245 | Ga0105242_10061575 | 3300009176 | Bacteria | 3087 |
| 246 | Ga0105242_10066836 | 3300009176 | Bacteria | 2970 |
| 247 | Ga0105242_10429614 | 3300009176 | Bacteria | 1240 |
| 248 | Ga0105248_10077735 | 3300009177 | Bacteria | 3731 |
| 249 | Ga0105248_10128764 | 3300009177 | Bacteria | 2856 |
| 250 | Ga0105248_10424847 | 3300009177 | Bacteria | 1497 |
| 251 | Ga0105237_10080751 | 3300009545 | Bacteria | 3242 |
| 252 | Ga0105238_10036976 | 3300009551 | Bacteria | 4964 |
| 253 | Ga0105238_10046749 | 3300009551 | Bacteria | 4365 |
| 254 | Ga0105238_10527902 | 3300009551 | Bacteria | 1183 |
| 255 | Ga0105249_10008732 | 3300009553 | Bacteria | 8839 |
| 256 | Ga0105249_10119310 | 3300009553 | Unclassified | 2505 |
| 257 | Ga0105249_10862687 | 3300009553 | Bacteria | 971 |
| 258 | Ga0105239_10087029 | 3300010375 | Bacteria | 3444 |
| 259 | Ga0105239_10121458 | 3300010375 | Bacteria | 2901 |
| 260 | Ga0105239_10405184 | 3300010375 | Bacteria | 1544 |
| 261 | Ga0105246_10005883 | 3300011119 | Bacteria | 7482 |
| 262 | Ga0157373_10211878 | 3300013100 | Bacteria | 1366 |
| 263 | Ga0157373_10269605 | 3300013100 | Bacteria | 1205 |
| 264 | Ga0157370_10082774 | 3300013104 | Bacteria | 3018 |
| 265 | Ga0157370_10167968 | 3300013104 | Bacteria | 2040 |
| 266 | Ga0157370_10191642 | 3300013104 | Bacteria | 1897 |
| 267 | Ga0157370_10392594 | 3300013104 | Bacteria | 1278 |
| 268 | Ga0157369_10003856 | 3300013105 | Bacteria | 17824 |
| 269 | Ga0157369_10004745 | 3300013105 | Bacteria | 15975 |
| 270 | Ga0157369_10029338 | 3300013105 | Bacteria | 6080 |
| 271 | Ga0157369_10039271 | 3300013105 | Bacteria | 5173 |
| 272 | Ga0157369_10048490 | 3300013105 | Bacteria | 4608 |
| 273 | Ga0157369_10184825 | 3300013105 | Bacteria | 2192 |
| 274 | Ga0157374_10107277 | 3300013296 | Bacteria | 2684 |
| 275 | Ga0157378_10090796 | 3300013297 | Bacteria | 2776 |
| 276 | Ga0157378_10199513 | 3300013297 | Bacteria | 1892 |
| 277 | Ga0157372_10027331 | 3300013307 | Bacteria | 6213 |
| 278 | Ga0157372_10048606 | 3300013307 | Bacteria | 4716 |
| 279 | Ga0157372_10073700 | 3300013307 | Bacteria | 3849 |
| 280 | Ga0157372_10256476 | 3300013307 | Bacteria | 2030 |
| 281 | Ga0157372_10263658 | 3300013307 | Bacteria | 2001 |
| 282 | Ga0157372_10857237 | 3300013307 | Bacteria | 1054 |
| 283 | Ga0163163_10084462 | 3300014325 | Bacteria | 3181 |
| 284 | Ga0163163_10203039 | 3300014325 | Bacteria | 2030 |
| 285 | Ga0157380_10040578 | 3300014326 | Bacteria | 3626 |
| 286 | Ga0157380_10303123 | 3300014326 | Bacteria | 1473 |
| 287 | Ga0182008_10006292 | 3300014497 | Bacteria | 6662 |
| 288 | Ga0157377_10000547 | 3300014745 | Bacteria | 15851 |
| 289 | Ga0157377_10003389 | 3300014745 | Bacteria | 7207 |
| 290 | Ga0157377_10005877 | 3300014745 | Bacteria | 5807 |
| 291 | Ga0157377_10068948 | 3300014745 | Unclassified | 2039 |
| 292 | Ga0157376_10105467 | 3300014969 | Bacteria | 2471 |
| 293 | Ga0157376_10223600 | 3300014969 | Bacteria | 1745 |
| 294 | Ga0182006_1015081 | 3300015261 | Bacteria | 3319 |
| 295 | Ga0182007_10030994 | 3300015262 | Bacteria | 1824 |
| 296 | Ga0163161_10131043 | 3300017792 | Bacteria | 1891 |
| 297 | Ga0206356_10498829 | 3300020070 | Bacteria | 2224 |
| 298 | Ga0206356_10525729 | 3300020070 | Bacteria | 1508 |
| 299 | Ga0206356_10612284 | 3300020070 | Bacteria | 1197 |
| 300 | Ga0206356_11589996 | 3300020070 | Bacteria | 2290 |
| 301 | Ga0206350_11494092 | 3300020080 | Bacteria | 1139 |
| 302 | Ga0206354_10607152 | 3300020081 | Bacteria | 2043 |
| 303 | Ga0206354_11210031 | 3300020081 | Bacteria | 1165 |
| 304 | Ga0206353_10294127 | 3300020082 | Bacteria | 1089 |
| 305 | Ga0206353_10558386 | 3300020082 | Bacteria | 2034 |
| 306 | Ga0206353_11428389 | 3300020082 | Bacteria | 1373 |
| 307 | Ga0206353_11672605 | 3300020082 | Bacteria | 3867 |
| 308 | Ga0213876_10036081 | 3300021384 | Bacteria | 2608 |
| 309 | Ga0213871_10078276 | 3300021441 | Bacteria | 944 |
| 310 | Ga0224712_10031602 | 3300022467 | Bacteria | 1922 |
| 311 | Ga0224712_10162561 | 3300022467 | Bacteria | 996 |
| 312 | Ga0207653_10012709 | 3300025885 | Bacteria | 2630 |
| 313 | Ga0207692_10328132 | 3300025898 | Bacteria | 938 |
| 314 | Ga0207642_10118456 | 3300025899 | Bacteria | 1361 |
| 315 | Ga0207710_10144375 | 3300025900 | Bacteria | 1151 |
| 316 | Ga0207688_10000094 | 3300025901 | Bacteria | 34655 |
| 317 | Ga0207688_10019905 | 3300025901 | Bacteria | 3660 |
| 318 | Ga0207680_10294154 | 3300025903 | Bacteria | 1131 |
| 319 | Ga0207647_10038076 | 3300025904 | Bacteria | 3043 |
| 320 | Ga0207685_10087548 | 3300025905 | Bacteria | 1304 |
| 321 | Ga0207699_10392315 | 3300025906 | Bacteria | 987 |
| 322 | Ga0207645_10019320 | 3300025907 | Bacteria | 4468 |
| 323 | Ga0207645_10026266 | 3300025907 | Bacteria | 3764 |
| 324 | Ga0207643_10044103 | 3300025908 | Bacteria | 2517 |
| 325 | Ga0207643_10180953 | 3300025908 | Bacteria | 1276 |
| 326 | Ga0207643_10198724 | 3300025908 | Bacteria | 1220 |
| 327 | Ga0207705_10086371 | 3300025909 | Bacteria | 2293 |
| 328 | Ga0207705_10096333 | 3300025909 | Bacteria | 2172 |
| 329 | Ga0207705_10109308 | 3300025909 | Bacteria | 2041 |
| 330 | Ga0207684_10070766 | 3300025910 | Bacteria | 2964 |
| 331 | Ga0207654_10029202 | 3300025911 | Bacteria | 3015 |
| 332 | Ga0207654_10278423 | 3300025911 | Bacteria | 1131 |
| 333 | Ga0207707_10005506 | 3300025912 | Bacteria | 11067 |
| 334 | Ga0207707_10010668 | 3300025912 | Bacteria | 7982 |
| 335 | Ga0207707_10021783 | 3300025912 | Bacteria | 5602 |
| 336 | Ga0207707_10037026 | 3300025912 | Bacteria | 4263 |
| 337 | Ga0207707_10046052 | 3300025912 | Bacteria | 3798 |
| 338 | Ga0207707_10067519 | 3300025912 | Bacteria | 3115 |
| 339 | Ga0207707_10078633 | 3300025912 | Bacteria | 2881 |
| 340 | Ga0207707_10117638 | 3300025912 | Bacteria | 2323 |
| 341 | Ga0207707_10177487 | 3300025912 | Bacteria | 1860 |
| 342 | Ga0207707_10226531 | 3300025912 | Bacteria | 1627 |
| 343 | Ga0207707_10306253 | 3300025912 | Bacteria | 1373 |
| 344 | Ga0207707_10382509 | 3300025912 | Bacteria | 1210 |
| 345 | Ga0207695_10061774 | 3300025913 | Bacteria | 3871 |
| 346 | Ga0207695_10072269 | 3300025913 | Bacteria | 3521 |
| 347 | Ga0207695_10079390 | 3300025913 | Bacteria | 3326 |
| 348 | Ga0207695_10226265 | 3300025913 | Bacteria | 1777 |
| 349 | Ga0207693_10004208 | 3300025915 | Bacteria | 12200 |
| 350 | Ga0207693_10075887 | 3300025915 | Bacteria | 2633 |
| 351 | Ga0207693_10097505 | 3300025915 | Bacteria | 2305 |
| 352 | Ga0207693_10114673 | 3300025915 | Bacteria | 2115 |
| 353 | Ga0207663_10007048 | 3300025916 | Bacteria | 5804 |
| 354 | Ga0207663_10229788 | 3300025916 | Bacteria | 1355 |
| 355 | Ga0207660_10005764 | 3300025917 | Bacteria | 8037 |
| 356 | Ga0207660_10104625 | 3300025917 | Bacteria | 2120 |
| 357 | Ga0207660_10128034 | 3300025917 | Bacteria | 1930 |
| 358 | Ga0207660_10162060 | 3300025917 | Bacteria | 1726 |
| 359 | Ga0207662_10051778 | 3300025918 | Bacteria | 2443 |
| 360 | Ga0207657_10000486 | 3300025919 | Bacteria | 41915 |
| 361 | Ga0207657_10005329 | 3300025919 | Bacteria | 13471 |
| 362 | Ga0207657_10006205 | 3300025919 | Bacteria | 12426 |
| 363 | Ga0207657_10008281 | 3300025919 | Bacteria | 10581 |
| 364 | Ga0207657_10008995 | 3300025919 | Bacteria | 10086 |
| 365 | Ga0207657_10033911 | 3300025919 | Bacteria | 4597 |
| 366 | Ga0207657_10065773 | 3300025919 | Bacteria | 3089 |
| 367 | Ga0207657_10114156 | 3300025919 | Bacteria | 2228 |
| 368 | Ga0207657_10166715 | 3300025919 | Bacteria | 1786 |
| 369 | Ga0207657_10191748 | 3300025919 | Bacteria | 1648 |
| 370 | Ga0207657_10288463 | 3300025919 | Bacteria | 1302 |
| 371 | Ga0207657_10307160 | 3300025919 | Bacteria | 1256 |
| 372 | Ga0207649_10013306 | 3300025920 | Bacteria | 4590 |
| 373 | Ga0207649_10044263 | 3300025920 | Bacteria | 2725 |
| 374 | Ga0207649_10100556 | 3300025920 | Bacteria | 1913 |
| 375 | Ga0207649_10108045 | 3300025920 | Bacteria | 1854 |
| 376 | Ga0207649_10113426 | 3300025920 | Bacteria | 1815 |
| 377 | Ga0207652_10001978 | 3300025921 | Bacteria | 17727 |
| 378 | Ga0207652_10010935 | 3300025921 | Bacteria | 7316 |
| 379 | Ga0207652_10026105 | 3300025921 | Bacteria | 4862 |
| 380 | Ga0207652_10027508 | 3300025921 | Bacteria | 4738 |
| 381 | Ga0207652_10056406 | 3300025921 | Bacteria | 3381 |
| 382 | Ga0207652_10112977 | 3300025921 | Bacteria | 2411 |
| 383 | Ga0207652_10114613 | 3300025921 | Bacteria | 2393 |
| 384 | Ga0207652_10125163 | 3300025921 | Bacteria | 2289 |
| 385 | Ga0207652_10152932 | 3300025921 | Bacteria | 2066 |
| 386 | Ga0207652_10189815 | 3300025921 | Unclassified | 1848 |
| 387 | Ga0207652_10335258 | 3300025921 | Bacteria | 1366 |
| 388 | Ga0207652_10434052 | 3300025921 | Bacteria | 1184 |
| 389 | Ga0207652_10530626 | 3300025921 | Bacteria | 1059 |
| 390 | Ga0207646_10003257 | 3300025922 | Bacteria | 18503 |
| 391 | Ga0207646_10010936 | 3300025922 | Bacteria | 8813 |
| 392 | Ga0207646_10227617 | 3300025922 | Bacteria | 1684 |
| 393 | Ga0207646_10337827 | 3300025922 | Bacteria | 1361 |
| 394 | Ga0207646_10513022 | 3300025922 | Bacteria | 1079 |
| 395 | Ga0207681_10431991 | 3300025923 | Bacteria | 1069 |
| 396 | Ga0207650_10010951 | 3300025925 | Bacteria | 6233 |
| 397 | Ga0207659_10116000 | 3300025926 | Bacteria | 2044 |
| 398 | Ga0207659_10386869 | 3300025926 | Bacteria | 1167 |
| 399 | Ga0207687_10020244 | 3300025927 | Bacteria | 4414 |
| 400 | Ga0207687_10027128 | 3300025927 | Bacteria | 3841 |
| 401 | Ga0207687_10028849 | 3300025927 | Bacteria | 3729 |
| 402 | Ga0207687_10074672 | 3300025927 | Unclassified | 2431 |
| 403 | Ga0207700_10060593 | 3300025928 | Bacteria | 2867 |
| 404 | Ga0207700_10079616 | 3300025928 | Bacteria | 2552 |
| 405 | Ga0207700_10110286 | 3300025928 | Bacteria | 2213 |
| 406 | Ga0207664_10016700 | 3300025929 | Bacteria | 5360 |
| 407 | Ga0207664_10141390 | 3300025929 | Bacteria | 2036 |
| 408 | Ga0207664_10249969 | 3300025929 | Bacteria | 1547 |
| 409 | Ga0207664_10284909 | 3300025929 | Bacteria | 1450 |
| 410 | Ga0207664_10362933 | 3300025929 | Bacteria | 1283 |
| 411 | Ga0207644_10268609 | 3300025931 | Bacteria | 1366 |
| 412 | Ga0207690_10037999 | 3300025932 | Bacteria | 3130 |
| 413 | Ga0207690_10237158 | 3300025932 | Bacteria | 1403 |
| 414 | Ga0207690_10496472 | 3300025932 | Bacteria | 987 |
| 415 | Ga0207706_10049875 | 3300025933 | Bacteria | 3699 |
| 416 | Ga0207706_10094871 | 3300025933 | Bacteria | 2624 |
| 417 | Ga0207686_10233774 | 3300025934 | Bacteria | 1334 |
| 418 | Ga0207709_10017746 | 3300025935 | Bacteria | 3978 |
| 419 | Ga0207709_10068356 | 3300025935 | Unclassified | 2245 |
| 420 | Ga0207670_10147357 | 3300025936 | Bacteria | 1742 |
| 421 | Ga0207704_10003174 | 3300025938 | Bacteria | 7441 |
| 422 | Ga0207704_10090206 | 3300025938 | Bacteria | 2011 |
| 423 | Ga0207704_10112229 | 3300025938 | Bacteria | 1846 |
| 424 | Ga0207665_10002976 | 3300025939 | Bacteria | 11360 |
| 425 | Ga0207665_10018558 | 3300025939 | Bacteria | 4569 |
| 426 | Ga0207665_10057948 | 3300025939 | Bacteria | 2617 |
| 427 | Ga0207691_10001755 | 3300025940 | Bacteria | 21340 |
| 428 | Ga0207691_10046257 | 3300025940 | Bacteria | 4000 |
| 429 | Ga0207661_10000201 | 3300025944 | Bacteria | 38650 |
| 430 | Ga0207661_10002757 | 3300025944 | Bacteria | 12095 |
| 431 | Ga0207661_10009671 | 3300025944 | Bacteria | 6924 |
| 432 | Ga0207661_10010459 | 3300025944 | Bacteria | 6680 |
| 433 | Ga0207661_10056215 | 3300025944 | Bacteria | 3159 |
| 434 | Ga0207661_10068415 | 3300025944 | Bacteria | 2892 |
| 435 | Ga0207661_10216815 | 3300025944 | Bacteria | 1690 |
| 436 | Ga0207661_10245970 | 3300025944 | Bacteria | 1588 |
| 437 | Ga0207661_10263153 | 3300025944 | Bacteria | 1537 |
| 438 | Ga0207661_10356026 | 3300025944 | Bacteria | 1321 |
| 439 | Ga0207679_10036426 | 3300025945 | Bacteria | 3489 |
| 440 | Ga0207679_10070406 | 3300025945 | Bacteria | 2635 |
| 441 | Ga0207679_10215149 | 3300025945 | Bacteria | 1614 |
| 442 | Ga0207667_10052081 | 3300025949 | Bacteria | 4313 |
| 443 | Ga0207667_10075232 | 3300025949 | Bacteria | 3507 |
| 444 | Ga0207667_10083657 | 3300025949 | Bacteria | 3304 |
| 445 | Ga0207667_10083914 | 3300025949 | Bacteria | 3298 |
| 446 | Ga0207667_10086985 | 3300025949 | Bacteria | 3233 |
| 447 | Ga0207667_10111711 | 3300025949 | Bacteria | 2818 |
| 448 | Ga0207667_10271048 | 3300025949 | Bacteria | 1735 |
| 449 | Ga0207667_10404179 | 3300025949 | Bacteria | 1390 |
| 450 | Ga0207651_10140063 | 3300025960 | Bacteria | 1867 |
| 451 | Ga0207712_10067585 | 3300025961 | Bacteria | 2558 |
| 452 | Ga0207640_10122345 | 3300025981 | Bacteria | 1867 |
| 453 | Ga0207677_10007340 | 3300026023 | Bacteria | 6089 |
| 454 | Ga0207677_10014913 | 3300026023 | Bacteria | 4552 |
| 455 | Ga0207677_10089545 | 3300026023 | Bacteria | 2234 |
| 456 | Ga0207639_10028058 | 3300026041 | Bacteria | 4106 |
| 457 | Ga0207639_10092125 | 3300026041 | Bacteria | 2428 |
| 458 | Ga0207678_10021047 | 3300026067 | Bacteria | 5717 |
| 459 | Ga0207678_10031345 | 3300026067 | Bacteria | 4638 |
| 460 | Ga0207678_10117281 | 3300026067 | Bacteria | 2272 |
| 461 | Ga0207708_10003971 | 3300026075 | Bacteria | 10887 |
| 462 | Ga0207708_10031574 | 3300026075 | Bacteria | 4021 |
| 463 | Ga0207708_10035802 | 3300026075 | Bacteria | 3777 |
| 464 | Ga0207702_10054613 | 3300026078 | Bacteria | 3385 |
| 465 | Ga0207702_10121978 | 3300026078 | Bacteria | 2334 |
| 466 | Ga0207702_10364862 | 3300026078 | Bacteria | 1385 |
| 467 | Ga0207648_10002974 | 3300026089 | Bacteria | 17907 |
| 468 | Ga0207648_10025033 | 3300026089 | Bacteria | 5320 |
| 469 | Ga0207648_10052994 | 3300026089 | Bacteria | 3547 |
| 470 | Ga0207674_10126655 | 3300026116 | Bacteria | 2520 |
| 471 | Ga0207674_10210356 | 3300026116 | Bacteria | 1894 |
| 472 | Ga0207675_100113166 | 3300026118 | Bacteria | 2562 |
| 473 | Ga0207675_100778403 | 3300026118 | Bacteria | 969 |
| 474 | Ga0207683_10000336 | 3300026121 | Bacteria | 42739 |
| 475 | Ga0207683_10002398 | 3300026121 | Bacteria | 16371 |
| 476 | Ga0207683_10400721 | 3300026121 | Bacteria | 1262 |
| 477 | Ga0207428_10000181 | 3300027907 | Bacteria | 88299 |
| 478 | Ga0207428_10024668 | 3300027907 | Bacteria | 5048 |
| 479 | Ga0207428_10061006 | 3300027907 | Bacteria | 2987 |
| 480 | Ga0268266_10097446 | 3300028379 | Bacteria | 2586 |
| 481 | Ga0268266_10222108 | 3300028379 | Bacteria | 1737 |
| 482 | Ga0265337_1045371 | 3300028556 | Bacteria | 1251 |
| 483 | Ga0265319_1000793 | 3300028563 | Bacteria | 20469 |
| 484 | Ga0265319_1014624 | 3300028563 | Bacteria | 3072 |
| 485 | Ga0265334_10000386 | 3300028573 | Bacteria | 23500 |
| 486 | Ga0265334_10009904 | 3300028573 | Bacteria | 4029 |
| 487 | Ga0265318_10000286 | 3300028577 | Bacteria | 41428 |
| 488 | Ga0265318_10021450 | 3300028577 | Bacteria | 2592 |
| 489 | Ga0265322_10001453 | 3300028654 | Bacteria | 7754 |
| 490 | Ga0265322_10010248 | 3300028654 | Bacteria | 2718 |
| 491 | Ga0265322_10017878 | 3300028654 | Bacteria | 2040 |
| 492 | Ga0265336_10008751 | 3300028666 | Bacteria | 3532 |
| 493 | Ga0265336_10067368 | 3300028666 | Bacteria | 1071 |
| 494 | Ga0265336_10071407 | 3300028666 | Bacteria | 1038 |
| 495 | Ga0265338_10009739 | 3300028800 | Bacteria | 11401 |
| 496 | Ga0265338_10011205 | 3300028800 | Bacteria | 10388 |
| 497 | Ga0265338_10019353 | 3300028800 | Bacteria | 7226 |
| 498 | Ga0265338_10036811 | 3300028800 | Bacteria | 4673 |
| 499 | Ga0265338_10339145 | 3300028800 | Bacteria | 1083 |
| 500 | Ga0265330_10000170 | 3300031235 | Bacteria | 51357 |
| 501 | Ga0265330_10036568 | 3300031235 | Bacteria | 2188 |
| 502 | Ga0265332_10000981 | 3300031238 | Bacteria | 16887 |
| 503 | Ga0265328_10001374 | 3300031239 | Bacteria | 11231 |
| 504 | Ga0265320_10023330 | 3300031240 | Bacteria | 3295 |
| 505 | Ga0265320_10049072 | 3300031240 | Bacteria | 2056 |
| 506 | Ga0265320_10060916 | 3300031240 | Bacteria | 1800 |
| 507 | Ga0265325_10000058 | 3300031241 | Bacteria | 76250 |
| 508 | Ga0265325_10049478 | 3300031241 | Bacteria | 2169 |
| 509 | Ga0265329_10017346 | 3300031242 | Bacteria | 2480 |
| 510 | Ga0265339_10019338 | 3300031249 | Bacteria | 4001 |
| 511 | Ga0265331_10017968 | 3300031250 | Bacteria | 3676 |
| 512 | Ga0265331_10063184 | 3300031250 | Bacteria | 1745 |
| 513 | Ga0265316_10000700 | 3300031344 | Bacteria | 37322 |
| 514 | Ga0265316_10065958 | 3300031344 | Bacteria | 2802 |
| 515 | Ga0265316_10089729 | 3300031344 | Bacteria | 2345 |
| 516 | Ga0307408_100553090 | 3300031548 | Bacteria | 1016 |
| 517 | Ga0265313_10004445 | 3300031595 | Bacteria | 10779 |
| 518 | Ga0265313_10007060 | 3300031595 | Bacteria | 7767 |
| 519 | Ga0265313_10022340 | 3300031595 | Bacteria | 3434 |
| 520 | Ga0265314_10000982 | 3300031711 | Bacteria | 33556 |
| 521 | Ga0265314_10016166 | 3300031711 | Bacteria | 5908 |
| 522 | Ga0265342_10035168 | 3300031712 | Bacteria | 3068 |
| 523 | Ga0265342_10187648 | 3300031712 | Bacteria | 1129 |
| 524 | Ga0307410_10029304 | 3300031852 | Bacteria | 3504 |
| 525 | Ga0307407_10012046 | 3300031903 | Bacteria | 4144 |
| 526 | Ga0307416_100020230 | 3300032002 | Bacteria | 4743 |
| 527 | Ga0307416_100225345 | 3300032002 | Bacteria | 1802 |
| 528 | Ga0307416_100230816 | 3300032002 | Bacteria | 1784 |
| 529 | Ga0307414_10008145 | 3300032004 | Bacteria | 5924 |
| 530 | Ga0307415_100027981 | 3300032126 | Bacteria | 3580 |
| 531 | Ga0307415_100049647 | 3300032126 | Bacteria | 2838 |
| 532 | Ga0307415_100060903 | 3300032126 | Bacteria | 2611 |
| 533 | Ga0373926_0119270 | 3300035083 | Bacteria | 994 |
| 534 | Ga0373944_0010158 | 3300035089 | Bacteria | 2562 |
| 535 | Ga0373944_0018005 | 3300035089 | Bacteria | 2013 |
| 536 | Ga0373936_0012443 | 3300035113 | Bacteria | 3237 |
| 537 | Ga0373936_0072092 | 3300035113 | Bacteria | 1425 |
| 538 | Ga0373939_0045655 | 3300035114 | Bacteria | 1338 |
| 539 | Ga0373945_0010892 | 3300035116 | Bacteria | 2999 |
| 540 | Ga0373960_0021354 | 3300035121 | Bacteria | 1721 |
| 541 | Ga0373943_0002996 | 3300035170 | Bacteria | 7670 |
| 542 | Ga0373943_0004269 | 3300035170 | Bacteria | 6486 |
| 543 | Ga0373943_0019523 | 3300035170 | Bacteria | 3117 |
| 544 | Ga0373943_0047963 | 3300035170 | Bacteria | 2091 |
| 545 | Ga0373943_0344038 | 3300035170 | Bacteria | 854 |
| 546 | Ga0373946_0083899 | 3300035171 | Bacteria | 1400 |
| 547 | Ga0373946_0152879 | 3300035171 | Bacteria | 1078 |
| 548 | Ga0373955_0016428 | 3300035172 | Bacteria | 3643 |
| 549 | Ga0373931_0212180 | 3300035691 | Unclassified | 1162 |
| 550 | Ga0373935_0149716 | 3300035692 | Unclassified | 1583 |
| 551 | Ga0373935_0164504 | 3300035692 | Bacteria | 1514 |
| 552 | Ga0373927_0198982 | 3300035695 | Bacteria | 1315 |
| 553 | Ga0373947_0000833 | 3300035725 | Bacteria | 18617 |
| 554 | Ga0373947_0001712 | 3300035725 | Bacteria | 13442 |
| 555 | Ga0373937_0041775 | 3300036401 | Bacteria | 4183 |
| 556 | Ga0373937_0198068 | 3300036401 | Bacteria | 1888 |
| 557 | Ga0373925_0016345 | 3300037068 | Bacteria | 5373 |
| 558 | Ga0373925_0044987 | 3300037068 | Bacteria | 3278 |
| 559 | Ga0395899_0001122 | 3300037312 | Bacteria | 23915 |
| 560 | Ga0395899_0003567 | 3300037312 | Bacteria | 12317 |
| 561 | Ga0395899_0003675 | 3300037312 | Bacteria | 12146 |
| 562 | Ga0395899_0009564 | 3300037312 | Bacteria | 7441 |
| 563 | Ga0395899_0014177 | 3300037312 | Bacteria | 6081 |
| 564 | Ga0395899_0015791 | 3300037312 | Bacteria | 5757 |
| 565 | Ga0395899_0027155 | 3300037312 | Bacteria | 4318 |
| 566 | Ga0395899_0036471 | 3300037312 | Bacteria | 3688 |
| 567 | Ga0395899_0043149 | 3300037312 | Bacteria | 3364 |
| 568 | Ga0395899_0045379 | 3300037312 | Bacteria | 3275 |
| 569 | Ga0395899_0075332 | 3300037312 | Bacteria | 2464 |
| 570 | Ga0395899_0108555 | 3300037312 | Bacteria | 1997 |
| 571 | Ga0395899_0152547 | 3300037312 | Bacteria | 1636 |
| 572 | Ga0395900_0001349 | 3300037418 | Bacteria | 29640 |
| 573 | Ga0395900_0002317 | 3300037418 | Bacteria | 21119 |
| 574 | Ga0395900_0003438 | 3300037418 | Bacteria | 17122 |
| 575 | Ga0395900_0004581 | 3300037418 | Bacteria | 14587 |
| 576 | Ga0395900_0005036 | 3300037418 | Bacteria | 13871 |
| 577 | Ga0395900_0005715 | 3300037418 | Bacteria | 12998 |
| 578 | Ga0395900_0011577 | 3300037418 | Bacteria | 9027 |
| 579 | Ga0395900_0014881 | 3300037418 | Bacteria | 7926 |
| 580 | Ga0395900_0024327 | 3300037418 | Bacteria | 6201 |
| 581 | Ga0395900_0032544 | 3300037418 | Bacteria | 5362 |
| 582 | Ga0395900_0034179 | 3300037418 | Bacteria | 5234 |
| 583 | Ga0395900_0036326 | 3300037418 | Bacteria | 5079 |
| 584 | Ga0395900_0065851 | 3300037418 | Bacteria | 3722 |
| 585 | Ga0395900_0068057 | 3300037418 | Bacteria | 3659 |
| 586 | Ga0395900_0147508 | 3300037418 | Bacteria | 2405 |
| 587 | Ga0395900_0149433 | 3300037418 | Bacteria | 2387 |
| 588 | Ga0395900_0176430 | 3300037418 | Bacteria | 2173 |
| 589 | Ga0395900_0178244 | 3300037418 | Bacteria | 2161 |
| 590 | Ga0395900_0209854 | 3300037418 | Bacteria | 1967 |
| 591 | Ga0395898_0002618 | 3300037466 | Bacteria | 20929 |
| 592 | Ga0395898_0002928 | 3300037466 | Bacteria | 19413 |
| 593 | Ga0395898_0004496 | 3300037466 | Bacteria | 15252 |
| 594 | Ga0395898_0006072 | 3300037466 | Bacteria | 12965 |
| 595 | Ga0395898_0009074 | 3300037466 | Bacteria | 10472 |
| 596 | Ga0395898_0014383 | 3300037466 | Bacteria | 8133 |
| 597 | Ga0395898_0015704 | 3300037466 | Bacteria | 7759 |
| 598 | Ga0395898_0021626 | 3300037466 | Bacteria | 6520 |
| 599 | Ga0395898_0022174 | 3300037466 | Bacteria | 6434 |
| 600 | Ga0395898_0025821 | 3300037466 | Bacteria | 5915 |
| 601 | Ga0395898_0026581 | 3300037466 | Bacteria | 5821 |
| 602 | Ga0395898_0045256 | 3300037466 | Bacteria | 4326 |
| 603 | Ga0395898_0069052 | 3300037466 | Bacteria | 3419 |
| 604 | Ga0395898_0073070 | 3300037466 | Bacteria | 3312 |
| 605 | Ga0395898_0085464 | 3300037466 | Bacteria | 3041 |
| 606 | Ga0395898_0187663 | 3300037466 | Bacteria | 1975 |
| 607 | Ga0395898_0738309 | 3300037466 | Bacteria | 926 |
| 608 | Ga0395905_0001947 | 3300037471 | Bacteria | 23672 |
| 609 | Ga0395905_0002131 | 3300037471 | Bacteria | 22440 |
| 610 | Ga0395905_0002582 | 3300037471 | Bacteria | 19936 |
| 611 | Ga0395905_0005008 | 3300037471 | Bacteria | 13644 |
| 612 | Ga0395905_0006203 | 3300037471 | Bacteria | 12064 |
| 613 | Ga0395905_0008425 | 3300037471 | Bacteria | 10167 |
| 614 | Ga0395905_0015805 | 3300037471 | Bacteria | 7169 |
| 615 | Ga0395905_0024156 | 3300037471 | Bacteria | 5736 |
| 616 | Ga0395905_0044546 | 3300037471 | Bacteria | 4164 |
| 617 | Ga0395905_0050246 | 3300037471 | Bacteria | 3907 |
| 618 | Ga0395905_0084583 | 3300037471 | Bacteria | 2972 |
| 619 | Ga0395905_0099069 | 3300037471 | Bacteria | 2737 |
| 620 | Ga0395905_0110244 | 3300037471 | Bacteria | 2584 |
| 621 | Ga0395905_0120539 | 3300037471 | Bacteria | 2466 |
| 622 | Ga0395905_0121651 | 3300037471 | Bacteria | 2454 |
| 623 | Ga0395905_0135861 | 3300037471 | Bacteria | 2313 |
| 624 | Ga0395905_0313090 | 3300037471 | Bacteria | 1458 |
| 625 | Ga0395905_0443029 | 3300037471 | Bacteria | 1196 |
| 626 | Ga0436364_0295591 | 3300037853 | Bacteria | 2434 |
| 627 | Ga0395901_0001080 | 3300038443 | Bacteria | 29138 |
| 628 | Ga0395901_0001102 | 3300038443 | Bacteria | 28752 |
| 629 | Ga0395901_0001138 | 3300038443 | Bacteria | 28189 |
| 630 | Ga0395901_0003562 | 3300038443 | Bacteria | 15701 |
| 631 | Ga0395901_0007015 | 3300038443 | Bacteria | 11386 |
| 632 | Ga0395901_0009409 | 3300038443 | Bacteria | 9915 |
| 633 | Ga0395901_0010905 | 3300038443 | Bacteria | 9209 |
| 634 | Ga0395901_0029784 | 3300038443 | Bacteria | 5622 |
| 635 | Ga0395901_0031149 | 3300038443 | Bacteria | 5499 |
| 636 | Ga0395901_0039156 | 3300038443 | Bacteria | 4905 |
| 637 | Ga0395901_0045318 | 3300038443 | Bacteria | 4563 |
| 638 | Ga0395901_0062833 | 3300038443 | Bacteria | 3864 |
| 639 | Ga0395901_0076575 | 3300038443 | Bacteria | 3490 |
| 640 | Ga0395901_0082141 | 3300038443 | Bacteria | 3366 |
| 641 | Ga0395901_0088453 | 3300038443 | Bacteria | 3240 |
| 642 | Ga0395901_0091183 | 3300038443 | Bacteria | 3190 |
| 643 | Ga0395901_0143020 | 3300038443 | Bacteria | 2514 |
| 644 | Ga0395901_0167454 | 3300038443 | Bacteria | 2306 |
| 645 | Ga0395901_0230906 | 3300038443 | Bacteria | 1931 |
| 646 | Ga0395901_0264308 | 3300038443 | Bacteria | 1790 |
| 647 | Ga0395901_0282790 | 3300038443 | Bacteria | 1723 |
| 648 | Ga0395901_0478750 | 3300038443 | Bacteria | 1270 |
| 649 | Ga0395901_0489810 | 3300038443 | Bacteria | 1253 |
| 650 | Ga0395901_0506229 | 3300038443 | Bacteria | 1229 |
| 651 | Ga0395901_0591578 | 3300038443 | Bacteria | 1120 |
| 652 | Ga0395901_0626422 | 3300038443 | Bacteria | 1082 |
| 653 | Ga0395901_0653884 | 3300038443 | Bacteria | 1054 |
| 654 | Ga0395901_0692770 | 3300038443 | Bacteria | 1017 |
| 655 | Ga0436365_0524403 | 3300039437 | Bacteria | 1188 |
| 656 | Ga0436360_0030209 | 3300039438 | Bacteria | 2563 |
| 657 | Ga0439454_011277 | 3300042011 | Bacteria | 1192 |
| 658 | Ga0450920_002093 | 3300042122 | Bacteria | 3372 |
| 659 | Ga0450920_011205 | 3300042122 | Bacteria | 1669 |
| 660 | Ga0450906_007585 | 3300042145 | Bacteria | 2137 |
| 661 | Ga0450907_007292 | 3300042146 | Bacteria | 1848 |
| 662 | Ga0439435_0067289 | 3300042436 | Bacteria | 1055 |
| 663 | Ga0450918_014047 | 3300042531 | Bacteria | 1392 |
| 664 | Ga0466966_0007345 | 3300044684 | Bacteria | 7309 |
| 665 | Ga0466966_0072926 | 3300044684 | Bacteria | 2148 |
| 666 | Ga0466966_0107538 | 3300044684 | Bacteria | 1721 |
| 667 | Ga0466966_0138439 | 3300044684 | Bacteria | 1488 |
| 668 | Ga0466966_0155542 | 3300044684 | Bacteria | 1393 |
| 669 | Ga0466966_0297373 | 3300044684 | Bacteria | 970 |
| 670 | Ga0466961_0025742 | 3300044693 | Bacteria | 3782 |
| 671 | Ga0466961_0041172 | 3300044693 | Bacteria | 2962 |
| 672 | Ga0466961_0043612 | 3300044693 | Bacteria | 2872 |
| 673 | Ga0466963_0002467 | 3300044694 | Bacteria | 10342 |
| 674 | Ga0466963_0003262 | 3300044694 | Bacteria | 9254 |
| 675 | Ga0466963_0004896 | 3300044694 | Bacteria | 7808 |
| 676 | Ga0466963_0011367 | 3300044694 | Bacteria | 5418 |
| 677 | Ga0466963_0014410 | 3300044694 | Bacteria | 4873 |
| 678 | Ga0466963_0019410 | 3300044694 | Bacteria | 4263 |
| 679 | Ga0466963_0040786 | 3300044694 | Bacteria | 3043 |
| 680 | Ga0466963_0163992 | 3300044694 | Bacteria | 1547 |
| 681 | Ga0466963_0217901 | 3300044694 | Bacteria | 1336 |
| 682 | Ga0466963_0226032 | 3300044694 | Bacteria | 1311 |
| 683 | Ga0466963_0295502 | 3300044694 | Bacteria | 1139 |
| 684 | Ga0466963_0386235 | 3300044694 | Bacteria | 987 |
| 685 | Ga0466964_0018528 | 3300044706 | Bacteria | 2672 |
| 686 | Ga0466964_0027730 | 3300044706 | Bacteria | 2225 |
| 687 | Ga0466964_0034153 | 3300044706 | Bacteria | 2029 |
| 688 | Ga0466964_0105857 | 3300044706 | Bacteria | 1247 |
| 689 | Ga0466971_0052537 | 3300044719 | Bacteria | 1835 |
| 690 | Ga0466968_0048332 | 3300044735 | Bacteria | 1810 |
| 691 | Ga0466970_0110321 | 3300044765 | Bacteria | 1502 |
| 692 | Ga0466970_0205699 | 3300044765 | Bacteria | 1096 |
| 693 | Ga0466957_0000320 | 3300044842 | Bacteria | 23320 |
| 694 | Ga0466957_0022515 | 3300044842 | Bacteria | 3719 |
| 695 | Ga0466957_0043882 | 3300044842 | Bacteria | 2709 |
| 696 | Ga0466957_0063556 | 3300044842 | Bacteria | 2269 |
| 697 | Ga0466957_0084439 | 3300044842 | Bacteria | 1982 |
| 698 | Ga0466957_0112594 | 3300044842 | Bacteria | 1727 |
| 699 | Ga0466959_0001566 | 3300045049 | Bacteria | 14087 |
| 700 | Ga0466959_0008520 | 3300045049 | Bacteria | 7256 |
| 701 | Ga0466959_0070655 | 3300045049 | Bacteria | 2529 |
| 702 | Ga0451576_0219917 | 3300045051 | Bacteria | 1983 |
| 703 | Ga0466958_0002644 | 3300045836 | Bacteria | 9059 |
| 704 | Ga0466958_0003728 | 3300045836 | Bacteria | 7955 |
| 705 | Ga0466958_0020531 | 3300045836 | Bacteria | 3854 |
| 706 | Ga0466958_0031910 | 3300045836 | Bacteria | 3131 |
| 707 | Ga0466958_0081214 | 3300045836 | Bacteria | 1995 |
| 708 | Ga0466958_0083725 | 3300045836 | Bacteria | 1966 |
| 709 | Ga0466958_0196188 | 3300045836 | Bacteria | 1284 |
| 710 | Ga0466958_0227667 | 3300045836 | Bacteria | 1190 |
| 711 | Ga0466967_0000433 | 3300045976 | Bacteria | 19966 |
| 712 | Ga0466967_0003672 | 3300045976 | Bacteria | 10098 |
| 713 | Ga0466967_0005278 | 3300045976 | Bacteria | 8914 |
| 714 | Ga0466967_0005373 | 3300045976 | Bacteria | 8864 |
| 715 | Ga0466967_0006777 | 3300045976 | Bacteria | 8159 |
| 716 | Ga0466967_0023511 | 3300045976 | Bacteria | 5051 |
| 717 | Ga0466967_0025397 | 3300045976 | Bacteria | 4885 |
| 718 | Ga0466967_0036147 | 3300045976 | Bacteria | 4214 |
| 719 | Ga0466967_0045092 | 3300045976 | Bacteria | 3829 |
| 720 | Ga0466967_0045547 | 3300045976 | Bacteria | 3812 |
| 721 | Ga0466967_0055596 | 3300045976 | Bacteria | 3486 |
| 722 | Ga0466967_0076599 | 3300045976 | Bacteria | 3009 |
| 723 | Ga0466967_0101528 | 3300045976 | Bacteria | 2630 |
| 724 | Ga0466967_0164052 | 3300045976 | Bacteria | 2087 |
| 725 | Ga0466967_0274943 | 3300045976 | Bacteria | 1615 |
| 726 | Ga0466967_0309850 | 3300045976 | Bacteria | 1520 |
| 727 | Ga0466967_0313094 | 3300045976 | Bacteria | 1512 |
| 728 | Ga0466967_0327137 | 3300045976 | Bacteria | 1480 |
| 729 | Ga0466967_0334028 | 3300045976 | Bacteria | 1464 |
| 730 | Ga0466967_0356058 | 3300045976 | Bacteria | 1417 |
| 731 | Ga0466967_0393684 | 3300045976 | Bacteria | 1347 |
| 732 | Ga0466967_0445857 | 3300045976 | Bacteria | 1264 |
| 733 | Ga0495592_0078399 | 3300046454 | Bacteria | 2393 |
| 734 | Ga0495592_0107950 | 3300046454 | Bacteria | 1973 |
| 735 | Ga0495603_0235075 | 3300046455 | Bacteria | 1056 |
| 736 | Ga0495629_0000983 | 3300046459 | Bacteria | 22888 |
| 737 | Ga0495629_0005386 | 3300046459 | Bacteria | 9545 |
| 738 | Ga0495629_0034794 | 3300046459 | Bacteria | 3561 |
| 739 | Ga0495629_0096744 | 3300046459 | Bacteria | 2059 |
| 740 | Ga0495629_0141512 | 3300046459 | Bacteria | 1674 |
| 741 | Ga0495629_0169960 | 3300046459 | Bacteria | 1513 |
| 742 | Ga0495641_0000513 | 3300046461 | Bacteria | 32468 |
| 743 | Ga0495641_0013891 | 3300046461 | Bacteria | 4390 |
| 744 | Ga0495651_0008831 | 3300046462 | Bacteria | 7731 |
| 745 | Ga0495651_0028727 | 3300046462 | Bacteria | 4333 |
| 746 | Ga0495651_0036582 | 3300046462 | Bacteria | 3822 |
| 747 | Ga0495651_0057837 | 3300046462 | Bacteria | 2976 |
| 748 | Ga0495651_0195228 | 3300046462 | Bacteria | 1421 |
| 749 | Ga0495653_0015091 | 3300046463 | Bacteria | 6296 |
| 750 | Ga0495653_0052672 | 3300046463 | Bacteria | 3118 |
| 751 | Ga0495653_0064933 | 3300046463 | Bacteria | 2749 |
| 752 | Ga0495653_0188068 | 3300046463 | Bacteria | 1411 |
| 753 | Ga0495582_0000553 | 3300046473 | Bacteria | 20635 |
| 754 | Ga0495582_0024252 | 3300046473 | Bacteria | 3317 |
| 755 | Ga0495582_0029202 | 3300046473 | Bacteria | 3027 |
| 756 | Ga0495582_0112345 | 3300046473 | Bacteria | 1531 |
| 757 | Ga0495582_0184146 | 3300046473 | Bacteria | 1190 |
| 758 | Ga0495605_0058685 | 3300046474 | Bacteria | 1849 |
| 759 | Ga0495639_0007896 | 3300046475 | Bacteria | 4573 |
| 760 | Ga0495662_0004812 | 3300046476 | Bacteria | 6766 |
| 761 | Ga0495662_0033415 | 3300046476 | Bacteria | 2485 |
| 762 | Ga0495584_0009844 | 3300046491 | Bacteria | 4917 |
| 763 | Ga0495584_0093197 | 3300046491 | Bacteria | 1520 |
| 764 | Ga0495594_0089921 | 3300046499 | Bacteria | 1720 |
| 765 | Ga0495607_0030538 | 3300046501 | Bacteria | 3307 |
| 766 | Ga0495608_0010647 | 3300046511 | Bacteria | 6416 |
| 767 | Ga0495608_0010965 | 3300046511 | Bacteria | 6317 |
| 768 | Ga0495608_0266532 | 3300046511 | Bacteria | 1065 |
| 769 | Ga0495618_0049002 | 3300046514 | Bacteria | 2668 |
| 770 | Ga0495628_0047013 | 3300046516 | Bacteria | 3426 |
| 771 | Ga0495628_0074653 | 3300046516 | Bacteria | 2641 |
| 772 | Ga0495628_0127796 | 3300046516 | Bacteria | 1946 |
| 773 | Ga0495630_0030060 | 3300046517 | Bacteria | 4039 |
| 774 | Ga0495630_0048094 | 3300046517 | Bacteria | 3192 |
| 775 | Ga0495630_0070624 | 3300046517 | Bacteria | 2627 |
| 776 | Ga0495630_0391229 | 3300046517 | Bacteria | 1065 |
| 777 | Ga0495630_0432050 | 3300046517 | Bacteria | 1009 |
| 778 | Ga0495666_0054385 | 3300046526 | Bacteria | 1920 |
| 779 | Ga0495642_0028078 | 3300046528 | Bacteria | 2240 |
| 780 | Ga0495652_0033764 | 3300046529 | Bacteria | 4463 |
| 781 | Ga0495652_0035874 | 3300046529 | Bacteria | 4314 |
| 782 | Ga0495652_0317714 | 3300046529 | Bacteria | 1126 |
| 783 | Ga0495652_0328103 | 3300046529 | Bacteria | 1103 |
| 784 | Ga0495665_0010478 | 3300046531 | Bacteria | 5017 |
| 785 | Ga0495640_0015840 | 3300046533 | Bacteria | 5658 |
| 786 | Ga0495640_0145796 | 3300046533 | Unclassified | 1523 |
| 787 | Ga0495640_0221328 | 3300046533 | Bacteria | 1194 |
| 788 | Ga0495586_0182651 | 3300046535 | Bacteria | 1187 |
| 789 | Ga0495587_0016056 | 3300046536 | Bacteria | 4660 |
| 790 | Ga0495587_0093812 | 3300046536 | Bacteria | 1733 |
| 791 | Ga0495587_0258003 | 3300046536 | Bacteria | 979 |
| 792 | Ga0495609_0042385 | 3300046538 | Bacteria | 2044 |
| 793 | Ga0495645_0012630 | 3300046543 | Bacteria | 5956 |
| 794 | Ga0495667_0004861 | 3300046559 | Bacteria | 9084 |
| 795 | Ga0495667_0011321 | 3300046559 | Bacteria | 6039 |
| 796 | Ga0495667_0034880 | 3300046559 | Bacteria | 3364 |
| 797 | Ga0495656_0021831 | 3300046615 | Bacteria | 2498 |
| 798 | Ga0495656_0025895 | 3300046615 | Bacteria | 2330 |
| 799 | Ga0495634_0017514 | 3300046642 | Bacteria | 5109 |
| 800 | Ga0495634_0080784 | 3300046642 | Bacteria | 2127 |
| 801 | Ga0495634_0083952 | 3300046642 | Bacteria | 2078 |
| 802 | Ga0495635_0017038 | 3300046663 | Bacteria | 5075 |
| 803 | Ga0495635_0023772 | 3300046663 | Bacteria | 4270 |
| 804 | Ga0495635_0029893 | 3300046663 | Bacteria | 3788 |
| 805 | Ga0495659_0010780 | 3300046664 | Bacteria | 2941 |
| 806 | Ga0495588_0001267 | 3300046674 | Bacteria | 10837 |
| 807 | Ga0495657_0006323 | 3300046675 | Bacteria | 9282 |
| 808 | Ga0495657_0022761 | 3300046675 | Bacteria | 4484 |
| 809 | Ga0495657_0062826 | 3300046675 | Bacteria | 2452 |
| 810 | Ga0495657_0112843 | 3300046675 | Bacteria | 1720 |
| 811 | Ga0495599_0088633 | 3300046678 | Bacteria | 1932 |
| 812 | Ga0495623_0018829 | 3300046679 | Bacteria | 4457 |
| 813 | Ga0495623_0265680 | 3300046679 | Bacteria | 960 |
| 814 | Ga0495646_0033710 | 3300046680 | Bacteria | 3183 |
| 815 | Ga0495646_0055715 | 3300046680 | Bacteria | 2373 |
| 816 | Ga0495658_0000300 | 3300046683 | Bacteria | 28107 |
| 817 | Ga0495658_0146923 | 3300046683 | Bacteria | 1446 |
| 818 | Ga0495613_0010487 | 3300046689 | Bacteria | 6879 |
| 819 | Ga0495613_0101516 | 3300046689 | Bacteria | 2078 |
| 820 | Ga0495670_0067555 | 3300046691 | Bacteria | 1805 |
| 821 | Ga0495589_0016095 | 3300046794 | Bacteria | 3842 |
| 822 | Ga0495600_0102147 | 3300046809 | Bacteria | 1869 |
| 823 | Ga0495581_0019593 | 3300047315 | Bacteria | 3926 |
| 824 | Ga0495581_0082333 | 3300047315 | Bacteria | 1864 |
| 825 | Ga0495581_0182959 | 3300047315 | Bacteria | 1226 |
| 826 | Ga0495581_0183047 | 3300047315 | Bacteria | 1225 |
| 827 | Ga0495604_0133055 | 3300047317 | Bacteria | 1785 |
| 828 | Ga0495604_0269756 | 3300047317 | Bacteria | 1153 |
| 829 | Ga0495674_0003155 | 3300047319 | Bacteria | 16010 |
| 830 | Ga0495674_0050062 | 3300047319 | Bacteria | 3687 |
| 831 | Ga0495674_0320536 | 3300047319 | Bacteria | 1263 |
| 832 | Ga0495676_0001459 | 3300047321 | Bacteria | 20404 |
| 833 | Ga0495676_0035504 | 3300047321 | Bacteria | 4168 |
| 834 | Ga0495676_0036083 | 3300047321 | Bacteria | 4131 |
| 835 | Ga0495680_0003282 | 3300047322 | Bacteria | 16027 |
| 836 | Ga0495680_0004330 | 3300047322 | Bacteria | 13597 |
| 837 | Ga0495680_0009818 | 3300047322 | Bacteria | 8582 |
| 838 | Ga0495680_0046182 | 3300047322 | Bacteria | 3435 |
| 839 | Ga0495680_0078517 | 3300047322 | Bacteria | 2498 |
| 840 | Ga0495675_0049893 | 3300047444 | Bacteria | 2659 |
| 841 | Ga0495675_0079610 | 3300047444 | Bacteria | 2064 |
| 842 | Ga0495677_0011247 | 3300047445 | Bacteria | 3277 |
| 843 | Ga0495593_0006091 | 3300047673 | Bacteria | 7094 |
| 844 | Ga0495593_0102297 | 3300047673 | Bacteria | 1469 |
| 845 | Ga0495593_0112650 | 3300047673 | Bacteria | 1388 |
| 846 | Ga0495602_0186760 | 3300048088 | Bacteria | 1593 |
| 847 | Ga0495602_0278559 | 3300048088 | Bacteria | 1233 |
| 848 | Ga0495614_0044451 | 3300048089 | Bacteria | 1905 |
| 849 | Ga0495614_0077464 | 3300048089 | Bacteria | 1438 |
| 850 | Ga0496100_0004882 | 3300048903 | Bacteria | 7168 |
| 851 | Ga0496100_0025294 | 3300048903 | Bacteria | 3630 |
| 852 | Ga0496100_0033693 | 3300048903 | Bacteria | 3207 |
| 853 | Ga0496100_0509100 | 3300048903 | Bacteria | 928 |
| 854 | Ga0496101_0001389 | 3300048904 | Bacteria | 14495 |
| 855 | Ga0496101_0003760 | 3300048904 | Bacteria | 9478 |
| 856 | Ga0496101_0004977 | 3300048904 | Bacteria | 8437 |
| 857 | Ga0496101_0027434 | 3300048904 | Bacteria | 3967 |
| 858 | Ga0496101_0096938 | 3300048904 | Bacteria | 2201 |
| 859 | Ga0496101_0107889 | 3300048904 | Bacteria | 2092 |
| 860 | Ga0496101_0139754 | 3300048904 | Bacteria | 1845 |
| 861 | Ga0496101_0168157 | 3300048904 | Unclassified | 1684 |
| 862 | Ga0496101_0326731 | 3300048904 | Bacteria | 1204 |
| 863 | Ga0496102_0003545 | 3300048905 | Bacteria | 13216 |
| 864 | Ga0496102_0051719 | 3300048905 | Bacteria | 3742 |
| 865 | Ga0496102_0058391 | 3300048905 | Bacteria | 3525 |
| 866 | Ga0496102_0069568 | 3300048905 | Bacteria | 3231 |
| 867 | Ga0496102_0142564 | 3300048905 | Bacteria | 2247 |
| 868 | Ga0496102_0163665 | 3300048905 | Bacteria | 2093 |
| 869 | Ga0496102_0323173 | 3300048905 | Bacteria | 1453 |
| 870 | Ga0496102_0359344 | 3300048905 | Bacteria | 1371 |
| 871 | Ga0496102_0409707 | 3300048905 | Bacteria | 1274 |
| 872 | Ga0496103_0009466 | 3300048906 | Bacteria | 5768 |
| 873 | Ga0496103_0098195 | 3300048906 | Bacteria | 1852 |
| 874 | Ga0496103_0166468 | 3300048906 | Bacteria | 1414 |
| 875 | Ga0496104_0023166 | 3300048907 | Bacteria | 5708 |
| 876 | Ga0496104_0048118 | 3300048907 | Bacteria | 4020 |
| 877 | Ga0496104_0089064 | 3300048907 | Bacteria | 2948 |
| 878 | Ga0496104_0089328 | 3300048907 | Bacteria | 2944 |
| 879 | Ga0496104_0208456 | 3300048907 | Bacteria | 1866 |
| 880 | Ga0496104_0586477 | 3300048907 | Bacteria | 1025 |
| 881 | Ga0496104_0618704 | 3300048907 | Unclassified | 993 |
| 882 | Ga0496105_0005175 | 3300048908 | Bacteria | 9889 |
| 883 | Ga0496105_0008326 | 3300048908 | Bacteria | 8060 |
| 884 | Ga0496105_0038665 | 3300048908 | Bacteria | 3930 |
| 885 | Ga0496105_0064818 | 3300048908 | Bacteria | 3015 |
| 886 | Ga0496105_0086200 | 3300048908 | Bacteria | 2595 |
| 887 | Ga0496106_0009146 | 3300048909 | Bacteria | 7316 |
| 888 | Ga0496106_0016076 | 3300048909 | Bacteria | 5533 |
| 889 | Ga0496106_0025577 | 3300048909 | Bacteria | 4394 |
| 890 | Ga0496106_0037974 | 3300048909 | Bacteria | 3603 |
| 891 | Ga0496106_0410340 | 3300048909 | Bacteria | 1089 |
| 892 | Ga0496107_0011757 | 3300048910 | Bacteria | 6106 |
| 893 | Ga0496107_0016606 | 3300048910 | Bacteria | 5172 |
| 894 | Ga0496107_0024830 | 3300048910 | Bacteria | 4241 |
| 895 | Ga0496107_0073591 | 3300048910 | Bacteria | 2485 |
| 896 | Ga0496108_0004497 | 3300048911 | Bacteria | 11232 |
| 897 | Ga0496108_0017997 | 3300048911 | Bacteria | 5780 |
| 898 | Ga0496108_0049009 | 3300048911 | Bacteria | 3533 |
| 899 | Ga0496108_0054923 | 3300048911 | Unclassified | 3343 |
| 900 | Ga0496108_0188418 | 3300048911 | Bacteria | 1787 |
| 901 | Ga0496108_0293878 | 3300048911 | Bacteria | 1415 |
| 902 | Ga0496108_0294878 | 3300048911 | Bacteria | 1412 |
| 903 | Ga0496109_0010777 | 3300048912 | Bacteria | 7825 |
| 904 | Ga0496109_0025155 | 3300048912 | Bacteria | 5302 |
| 905 | Ga0496109_0033171 | 3300048912 | Bacteria | 4644 |
| 906 | Ga0496109_0037156 | 3300048912 | Bacteria | 4400 |
| 907 | Ga0496109_0089941 | 3300048912 | Bacteria | 2839 |
| 908 | Ga0496109_0174307 | 3300048912 | Bacteria | 2018 |
| 909 | Ga0496109_0185597 | 3300048912 | Bacteria | 1954 |
| 910 | Ga0496109_0251956 | 3300048912 | Bacteria | 1663 |
| 911 | Ga0496109_0257922 | 3300048912 | Bacteria | 1642 |
| 912 | Ga0496109_0383252 | 3300048912 | Bacteria | 1328 |
| 913 | Ga0496110_0002589 | 3300048913 | Bacteria | 13606 |
| 914 | Ga0496110_0032189 | 3300048913 | Bacteria | 4527 |
| 915 | Ga0496110_0039149 | 3300048913 | Bacteria | 4127 |
| 916 | Ga0496110_0041405 | 3300048913 | Bacteria | 4019 |
| 917 | Ga0496110_0048802 | 3300048913 | Bacteria | 3712 |
| 918 | Ga0496110_0065340 | 3300048913 | Bacteria | 3216 |
| 919 | Ga0496110_0258403 | 3300048913 | Bacteria | 1585 |
| 920 | Ga0496110_0266724 | 3300048913 | Bacteria | 1559 |
| 921 | Ga0496110_0485042 | 3300048913 | Bacteria | 1126 |
| 922 | Ga0496111_0005335 | 3300048914 | Bacteria | 8216 |
| 923 | Ga0496111_0007386 | 3300048914 | Bacteria | 7197 |
| 924 | Ga0496111_0007877 | 3300048914 | Bacteria | 7021 |
| 925 | Ga0496111_0017416 | 3300048914 | Bacteria | 4968 |
| 926 | Ga0496112_0001415 | 3300048915 | Bacteria | 18349 |
| 927 | Ga0496112_0003186 | 3300048915 | Bacteria | 13491 |
| 928 | Ga0496112_0016093 | 3300048915 | Bacteria | 6993 |
| 929 | Ga0496112_0017575 | 3300048915 | Bacteria | 6723 |
| 930 | Ga0496112_0056051 | 3300048915 | Bacteria | 3878 |
| 931 | Ga0496112_0066559 | 3300048915 | Bacteria | 3555 |
| 932 | Ga0496112_0069221 | 3300048915 | Bacteria | 3486 |
| 933 | Ga0496112_0160331 | 3300048915 | Bacteria | 2216 |
| 934 | Ga0496112_0241187 | 3300048915 | Bacteria | 1760 |
| 935 | Ga0496112_0262402 | 3300048915 | Bacteria | 1677 |
| 936 | Ga0496113_0026770 | 3300048916 | Bacteria | 4127 |
| 937 | Ga0496113_0112846 | 3300048916 | Bacteria | 2118 |
| 938 | Ga0496113_0427377 | 3300048916 | Bacteria | 1064 |
| 939 | Ga0496113_0576068 | 3300048916 | Bacteria | 902 |
| 940 | Ga0496114_0000593 | 3300048917 | Bacteria | 26747 |
| 941 | Ga0496114_0003060 | 3300048917 | Bacteria | 12810 |
| 942 | Ga0496114_0004918 | 3300048917 | Bacteria | 10410 |
| 943 | Ga0496114_0010412 | 3300048917 | Bacteria | 7397 |
| 944 | Ga0496114_0012526 | 3300048917 | Bacteria | 6791 |
| 945 | Ga0496114_0031336 | 3300048917 | Bacteria | 4376 |
| 946 | Ga0496114_0118729 | 3300048917 | Bacteria | 2272 |
| 947 | Ga0496114_0132376 | 3300048917 | Bacteria | 2154 |
| 948 | Ga0496115_0002884 | 3300048918 | Bacteria | 12387 |
| 949 | Ga0496115_0019565 | 3300048918 | Bacteria | 5212 |
| 950 | Ga0496115_0023989 | 3300048918 | Bacteria | 4737 |
| 951 | Ga0496115_0060072 | 3300048918 | Bacteria | 3062 |
| 952 | Ga0496115_0550829 | 3300048918 | Bacteria | 922 |
| 953 | Ga0501031_0003201 | 3300049568 | Bacteria | 10506 |
| 954 | Ga0501031_0010316 | 3300049568 | Bacteria | 6086 |
| 955 | Ga0501031_0027189 | 3300049568 | Bacteria | 3730 |
| 956 | Ga0501031_0028064 | 3300049568 | Bacteria | 3668 |
| 957 | Ga0501032_0003510 | 3300049569 | Bacteria | 11978 |
| 958 | Ga0501032_0034078 | 3300049569 | Bacteria | 3487 |
| 959 | Ga0501032_0145374 | 3300049569 | Bacteria | 1561 |
| 960 | Ga0501032_0214418 | 3300049569 | Bacteria | 1254 |
| 961 | Ga0501032_0271383 | 3300049569 | Bacteria | 1099 |
| 962 | Ga0501033_0009336 | 3300049570 | Bacteria | 7552 |
| 963 | Ga0501033_0011029 | 3300049570 | Bacteria | 6920 |
| 964 | Ga0501033_0251144 | 3300049570 | Bacteria | 1253 |
| 965 | Ga0501033_0305487 | 3300049570 | Bacteria | 1119 |
| 966 | Ga0501034_0052801 | 3300049571 | Bacteria | 4094 |
| 967 | Ga0501034_0110725 | 3300049571 | Bacteria | 2737 |
| 968 | Ga0501036_0016353 | 3300049572 | Bacteria | 6198 |
| 969 | Ga0501036_0018678 | 3300049572 | Bacteria | 5813 |
| 970 | Ga0501036_0037239 | 3300049572 | Bacteria | 4115 |
| 971 | Ga0501036_0143921 | 3300049572 | Bacteria | 2011 |
| 972 | Ga0501036_0230343 | 3300049572 | Unclassified | 1555 |
| 973 | Ga0501037_0005161 | 3300049573 | Bacteria | 9501 |
| 974 | Ga0501037_0032379 | 3300049573 | Bacteria | 3860 |
| 975 | Ga0501037_0040856 | 3300049573 | Bacteria | 3413 |
| 976 | Ga0501037_0155602 | 3300049573 | Bacteria | 1632 |
| 977 | Ga0501038_0002125 | 3300049574 | Bacteria | 18378 |
| 978 | Ga0501038_0028671 | 3300049574 | Bacteria | 4944 |
| 979 | Ga0501038_0130409 | 3300049574 | Unclassified | 2064 |
| 980 | Ga0501038_0237867 | 3300049574 | Bacteria | 1447 |
| 981 | Ga0501038_0240788 | 3300049574 | Bacteria | 1436 |
| 982 | Ga0501039_0008922 | 3300049575 | Bacteria | 7639 |
| 983 | Ga0501039_0011096 | 3300049575 | Bacteria | 6866 |
| 984 | Ga0501039_0041616 | 3300049575 | Bacteria | 3549 |
| 985 | Ga0501039_0097716 | 3300049575 | Bacteria | 2290 |
| 986 | Ga0501040_0008306 | 3300049576 | Bacteria | 6752 |
| 987 | Ga0501040_0041715 | 3300049576 | Bacteria | 3125 |
| 988 | Ga0501040_0275674 | 3300049576 | Bacteria | 1201 |
| 989 | Ga0501041_0002077 | 3300049577 | Bacteria | 11274 |
| 990 | Ga0501041_0005126 | 3300049577 | Bacteria | 7643 |
| 991 | Ga0501041_0019846 | 3300049577 | Bacteria | 4015 |
| 992 | Ga0501041_0096415 | 3300049577 | Bacteria | 1828 |
| 993 | Ga0501042_0003373 | 3300049578 | Bacteria | 10017 |
| 994 | Ga0501042_0014660 | 3300049578 | Bacteria | 5353 |
| 995 | Ga0501042_0055816 | 3300049578 | Unclassified | 2819 |
| 996 | Ga0501042_0081887 | 3300049578 | Bacteria | 2313 |
| 997 | Ga0501042_0117341 | 3300049578 | Bacteria | 1916 |
| 998 | Ga0501042_0193332 | 3300049578 | Bacteria | 1467 |
| 999 | Ga0501042_0338062 | 3300049578 | Bacteria | 1088 |
| 1000 | Ga0501043_0020365 | 3300049579 | Bacteria | 5203 |
| 1001 | Ga0501043_0037251 | 3300049579 | Bacteria | 3825 |
| 1002 | Ga0501043_0363167 | 3300049579 | Bacteria | 1099 |
| 1003 | Ga0501046_0019560 | 3300049580 | Bacteria | 5614 |
| 1004 | Ga0501046_0305282 | 3300049580 | Bacteria | 1161 |
| 1005 | Ga0501048_0004447 | 3300049582 | Bacteria | 10681 |
| 1006 | Ga0501048_0030532 | 3300049582 | Bacteria | 3898 |
| 1007 | Ga0501048_0030933 | 3300049582 | Bacteria | 3874 |
| 1008 | Ga0501048_0045087 | 3300049582 | Bacteria | 3151 |
| 1009 | Ga0501048_0072852 | 3300049582 | Bacteria | 2424 |
| 1010 | Ga0501067_0009512 | 3300049583 | Bacteria | 5383 |
| 1011 | Ga0501067_0085384 | 3300049583 | Bacteria | 1751 |
| 1012 | Ga0501068_0001537 | 3300049584 | Bacteria | 12263 |
| 1013 | Ga0501068_0005706 | 3300049584 | Bacteria | 6821 |
| 1014 | Ga0501068_0006272 | 3300049584 | Bacteria | 6544 |
| 1015 | Ga0501068_0025712 | 3300049584 | Bacteria | 3464 |
| 1016 | Ga0501068_0093277 | 3300049584 | Bacteria | 1860 |
| 1017 | Ga0501069_0005348 | 3300049585 | Bacteria | 6678 |
| 1018 | Ga0501069_0005484 | 3300049585 | Bacteria | 6600 |
| 1019 | Ga0501069_0006946 | 3300049585 | Bacteria | 5918 |
| 1020 | Ga0501069_0017146 | 3300049585 | Bacteria | 3894 |
| 1021 | Ga0501069_0106449 | 3300049585 | Bacteria | 1594 |
| 1022 | Ga0501069_0114398 | 3300049585 | Bacteria | 1538 |
| 1023 | Ga0501070_0000932 | 3300049586 | Bacteria | 26359 |
| 1024 | Ga0501070_0002071 | 3300049586 | Bacteria | 17606 |
| 1025 | Ga0501070_0011151 | 3300049586 | Bacteria | 7586 |
| 1026 | Ga0501070_0020037 | 3300049586 | Bacteria | 5608 |
| 1027 | Ga0501070_0121834 | 3300049586 | Bacteria | 2155 |
| 1028 | Ga0501070_0213984 | 3300049586 | Bacteria | 1581 |
| 1029 | Ga0501070_0356231 | 3300049586 | Bacteria | 1187 |
| 1030 | Ga0501071_0008317 | 3300049587 | Bacteria | 6854 |
| 1031 | Ga0501071_0010584 | 3300049587 | Bacteria | 6187 |
| 1032 | Ga0501071_0017401 | 3300049587 | Bacteria | 4956 |
| 1033 | Ga0501071_0068518 | 3300049587 | Bacteria | 2582 |
| 1034 | Ga0501071_0163411 | 3300049587 | Bacteria | 1665 |
| 1035 | Ga0501071_0241836 | 3300049587 | Unclassified | 1361 |
| 1036 | Ga0501072_0008089 | 3300049588 | Bacteria | 7980 |
| 1037 | Ga0501072_0011971 | 3300049588 | Bacteria | 6627 |
| 1038 | Ga0501072_0022954 | 3300049588 | Bacteria | 4843 |
| 1039 | Ga0501072_0035498 | 3300049588 | Bacteria | 3905 |
| 1040 | Ga0501072_0040293 | 3300049588 | Bacteria | 3668 |
| 1041 | Ga0501072_0065467 | 3300049588 | Bacteria | 2866 |
| 1042 | Ga0501072_0093560 | 3300049588 | Bacteria | 2388 |
| 1043 | Ga0501072_0101103 | 3300049588 | Bacteria | 2291 |
| 1044 | Ga0501072_0164049 | 3300049588 | Bacteria | 1772 |
| 1045 | Ga0501073_0029889 | 3300049589 | Bacteria | 3891 |
| 1046 | Ga0501073_0075243 | 3300049589 | Bacteria | 2350 |
| 1047 | Ga0501073_0096106 | 3300049589 | Bacteria | 2057 |
| 1048 | Ga0501073_0268369 | 3300049589 | Bacteria | 1178 |
| 1049 | Ga0501074_0009335 | 3300049590 | Bacteria | 7125 |
| 1050 | Ga0501074_0029313 | 3300049590 | Bacteria | 3986 |
| 1051 | Ga0501074_0092050 | 3300049590 | Bacteria | 2171 |
| 1052 | Ga0501074_0138061 | 3300049590 | Bacteria | 1744 |
| 1053 | Ga0501074_0180786 | 3300049590 | Bacteria | 1505 |
| 1054 | Ga0501075_0003177 | 3300049591 | Bacteria | 11004 |
| 1055 | Ga0501075_0009635 | 3300049591 | Bacteria | 6763 |
| 1056 | Ga0501075_0051824 | 3300049591 | Bacteria | 3086 |
| 1057 | Ga0501075_0098589 | 3300049591 | Bacteria | 2218 |
| 1058 | Ga0501075_0133061 | 3300049591 | Bacteria | 1895 |
| 1059 | Ga0501075_0246597 | 3300049591 | Bacteria | 1361 |
| 1060 | Ga0501076_0006779 | 3300049592 | Bacteria | 8310 |
| 1061 | Ga0501076_0008556 | 3300049592 | Bacteria | 7504 |
| 1062 | Ga0501076_0016816 | 3300049592 | Bacteria | 5551 |
| 1063 | Ga0501076_0038033 | 3300049592 | Unclassified | 3776 |
| 1064 | Ga0501076_0056547 | 3300049592 | Bacteria | 3114 |
| 1065 | Ga0501076_0060231 | 3300049592 | Bacteria | 3020 |
| 1066 | Ga0501076_0081383 | 3300049592 | Bacteria | 2600 |
| 1067 | Ga0501076_0482884 | 3300049592 | Bacteria | 1021 |
| 1068 | Ga0501077_0002696 | 3300049593 | Bacteria | 10645 |
| 1069 | Ga0501077_0004113 | 3300049593 | Bacteria | 8782 |
| 1070 | Ga0501077_0021974 | 3300049593 | Bacteria | 4040 |
| 1071 | Ga0501077_0043824 | 3300049593 | Bacteria | 2843 |
| 1072 | Ga0501077_0046241 | 3300049593 | Bacteria | 2766 |
| 1073 | Ga0501077_0053737 | 3300049593 | Bacteria | 2557 |
| 1074 | Ga0501079_0002599 | 3300049741 | Bacteria | 13122 |
| 1075 | Ga0501079_0006044 | 3300049741 | Bacteria | 9074 |
| 1076 | Ga0501079_0018929 | 3300049741 | Bacteria | 5261 |
| 1077 | Ga0501079_0112580 | 3300049741 | Bacteria | 2115 |
| 1078 | Ga0501079_0128028 | 3300049741 | Unclassified | 1975 |
| 1079 | Ga0501079_0302104 | 3300049741 | Bacteria | 1252 |
| 1080 | Ga0501080_0003099 | 3300049742 | Bacteria | 14676 |
| 1081 | Ga0501080_0009875 | 3300049742 | Bacteria | 8718 |
| 1082 | Ga0501080_0011017 | 3300049742 | Bacteria | 8277 |
| 1083 | Ga0501080_0015234 | 3300049742 | Bacteria | 7086 |
| 1084 | Ga0501080_0015236 | 3300049742 | Bacteria | 7086 |
| 1085 | Ga0501080_0030090 | 3300049742 | Bacteria | 5057 |
| 1086 | Ga0501080_0042851 | 3300049742 | Bacteria | 4213 |
| 1087 | Ga0501080_0128843 | 3300049742 | Bacteria | 2343 |
| 1088 | Ga0501080_0245813 | 3300049742 | Bacteria | 1632 |
| 1089 | Ga0501080_0249400 | 3300049742 | Unclassified | 1619 |
| 1090 | Ga0501080_0323400 | 3300049742 | Bacteria | 1396 |
| 1091 | Ga0501080_0598069 | 3300049742 | Bacteria | 979 |
| 1092 | Ga0501081_0006015 | 3300049743 | Bacteria | 7856 |
| 1093 | Ga0501081_0012121 | 3300049743 | Bacteria | 5652 |
| 1094 | Ga0501081_0027399 | 3300049743 | Bacteria | 3844 |
| 1095 | Ga0501081_0046325 | 3300049743 | Bacteria | 2989 |
| 1096 | Ga0501081_0057695 | 3300049743 | Bacteria | 2685 |
| 1097 | Ga0501081_0074805 | 3300049743 | Bacteria | 2363 |
| 1098 | Ga0501083_0001150 | 3300049744 | Bacteria | 17794 |
| 1099 | Ga0501083_0009072 | 3300049744 | Bacteria | 7022 |
| 1100 | Ga0501083_0033347 | 3300049744 | Bacteria | 3527 |
| 1101 | Ga0501083_0073318 | 3300049744 | Bacteria | 2276 |
| 1102 | Ga0501083_0132962 | 3300049744 | Bacteria | 1631 |
| 1103 | Ga0501035_0029051 | 3300049822 | Bacteria | 5042 |
| 1104 | Ga0501035_0051815 | 3300049822 | Bacteria | 3673 |
| 1105 | Ga0501035_0207160 | 3300049822 | Unclassified | 1679 |
| 1106 | Ga0501035_0425194 | 3300049822 | Bacteria | 1102 |
| 1107 | Ga0501035_0439416 | 3300049822 | Bacteria | 1081 |
| 1108 | Ga0501044_0032685 | 3300049823 | Bacteria | 5469 |
| 1109 | Ga0501044_0046195 | 3300049823 | Bacteria | 4510 |
| 1110 | Ga0501044_0074258 | 3300049823 | Bacteria | 3455 |
| 1111 | Ga0501045_0004472 | 3300049824 | Bacteria | 9653 |
| 1112 | Ga0501045_0007706 | 3300049824 | Bacteria | 7490 |
| 1113 | Ga0501045_0015025 | 3300049824 | Bacteria | 5495 |
| 1114 | Ga0501045_0316369 | 3300049824 | Bacteria | 1161 |
| 1115 | nmdc:mga03683_50388_c1 | 3300050489 | Bacteria | 1735 |
| 1116 | nmdc:mga06z11_55334_c1 | 3300050494 | Bacteria | 2048 |
| 1117 | nmdc:mga05p37_218628_c1 | 3300050507 | Bacteria | 2300 |
| 1118 | nmdc:mga05p37_28125_c1 | 3300050507 | Bacteria | 6852 |
| 1119 | nmdc:mga05p37_42550_c1 | 3300050507 | Bacteria | 5582 |
| 1120 | nmdc:mga05p37_69520_c1 | 3300050507 | Bacteria | 4331 |
| 1121 | nmdc:mga05p37_91230_c1 | 3300050507 | Bacteria | 3754 |
| 1122 | nmdc:mga09592_372152_c1 | 3300050508 | Bacteria | 1236 |
| 1123 | nmdc:mga09592_97006_c1 | 3300050508 | Bacteria | 2522 |
| 1124 | nmdc:mga06r32_436727_c1 | 3300050510 | Unclassified | 1289 |
| 1125 | nmdc:mga06r32_559548_c1 | 3300050510 | Bacteria | 1117 |
| 1126 | nmdc:mga08y16_112287_c1 | 3300050511 | Bacteria | 2837 |
| 1127 | nmdc:mga08y16_128888_c1 | 3300050511 | Bacteria | 2632 |
| 1128 | nmdc:mga08y16_313864_c1 | 3300050511 | Bacteria | 1614 |
| 1129 | nmdc:mga08y16_350857_c1 | 3300050511 | Bacteria | 1516 |
| 1130 | nmdc:mga08y16_40122_c1 | 3300050511 | Bacteria | 4908 |
| 1131 | nmdc:mga0n895_3110_c1 | 3300050512 | Bacteria | 13221 |
| 1132 | nmdc:mga0rr50_22496_c1 | 3300050513 | Bacteria | 4328 |
| 1133 | nmdc:mga08x19_246563_c1 | 3300050514 | Bacteria | 1232 |
| 1134 | nmdc:mga08x19_328248_c1 | 3300050514 | Bacteria | 1065 |
| 1135 | nmdc:mga0a205_132300_c1 | 3300050515 | Bacteria | 2395 |
| 1136 | nmdc:mga0a205_38193_c1 | 3300050515 | Bacteria | 4618 |
| 1137 | Ga0495601_0013877 | 3300053077 | Bacteria | 4851 |
| 1138 | Ga0495601_0026505 | 3300053077 | Bacteria | 3579 |
| 1139 | Ga0495601_0193108 | 3300053077 | Bacteria | 1331 |
| 1140 | Ga0495612_0023733 | 3300053078 | Bacteria | 2462 |
| 1141 | Ga0495612_0044779 | 3300053078 | Bacteria | 1811 |
| 1142 | Ga0495595_0003172 | 3300053084 | Bacteria | 6521 |
| 1143 | Ga0495595_0034736 | 3300053084 | Bacteria | 2282 |
| 1144 | Ga0495595_0039666 | 3300053084 | Bacteria | 2149 |
| 1145 | Ga0495595_0190490 | 3300053084 | Bacteria | 1019 |
| 1146 | Ga0495619_0008553 | 3300053085 | Bacteria | 6476 |
| 1147 | Ga0495619_0008933 | 3300053085 | Bacteria | 6324 |
| 1148 | Ga0495619_0010495 | 3300053085 | Bacteria | 5828 |
| 1149 | Ga0495619_0061892 | 3300053085 | Bacteria | 2491 |
| 1150 | Ga0495619_0283205 | 3300053085 | Bacteria | 1149 |
| 1151 | Ga0495619_0337062 | 3300053085 | Bacteria | 1044 |
| 1152 | Ga0501084_0008364 | 3300054114 | Bacteria | 8542 |
| 1153 | Ga0501084_0027752 | 3300054114 | Bacteria | 4730 |
| 1154 | Ga0501084_0045011 | 3300054114 | Bacteria | 3695 |
| 1155 | Ga0501084_0051198 | 3300054114 | Bacteria | 3456 |
| 1156 | Ga0501084_0057429 | 3300054114 | Bacteria | 3257 |
| 1157 | Ga0501084_0228959 | 3300054114 | Bacteria | 1569 |
| 1158 | Ga0501084_0244646 | 3300054114 | Bacteria | 1514 |
| 1159 | Ga0501084_0471443 | 3300054114 | Bacteria | 1061 |
| 1160 | Ga0501082_0010110 | 3300060353 | Bacteria | 8127 |
| 1161 | Ga0501082_0017296 | 3300060353 | Bacteria | 6211 |
| 1162 | Ga0501082_0018315 | 3300060353 | Bacteria | 6030 |
| 1163 | Ga0501082_0033000 | 3300060353 | Bacteria | 4465 |
| 1164 | Ga0501082_0069746 | 3300060353 | Bacteria | 3027 |
| 1165 | Ga0501082_0182563 | 3300060353 | Bacteria | 1825 |
| 1166 | Ga0466962_0004475 | 3300061719 | Bacteria | 6699 |
| 1167 | Ga0530510_0002954 | 3300061734 | Bacteria | 11663 |
| 1168 | Ga0530510_0034472 | 3300061734 | Bacteria | 3647 |
| 1169 | Ga0530510_0034484 | 3300061734 | Bacteria | 3646 |
| 1170 | Ga0530510_0041507 | 3300061734 | Unclassified | 3322 |
| 1171 | Ga0530510_0056043 | 3300061734 | Bacteria | 2847 |
| 1172 | Ga0530510_0079718 | 3300061734 | Unclassified | 2382 |
| 1173 | Ga0530510_0085852 | 3300061734 | Bacteria | 2293 |
| 1174 | Ga0530510_0124561 | 3300061734 | Bacteria | 1893 |
| 1175 | Ga0530510_0249544 | 3300061734 | Bacteria | 1322 |
| 1176 | Ga0530510_0310018 | 3300061734 | Unclassified | 1182 |
| 1177 | 3006975249 | 3006973921 | Bacteria | 4423788 |
| 1178 | Ga0501040_0184988 | |||
| 1179 | JGI24747J21853_1005485 | |||
| 1180 | JGI24749J21850_1009238 | |||
| 1181 | JGI24744J21845_10003353 | |||
| 1182 | JGI25407J50210_10000579 | |||
| 1183 | JGI25407J50210_10005452 | |||
| 1184 | Ga0070658_10010114 | |||
| 1185 | Ga0070658_10028070 | |||
| 1186 | Ga0070658_10071971 | |||
| 1187 | Ga0070658_10072608 | |||
| 1188 | Ga0070658_10471760 | |||
| 1189 | Ga0070676_10045076 | |||
| 1190 | Ga0070683_100004095 | |||
| 1191 | Ga0070683_100231028 | |||
| 1192 | Ga0070683_100256172 | |||
| 1193 | Ga0070683_100514878 | |||
| 1194 | Ga0070670_100018158 | |||
| 1195 | Ga0070666_10114532 | |||
| 1196 | Ga0070680_100005086 | |||
| 1197 | Ga0070680_100007837 | |||
| 1198 | Ga0070680_100008703 | |||
| 1199 | Ga0070680_100200540 | |||
| 1200 | Ga0070682_100024789 | |||
| 1201 | Ga0070682_100061448 | |||
| 1202 | Ga0070682_100188816 | |||
| 1203 | Ga0068868_100040658 | |||
| 1204 | Ga0068868_100062012 | |||
| 1205 | Ga0070660_100003574 | |||
| 1206 | Ga0070660_100004622 | |||
| 1207 | Ga0070660_100154823 | |||
| 1208 | Ga0070660_100331784 | |||
| 1209 | Ga0070689_100047182 | |||
| 1210 | Ga0070691_10032809 | |||
| 1211 | Ga0070687_100037970 | |||
| 1212 | Ga0070687_100177880 | |||
| 1213 | Ga0070661_100016782 | |||
| 1214 | Ga0070661_100030295 | |||
| 1215 | Ga0070661_100065760 | |||
| 1216 | Ga0070661_100066365 | |||
| 1217 | Ga0070661_100125465 | |||
| 1218 | Ga0070692_10219176 | |||
| 1219 | Ga0070668_100064152 | |||
| 1220 | Ga0070668_100181922 | |||
| 1221 | Ga0070668_100354194 | |||
| 1222 | Ga0070675_100013851 | |||
| 1223 | Ga0070675_100093911 | |||
| 1224 | Ga0070671_100016930 | |||
| 1225 | Ga0070671_100060084 | |||
| 1226 | Ga0070674_100001772 | |||
| 1227 | Ga0070674_100014593 | |||
| 1228 | Ga0070674_100024872 | |||
| 1229 | Ga0070674_100032598 | |||
| 1230 | Ga0070673_100017348 | |||
| 1231 | Ga0070688_100002947 | |||
| 1232 | Ga0070688_100025703 | |||
| 1233 | Ga0070659_100054433 | |||
| 1234 | Ga0070659_100129110 | |||
| 1235 | Ga0070703_10070945 | |||
| 1236 | Ga0070709_10136862 | |||
| 1237 | Ga0070714_100004907 | |||
| 1238 | Ga0070714_100069502 | |||
| 1239 | Ga0070714_100303136 | |||
| 1240 | Ga0070714_100417020 | |||
| 1241 | Ga0070714_100580937 | |||
| 1242 | Ga0070713_100171490 | |||
| 1243 | Ga0070710_10045044 | |||
| 1244 | Ga0070701_10012352 | |||
| 1245 | Ga0070701_10093551 | |||
| 1246 | Ga0070711_100219247 | |||
| 1247 | Ga0070711_100262425 | |||
| 1248 | Ga0070700_100008291 | |||
| 1249 | Ga0070694_100049597 | |||
| 1250 | Ga0070708_100272235 | |||
| 1251 | Ga0070663_100042192 | |||
| 1252 | Ga0070663_100054447 | |||
| 1253 | Ga0070663_100142404 | |||
| 1254 | Ga0070678_100021853 | |||
| 1255 | Ga0070678_100233863 | |||
| 1256 | Ga0070662_100026269 | |||
| 1257 | Ga0070662_100089419 | |||
| 1258 | Ga0070681_10000749 | |||
| 1259 | Ga0070681_10002438 | |||
| 1260 | Ga0070681_10006655 | |||
| 1261 | Ga0070681_10010692 | |||
| 1262 | Ga0070681_10020308 | |||
| 1263 | Ga0070681_10145901 | |||
| 1264 | Ga0070681_10198909 | |||
| 1265 | Ga0070681_10210855 | |||
| 1266 | Ga0070681_10484398 | |||
| 1267 | Ga0068867_100053297 | |||
| 1268 | Ga0070685_10003250 | |||
| 1269 | Ga0070685_10004853 | |||
| 1270 | Ga0070706_100024656 | |||
| 1271 | Ga0070706_100033735 | |||
| 1272 | Ga0070706_100088077 | |||
| 1273 | Ga0070707_100024051 | |||
| 1274 | Ga0070707_100170370 | |||
| 1275 | Ga0070707_100224763 | |||
| 1276 | Ga0070707_100270323 | |||
| 1277 | Ga0070707_100344456 | |||
| 1278 | Ga0070698_100010130 | |||
| 1279 | Ga0070698_100038621 | |||
| 1280 | Ga0070698_100099283 | |||
| 1281 | Ga0070698_100120471 | |||
| 1282 | Ga0070698_100242003 | |||
| 1283 | Ga0070699_100033541 | |||
| 1284 | Ga0070699_100085618 | |||
| 1285 | Ga0070699_100287386 | |||
| 1286 | Ga0070679_100016743 | |||
| 1287 | Ga0070679_100032625 | |||
| 1288 | Ga0070679_100038005 | |||
| 1289 | Ga0070679_100038029 | |||
| 1290 | Ga0070679_100066304 | |||
| 1291 | Ga0070679_100085126 | |||
| 1292 | Ga0070679_100152562 | |||
| 1293 | Ga0070679_100513908 | |||
| 1294 | Ga0070684_100007703 | |||
| 1295 | Ga0070684_100008812 | |||
| 1296 | Ga0070684_100016168 | |||
| 1297 | Ga0070684_100024755 | |||
| 1298 | Ga0070684_100027123 | |||
| 1299 | Ga0070684_100135701 | |||
| 1300 | Ga0070684_100186885 | |||
| 1301 | Ga0070684_100242356 | |||
| 1302 | Ga0070684_100385272 | |||
| 1303 | Ga0070684_100522997 | |||
| 1304 | Ga0068853_100062429 | |||
| 1305 | Ga0070672_100017544 | |||
| 1306 | Ga0070672_100039052 | |||
| 1307 | Ga0070686_100017035 | |||
| 1308 | Ga0070686_100100217 | |||
| 1309 | Ga0070696_100030807 | |||
| 1310 | Ga0070696_100039316 | |||
| 1311 | Ga0070693_100005691 | |||
| 1312 | Ga0070693_100010318 | |||
| 1313 | Ga0070693_100028214 | |||
| 1314 | Ga0070665_100019078 | |||
| 1315 | Ga0070665_100020625 | |||
| 1316 | Ga0070665_100022583 | |||
| 1317 | Ga0070704_100022283 | |||
| 1318 | Ga0070704_100121350 | |||
| 1319 | Ga0068855_100013479 | |||
| 1320 | Ga0068855_100017889 | |||
| 1321 | Ga0068855_100043921 | |||
| 1322 | Ga0068855_100105880 | |||
| 1323 | Ga0068855_100198402 | |||
| 1324 | Ga0070664_100004370 | |||
| 1325 | Ga0070664_100213325 | |||
| 1326 | Ga0070664_100497186 | |||
| 1327 | Ga0068857_100056589 | |||
| 1328 | Ga0068857_100128737 | |||
| 1329 | Ga0068857_100133197 | |||
| 1330 | Ga0068856_100157818 | |||
| 1331 | Ga0068856_100233310 | |||
| 1332 | Ga0068856_100417472 | |||
| 1333 | Ga0070702_100049892 | |||
| 1334 | Ga0070702_100079449 | |||
| 1335 | Ga0070702_100091583 | |||
| 1336 | Ga0068852_100038105 | |||
| 1337 | Ga0068852_100322301 | |||
| 1338 | Ga0068859_100350113 | |||
| 1339 | Ga0068859_100382935 | |||
| 1340 | Ga0068864_100013928 | |||
| 1341 | Ga0068866_10021168 | |||
| 1342 | Ga0068866_10025200 | |||
| 1343 | Ga0068866_10190184 | |||
| 1344 | Ga0068851_10223941 | |||
| 1345 | Ga0068870_10158297 | |||
| 1346 | Ga0068870_10272311 | |||
| 1347 | Ga0068862_100277854 | |||
| 1348 | Ga0081455_10027165 | |||
| 1349 | Ga0081455_10027400 | |||
| 1350 | Ga0081455_10040735 | |||
| 1351 | Ga0081455_10049314 | |||
| 1352 | Ga0081455_10052841 | |||
| 1353 | Ga0081455_10092006 | |||
| 1354 | Ga0081455_10095463 | |||
| 1355 | Ga0081455_10162487 | |||
| 1356 | Ga0081455_10206461 | |||
| 1357 | Ga0081455_10265364 | |||
| 1358 | Ga0081538_10000455 | |||
| 1359 | Ga0081538_10000458 | |||
| 1360 | Ga0081538_10000515 | |||
| 1361 | Ga0081538_10010281 | |||
| 1362 | Ga0081538_10018466 | |||
| 1363 | Ga0081539_10001762 | |||
| 1364 | Ga0081539_10003734 | |||
| 1365 | Ga0081539_10063314 | |||
| 1366 | Ga0075365_10165455 | |||
| 1367 | Ga0075363_100059917 | |||
| 1368 | Ga0075432_10002033 | |||
| 1369 | Ga0070716_100138938 | |||
| 1370 | Ga0070716_100269572 | |||
| 1371 | Ga0070712_100010028 | |||
| 1372 | Ga0070712_100068415 | |||
| 1373 | Ga0075362_10037521 | |||
| 1374 | Ga0075367_10021905 | |||
| 1375 | Ga0097621_100016451 | |||
| 1376 | Ga0068871_100008154 | |||
| 1377 | Ga0068871_100187969 | |||
| 1378 | Ga0068871_100279383 | |||
| 1379 | Ga0075428_100003088 | |||
| 1380 | Ga0075428_100010638 | |||
| 1381 | Ga0075430_100031259 | |||
| 1382 | Ga0075431_100100516 | |||
| 1383 | Ga0075431_100152582 | |||
| 1384 | Ga0075433_10015575 | |||
| 1385 | Ga0075433_10112863 | |||
| 1386 | Ga0075434_100042180 | |||
| 1387 | Ga0075429_100001412 | |||
| 1388 | Ga0068865_100039665 | |||
| 1389 | Ga0068865_100187153 | |||
| 1390 | Ga0097620_100350113 | |||
| 1391 | Ga0097620_100382938 | |||
| 1392 | Ga0075435_100149343 | |||
| 1393 | Ga0105240_10004372 | |||
| 1394 | Ga0105240_10062989 | |||
| 1395 | Ga0105240_10079949 | |||
| 1396 | Ga0105240_10099590 | |||
| 1397 | Ga0105240_10181998 | |||
| 1398 | Ga0111539_10017279 | |||
| 1399 | Ga0111539_10095782 | |||
| 1400 | Ga0111539_10238313 | |||
| 1401 | Ga0105245_10009977 | |||
| 1402 | Ga0105245_10026745 | |||
| 1403 | Ga0105245_10035862 | |||
| 1404 | Ga0105245_10074826 | |||
| 1405 | Ga0105245_10120838 | |||
| 1406 | Ga0105245_10127228 | |||
| 1407 | Ga0105245_10234160 | |||
| 1408 | Ga0105247_10095101 | |||
| 1409 | Ga0114129_10012486 | |||
| 1410 | Ga0114129_10020559 | |||
| 1411 | Ga0114129_10021264 | |||
| 1412 | Ga0114129_10029801 | |||
| 1413 | Ga0114129_10052837 | |||
| 1414 | Ga0114129_10622484 | |||
| 1415 | Ga0105243_10133205 | |||
| 1416 | Ga0105243_10153483 | |||
| 1417 | Ga0105241_10101612 | |||
| 1418 | Ga0105241_10245744 | |||
| 1419 | Ga0105241_10280763 | |||
| 1420 | Ga0105241_10311481 | |||
| 1421 | Ga0105241_10558167 | |||
| 1422 | Ga0105242_10061575 | |||
| 1423 | Ga0105242_10066836 | |||
| 1424 | Ga0105242_10429614 | |||
| 1425 | Ga0105248_10077735 | |||
| 1426 | Ga0105248_10128764 | |||
| 1427 | Ga0105248_10424847 | |||
| 1428 | Ga0105237_10080751 | |||
| 1429 | Ga0105238_10036976 | |||
| 1430 | Ga0105238_10046749 | |||
| 1431 | Ga0105238_10527902 | |||
| 1432 | Ga0105249_10008732 | |||
| 1433 | Ga0105249_10119310 | |||
| 1434 | Ga0105249_10862687 | |||
| 1435 | Ga0105239_10087029 | |||
| 1436 | Ga0105239_10121458 | |||
| 1437 | Ga0105239_10405184 | |||
| 1438 | Ga0105246_10005883 | |||
| 1439 | Ga0157373_10211878 | |||
| 1440 | Ga0157373_10269605 | |||
| 1441 | Ga0157370_10082774 | |||
| 1442 | Ga0157370_10167968 | |||
| 1443 | Ga0157370_10191642 | |||
| 1444 | Ga0157370_10392594 | |||
| 1445 | Ga0157369_10003856 | |||
| 1446 | Ga0157369_10004745 | |||
| 1447 | Ga0157369_10029338 | |||
| 1448 | Ga0157369_10039271 | |||
| 1449 | Ga0157369_10048490 | |||
| 1450 | Ga0157369_10184825 | |||
| 1451 | Ga0157374_10107277 | |||
| 1452 | Ga0157378_10090796 | |||
| 1453 | Ga0157378_10199513 | |||
| 1454 | Ga0157372_10027331 | |||
| 1455 | Ga0157372_10048606 | |||
| 1456 | Ga0157372_10073700 | |||
| 1457 | Ga0157372_10256476 | |||
| 1458 | Ga0157372_10263658 | |||
| 1459 | Ga0157372_10857237 | |||
| 1460 | Ga0163163_10084462 | |||
| 1461 | Ga0163163_10203039 | |||
| 1462 | Ga0157380_10040578 | |||
| 1463 | Ga0157380_10303123 | |||
| 1464 | Ga0182008_10006292 | |||
| 1465 | Ga0157377_10000547 | |||
| 1466 | Ga0157377_10003389 | |||
| 1467 | Ga0157377_10005877 | |||
| 1468 | Ga0157377_10068948 | |||
| 1469 | Ga0157376_10105467 | |||
| 1470 | Ga0157376_10223600 | |||
| 1471 | Ga0182006_1015081 | |||
| 1472 | Ga0182007_10030994 | |||
| 1473 | Ga0163161_10131043 | |||
| 1474 | Ga0206356_10498829 | |||
| 1475 | Ga0206356_10525729 | |||
| 1476 | Ga0206356_10612284 | |||
| 1477 | Ga0206356_11589996 | |||
| 1478 | Ga0206350_11494092 | |||
| 1479 | Ga0206354_10607152 | |||
| 1480 | Ga0206354_11210031 | |||
| 1481 | Ga0206353_10294127 | |||
| 1482 | Ga0206353_10558386 | |||
| 1483 | Ga0206353_11428389 | |||
| 1484 | Ga0206353_11672605 | |||
| 1485 | Ga0213876_10036081 | |||
| 1486 | Ga0213871_10078276 | |||
| 1487 | Ga0224712_10031602 | |||
| 1488 | Ga0224712_10162561 | |||
| 1489 | Ga0207653_10012709 | |||
| 1490 | Ga0207692_10328132 | |||
| 1491 | Ga0207642_10118456 | |||
| 1492 | Ga0207710_10144375 | |||
| 1493 | Ga0207688_10000094 | |||
| 1494 | Ga0207688_10019905 | |||
| 1495 | Ga0207680_10294154 | |||
| 1496 | Ga0207647_10038076 | |||
| 1497 | Ga0207685_10087548 | |||
| 1498 | Ga0207699_10392315 | |||
| 1499 | Ga0207645_10019320 | |||
| 1500 | Ga0207645_10026266 | |||
| 1501 | Ga0207643_10044103 | |||
| 1502 | Ga0207643_10180953 | |||
| 1503 | Ga0207643_10198724 | |||
| 1504 | Ga0207705_10086371 | |||
| 1505 | Ga0207705_10096333 | |||
| 1506 | Ga0207705_10109308 | |||
| 1507 | Ga0207684_10070766 | |||
| 1508 | Ga0207654_10029202 | |||
| 1509 | Ga0207654_10278423 | |||
| 1510 | Ga0207707_10005506 | |||
| 1511 | Ga0207707_10010668 | |||
| 1512 | Ga0207707_10021783 | |||
| 1513 | Ga0207707_10037026 | |||
| 1514 | Ga0207707_10046052 | |||
| 1515 | Ga0207707_10067519 | |||
| 1516 | Ga0207707_10078633 | |||
| 1517 | Ga0207707_10117638 | |||
| 1518 | Ga0207707_10177487 | |||
| 1519 | Ga0207707_10226531 | |||
| 1520 | Ga0207707_10306253 | |||
| 1521 | Ga0207707_10382509 | |||
| 1522 | Ga0207695_10061774 | |||
| 1523 | Ga0207695_10072269 | |||
| 1524 | Ga0207695_10079390 | |||
| 1525 | Ga0207695_10226265 | |||
| 1526 | Ga0207693_10004208 | |||
| 1527 | Ga0207693_10075887 | |||
| 1528 | Ga0207693_10097505 | |||
| 1529 | Ga0207693_10114673 | |||
| 1530 | Ga0207663_10007048 | |||
| 1531 | Ga0207663_10229788 | |||
| 1532 | Ga0207660_10005764 | |||
| 1533 | Ga0207660_10104625 | |||
| 1534 | Ga0207660_10128034 | |||
| 1535 | Ga0207660_10162060 | |||
| 1536 | Ga0207662_10051778 | |||
| 1537 | Ga0207657_10000486 | |||
| 1538 | Ga0207657_10005329 | |||
| 1539 | Ga0207657_10006205 | |||
| 1540 | Ga0207657_10008281 | |||
| 1541 | Ga0207657_10008995 | |||
| 1542 | Ga0207657_10033911 | |||
| 1543 | Ga0207657_10065773 | |||
| 1544 | Ga0207657_10114156 | |||
| 1545 | Ga0207657_10166715 | |||
| 1546 | Ga0207657_10191748 | |||
| 1547 | Ga0207657_10288463 | |||
| 1548 | Ga0207657_10307160 | |||
| 1549 | Ga0207649_10013306 | |||
| 1550 | Ga0207649_10044263 | |||
| 1551 | Ga0207649_10100556 | |||
| 1552 | Ga0207649_10108045 | |||
| 1553 | Ga0207649_10113426 | |||
| 1554 | Ga0207652_10001978 | |||
| 1555 | Ga0207652_10010935 | |||
| 1556 | Ga0207652_10026105 | |||
| 1557 | Ga0207652_10027508 | |||
| 1558 | Ga0207652_10056406 | |||
| 1559 | Ga0207652_10112977 | |||
| 1560 | Ga0207652_10114613 | |||
| 1561 | Ga0207652_10125163 | |||
| 1562 | Ga0207652_10152932 | |||
| 1563 | Ga0207652_10189815 | |||
| 1564 | Ga0207652_10335258 | |||
| 1565 | Ga0207652_10434052 | |||
| 1566 | Ga0207652_10530626 | |||
| 1567 | Ga0207646_10003257 | |||
| 1568 | Ga0207646_10010936 | |||
| 1569 | Ga0207646_10227617 | |||
| 1570 | Ga0207646_10337827 | |||
| 1571 | Ga0207646_10513022 | |||
| 1572 | Ga0207681_10431991 | |||
| 1573 | Ga0207650_10010951 | |||
| 1574 | Ga0207659_10116000 | |||
| 1575 | Ga0207659_10386869 | |||
| 1576 | Ga0207687_10020244 | |||
| 1577 | Ga0207687_10027128 | |||
| 1578 | Ga0207687_10028849 | |||
| 1579 | Ga0207687_10074672 | |||
| 1580 | Ga0207700_10060593 | |||
| 1581 | Ga0207700_10079616 | |||
| 1582 | Ga0207700_10110286 | |||
| 1583 | Ga0207664_10016700 | |||
| 1584 | Ga0207664_10141390 | |||
| 1585 | Ga0207664_10249969 | |||
| 1586 | Ga0207664_10284909 | |||
| 1587 | Ga0207664_10362933 | |||
| 1588 | Ga0207644_10268609 | |||
| 1589 | Ga0207690_10037999 | |||
| 1590 | Ga0207690_10237158 | |||
| 1591 | Ga0207690_10496472 | |||
| 1592 | Ga0207706_10049875 | |||
| 1593 | Ga0207706_10094871 | |||
| 1594 | Ga0207686_10233774 | |||
| 1595 | Ga0207709_10017746 | |||
| 1596 | Ga0207709_10068356 | |||
| 1597 | Ga0207670_10147357 | |||
| 1598 | Ga0207704_10003174 | |||
| 1599 | Ga0207704_10090206 | |||
| 1600 | Ga0207704_10112229 | |||
| 1601 | Ga0207665_10002976 | |||
| 1602 | Ga0207665_10018558 | |||
| 1603 | Ga0207665_10057948 | |||
| 1604 | Ga0207691_10001755 | |||
| 1605 | Ga0207691_10046257 | |||
| 1606 | Ga0207661_10000201 | |||
| 1607 | Ga0207661_10002757 | |||
| 1608 | Ga0207661_10009671 | |||
| 1609 | Ga0207661_10010459 | |||
| 1610 | Ga0207661_10056215 | |||
| 1611 | Ga0207661_10068415 | |||
| 1612 | Ga0207661_10216815 | |||
| 1613 | Ga0207661_10245970 | |||
| 1614 | Ga0207661_10263153 | |||
| 1615 | Ga0207661_10356026 | |||
| 1616 | Ga0207679_10036426 | |||
| 1617 | Ga0207679_10070406 | |||
| 1618 | Ga0207679_10215149 | |||
| 1619 | Ga0207667_10052081 | |||
| 1620 | Ga0207667_10075232 | |||
| 1621 | Ga0207667_10083657 | |||
| 1622 | Ga0207667_10083914 | |||
| 1623 | Ga0207667_10086985 | |||
| 1624 | Ga0207667_10111711 | |||
| 1625 | Ga0207667_10271048 | |||
| 1626 | Ga0207667_10404179 | |||
| 1627 | Ga0207651_10140063 | |||
| 1628 | Ga0207712_10067585 | |||
| 1629 | Ga0207640_10122345 | |||
| 1630 | Ga0207677_10007340 | |||
| 1631 | Ga0207677_10014913 | |||
| 1632 | Ga0207677_10089545 | |||
| 1633 | Ga0207639_10028058 | |||
| 1634 | Ga0207639_10092125 | |||
| 1635 | Ga0207678_10021047 | |||
| 1636 | Ga0207678_10031345 | |||
| 1637 | Ga0207678_10117281 | |||
| 1638 | Ga0207708_10003971 | |||
| 1639 | Ga0207708_10031574 | |||
| 1640 | Ga0207708_10035802 | |||
| 1641 | Ga0207702_10054613 | |||
| 1642 | Ga0207702_10121978 | |||
| 1643 | Ga0207702_10364862 | |||
| 1644 | Ga0207648_10002974 | |||
| 1645 | Ga0207648_10025033 | |||
| 1646 | Ga0207648_10052994 | |||
| 1647 | Ga0207674_10126655 | |||
| 1648 | Ga0207674_10210356 | |||
| 1649 | Ga0207675_100113166 | |||
| 1650 | Ga0207675_100778403 | |||
| 1651 | Ga0207683_10000336 | |||
| 1652 | Ga0207683_10002398 | |||
| 1653 | Ga0207683_10400721 | |||
| 1654 | Ga0207428_10000181 | |||
| 1655 | Ga0207428_10024668 | |||
| 1656 | Ga0207428_10061006 | |||
| 1657 | Ga0268266_10097446 | |||
| 1658 | Ga0268266_10222108 | |||
| 1659 | Ga0265337_1045371 | |||
| 1660 | Ga0265319_1000793 | |||
| 1661 | Ga0265319_1014624 | |||
| 1662 | Ga0265334_10000386 | |||
| 1663 | Ga0265334_10009904 | |||
| 1664 | Ga0265318_10000286 | |||
| 1665 | Ga0265318_10021450 | |||
| 1666 | Ga0265322_10001453 | |||
| 1667 | Ga0265322_10010248 | |||
| 1668 | Ga0265322_10017878 | |||
| 1669 | Ga0265336_10008751 | |||
| 1670 | Ga0265336_10067368 | |||
| 1671 | Ga0265336_10071407 | |||
| 1672 | Ga0265338_10009739 | |||
| 1673 | Ga0265338_10011205 | |||
| 1674 | Ga0265338_10019353 | |||
| 1675 | Ga0265338_10036811 | |||
| 1676 | Ga0265338_10339145 | |||
| 1677 | Ga0265330_10000170 | |||
| 1678 | Ga0265330_10036568 | |||
| 1679 | Ga0265332_10000981 | |||
| 1680 | Ga0265328_10001374 | |||
| 1681 | Ga0265320_10023330 | |||
| 1682 | Ga0265320_10049072 | |||
| 1683 | Ga0265320_10060916 | |||
| 1684 | Ga0265325_10000058 | |||
| 1685 | Ga0265325_10049478 | |||
| 1686 | Ga0265329_10017346 | |||
| 1687 | Ga0265339_10019338 | |||
| 1688 | Ga0265331_10017968 | |||
| 1689 | Ga0265331_10063184 | |||
| 1690 | Ga0265316_10000700 | |||
| 1691 | Ga0265316_10065958 | |||
| 1692 | Ga0265316_10089729 | |||
| 1693 | Ga0307408_100553090 | |||
| 1694 | Ga0265313_10004445 | |||
| 1695 | Ga0265313_10007060 | |||
| 1696 | Ga0265313_10022340 | |||
| 1697 | Ga0265314_10000982 | |||
| 1698 | Ga0265314_10016166 | |||
| 1699 | Ga0265342_10035168 | |||
| 1700 | Ga0265342_10187648 | |||
| 1701 | Ga0307410_10029304 | |||
| 1702 | Ga0307407_10012046 | |||
| 1703 | Ga0307416_100020230 | |||
| 1704 | Ga0307416_100225345 | |||
| 1705 | Ga0307416_100230816 | |||
| 1706 | Ga0307414_10008145 | |||
| 1707 | Ga0307415_100027981 | |||
| 1708 | Ga0307415_100049647 | |||
| 1709 | Ga0307415_100060903 | |||
| 1710 | Ga0373926_0119270 | |||
| 1711 | Ga0373944_0010158 | |||
| 1712 | Ga0373944_0018005 | |||
| 1713 | Ga0373936_0012443 | |||
| 1714 | Ga0373936_0072092 | |||
| 1715 | Ga0373939_0045655 | |||
| 1716 | Ga0373945_0010892 | |||
| 1717 | Ga0373960_0021354 | |||
| 1718 | Ga0373943_0002996 | |||
| 1719 | Ga0373943_0004269 | |||
| 1720 | Ga0373943_0019523 | |||
| 1721 | Ga0373943_0047963 | |||
| 1722 | Ga0373943_0344038 | |||
| 1723 | Ga0373946_0083899 | |||
| 1724 | Ga0373946_0152879 | |||
| 1725 | Ga0373955_0016428 | |||
| 1726 | Ga0373931_0212180 | |||
| 1727 | Ga0373935_0149716 | |||
| 1728 | Ga0373935_0164504 | |||
| 1729 | Ga0373927_0198982 | |||
| 1730 | Ga0373947_0000833 | |||
| 1731 | Ga0373947_0001712 | |||
| 1732 | Ga0373937_0041775 | |||
| 1733 | Ga0373937_0198068 | |||
| 1734 | Ga0373925_0016345 | |||
| 1735 | Ga0373925_0044987 | |||
| 1736 | Ga0395899_0001122 | |||
| 1737 | Ga0395899_0003567 | |||
| 1738 | Ga0395899_0003675 | |||
| 1739 | Ga0395899_0009564 | |||
| 1740 | Ga0395899_0014177 | |||
| 1741 | Ga0395899_0015791 | |||
| 1742 | Ga0395899_0027155 | |||
| 1743 | Ga0395899_0036471 | |||
| 1744 | Ga0395899_0043149 | |||
| 1745 | Ga0395899_0045379 | |||
| 1746 | Ga0395899_0075332 | |||
| 1747 | Ga0395899_0108555 | |||
| 1748 | Ga0395899_0152547 | |||
| 1749 | Ga0395900_0001349 | |||
| 1750 | Ga0395900_0002317 | |||
| 1751 | Ga0395900_0003438 | |||
| 1752 | Ga0395900_0004581 | |||
| 1753 | Ga0395900_0005036 | |||
| 1754 | Ga0395900_0005715 | |||
| 1755 | Ga0395900_0011577 | |||
| 1756 | Ga0395900_0014881 | |||
| 1757 | Ga0395900_0024327 | |||
| 1758 | Ga0395900_0032544 | |||
| 1759 | Ga0395900_0034179 | |||
| 1760 | Ga0395900_0036326 | |||
| 1761 | Ga0395900_0065851 | |||
| 1762 | Ga0395900_0068057 | |||
| 1763 | Ga0395900_0147508 | |||
| 1764 | Ga0395900_0149433 | |||
| 1765 | Ga0395900_0176430 | |||
| 1766 | Ga0395900_0178244 | |||
| 1767 | Ga0395900_0209854 | |||
| 1768 | Ga0395898_0002618 | |||
| 1769 | Ga0395898_0002928 | |||
| 1770 | Ga0395898_0004496 | |||
| 1771 | Ga0395898_0006072 | |||
| 1772 | Ga0395898_0009074 | |||
| 1773 | Ga0395898_0014383 | |||
| 1774 | Ga0395898_0015704 | |||
| 1775 | Ga0395898_0021626 | |||
| 1776 | Ga0395898_0022174 | |||
| 1777 | Ga0395898_0025821 | |||
| 1778 | Ga0395898_0026581 | |||
| 1779 | Ga0395898_0045256 | |||
| 1780 | Ga0395898_0069052 | |||
| 1781 | Ga0395898_0073070 | |||
| 1782 | Ga0395898_0085464 | |||
| 1783 | Ga0395898_0187663 | |||
| 1784 | Ga0395898_0738309 | |||
| 1785 | Ga0395905_0001947 | |||
| 1786 | Ga0395905_0002131 | |||
| 1787 | Ga0395905_0002582 | |||
| 1788 | Ga0395905_0005008 | |||
| 1789 | Ga0395905_0006203 | |||
| 1790 | Ga0395905_0008425 | |||
| 1791 | Ga0395905_0015805 | |||
| 1792 | Ga0395905_0024156 | |||
| 1793 | Ga0395905_0044546 | |||
| 1794 | Ga0395905_0050246 | |||
| 1795 | Ga0395905_0084583 | |||
| 1796 | Ga0395905_0099069 | |||
| 1797 | Ga0395905_0110244 | |||
| 1798 | Ga0395905_0120539 | |||
| 1799 | Ga0395905_0121651 | |||
| 1800 | Ga0395905_0135861 | |||
| 1801 | Ga0395905_0313090 | |||
| 1802 | Ga0395905_0443029 | |||
| 1803 | Ga0436364_0295591 | |||
| 1804 | Ga0395901_0001080 | |||
| 1805 | Ga0395901_0001102 | |||
| 1806 | Ga0395901_0001138 | |||
| 1807 | Ga0395901_0003562 | |||
| 1808 | Ga0395901_0007015 | |||
| 1809 | Ga0395901_0009409 | |||
| 1810 | Ga0395901_0010905 | |||
| 1811 | Ga0395901_0029784 | |||
| 1812 | Ga0395901_0031149 | |||
| 1813 | Ga0395901_0039156 | |||
| 1814 | Ga0395901_0045318 | |||
| 1815 | Ga0395901_0062833 | |||
| 1816 | Ga0395901_0076575 | |||
| 1817 | Ga0395901_0082141 | |||
| 1818 | Ga0395901_0088453 | |||
| 1819 | Ga0395901_0091183 | |||
| 1820 | Ga0395901_0143020 | |||
| 1821 | Ga0395901_0167454 | |||
| 1822 | Ga0395901_0230906 | |||
| 1823 | Ga0395901_0264308 | |||
| 1824 | Ga0395901_0282790 | |||
| 1825 | Ga0395901_0478750 | |||
| 1826 | Ga0395901_0489810 | |||
| 1827 | Ga0395901_0506229 | |||
| 1828 | Ga0395901_0591578 | |||
| 1829 | Ga0395901_0626422 | |||
| 1830 | Ga0395901_0653884 | |||
| 1831 | Ga0395901_0692770 | |||
| 1832 | Ga0436365_0524403 | |||
| 1833 | Ga0436360_0030209 | |||
| 1834 | Ga0439454_011277 | |||
| 1835 | Ga0450920_002093 | |||
| 1836 | Ga0450920_011205 | |||
| 1837 | Ga0450906_007585 | |||
| 1838 | Ga0450907_007292 | |||
| 1839 | Ga0439435_0067289 | |||
| 1840 | Ga0450918_014047 | |||
| 1841 | Ga0466966_0007345 | |||
| 1842 | Ga0466966_0072926 | |||
| 1843 | Ga0466966_0107538 | |||
| 1844 | Ga0466966_0138439 | |||
| 1845 | Ga0466966_0155542 | |||
| 1846 | Ga0466966_0297373 | |||
| 1847 | Ga0466961_0025742 | |||
| 1848 | Ga0466961_0041172 | |||
| 1849 | Ga0466961_0043612 | |||
| 1850 | Ga0466963_0002467 | |||
| 1851 | Ga0466963_0003262 | |||
| 1852 | Ga0466963_0004896 | |||
| 1853 | Ga0466963_0011367 | |||
| 1854 | Ga0466963_0014410 | |||
| 1855 | Ga0466963_0019410 | |||
| 1856 | Ga0466963_0040786 | |||
| 1857 | Ga0466963_0163992 | |||
| 1858 | Ga0466963_0217901 | |||
| 1859 | Ga0466963_0226032 | |||
| 1860 | Ga0466963_0295502 | |||
| 1861 | Ga0466963_0386235 | |||
| 1862 | Ga0466964_0018528 | |||
| 1863 | Ga0466964_0027730 | |||
| 1864 | Ga0466964_0034153 | |||
| 1865 | Ga0466964_0105857 | |||
| 1866 | Ga0466971_0052537 | |||
| 1867 | Ga0466968_0048332 | |||
| 1868 | Ga0466970_0110321 | |||
| 1869 | Ga0466970_0205699 | |||
| 1870 | Ga0466957_0000320 | |||
| 1871 | Ga0466957_0022515 | |||
| 1872 | Ga0466957_0043882 | |||
| 1873 | Ga0466957_0063556 | |||
| 1874 | Ga0466957_0084439 | |||
| 1875 | Ga0466957_0112594 | |||
| 1876 | Ga0466959_0001566 | |||
| 1877 | Ga0466959_0008520 | |||
| 1878 | Ga0466959_0070655 | |||
| 1879 | Ga0451576_0219917 | |||
| 1880 | Ga0466958_0002644 | |||
| 1881 | Ga0466958_0003728 | |||
| 1882 | Ga0466958_0020531 | |||
| 1883 | Ga0466958_0031910 | |||
| 1884 | Ga0466958_0081214 | |||
| 1885 | Ga0466958_0083725 | |||
| 1886 | Ga0466958_0196188 | |||
| 1887 | Ga0466958_0227667 | |||
| 1888 | Ga0466967_0000433 | |||
| 1889 | Ga0466967_0003672 | |||
| 1890 | Ga0466967_0005278 | |||
| 1891 | Ga0466967_0005373 | |||
| 1892 | Ga0466967_0006777 | |||
| 1893 | Ga0466967_0023511 | |||
| 1894 | Ga0466967_0025397 | |||
| 1895 | Ga0466967_0036147 | |||
| 1896 | Ga0466967_0045092 | |||
| 1897 | Ga0466967_0045547 | |||
| 1898 | Ga0466967_0055596 | |||
| 1899 | Ga0466967_0076599 | |||
| 1900 | Ga0466967_0101528 | |||
| 1901 | Ga0466967_0164052 | |||
| 1902 | Ga0466967_0274943 | |||
| 1903 | Ga0466967_0309850 | |||
| 1904 | Ga0466967_0313094 | |||
| 1905 | Ga0466967_0327137 | |||
| 1906 | Ga0466967_0334028 | |||
| 1907 | Ga0466967_0356058 | |||
| 1908 | Ga0466967_0393684 | |||
| 1909 | Ga0466967_0445857 | |||
| 1910 | Ga0495592_0078399 | |||
| 1911 | Ga0495592_0107950 | |||
| 1912 | Ga0495603_0235075 | |||
| 1913 | Ga0495629_0000983 | |||
| 1914 | Ga0495629_0005386 | |||
| 1915 | Ga0495629_0034794 | |||
| 1916 | Ga0495629_0096744 | |||
| 1917 | Ga0495629_0141512 | |||
| 1918 | Ga0495629_0169960 | |||
| 1919 | Ga0495641_0000513 | |||
| 1920 | Ga0495641_0013891 | |||
| 1921 | Ga0495651_0008831 | |||
| 1922 | Ga0495651_0028727 | |||
| 1923 | Ga0495651_0036582 | |||
| 1924 | Ga0495651_0057837 | |||
| 1925 | Ga0495651_0195228 | |||
| 1926 | Ga0495653_0015091 | |||
| 1927 | Ga0495653_0052672 | |||
| 1928 | Ga0495653_0064933 | |||
| 1929 | Ga0495653_0188068 | |||
| 1930 | Ga0495582_0000553 | |||
| 1931 | Ga0495582_0024252 | |||
| 1932 | Ga0495582_0029202 | |||
| 1933 | Ga0495582_0112345 | |||
| 1934 | Ga0495582_0184146 | |||
| 1935 | Ga0495605_0058685 | |||
| 1936 | Ga0495639_0007896 | |||
| 1937 | Ga0495662_0004812 | |||
| 1938 | Ga0495662_0033415 | |||
| 1939 | Ga0495584_0009844 | |||
| 1940 | Ga0495584_0093197 | |||
| 1941 | Ga0495594_0089921 | |||
| 1942 | Ga0495607_0030538 | |||
| 1943 | Ga0495608_0010647 | |||
| 1944 | Ga0495608_0010965 | |||
| 1945 | Ga0495608_0266532 | |||
| 1946 | Ga0495618_0049002 | |||
| 1947 | Ga0495628_0047013 | |||
| 1948 | Ga0495628_0074653 | |||
| 1949 | Ga0495628_0127796 | |||
| 1950 | Ga0495630_0030060 | |||
| 1951 | Ga0495630_0048094 | |||
| 1952 | Ga0495630_0070624 | |||
| 1953 | Ga0495630_0391229 | |||
| 1954 | Ga0495630_0432050 | |||
| 1955 | Ga0495666_0054385 | |||
| 1956 | Ga0495642_0028078 | |||
| 1957 | Ga0495652_0033764 | |||
| 1958 | Ga0495652_0035874 | |||
| 1959 | Ga0495652_0317714 | |||
| 1960 | Ga0495652_0328103 | |||
| 1961 | Ga0495665_0010478 | |||
| 1962 | Ga0495640_0015840 | |||
| 1963 | Ga0495640_0145796 | |||
| 1964 | Ga0495640_0221328 | |||
| 1965 | Ga0495586_0182651 | |||
| 1966 | Ga0495587_0016056 | |||
| 1967 | Ga0495587_0093812 | |||
| 1968 | Ga0495587_0258003 | |||
| 1969 | Ga0495609_0042385 | |||
| 1970 | Ga0495645_0012630 | |||
| 1971 | Ga0495667_0004861 | |||
| 1972 | Ga0495667_0011321 | |||
| 1973 | Ga0495667_0034880 | |||
| 1974 | Ga0495656_0021831 | |||
| 1975 | Ga0495656_0025895 | |||
| 1976 | Ga0495634_0017514 | |||
| 1977 | Ga0495634_0080784 | |||
| 1978 | Ga0495634_0083952 | |||
| 1979 | Ga0495635_0017038 | |||
| 1980 | Ga0495635_0023772 | |||
| 1981 | Ga0495635_0029893 | |||
| 1982 | Ga0495659_0010780 | |||
| 1983 | Ga0495588_0001267 | |||
| 1984 | Ga0495657_0006323 | |||
| 1985 | Ga0495657_0022761 | |||
| 1986 | Ga0495657_0062826 | |||
| 1987 | Ga0495657_0112843 | |||
| 1988 | Ga0495599_0088633 | |||
| 1989 | Ga0495623_0018829 | |||
| 1990 | Ga0495623_0265680 | |||
| 1991 | Ga0495646_0033710 | |||
| 1992 | Ga0495646_0055715 | |||
| 1993 | Ga0495658_0000300 | |||
| 1994 | Ga0495658_0146923 | |||
| 1995 | Ga0495613_0010487 | |||
| 1996 | Ga0495613_0101516 | |||
| 1997 | Ga0495670_0067555 | |||
| 1998 | Ga0495589_0016095 | |||
| 1999 | Ga0495600_0102147 | |||
| 2000 | Ga0495581_0019593 | |||
| 2001 | Ga0495581_0082333 | |||
| 2002 | Ga0495581_0182959 | |||
| 2003 | Ga0495581_0183047 | |||
| 2004 | Ga0495604_0133055 | |||
| 2005 | Ga0495604_0269756 | |||
| 2006 | Ga0495674_0003155 | |||
| 2007 | Ga0495674_0050062 | |||
| 2008 | Ga0495674_0320536 | |||
| 2009 | Ga0495676_0001459 | |||
| 2010 | Ga0495676_0035504 | |||
| 2011 | Ga0495676_0036083 | |||
| 2012 | Ga0495680_0003282 | |||
| 2013 | Ga0495680_0004330 | |||
| 2014 | Ga0495680_0009818 | |||
| 2015 | Ga0495680_0046182 | |||
| 2016 | Ga0495680_0078517 | |||
| 2017 | Ga0495675_0049893 | |||
| 2018 | Ga0495675_0079610 | |||
| 2019 | Ga0495677_0011247 | |||
| 2020 | Ga0495593_0006091 | |||
| 2021 | Ga0495593_0102297 | |||
| 2022 | Ga0495593_0112650 | |||
| 2023 | Ga0495602_0186760 | |||
| 2024 | Ga0495602_0278559 | |||
| 2025 | Ga0495614_0044451 | |||
| 2026 | Ga0495614_0077464 | |||
| 2027 | Ga0496100_0004882 | |||
| 2028 | Ga0496100_0025294 | |||
| 2029 | Ga0496100_0033693 | |||
| 2030 | Ga0496100_0509100 | |||
| 2031 | Ga0496101_0001389 | |||
| 2032 | Ga0496101_0003760 | |||
| 2033 | Ga0496101_0004977 | |||
| 2034 | Ga0496101_0027434 | |||
| 2035 | Ga0496101_0096938 | |||
| 2036 | Ga0496101_0107889 | |||
| 2037 | Ga0496101_0139754 | |||
| 2038 | Ga0496101_0168157 | |||
| 2039 | Ga0496101_0326731 | |||
| 2040 | Ga0496102_0003545 | |||
| 2041 | Ga0496102_0051719 | |||
| 2042 | Ga0496102_0058391 | |||
| 2043 | Ga0496102_0069568 | |||
| 2044 | Ga0496102_0142564 | |||
| 2045 | Ga0496102_0163665 | |||
| 2046 | Ga0496102_0323173 | |||
| 2047 | Ga0496102_0359344 | |||
| 2048 | Ga0496102_0409707 | |||
| 2049 | Ga0496103_0009466 | |||
| 2050 | Ga0496103_0098195 | |||
| 2051 | Ga0496103_0166468 | |||
| 2052 | Ga0496104_0023166 | |||
| 2053 | Ga0496104_0048118 | |||
| 2054 | Ga0496104_0089064 | |||
| 2055 | Ga0496104_0089328 | |||
| 2056 | Ga0496104_0208456 | |||
| 2057 | Ga0496104_0586477 | |||
| 2058 | Ga0496104_0618704 | |||
| 2059 | Ga0496105_0005175 | |||
| 2060 | Ga0496105_0008326 | |||
| 2061 | Ga0496105_0038665 | |||
| 2062 | Ga0496105_0064818 | |||
| 2063 | Ga0496105_0086200 | |||
| 2064 | Ga0496106_0009146 | |||
| 2065 | Ga0496106_0016076 | |||
| 2066 | Ga0496106_0025577 | |||
| 2067 | Ga0496106_0037974 | |||
| 2068 | Ga0496106_0410340 | |||
| 2069 | Ga0496107_0011757 | |||
| 2070 | Ga0496107_0016606 | |||
| 2071 | Ga0496107_0024830 | |||
| 2072 | Ga0496107_0073591 | |||
| 2073 | Ga0496108_0004497 | |||
| 2074 | Ga0496108_0017997 | |||
| 2075 | Ga0496108_0049009 | |||
| 2076 | Ga0496108_0054923 | |||
| 2077 | Ga0496108_0188418 | |||
| 2078 | Ga0496108_0293878 | |||
| 2079 | Ga0496108_0294878 | |||
| 2080 | Ga0496109_0010777 | |||
| 2081 | Ga0496109_0025155 | |||
| 2082 | Ga0496109_0033171 | |||
| 2083 | Ga0496109_0037156 | |||
| 2084 | Ga0496109_0089941 | |||
| 2085 | Ga0496109_0174307 | |||
| 2086 | Ga0496109_0185597 | |||
| 2087 | Ga0496109_0251956 | |||
| 2088 | Ga0496109_0257922 | |||
| 2089 | Ga0496109_0383252 | |||
| 2090 | Ga0496110_0002589 | |||
| 2091 | Ga0496110_0032189 | |||
| 2092 | Ga0496110_0039149 | |||
| 2093 | Ga0496110_0041405 | |||
| 2094 | Ga0496110_0048802 | |||
| 2095 | Ga0496110_0065340 | |||
| 2096 | Ga0496110_0258403 | |||
| 2097 | Ga0496110_0266724 | |||
| 2098 | Ga0496110_0485042 | |||
| 2099 | Ga0496111_0005335 | |||
| 2100 | Ga0496111_0007386 | |||
| 2101 | Ga0496111_0007877 | |||
| 2102 | Ga0496111_0017416 | |||
| 2103 | Ga0496112_0001415 | |||
| 2104 | Ga0496112_0003186 | |||
| 2105 | Ga0496112_0016093 | |||
| 2106 | Ga0496112_0017575 | |||
| 2107 | Ga0496112_0056051 | |||
| 2108 | Ga0496112_0066559 | |||
| 2109 | Ga0496112_0069221 | |||
| 2110 | Ga0496112_0160331 | |||
| 2111 | Ga0496112_0241187 | |||
| 2112 | Ga0496112_0262402 | |||
| 2113 | Ga0496113_0026770 | |||
| 2114 | Ga0496113_0112846 | |||
| 2115 | Ga0496113_0427377 | |||
| 2116 | Ga0496113_0576068 | |||
| 2117 | Ga0496114_0000593 | |||
| 2118 | Ga0496114_0003060 | |||
| 2119 | Ga0496114_0004918 | |||
| 2120 | Ga0496114_0010412 | |||
| 2121 | Ga0496114_0012526 | |||
| 2122 | Ga0496114_0031336 | |||
| 2123 | Ga0496114_0118729 | |||
| 2124 | Ga0496114_0132376 | |||
| 2125 | Ga0496115_0002884 | |||
| 2126 | Ga0496115_0019565 | |||
| 2127 | Ga0496115_0023989 | |||
| 2128 | Ga0496115_0060072 | |||
| 2129 | Ga0496115_0550829 | |||
| 2130 | Ga0501031_0003201 | |||
| 2131 | Ga0501031_0010316 | |||
| 2132 | Ga0501031_0027189 | |||
| 2133 | Ga0501031_0028064 | |||
| 2134 | Ga0501032_0003510 | |||
| 2135 | Ga0501032_0034078 | |||
| 2136 | Ga0501032_0145374 | |||
| 2137 | Ga0501032_0214418 | |||
| 2138 | Ga0501032_0271383 | |||
| 2139 | Ga0501033_0009336 | |||
| 2140 | Ga0501033_0011029 | |||
| 2141 | Ga0501033_0251144 | |||
| 2142 | Ga0501033_0305487 | |||
| 2143 | Ga0501034_0052801 | |||
| 2144 | Ga0501034_0110725 | |||
| 2145 | Ga0501036_0016353 | |||
| 2146 | Ga0501036_0018678 | |||
| 2147 | Ga0501036_0037239 | |||
| 2148 | Ga0501036_0143921 | |||
| 2149 | Ga0501036_0230343 | |||
| 2150 | Ga0501037_0005161 | |||
| 2151 | Ga0501037_0032379 | |||
| 2152 | Ga0501037_0040856 | |||
| 2153 | Ga0501037_0155602 | |||
| 2154 | Ga0501038_0002125 | |||
| 2155 | Ga0501038_0028671 | |||
| 2156 | Ga0501038_0130409 | |||
| 2157 | Ga0501038_0237867 | |||
| 2158 | Ga0501038_0240788 | |||
| 2159 | Ga0501039_0008922 | |||
| 2160 | Ga0501039_0011096 | |||
| 2161 | Ga0501039_0041616 | |||
| 2162 | Ga0501039_0097716 | |||
| 2163 | Ga0501040_0008306 | |||
| 2164 | Ga0501040_0041715 | |||
| 2165 | Ga0501040_0275674 | |||
| 2166 | Ga0501041_0002077 | |||
| 2167 | Ga0501041_0005126 | |||
| 2168 | Ga0501041_0019846 | |||
| 2169 | Ga0501041_0096415 | |||
| 2170 | Ga0501042_0003373 | |||
| 2171 | Ga0501042_0014660 | |||
| 2172 | Ga0501042_0055816 | |||
| 2173 | Ga0501042_0081887 | |||
| 2174 | Ga0501042_0117341 | |||
| 2175 | Ga0501042_0193332 | |||
| 2176 | Ga0501042_0338062 | |||
| 2177 | Ga0501043_0020365 | |||
| 2178 | Ga0501043_0037251 | |||
| 2179 | Ga0501043_0363167 | |||
| 2180 | Ga0501046_0019560 | |||
| 2181 | Ga0501046_0305282 | |||
| 2182 | Ga0501048_0004447 | |||
| 2183 | Ga0501048_0030532 | |||
| 2184 | Ga0501048_0030933 | |||
| 2185 | Ga0501048_0045087 | |||
| 2186 | Ga0501048_0072852 | |||
| 2187 | Ga0501067_0009512 | |||
| 2188 | Ga0501067_0085384 | |||
| 2189 | Ga0501068_0001537 | |||
| 2190 | Ga0501068_0005706 | |||
| 2191 | Ga0501068_0006272 | |||
| 2192 | Ga0501068_0025712 | |||
| 2193 | Ga0501068_0093277 | |||
| 2194 | Ga0501069_0005348 | |||
| 2195 | Ga0501069_0005484 | |||
| 2196 | Ga0501069_0006946 | |||
| 2197 | Ga0501069_0017146 | |||
| 2198 | Ga0501069_0106449 | |||
| 2199 | Ga0501069_0114398 | |||
| 2200 | Ga0501070_0000932 | |||
| 2201 | Ga0501070_0002071 | |||
| 2202 | Ga0501070_0011151 | |||
| 2203 | Ga0501070_0020037 | |||
| 2204 | Ga0501070_0121834 | |||
| 2205 | Ga0501070_0213984 | |||
| 2206 | Ga0501070_0356231 | |||
| 2207 | Ga0501071_0008317 | |||
| 2208 | Ga0501071_0010584 | |||
| 2209 | Ga0501071_0017401 | |||
| 2210 | Ga0501071_0068518 | |||
| 2211 | Ga0501071_0163411 | |||
| 2212 | Ga0501071_0241836 | |||
| 2213 | Ga0501072_0008089 | |||
| 2214 | Ga0501072_0011971 | |||
| 2215 | Ga0501072_0022954 | |||
| 2216 | Ga0501072_0035498 | |||
| 2217 | Ga0501072_0040293 | |||
| 2218 | Ga0501072_0065467 | |||
| 2219 | Ga0501072_0093560 | |||
| 2220 | Ga0501072_0101103 | |||
| 2221 | Ga0501072_0164049 | |||
| 2222 | Ga0501073_0029889 | |||
| 2223 | Ga0501073_0075243 | |||
| 2224 | Ga0501073_0096106 | |||
| 2225 | Ga0501073_0268369 | |||
| 2226 | Ga0501074_0009335 | |||
| 2227 | Ga0501074_0029313 | |||
| 2228 | Ga0501074_0092050 | |||
| 2229 | Ga0501074_0138061 | |||
| 2230 | Ga0501074_0180786 | |||
| 2231 | Ga0501075_0003177 | |||
| 2232 | Ga0501075_0009635 | |||
| 2233 | Ga0501075_0051824 | |||
| 2234 | Ga0501075_0098589 | |||
| 2235 | Ga0501075_0133061 | |||
| 2236 | Ga0501075_0246597 | |||
| 2237 | Ga0501076_0006779 | |||
| 2238 | Ga0501076_0008556 | |||
| 2239 | Ga0501076_0016816 | |||
| 2240 | Ga0501076_0038033 | |||
| 2241 | Ga0501076_0056547 | |||
| 2242 | Ga0501076_0060231 | |||
| 2243 | Ga0501076_0081383 | |||
| 2244 | Ga0501076_0482884 | |||
| 2245 | Ga0501077_0002696 | |||
| 2246 | Ga0501077_0004113 | |||
| 2247 | Ga0501077_0021974 | |||
| 2248 | Ga0501077_0043824 | |||
| 2249 | Ga0501077_0046241 | |||
| 2250 | Ga0501077_0053737 | |||
| 2251 | Ga0501079_0002599 | |||
| 2252 | Ga0501079_0006044 | |||
| 2253 | Ga0501079_0018929 | |||
| 2254 | Ga0501079_0112580 | |||
| 2255 | Ga0501079_0128028 | |||
| 2256 | Ga0501079_0302104 | |||
| 2257 | Ga0501080_0003099 | |||
| 2258 | Ga0501080_0009875 | |||
| 2259 | Ga0501080_0011017 | |||
| 2260 | Ga0501080_0015234 | |||
| 2261 | Ga0501080_0015236 | |||
| 2262 | Ga0501080_0030090 | |||
| 2263 | Ga0501080_0042851 | |||
| 2264 | Ga0501080_0128843 | |||
| 2265 | Ga0501080_0245813 | |||
| 2266 | Ga0501080_0249400 | |||
| 2267 | Ga0501080_0323400 | |||
| 2268 | Ga0501080_0598069 | |||
| 2269 | Ga0501081_0006015 | |||
| 2270 | Ga0501081_0012121 | |||
| 2271 | Ga0501081_0027399 | |||
| 2272 | Ga0501081_0046325 | |||
| 2273 | Ga0501081_0057695 | |||
| 2274 | Ga0501081_0074805 | |||
| 2275 | Ga0501083_0001150 | |||
| 2276 | Ga0501083_0009072 | |||
| 2277 | Ga0501083_0033347 | |||
| 2278 | Ga0501083_0073318 | |||
| 2279 | Ga0501083_0132962 | |||
| 2280 | Ga0501035_0029051 | |||
| 2281 | Ga0501035_0051815 | |||
| 2282 | Ga0501035_0207160 | |||
| 2283 | Ga0501035_0425194 | |||
| 2284 | Ga0501035_0439416 | |||
| 2285 | Ga0501044_0032685 | |||
| 2286 | Ga0501044_0046195 | |||
| 2287 | Ga0501044_0074258 | |||
| 2288 | Ga0501045_0004472 | |||
| 2289 | Ga0501045_0007706 | |||
| 2290 | Ga0501045_0015025 | |||
| 2291 | Ga0501045_0316369 | |||
| 2292 | nmdc:mga03683_50388_c1 | |||
| 2293 | nmdc:mga06z11_55334_c1 | |||
| 2294 | nmdc:mga05p37_218628_c1 | |||
| 2295 | nmdc:mga05p37_28125_c1 | |||
| 2296 | nmdc:mga05p37_42550_c1 | |||
| 2297 | nmdc:mga05p37_69520_c1 | |||
| 2298 | nmdc:mga05p37_91230_c1 | |||
| 2299 | nmdc:mga09592_372152_c1 | |||
| 2300 | nmdc:mga09592_97006_c1 | |||
| 2301 | nmdc:mga06r32_436727_c1 | |||
| 2302 | nmdc:mga06r32_559548_c1 | |||
| 2303 | nmdc:mga08y16_112287_c1 | |||
| 2304 | nmdc:mga08y16_128888_c1 | |||
| 2305 | nmdc:mga08y16_313864_c1 | |||
| 2306 | nmdc:mga08y16_350857_c1 | |||
| 2307 | nmdc:mga08y16_40122_c1 | |||
| 2308 | nmdc:mga0n895_3110_c1 | |||
| 2309 | nmdc:mga0rr50_22496_c1 | |||
| 2310 | nmdc:mga08x19_246563_c1 | |||
| 2311 | nmdc:mga08x19_328248_c1 | |||
| 2312 | nmdc:mga0a205_132300_c1 | |||
| 2313 | nmdc:mga0a205_38193_c1 | |||
| 2314 | Ga0495601_0013877 | |||
| 2315 | Ga0495601_0026505 | |||
| 2316 | Ga0495601_0193108 | |||
| 2317 | Ga0495612_0023733 | |||
| 2318 | Ga0495612_0044779 | |||
| 2319 | Ga0495595_0003172 | |||
| 2320 | Ga0495595_0034736 | |||
| 2321 | Ga0495595_0039666 | |||
| 2322 | Ga0495595_0190490 | |||
| 2323 | Ga0495619_0008553 | |||
| 2324 | Ga0495619_0008933 | |||
| 2325 | Ga0495619_0010495 | |||
| 2326 | Ga0495619_0061892 | |||
| 2327 | Ga0495619_0283205 | |||
| 2328 | Ga0495619_0337062 | |||
| 2329 | Ga0501084_0008364 | |||
| 2330 | Ga0501084_0027752 | |||
| 2331 | Ga0501084_0045011 | |||
| 2332 | Ga0501084_0051198 | |||
| 2333 | Ga0501084_0057429 | |||
| 2334 | Ga0501084_0228959 | |||
| 2335 | Ga0501084_0244646 | |||
| 2336 | Ga0501084_0471443 | |||
| 2337 | Ga0501082_0010110 | |||
| 2338 | Ga0501082_0017296 | |||
| 2339 | Ga0501082_0018315 | |||
| 2340 | Ga0501082_0033000 | |||
| 2341 | Ga0501082_0069746 | |||
| 2342 | Ga0501082_0182563 | |||
| 2343 | Ga0466962_0004475 | |||
| 2344 | Ga0530510_0002954 | |||
| 2345 | Ga0530510_0034472 | |||
| 2346 | Ga0530510_0034484 | |||
| 2347 | Ga0530510_0041507 | |||
| 2348 | Ga0530510_0056043 | |||
| 2349 | Ga0530510_0079718 | |||
| 2350 | Ga0530510_0085852 | |||
| 2351 | Ga0530510_0124561 | |||
| 2352 | Ga0530510_0249544 | |||
| 2353 | Ga0530510_0310018 | |||
| 2354 | 3006975249 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5end-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg)(q152a) from vibrio cholerae | 0.9382 | 5 | 269 |
| 2hq1-assembly1.cif.gz_A | crystal structure of orf 1438 a putative glucose/ribitol dehydrogenase from clostridium thermocellum | 0.9295 | 4 | 270 |
| 3osu-assembly1.cif.gz_B | crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus | 0.9291 | 9 | 269 |
| 7tzp-assembly3.cif.gz_G | crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044 in complex with nadh | 0.9273 | 1 | 270 |
| 4ure-assembly1.cif.gz_A | molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 | 0.926 | 4 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2hq1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9295 | 4 | 270 | 3.40.50.720 |
| 3tzcB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.927 | 5 | 271 | 3.40.50.720 |
| af_B7FAC8_69_312_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9259 | 8 | 269 | 3.40.50.720 |
| 2hq1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9254 | 4 | 270 | 3.40.50.720 |
| 4urfA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9238 | 6 | 268 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V5DR57-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.9442 | 4 | 269 |
GO:0004316
GO:0030497 GO:0051287 |
| AF-A0A535HMS1-F1-model_v4 | 3-oxoacyl-ACP reductase FabG | 0.9408 | 4 | 275 |
GO:0016491
|
| AF-A0A7C1F794-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.9381 | 4 | 269 |
GO:0004316
GO:0030497 GO:0051287 |
| AF-A0A7C1GKR3-F1-model_v4 | Beta-ketoacyl-ACP reductase | 0.9377 | 2 | 268 |
GO:0016491
|
| AF-D5WXR6-F1-model_v4 | Short-chain dehydrogenase/reductase SDR | 0.9367 | 4 | 269 |
GO:0016491
|