F491267

General Info

Members Datasets Scaffolds Average Seq Length
1177 362 2354 275

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0184988|Ga0501040_0184988_301_1137
Length 278
Sequence MSLEIDLSGRVALVTGGSRGLGRADALTLARAGADVVIADIQVESETTDEEAERYGPLAQVARAQGLVFTEATAQEIQAIGRRAAAVKCDVTDREQVATTVARTVEELGSVDILVNNAGTLDHVAQLGDQSPELWERDLRVNLTGAFNCAQAVWPHMQERGWGRIVNMASVAGTLGGFGQSSYSTTKAGLLGLTKSLALEGARHGITVNAIVPGIIGTEAFSFGNPEMNERMVKRTALRRVGEPQDIANAIAFLCSDLAAYITGVGLNVSGGIELFTF

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
181 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
182 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
183 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
184 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
185 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
190 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
229 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
230 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
231 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
232 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
233 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
238 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
254 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
255 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
256 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
257 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
258 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
277 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
278 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
294 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
295 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
296 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
327 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
328 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
329 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
330 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
331 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
332 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
333 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
334 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
335 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
336 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
340 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
345 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
351 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
352 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
353 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
354 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
355 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
356 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
357 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
358 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
362 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 1.1
Isolates 0.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 8.75
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0184988 3300049576 Bacteria 1477
2 JGI24747J21853_1005485 3300001978 Bacteria 1172
3 JGI24749J21850_1009238 3300002076 Bacteria 1378
4 JGI24744J21845_10003353 3300002077 Bacteria 3290
5 JGI25407J50210_10000579 3300003373 Bacteria 7403
6 JGI25407J50210_10005452 3300003373 Bacteria 3128
7 Ga0070658_10010114 3300005327 Bacteria 7571
8 Ga0070658_10028070 3300005327 Bacteria 4517
9 Ga0070658_10071971 3300005327 Bacteria 2832
10 Ga0070658_10072608 3300005327 Bacteria 2820
11 Ga0070658_10471760 3300005327 Bacteria 1082
12 Ga0070676_10045076 3300005328 Bacteria 2568
13 Ga0070683_100004095 3300005329 Bacteria 11949
14 Ga0070683_100231028 3300005329 Bacteria 1759
15 Ga0070683_100256172 3300005329 Bacteria 1664
16 Ga0070683_100514878 3300005329 Bacteria 1143
17 Ga0070670_100018158 3300005331 Bacteria 6036
18 Ga0070666_10114532 3300005335 Bacteria 1867
19 Ga0070680_100005086 3300005336 Bacteria 9922
20 Ga0070680_100007837 3300005336 Bacteria 8143
21 Ga0070680_100008703 3300005336 Bacteria 7780
22 Ga0070680_100200540 3300005336 Bacteria 1682
23 Ga0070682_100024789 3300005337 Bacteria 3573
24 Ga0070682_100061448 3300005337 Bacteria 2378
25 Ga0070682_100188816 3300005337 Bacteria 1445
26 Ga0068868_100040658 3300005338 Bacteria 3619
27 Ga0068868_100062012 3300005338 Bacteria 2963
28 Ga0070660_100003574 3300005339 Bacteria 10734
29 Ga0070660_100004622 3300005339 Bacteria 9530
30 Ga0070660_100154823 3300005339 Bacteria 1845
31 Ga0070660_100331784 3300005339 Bacteria 1251
32 Ga0070689_100047182 3300005340 Bacteria 3321
33 Ga0070691_10032809 3300005341 Bacteria 2441
34 Ga0070687_100037970 3300005343 Bacteria 2411
35 Ga0070687_100177880 3300005343 Bacteria 1272
36 Ga0070661_100016782 3300005344 Bacteria 5184
37 Ga0070661_100030295 3300005344 Bacteria 3908
38 Ga0070661_100065760 3300005344 Bacteria 2664
39 Ga0070661_100066365 3300005344 Bacteria 2651
40 Ga0070661_100125465 3300005344 Bacteria 1925
41 Ga0070692_10219176 3300005345 Bacteria 1124
42 Ga0070668_100064152 3300005347 Bacteria 2848
43 Ga0070668_100181922 3300005347 Bacteria 1717
44 Ga0070668_100354194 3300005347 Bacteria 1243
45 Ga0070675_100013851 3300005354 Bacteria 6349
46 Ga0070675_100093911 3300005354 Bacteria 2516
47 Ga0070671_100016930 3300005355 Bacteria 5896
48 Ga0070671_100060084 3300005355 Bacteria 3164
49 Ga0070674_100001772 3300005356 Bacteria 11704
50 Ga0070674_100014593 3300005356 Bacteria 4887
51 Ga0070674_100024872 3300005356 Bacteria 3890
52 Ga0070674_100032598 3300005356 Bacteria 3460
53 Ga0070673_100017348 3300005364 Bacteria 5117
54 Ga0070688_100002947 3300005365 Bacteria 8684
55 Ga0070688_100025703 3300005365 Bacteria 3489
56 Ga0070659_100054433 3300005366 Bacteria 3151
57 Ga0070659_100129110 3300005366 Bacteria 2052
58 Ga0070703_10070945 3300005406 Bacteria 1164
59 Ga0070709_10136862 3300005434 Bacteria 1678
60 Ga0070714_100004907 3300005435 Bacteria 10160
61 Ga0070714_100069502 3300005435 Bacteria 3042
62 Ga0070714_100303136 3300005435 Bacteria 1490
63 Ga0070714_100417020 3300005435 Bacteria 1271
64 Ga0070714_100580937 3300005435 Bacteria 1075
65 Ga0070713_100171490 3300005436 Bacteria 1944
66 Ga0070710_10045044 3300005437 Bacteria 2450
67 Ga0070701_10012352 3300005438 Bacteria 3849
68 Ga0070701_10093551 3300005438 Bacteria 1652
69 Ga0070711_100219247 3300005439 Bacteria 1478
70 Ga0070711_100262425 3300005439 Bacteria 1359
71 Ga0070700_100008291 3300005441 Bacteria 5655
72 Ga0070694_100049597 3300005444 Bacteria 2828
73 Ga0070708_100272235 3300005445 Bacteria 1593
74 Ga0070663_100042192 3300005455 Bacteria 3205
75 Ga0070663_100054447 3300005455 Bacteria 2860
76 Ga0070663_100142404 3300005455 Bacteria 1832
77 Ga0070678_100021853 3300005456 Bacteria 4229
78 Ga0070678_100233863 3300005456 Bacteria 1533
79 Ga0070662_100026269 3300005457 Bacteria 4031
80 Ga0070662_100089419 3300005457 Bacteria 2310
81 Ga0070681_10000749 3300005458 Bacteria 26980
82 Ga0070681_10002438 3300005458 Bacteria 17023
83 Ga0070681_10006655 3300005458 Bacteria 11248
84 Ga0070681_10010692 3300005458 Bacteria 9072
85 Ga0070681_10020308 3300005458 Bacteria 6658
86 Ga0070681_10145901 3300005458 Bacteria 2295
87 Ga0070681_10198909 3300005458 Bacteria 1923
88 Ga0070681_10210855 3300005458 Bacteria 1859
89 Ga0070681_10484398 3300005458 Bacteria 1150
90 Ga0068867_100053297 3300005459 Bacteria 2987
91 Ga0070685_10003250 3300005466 Bacteria 8257
92 Ga0070685_10004853 3300005466 Bacteria 6803
93 Ga0070706_100024656 3300005467 Bacteria 5538
94 Ga0070706_100033735 3300005467 Bacteria 4726
95 Ga0070706_100088077 3300005467 Bacteria 2878
96 Ga0070707_100024051 3300005468 Bacteria 5766
97 Ga0070707_100170370 3300005468 Bacteria 2122
98 Ga0070707_100224763 3300005468 Bacteria 1828
99 Ga0070707_100270323 3300005468 Bacteria 1653
100 Ga0070707_100344456 3300005468 Bacteria 1448
101 Ga0070698_100010130 3300005471 Bacteria 10068
102 Ga0070698_100038621 3300005471 Bacteria 4918
103 Ga0070698_100099283 3300005471 Bacteria 2885
104 Ga0070698_100120471 3300005471 Bacteria 2584
105 Ga0070698_100242003 3300005471 Bacteria 1737
106 Ga0070699_100033541 3300005518 Bacteria 4435
107 Ga0070699_100085618 3300005518 Unclassified 2750
108 Ga0070699_100287386 3300005518 Bacteria 1474
109 Ga0070679_100016743 3300005530 Bacteria 7084
110 Ga0070679_100032625 3300005530 Bacteria 5153
111 Ga0070679_100038005 3300005530 Bacteria 4784
112 Ga0070679_100038029 3300005530 Bacteria 4782
113 Ga0070679_100066304 3300005530 Bacteria 3598
114 Ga0070679_100085126 3300005530 Bacteria 3148
115 Ga0070679_100152562 3300005530 Bacteria 2287
116 Ga0070679_100513908 3300005530 Bacteria 1142
117 Ga0070684_100007703 3300005535 Bacteria 8395
118 Ga0070684_100008812 3300005535 Bacteria 7908
119 Ga0070684_100016168 3300005535 Bacteria 6095
120 Ga0070684_100024755 3300005535 Bacteria 5038
121 Ga0070684_100027123 3300005535 Unclassified 4831
122 Ga0070684_100135701 3300005535 Bacteria 2222
123 Ga0070684_100186885 3300005535 Bacteria 1884
124 Ga0070684_100242356 3300005535 Bacteria 1647
125 Ga0070684_100385272 3300005535 Bacteria 1291
126 Ga0070684_100522997 3300005535 Bacteria 1100
127 Ga0068853_100062429 3300005539 Bacteria 3224
128 Ga0070672_100017544 3300005543 Bacteria 5155
129 Ga0070672_100039052 3300005543 Bacteria 3633
130 Ga0070686_100017035 3300005544 Bacteria 4239
131 Ga0070686_100100217 3300005544 Bacteria 1955
132 Ga0070696_100030807 3300005546 Bacteria 3674
133 Ga0070696_100039316 3300005546 Bacteria 3266
134 Ga0070693_100005691 3300005547 Bacteria 6011
135 Ga0070693_100010318 3300005547 Bacteria 4676
136 Ga0070693_100028214 3300005547 Bacteria 3050
137 Ga0070665_100019078 3300005548 Bacteria 6879
138 Ga0070665_100020625 3300005548 Bacteria 6621
139 Ga0070665_100022583 3300005548 Bacteria 6333
140 Ga0070704_100022283 3300005549 Bacteria 4120
141 Ga0070704_100121350 3300005549 Bacteria 2008
142 Ga0068855_100013479 3300005563 Bacteria 9854
143 Ga0068855_100017889 3300005563 Bacteria 8517
144 Ga0068855_100043921 3300005563 Bacteria 5291
145 Ga0068855_100105880 3300005563 Bacteria 3233
146 Ga0068855_100198402 3300005563 Bacteria 2260
147 Ga0070664_100004370 3300005564 Bacteria 11352
148 Ga0070664_100213325 3300005564 Bacteria 1726
149 Ga0070664_100497186 3300005564 Bacteria 1124
150 Ga0068857_100056589 3300005577 Bacteria 3481
151 Ga0068857_100128737 3300005577 Bacteria 2282
152 Ga0068857_100133197 3300005577 Bacteria 2243
153 Ga0068856_100157818 3300005614 Bacteria 2278
154 Ga0068856_100233310 3300005614 Bacteria 1855
155 Ga0068856_100417472 3300005614 Bacteria 1362
156 Ga0070702_100049892 3300005615 Bacteria 2389
157 Ga0070702_100079449 3300005615 Bacteria 1960
158 Ga0070702_100091583 3300005615 Bacteria 1845
159 Ga0068852_100038105 3300005616 Bacteria 4037
160 Ga0068852_100322301 3300005616 Bacteria 1501
161 Ga0068859_100350113 3300005617 Bacteria 1572
162 Ga0068859_100382935 3300005617 Bacteria 1502
163 Ga0068864_100013928 3300005618 Bacteria 6666
164 Ga0068866_10021168 3300005718 Bacteria 2992
165 Ga0068866_10025200 3300005718 Bacteria 2794
166 Ga0068866_10190184 3300005718 Bacteria 1219
167 Ga0068851_10223941 3300005834 Unclassified 1058
168 Ga0068870_10158297 3300005840 Bacteria 1341
169 Ga0068870_10272311 3300005840 Bacteria 1058
170 Ga0068862_100277854 3300005844 Bacteria 1534
171 Ga0081455_10027165 3300005937 Bacteria 5247
172 Ga0081455_10027400 3300005937 Bacteria 5222
173 Ga0081455_10040735 3300005937 Unclassified 4094
174 Ga0081455_10049314 3300005937 Bacteria 3630
175 Ga0081455_10052841 3300005937 Bacteria 3475
176 Ga0081455_10092006 3300005937 Bacteria 2455
177 Ga0081455_10095463 3300005937 Bacteria 2400
178 Ga0081455_10162487 3300005937 Bacteria 1710
179 Ga0081455_10206461 3300005937 Bacteria 1467
180 Ga0081455_10265364 3300005937 Bacteria 1248
181 Ga0081538_10000455 3300005981 Bacteria 45816
182 Ga0081538_10000458 3300005981 Bacteria 45661
183 Ga0081538_10000515 3300005981 Bacteria 43219
184 Ga0081538_10010281 3300005981 Bacteria 7684
185 Ga0081538_10018466 3300005981 Bacteria 5235
186 Ga0081539_10001762 3300005985 Bacteria 34518
187 Ga0081539_10003734 3300005985 Bacteria 18115
188 Ga0081539_10063314 3300005985 Bacteria 2018
189 Ga0075365_10165455 3300006038 Bacteria 1543
190 Ga0075363_100059917 3300006048 Bacteria 2048
191 Ga0075432_10002033 3300006058 Bacteria 6728
192 Ga0070716_100138938 3300006173 Bacteria 1546
193 Ga0070716_100269572 3300006173 Bacteria 1169
194 Ga0070712_100010028 3300006175 Bacteria 5972
195 Ga0070712_100068415 3300006175 Bacteria 2530
196 Ga0075362_10037521 3300006177 Bacteria 2125
197 Ga0075367_10021905 3300006178 Bacteria 3578
198 Ga0097621_100016451 3300006237 Bacteria 5592
199 Ga0068871_100008154 3300006358 Bacteria 7524
200 Ga0068871_100187969 3300006358 Bacteria 1778
201 Ga0068871_100279383 3300006358 Bacteria 1460
202 Ga0075428_100003088 3300006844 Bacteria 18172
203 Ga0075428_100010638 3300006844 Bacteria 10227
204 Ga0075430_100031259 3300006846 Bacteria 4519
205 Ga0075431_100100516 3300006847 Bacteria 2984
206 Ga0075431_100152582 3300006847 Bacteria 2378
207 Ga0075433_10015575 3300006852 Bacteria 6243
208 Ga0075433_10112863 3300006852 Bacteria 2411
209 Ga0075434_100042180 3300006871 Bacteria 4522
210 Ga0075429_100001412 3300006880 Bacteria 19667
211 Ga0068865_100039665 3300006881 Bacteria 3195
212 Ga0068865_100187153 3300006881 Bacteria 1598
213 Ga0097620_100350113 3300006931 Bacteria 1572
214 Ga0097620_100382938 3300006931 Bacteria 1502
215 Ga0075435_100149343 3300007076 Bacteria 1964
216 Ga0105240_10004372 3300009093 Bacteria 21577
217 Ga0105240_10062989 3300009093 Bacteria 4615
218 Ga0105240_10079949 3300009093 Bacteria 4022
219 Ga0105240_10099590 3300009093 Bacteria 3538
220 Ga0105240_10181998 3300009093 Bacteria 2479
221 Ga0111539_10017279 3300009094 Bacteria 8927
222 Ga0111539_10095782 3300009094 Bacteria 3486
223 Ga0111539_10238313 3300009094 Bacteria 2117
224 Ga0105245_10009977 3300009098 Bacteria 8271
225 Ga0105245_10026745 3300009098 Bacteria 5080
226 Ga0105245_10035862 3300009098 Bacteria 4403
227 Ga0105245_10074826 3300009098 Bacteria 3082
228 Ga0105245_10120838 3300009098 Bacteria 2447
229 Ga0105245_10127228 3300009098 Bacteria 2386
230 Ga0105245_10234160 3300009098 Bacteria 1777
231 Ga0105247_10095101 3300009101 Bacteria 1897
232 Ga0114129_10012486 3300009147 Bacteria 12094
233 Ga0114129_10020559 3300009147 Bacteria 9387
234 Ga0114129_10021264 3300009147 Bacteria 9212
235 Ga0114129_10029801 3300009147 Bacteria 7727
236 Ga0114129_10052837 3300009147 Bacteria 5702
237 Ga0114129_10622484 3300009147 Bacteria 1396
238 Ga0105243_10133205 3300009148 Bacteria 2111
239 Ga0105243_10153483 3300009148 Bacteria 1978
240 Ga0105241_10101612 3300009174 Bacteria 2286
241 Ga0105241_10245744 3300009174 Bacteria 1515
242 Ga0105241_10280763 3300009174 Bacteria 1422
243 Ga0105241_10311481 3300009174 Bacteria 1354
244 Ga0105241_10558167 3300009174 Bacteria 1029
245 Ga0105242_10061575 3300009176 Bacteria 3087
246 Ga0105242_10066836 3300009176 Bacteria 2970
247 Ga0105242_10429614 3300009176 Bacteria 1240
248 Ga0105248_10077735 3300009177 Bacteria 3731
249 Ga0105248_10128764 3300009177 Bacteria 2856
250 Ga0105248_10424847 3300009177 Bacteria 1497
251 Ga0105237_10080751 3300009545 Bacteria 3242
252 Ga0105238_10036976 3300009551 Bacteria 4964
253 Ga0105238_10046749 3300009551 Bacteria 4365
254 Ga0105238_10527902 3300009551 Bacteria 1183
255 Ga0105249_10008732 3300009553 Bacteria 8839
256 Ga0105249_10119310 3300009553 Unclassified 2505
257 Ga0105249_10862687 3300009553 Bacteria 971
258 Ga0105239_10087029 3300010375 Bacteria 3444
259 Ga0105239_10121458 3300010375 Bacteria 2901
260 Ga0105239_10405184 3300010375 Bacteria 1544
261 Ga0105246_10005883 3300011119 Bacteria 7482
262 Ga0157373_10211878 3300013100 Bacteria 1366
263 Ga0157373_10269605 3300013100 Bacteria 1205
264 Ga0157370_10082774 3300013104 Bacteria 3018
265 Ga0157370_10167968 3300013104 Bacteria 2040
266 Ga0157370_10191642 3300013104 Bacteria 1897
267 Ga0157370_10392594 3300013104 Bacteria 1278
268 Ga0157369_10003856 3300013105 Bacteria 17824
269 Ga0157369_10004745 3300013105 Bacteria 15975
270 Ga0157369_10029338 3300013105 Bacteria 6080
271 Ga0157369_10039271 3300013105 Bacteria 5173
272 Ga0157369_10048490 3300013105 Bacteria 4608
273 Ga0157369_10184825 3300013105 Bacteria 2192
274 Ga0157374_10107277 3300013296 Bacteria 2684
275 Ga0157378_10090796 3300013297 Bacteria 2776
276 Ga0157378_10199513 3300013297 Bacteria 1892
277 Ga0157372_10027331 3300013307 Bacteria 6213
278 Ga0157372_10048606 3300013307 Bacteria 4716
279 Ga0157372_10073700 3300013307 Bacteria 3849
280 Ga0157372_10256476 3300013307 Bacteria 2030
281 Ga0157372_10263658 3300013307 Bacteria 2001
282 Ga0157372_10857237 3300013307 Bacteria 1054
283 Ga0163163_10084462 3300014325 Bacteria 3181
284 Ga0163163_10203039 3300014325 Bacteria 2030
285 Ga0157380_10040578 3300014326 Bacteria 3626
286 Ga0157380_10303123 3300014326 Bacteria 1473
287 Ga0182008_10006292 3300014497 Bacteria 6662
288 Ga0157377_10000547 3300014745 Bacteria 15851
289 Ga0157377_10003389 3300014745 Bacteria 7207
290 Ga0157377_10005877 3300014745 Bacteria 5807
291 Ga0157377_10068948 3300014745 Unclassified 2039
292 Ga0157376_10105467 3300014969 Bacteria 2471
293 Ga0157376_10223600 3300014969 Bacteria 1745
294 Ga0182006_1015081 3300015261 Bacteria 3319
295 Ga0182007_10030994 3300015262 Bacteria 1824
296 Ga0163161_10131043 3300017792 Bacteria 1891
297 Ga0206356_10498829 3300020070 Bacteria 2224
298 Ga0206356_10525729 3300020070 Bacteria 1508
299 Ga0206356_10612284 3300020070 Bacteria 1197
300 Ga0206356_11589996 3300020070 Bacteria 2290
301 Ga0206350_11494092 3300020080 Bacteria 1139
302 Ga0206354_10607152 3300020081 Bacteria 2043
303 Ga0206354_11210031 3300020081 Bacteria 1165
304 Ga0206353_10294127 3300020082 Bacteria 1089
305 Ga0206353_10558386 3300020082 Bacteria 2034
306 Ga0206353_11428389 3300020082 Bacteria 1373
307 Ga0206353_11672605 3300020082 Bacteria 3867
308 Ga0213876_10036081 3300021384 Bacteria 2608
309 Ga0213871_10078276 3300021441 Bacteria 944
310 Ga0224712_10031602 3300022467 Bacteria 1922
311 Ga0224712_10162561 3300022467 Bacteria 996
312 Ga0207653_10012709 3300025885 Bacteria 2630
313 Ga0207692_10328132 3300025898 Bacteria 938
314 Ga0207642_10118456 3300025899 Bacteria 1361
315 Ga0207710_10144375 3300025900 Bacteria 1151
316 Ga0207688_10000094 3300025901 Bacteria 34655
317 Ga0207688_10019905 3300025901 Bacteria 3660
318 Ga0207680_10294154 3300025903 Bacteria 1131
319 Ga0207647_10038076 3300025904 Bacteria 3043
320 Ga0207685_10087548 3300025905 Bacteria 1304
321 Ga0207699_10392315 3300025906 Bacteria 987
322 Ga0207645_10019320 3300025907 Bacteria 4468
323 Ga0207645_10026266 3300025907 Bacteria 3764
324 Ga0207643_10044103 3300025908 Bacteria 2517
325 Ga0207643_10180953 3300025908 Bacteria 1276
326 Ga0207643_10198724 3300025908 Bacteria 1220
327 Ga0207705_10086371 3300025909 Bacteria 2293
328 Ga0207705_10096333 3300025909 Bacteria 2172
329 Ga0207705_10109308 3300025909 Bacteria 2041
330 Ga0207684_10070766 3300025910 Bacteria 2964
331 Ga0207654_10029202 3300025911 Bacteria 3015
332 Ga0207654_10278423 3300025911 Bacteria 1131
333 Ga0207707_10005506 3300025912 Bacteria 11067
334 Ga0207707_10010668 3300025912 Bacteria 7982
335 Ga0207707_10021783 3300025912 Bacteria 5602
336 Ga0207707_10037026 3300025912 Bacteria 4263
337 Ga0207707_10046052 3300025912 Bacteria 3798
338 Ga0207707_10067519 3300025912 Bacteria 3115
339 Ga0207707_10078633 3300025912 Bacteria 2881
340 Ga0207707_10117638 3300025912 Bacteria 2323
341 Ga0207707_10177487 3300025912 Bacteria 1860
342 Ga0207707_10226531 3300025912 Bacteria 1627
343 Ga0207707_10306253 3300025912 Bacteria 1373
344 Ga0207707_10382509 3300025912 Bacteria 1210
345 Ga0207695_10061774 3300025913 Bacteria 3871
346 Ga0207695_10072269 3300025913 Bacteria 3521
347 Ga0207695_10079390 3300025913 Bacteria 3326
348 Ga0207695_10226265 3300025913 Bacteria 1777
349 Ga0207693_10004208 3300025915 Bacteria 12200
350 Ga0207693_10075887 3300025915 Bacteria 2633
351 Ga0207693_10097505 3300025915 Bacteria 2305
352 Ga0207693_10114673 3300025915 Bacteria 2115
353 Ga0207663_10007048 3300025916 Bacteria 5804
354 Ga0207663_10229788 3300025916 Bacteria 1355
355 Ga0207660_10005764 3300025917 Bacteria 8037
356 Ga0207660_10104625 3300025917 Bacteria 2120
357 Ga0207660_10128034 3300025917 Bacteria 1930
358 Ga0207660_10162060 3300025917 Bacteria 1726
359 Ga0207662_10051778 3300025918 Bacteria 2443
360 Ga0207657_10000486 3300025919 Bacteria 41915
361 Ga0207657_10005329 3300025919 Bacteria 13471
362 Ga0207657_10006205 3300025919 Bacteria 12426
363 Ga0207657_10008281 3300025919 Bacteria 10581
364 Ga0207657_10008995 3300025919 Bacteria 10086
365 Ga0207657_10033911 3300025919 Bacteria 4597
366 Ga0207657_10065773 3300025919 Bacteria 3089
367 Ga0207657_10114156 3300025919 Bacteria 2228
368 Ga0207657_10166715 3300025919 Bacteria 1786
369 Ga0207657_10191748 3300025919 Bacteria 1648
370 Ga0207657_10288463 3300025919 Bacteria 1302
371 Ga0207657_10307160 3300025919 Bacteria 1256
372 Ga0207649_10013306 3300025920 Bacteria 4590
373 Ga0207649_10044263 3300025920 Bacteria 2725
374 Ga0207649_10100556 3300025920 Bacteria 1913
375 Ga0207649_10108045 3300025920 Bacteria 1854
376 Ga0207649_10113426 3300025920 Bacteria 1815
377 Ga0207652_10001978 3300025921 Bacteria 17727
378 Ga0207652_10010935 3300025921 Bacteria 7316
379 Ga0207652_10026105 3300025921 Bacteria 4862
380 Ga0207652_10027508 3300025921 Bacteria 4738
381 Ga0207652_10056406 3300025921 Bacteria 3381
382 Ga0207652_10112977 3300025921 Bacteria 2411
383 Ga0207652_10114613 3300025921 Bacteria 2393
384 Ga0207652_10125163 3300025921 Bacteria 2289
385 Ga0207652_10152932 3300025921 Bacteria 2066
386 Ga0207652_10189815 3300025921 Unclassified 1848
387 Ga0207652_10335258 3300025921 Bacteria 1366
388 Ga0207652_10434052 3300025921 Bacteria 1184
389 Ga0207652_10530626 3300025921 Bacteria 1059
390 Ga0207646_10003257 3300025922 Bacteria 18503
391 Ga0207646_10010936 3300025922 Bacteria 8813
392 Ga0207646_10227617 3300025922 Bacteria 1684
393 Ga0207646_10337827 3300025922 Bacteria 1361
394 Ga0207646_10513022 3300025922 Bacteria 1079
395 Ga0207681_10431991 3300025923 Bacteria 1069
396 Ga0207650_10010951 3300025925 Bacteria 6233
397 Ga0207659_10116000 3300025926 Bacteria 2044
398 Ga0207659_10386869 3300025926 Bacteria 1167
399 Ga0207687_10020244 3300025927 Bacteria 4414
400 Ga0207687_10027128 3300025927 Bacteria 3841
401 Ga0207687_10028849 3300025927 Bacteria 3729
402 Ga0207687_10074672 3300025927 Unclassified 2431
403 Ga0207700_10060593 3300025928 Bacteria 2867
404 Ga0207700_10079616 3300025928 Bacteria 2552
405 Ga0207700_10110286 3300025928 Bacteria 2213
406 Ga0207664_10016700 3300025929 Bacteria 5360
407 Ga0207664_10141390 3300025929 Bacteria 2036
408 Ga0207664_10249969 3300025929 Bacteria 1547
409 Ga0207664_10284909 3300025929 Bacteria 1450
410 Ga0207664_10362933 3300025929 Bacteria 1283
411 Ga0207644_10268609 3300025931 Bacteria 1366
412 Ga0207690_10037999 3300025932 Bacteria 3130
413 Ga0207690_10237158 3300025932 Bacteria 1403
414 Ga0207690_10496472 3300025932 Bacteria 987
415 Ga0207706_10049875 3300025933 Bacteria 3699
416 Ga0207706_10094871 3300025933 Bacteria 2624
417 Ga0207686_10233774 3300025934 Bacteria 1334
418 Ga0207709_10017746 3300025935 Bacteria 3978
419 Ga0207709_10068356 3300025935 Unclassified 2245
420 Ga0207670_10147357 3300025936 Bacteria 1742
421 Ga0207704_10003174 3300025938 Bacteria 7441
422 Ga0207704_10090206 3300025938 Bacteria 2011
423 Ga0207704_10112229 3300025938 Bacteria 1846
424 Ga0207665_10002976 3300025939 Bacteria 11360
425 Ga0207665_10018558 3300025939 Bacteria 4569
426 Ga0207665_10057948 3300025939 Bacteria 2617
427 Ga0207691_10001755 3300025940 Bacteria 21340
428 Ga0207691_10046257 3300025940 Bacteria 4000
429 Ga0207661_10000201 3300025944 Bacteria 38650
430 Ga0207661_10002757 3300025944 Bacteria 12095
431 Ga0207661_10009671 3300025944 Bacteria 6924
432 Ga0207661_10010459 3300025944 Bacteria 6680
433 Ga0207661_10056215 3300025944 Bacteria 3159
434 Ga0207661_10068415 3300025944 Bacteria 2892
435 Ga0207661_10216815 3300025944 Bacteria 1690
436 Ga0207661_10245970 3300025944 Bacteria 1588
437 Ga0207661_10263153 3300025944 Bacteria 1537
438 Ga0207661_10356026 3300025944 Bacteria 1321
439 Ga0207679_10036426 3300025945 Bacteria 3489
440 Ga0207679_10070406 3300025945 Bacteria 2635
441 Ga0207679_10215149 3300025945 Bacteria 1614
442 Ga0207667_10052081 3300025949 Bacteria 4313
443 Ga0207667_10075232 3300025949 Bacteria 3507
444 Ga0207667_10083657 3300025949 Bacteria 3304
445 Ga0207667_10083914 3300025949 Bacteria 3298
446 Ga0207667_10086985 3300025949 Bacteria 3233
447 Ga0207667_10111711 3300025949 Bacteria 2818
448 Ga0207667_10271048 3300025949 Bacteria 1735
449 Ga0207667_10404179 3300025949 Bacteria 1390
450 Ga0207651_10140063 3300025960 Bacteria 1867
451 Ga0207712_10067585 3300025961 Bacteria 2558
452 Ga0207640_10122345 3300025981 Bacteria 1867
453 Ga0207677_10007340 3300026023 Bacteria 6089
454 Ga0207677_10014913 3300026023 Bacteria 4552
455 Ga0207677_10089545 3300026023 Bacteria 2234
456 Ga0207639_10028058 3300026041 Bacteria 4106
457 Ga0207639_10092125 3300026041 Bacteria 2428
458 Ga0207678_10021047 3300026067 Bacteria 5717
459 Ga0207678_10031345 3300026067 Bacteria 4638
460 Ga0207678_10117281 3300026067 Bacteria 2272
461 Ga0207708_10003971 3300026075 Bacteria 10887
462 Ga0207708_10031574 3300026075 Bacteria 4021
463 Ga0207708_10035802 3300026075 Bacteria 3777
464 Ga0207702_10054613 3300026078 Bacteria 3385
465 Ga0207702_10121978 3300026078 Bacteria 2334
466 Ga0207702_10364862 3300026078 Bacteria 1385
467 Ga0207648_10002974 3300026089 Bacteria 17907
468 Ga0207648_10025033 3300026089 Bacteria 5320
469 Ga0207648_10052994 3300026089 Bacteria 3547
470 Ga0207674_10126655 3300026116 Bacteria 2520
471 Ga0207674_10210356 3300026116 Bacteria 1894
472 Ga0207675_100113166 3300026118 Bacteria 2562
473 Ga0207675_100778403 3300026118 Bacteria 969
474 Ga0207683_10000336 3300026121 Bacteria 42739
475 Ga0207683_10002398 3300026121 Bacteria 16371
476 Ga0207683_10400721 3300026121 Bacteria 1262
477 Ga0207428_10000181 3300027907 Bacteria 88299
478 Ga0207428_10024668 3300027907 Bacteria 5048
479 Ga0207428_10061006 3300027907 Bacteria 2987
480 Ga0268266_10097446 3300028379 Bacteria 2586
481 Ga0268266_10222108 3300028379 Bacteria 1737
482 Ga0265337_1045371 3300028556 Bacteria 1251
483 Ga0265319_1000793 3300028563 Bacteria 20469
484 Ga0265319_1014624 3300028563 Bacteria 3072
485 Ga0265334_10000386 3300028573 Bacteria 23500
486 Ga0265334_10009904 3300028573 Bacteria 4029
487 Ga0265318_10000286 3300028577 Bacteria 41428
488 Ga0265318_10021450 3300028577 Bacteria 2592
489 Ga0265322_10001453 3300028654 Bacteria 7754
490 Ga0265322_10010248 3300028654 Bacteria 2718
491 Ga0265322_10017878 3300028654 Bacteria 2040
492 Ga0265336_10008751 3300028666 Bacteria 3532
493 Ga0265336_10067368 3300028666 Bacteria 1071
494 Ga0265336_10071407 3300028666 Bacteria 1038
495 Ga0265338_10009739 3300028800 Bacteria 11401
496 Ga0265338_10011205 3300028800 Bacteria 10388
497 Ga0265338_10019353 3300028800 Bacteria 7226
498 Ga0265338_10036811 3300028800 Bacteria 4673
499 Ga0265338_10339145 3300028800 Bacteria 1083
500 Ga0265330_10000170 3300031235 Bacteria 51357
501 Ga0265330_10036568 3300031235 Bacteria 2188
502 Ga0265332_10000981 3300031238 Bacteria 16887
503 Ga0265328_10001374 3300031239 Bacteria 11231
504 Ga0265320_10023330 3300031240 Bacteria 3295
505 Ga0265320_10049072 3300031240 Bacteria 2056
506 Ga0265320_10060916 3300031240 Bacteria 1800
507 Ga0265325_10000058 3300031241 Bacteria 76250
508 Ga0265325_10049478 3300031241 Bacteria 2169
509 Ga0265329_10017346 3300031242 Bacteria 2480
510 Ga0265339_10019338 3300031249 Bacteria 4001
511 Ga0265331_10017968 3300031250 Bacteria 3676
512 Ga0265331_10063184 3300031250 Bacteria 1745
513 Ga0265316_10000700 3300031344 Bacteria 37322
514 Ga0265316_10065958 3300031344 Bacteria 2802
515 Ga0265316_10089729 3300031344 Bacteria 2345
516 Ga0307408_100553090 3300031548 Bacteria 1016
517 Ga0265313_10004445 3300031595 Bacteria 10779
518 Ga0265313_10007060 3300031595 Bacteria 7767
519 Ga0265313_10022340 3300031595 Bacteria 3434
520 Ga0265314_10000982 3300031711 Bacteria 33556
521 Ga0265314_10016166 3300031711 Bacteria 5908
522 Ga0265342_10035168 3300031712 Bacteria 3068
523 Ga0265342_10187648 3300031712 Bacteria 1129
524 Ga0307410_10029304 3300031852 Bacteria 3504
525 Ga0307407_10012046 3300031903 Bacteria 4144
526 Ga0307416_100020230 3300032002 Bacteria 4743
527 Ga0307416_100225345 3300032002 Bacteria 1802
528 Ga0307416_100230816 3300032002 Bacteria 1784
529 Ga0307414_10008145 3300032004 Bacteria 5924
530 Ga0307415_100027981 3300032126 Bacteria 3580
531 Ga0307415_100049647 3300032126 Bacteria 2838
532 Ga0307415_100060903 3300032126 Bacteria 2611
533 Ga0373926_0119270 3300035083 Bacteria 994
534 Ga0373944_0010158 3300035089 Bacteria 2562
535 Ga0373944_0018005 3300035089 Bacteria 2013
536 Ga0373936_0012443 3300035113 Bacteria 3237
537 Ga0373936_0072092 3300035113 Bacteria 1425
538 Ga0373939_0045655 3300035114 Bacteria 1338
539 Ga0373945_0010892 3300035116 Bacteria 2999
540 Ga0373960_0021354 3300035121 Bacteria 1721
541 Ga0373943_0002996 3300035170 Bacteria 7670
542 Ga0373943_0004269 3300035170 Bacteria 6486
543 Ga0373943_0019523 3300035170 Bacteria 3117
544 Ga0373943_0047963 3300035170 Bacteria 2091
545 Ga0373943_0344038 3300035170 Bacteria 854
546 Ga0373946_0083899 3300035171 Bacteria 1400
547 Ga0373946_0152879 3300035171 Bacteria 1078
548 Ga0373955_0016428 3300035172 Bacteria 3643
549 Ga0373931_0212180 3300035691 Unclassified 1162
550 Ga0373935_0149716 3300035692 Unclassified 1583
551 Ga0373935_0164504 3300035692 Bacteria 1514
552 Ga0373927_0198982 3300035695 Bacteria 1315
553 Ga0373947_0000833 3300035725 Bacteria 18617
554 Ga0373947_0001712 3300035725 Bacteria 13442
555 Ga0373937_0041775 3300036401 Bacteria 4183
556 Ga0373937_0198068 3300036401 Bacteria 1888
557 Ga0373925_0016345 3300037068 Bacteria 5373
558 Ga0373925_0044987 3300037068 Bacteria 3278
559 Ga0395899_0001122 3300037312 Bacteria 23915
560 Ga0395899_0003567 3300037312 Bacteria 12317
561 Ga0395899_0003675 3300037312 Bacteria 12146
562 Ga0395899_0009564 3300037312 Bacteria 7441
563 Ga0395899_0014177 3300037312 Bacteria 6081
564 Ga0395899_0015791 3300037312 Bacteria 5757
565 Ga0395899_0027155 3300037312 Bacteria 4318
566 Ga0395899_0036471 3300037312 Bacteria 3688
567 Ga0395899_0043149 3300037312 Bacteria 3364
568 Ga0395899_0045379 3300037312 Bacteria 3275
569 Ga0395899_0075332 3300037312 Bacteria 2464
570 Ga0395899_0108555 3300037312 Bacteria 1997
571 Ga0395899_0152547 3300037312 Bacteria 1636
572 Ga0395900_0001349 3300037418 Bacteria 29640
573 Ga0395900_0002317 3300037418 Bacteria 21119
574 Ga0395900_0003438 3300037418 Bacteria 17122
575 Ga0395900_0004581 3300037418 Bacteria 14587
576 Ga0395900_0005036 3300037418 Bacteria 13871
577 Ga0395900_0005715 3300037418 Bacteria 12998
578 Ga0395900_0011577 3300037418 Bacteria 9027
579 Ga0395900_0014881 3300037418 Bacteria 7926
580 Ga0395900_0024327 3300037418 Bacteria 6201
581 Ga0395900_0032544 3300037418 Bacteria 5362
582 Ga0395900_0034179 3300037418 Bacteria 5234
583 Ga0395900_0036326 3300037418 Bacteria 5079
584 Ga0395900_0065851 3300037418 Bacteria 3722
585 Ga0395900_0068057 3300037418 Bacteria 3659
586 Ga0395900_0147508 3300037418 Bacteria 2405
587 Ga0395900_0149433 3300037418 Bacteria 2387
588 Ga0395900_0176430 3300037418 Bacteria 2173
589 Ga0395900_0178244 3300037418 Bacteria 2161
590 Ga0395900_0209854 3300037418 Bacteria 1967
591 Ga0395898_0002618 3300037466 Bacteria 20929
592 Ga0395898_0002928 3300037466 Bacteria 19413
593 Ga0395898_0004496 3300037466 Bacteria 15252
594 Ga0395898_0006072 3300037466 Bacteria 12965
595 Ga0395898_0009074 3300037466 Bacteria 10472
596 Ga0395898_0014383 3300037466 Bacteria 8133
597 Ga0395898_0015704 3300037466 Bacteria 7759
598 Ga0395898_0021626 3300037466 Bacteria 6520
599 Ga0395898_0022174 3300037466 Bacteria 6434
600 Ga0395898_0025821 3300037466 Bacteria 5915
601 Ga0395898_0026581 3300037466 Bacteria 5821
602 Ga0395898_0045256 3300037466 Bacteria 4326
603 Ga0395898_0069052 3300037466 Bacteria 3419
604 Ga0395898_0073070 3300037466 Bacteria 3312
605 Ga0395898_0085464 3300037466 Bacteria 3041
606 Ga0395898_0187663 3300037466 Bacteria 1975
607 Ga0395898_0738309 3300037466 Bacteria 926
608 Ga0395905_0001947 3300037471 Bacteria 23672
609 Ga0395905_0002131 3300037471 Bacteria 22440
610 Ga0395905_0002582 3300037471 Bacteria 19936
611 Ga0395905_0005008 3300037471 Bacteria 13644
612 Ga0395905_0006203 3300037471 Bacteria 12064
613 Ga0395905_0008425 3300037471 Bacteria 10167
614 Ga0395905_0015805 3300037471 Bacteria 7169
615 Ga0395905_0024156 3300037471 Bacteria 5736
616 Ga0395905_0044546 3300037471 Bacteria 4164
617 Ga0395905_0050246 3300037471 Bacteria 3907
618 Ga0395905_0084583 3300037471 Bacteria 2972
619 Ga0395905_0099069 3300037471 Bacteria 2737
620 Ga0395905_0110244 3300037471 Bacteria 2584
621 Ga0395905_0120539 3300037471 Bacteria 2466
622 Ga0395905_0121651 3300037471 Bacteria 2454
623 Ga0395905_0135861 3300037471 Bacteria 2313
624 Ga0395905_0313090 3300037471 Bacteria 1458
625 Ga0395905_0443029 3300037471 Bacteria 1196
626 Ga0436364_0295591 3300037853 Bacteria 2434
627 Ga0395901_0001080 3300038443 Bacteria 29138
628 Ga0395901_0001102 3300038443 Bacteria 28752
629 Ga0395901_0001138 3300038443 Bacteria 28189
630 Ga0395901_0003562 3300038443 Bacteria 15701
631 Ga0395901_0007015 3300038443 Bacteria 11386
632 Ga0395901_0009409 3300038443 Bacteria 9915
633 Ga0395901_0010905 3300038443 Bacteria 9209
634 Ga0395901_0029784 3300038443 Bacteria 5622
635 Ga0395901_0031149 3300038443 Bacteria 5499
636 Ga0395901_0039156 3300038443 Bacteria 4905
637 Ga0395901_0045318 3300038443 Bacteria 4563
638 Ga0395901_0062833 3300038443 Bacteria 3864
639 Ga0395901_0076575 3300038443 Bacteria 3490
640 Ga0395901_0082141 3300038443 Bacteria 3366
641 Ga0395901_0088453 3300038443 Bacteria 3240
642 Ga0395901_0091183 3300038443 Bacteria 3190
643 Ga0395901_0143020 3300038443 Bacteria 2514
644 Ga0395901_0167454 3300038443 Bacteria 2306
645 Ga0395901_0230906 3300038443 Bacteria 1931
646 Ga0395901_0264308 3300038443 Bacteria 1790
647 Ga0395901_0282790 3300038443 Bacteria 1723
648 Ga0395901_0478750 3300038443 Bacteria 1270
649 Ga0395901_0489810 3300038443 Bacteria 1253
650 Ga0395901_0506229 3300038443 Bacteria 1229
651 Ga0395901_0591578 3300038443 Bacteria 1120
652 Ga0395901_0626422 3300038443 Bacteria 1082
653 Ga0395901_0653884 3300038443 Bacteria 1054
654 Ga0395901_0692770 3300038443 Bacteria 1017
655 Ga0436365_0524403 3300039437 Bacteria 1188
656 Ga0436360_0030209 3300039438 Bacteria 2563
657 Ga0439454_011277 3300042011 Bacteria 1192
658 Ga0450920_002093 3300042122 Bacteria 3372
659 Ga0450920_011205 3300042122 Bacteria 1669
660 Ga0450906_007585 3300042145 Bacteria 2137
661 Ga0450907_007292 3300042146 Bacteria 1848
662 Ga0439435_0067289 3300042436 Bacteria 1055
663 Ga0450918_014047 3300042531 Bacteria 1392
664 Ga0466966_0007345 3300044684 Bacteria 7309
665 Ga0466966_0072926 3300044684 Bacteria 2148
666 Ga0466966_0107538 3300044684 Bacteria 1721
667 Ga0466966_0138439 3300044684 Bacteria 1488
668 Ga0466966_0155542 3300044684 Bacteria 1393
669 Ga0466966_0297373 3300044684 Bacteria 970
670 Ga0466961_0025742 3300044693 Bacteria 3782
671 Ga0466961_0041172 3300044693 Bacteria 2962
672 Ga0466961_0043612 3300044693 Bacteria 2872
673 Ga0466963_0002467 3300044694 Bacteria 10342
674 Ga0466963_0003262 3300044694 Bacteria 9254
675 Ga0466963_0004896 3300044694 Bacteria 7808
676 Ga0466963_0011367 3300044694 Bacteria 5418
677 Ga0466963_0014410 3300044694 Bacteria 4873
678 Ga0466963_0019410 3300044694 Bacteria 4263
679 Ga0466963_0040786 3300044694 Bacteria 3043
680 Ga0466963_0163992 3300044694 Bacteria 1547
681 Ga0466963_0217901 3300044694 Bacteria 1336
682 Ga0466963_0226032 3300044694 Bacteria 1311
683 Ga0466963_0295502 3300044694 Bacteria 1139
684 Ga0466963_0386235 3300044694 Bacteria 987
685 Ga0466964_0018528 3300044706 Bacteria 2672
686 Ga0466964_0027730 3300044706 Bacteria 2225
687 Ga0466964_0034153 3300044706 Bacteria 2029
688 Ga0466964_0105857 3300044706 Bacteria 1247
689 Ga0466971_0052537 3300044719 Bacteria 1835
690 Ga0466968_0048332 3300044735 Bacteria 1810
691 Ga0466970_0110321 3300044765 Bacteria 1502
692 Ga0466970_0205699 3300044765 Bacteria 1096
693 Ga0466957_0000320 3300044842 Bacteria 23320
694 Ga0466957_0022515 3300044842 Bacteria 3719
695 Ga0466957_0043882 3300044842 Bacteria 2709
696 Ga0466957_0063556 3300044842 Bacteria 2269
697 Ga0466957_0084439 3300044842 Bacteria 1982
698 Ga0466957_0112594 3300044842 Bacteria 1727
699 Ga0466959_0001566 3300045049 Bacteria 14087
700 Ga0466959_0008520 3300045049 Bacteria 7256
701 Ga0466959_0070655 3300045049 Bacteria 2529
702 Ga0451576_0219917 3300045051 Bacteria 1983
703 Ga0466958_0002644 3300045836 Bacteria 9059
704 Ga0466958_0003728 3300045836 Bacteria 7955
705 Ga0466958_0020531 3300045836 Bacteria 3854
706 Ga0466958_0031910 3300045836 Bacteria 3131
707 Ga0466958_0081214 3300045836 Bacteria 1995
708 Ga0466958_0083725 3300045836 Bacteria 1966
709 Ga0466958_0196188 3300045836 Bacteria 1284
710 Ga0466958_0227667 3300045836 Bacteria 1190
711 Ga0466967_0000433 3300045976 Bacteria 19966
712 Ga0466967_0003672 3300045976 Bacteria 10098
713 Ga0466967_0005278 3300045976 Bacteria 8914
714 Ga0466967_0005373 3300045976 Bacteria 8864
715 Ga0466967_0006777 3300045976 Bacteria 8159
716 Ga0466967_0023511 3300045976 Bacteria 5051
717 Ga0466967_0025397 3300045976 Bacteria 4885
718 Ga0466967_0036147 3300045976 Bacteria 4214
719 Ga0466967_0045092 3300045976 Bacteria 3829
720 Ga0466967_0045547 3300045976 Bacteria 3812
721 Ga0466967_0055596 3300045976 Bacteria 3486
722 Ga0466967_0076599 3300045976 Bacteria 3009
723 Ga0466967_0101528 3300045976 Bacteria 2630
724 Ga0466967_0164052 3300045976 Bacteria 2087
725 Ga0466967_0274943 3300045976 Bacteria 1615
726 Ga0466967_0309850 3300045976 Bacteria 1520
727 Ga0466967_0313094 3300045976 Bacteria 1512
728 Ga0466967_0327137 3300045976 Bacteria 1480
729 Ga0466967_0334028 3300045976 Bacteria 1464
730 Ga0466967_0356058 3300045976 Bacteria 1417
731 Ga0466967_0393684 3300045976 Bacteria 1347
732 Ga0466967_0445857 3300045976 Bacteria 1264
733 Ga0495592_0078399 3300046454 Bacteria 2393
734 Ga0495592_0107950 3300046454 Bacteria 1973
735 Ga0495603_0235075 3300046455 Bacteria 1056
736 Ga0495629_0000983 3300046459 Bacteria 22888
737 Ga0495629_0005386 3300046459 Bacteria 9545
738 Ga0495629_0034794 3300046459 Bacteria 3561
739 Ga0495629_0096744 3300046459 Bacteria 2059
740 Ga0495629_0141512 3300046459 Bacteria 1674
741 Ga0495629_0169960 3300046459 Bacteria 1513
742 Ga0495641_0000513 3300046461 Bacteria 32468
743 Ga0495641_0013891 3300046461 Bacteria 4390
744 Ga0495651_0008831 3300046462 Bacteria 7731
745 Ga0495651_0028727 3300046462 Bacteria 4333
746 Ga0495651_0036582 3300046462 Bacteria 3822
747 Ga0495651_0057837 3300046462 Bacteria 2976
748 Ga0495651_0195228 3300046462 Bacteria 1421
749 Ga0495653_0015091 3300046463 Bacteria 6296
750 Ga0495653_0052672 3300046463 Bacteria 3118
751 Ga0495653_0064933 3300046463 Bacteria 2749
752 Ga0495653_0188068 3300046463 Bacteria 1411
753 Ga0495582_0000553 3300046473 Bacteria 20635
754 Ga0495582_0024252 3300046473 Bacteria 3317
755 Ga0495582_0029202 3300046473 Bacteria 3027
756 Ga0495582_0112345 3300046473 Bacteria 1531
757 Ga0495582_0184146 3300046473 Bacteria 1190
758 Ga0495605_0058685 3300046474 Bacteria 1849
759 Ga0495639_0007896 3300046475 Bacteria 4573
760 Ga0495662_0004812 3300046476 Bacteria 6766
761 Ga0495662_0033415 3300046476 Bacteria 2485
762 Ga0495584_0009844 3300046491 Bacteria 4917
763 Ga0495584_0093197 3300046491 Bacteria 1520
764 Ga0495594_0089921 3300046499 Bacteria 1720
765 Ga0495607_0030538 3300046501 Bacteria 3307
766 Ga0495608_0010647 3300046511 Bacteria 6416
767 Ga0495608_0010965 3300046511 Bacteria 6317
768 Ga0495608_0266532 3300046511 Bacteria 1065
769 Ga0495618_0049002 3300046514 Bacteria 2668
770 Ga0495628_0047013 3300046516 Bacteria 3426
771 Ga0495628_0074653 3300046516 Bacteria 2641
772 Ga0495628_0127796 3300046516 Bacteria 1946
773 Ga0495630_0030060 3300046517 Bacteria 4039
774 Ga0495630_0048094 3300046517 Bacteria 3192
775 Ga0495630_0070624 3300046517 Bacteria 2627
776 Ga0495630_0391229 3300046517 Bacteria 1065
777 Ga0495630_0432050 3300046517 Bacteria 1009
778 Ga0495666_0054385 3300046526 Bacteria 1920
779 Ga0495642_0028078 3300046528 Bacteria 2240
780 Ga0495652_0033764 3300046529 Bacteria 4463
781 Ga0495652_0035874 3300046529 Bacteria 4314
782 Ga0495652_0317714 3300046529 Bacteria 1126
783 Ga0495652_0328103 3300046529 Bacteria 1103
784 Ga0495665_0010478 3300046531 Bacteria 5017
785 Ga0495640_0015840 3300046533 Bacteria 5658
786 Ga0495640_0145796 3300046533 Unclassified 1523
787 Ga0495640_0221328 3300046533 Bacteria 1194
788 Ga0495586_0182651 3300046535 Bacteria 1187
789 Ga0495587_0016056 3300046536 Bacteria 4660
790 Ga0495587_0093812 3300046536 Bacteria 1733
791 Ga0495587_0258003 3300046536 Bacteria 979
792 Ga0495609_0042385 3300046538 Bacteria 2044
793 Ga0495645_0012630 3300046543 Bacteria 5956
794 Ga0495667_0004861 3300046559 Bacteria 9084
795 Ga0495667_0011321 3300046559 Bacteria 6039
796 Ga0495667_0034880 3300046559 Bacteria 3364
797 Ga0495656_0021831 3300046615 Bacteria 2498
798 Ga0495656_0025895 3300046615 Bacteria 2330
799 Ga0495634_0017514 3300046642 Bacteria 5109
800 Ga0495634_0080784 3300046642 Bacteria 2127
801 Ga0495634_0083952 3300046642 Bacteria 2078
802 Ga0495635_0017038 3300046663 Bacteria 5075
803 Ga0495635_0023772 3300046663 Bacteria 4270
804 Ga0495635_0029893 3300046663 Bacteria 3788
805 Ga0495659_0010780 3300046664 Bacteria 2941
806 Ga0495588_0001267 3300046674 Bacteria 10837
807 Ga0495657_0006323 3300046675 Bacteria 9282
808 Ga0495657_0022761 3300046675 Bacteria 4484
809 Ga0495657_0062826 3300046675 Bacteria 2452
810 Ga0495657_0112843 3300046675 Bacteria 1720
811 Ga0495599_0088633 3300046678 Bacteria 1932
812 Ga0495623_0018829 3300046679 Bacteria 4457
813 Ga0495623_0265680 3300046679 Bacteria 960
814 Ga0495646_0033710 3300046680 Bacteria 3183
815 Ga0495646_0055715 3300046680 Bacteria 2373
816 Ga0495658_0000300 3300046683 Bacteria 28107
817 Ga0495658_0146923 3300046683 Bacteria 1446
818 Ga0495613_0010487 3300046689 Bacteria 6879
819 Ga0495613_0101516 3300046689 Bacteria 2078
820 Ga0495670_0067555 3300046691 Bacteria 1805
821 Ga0495589_0016095 3300046794 Bacteria 3842
822 Ga0495600_0102147 3300046809 Bacteria 1869
823 Ga0495581_0019593 3300047315 Bacteria 3926
824 Ga0495581_0082333 3300047315 Bacteria 1864
825 Ga0495581_0182959 3300047315 Bacteria 1226
826 Ga0495581_0183047 3300047315 Bacteria 1225
827 Ga0495604_0133055 3300047317 Bacteria 1785
828 Ga0495604_0269756 3300047317 Bacteria 1153
829 Ga0495674_0003155 3300047319 Bacteria 16010
830 Ga0495674_0050062 3300047319 Bacteria 3687
831 Ga0495674_0320536 3300047319 Bacteria 1263
832 Ga0495676_0001459 3300047321 Bacteria 20404
833 Ga0495676_0035504 3300047321 Bacteria 4168
834 Ga0495676_0036083 3300047321 Bacteria 4131
835 Ga0495680_0003282 3300047322 Bacteria 16027
836 Ga0495680_0004330 3300047322 Bacteria 13597
837 Ga0495680_0009818 3300047322 Bacteria 8582
838 Ga0495680_0046182 3300047322 Bacteria 3435
839 Ga0495680_0078517 3300047322 Bacteria 2498
840 Ga0495675_0049893 3300047444 Bacteria 2659
841 Ga0495675_0079610 3300047444 Bacteria 2064
842 Ga0495677_0011247 3300047445 Bacteria 3277
843 Ga0495593_0006091 3300047673 Bacteria 7094
844 Ga0495593_0102297 3300047673 Bacteria 1469
845 Ga0495593_0112650 3300047673 Bacteria 1388
846 Ga0495602_0186760 3300048088 Bacteria 1593
847 Ga0495602_0278559 3300048088 Bacteria 1233
848 Ga0495614_0044451 3300048089 Bacteria 1905
849 Ga0495614_0077464 3300048089 Bacteria 1438
850 Ga0496100_0004882 3300048903 Bacteria 7168
851 Ga0496100_0025294 3300048903 Bacteria 3630
852 Ga0496100_0033693 3300048903 Bacteria 3207
853 Ga0496100_0509100 3300048903 Bacteria 928
854 Ga0496101_0001389 3300048904 Bacteria 14495
855 Ga0496101_0003760 3300048904 Bacteria 9478
856 Ga0496101_0004977 3300048904 Bacteria 8437
857 Ga0496101_0027434 3300048904 Bacteria 3967
858 Ga0496101_0096938 3300048904 Bacteria 2201
859 Ga0496101_0107889 3300048904 Bacteria 2092
860 Ga0496101_0139754 3300048904 Bacteria 1845
861 Ga0496101_0168157 3300048904 Unclassified 1684
862 Ga0496101_0326731 3300048904 Bacteria 1204
863 Ga0496102_0003545 3300048905 Bacteria 13216
864 Ga0496102_0051719 3300048905 Bacteria 3742
865 Ga0496102_0058391 3300048905 Bacteria 3525
866 Ga0496102_0069568 3300048905 Bacteria 3231
867 Ga0496102_0142564 3300048905 Bacteria 2247
868 Ga0496102_0163665 3300048905 Bacteria 2093
869 Ga0496102_0323173 3300048905 Bacteria 1453
870 Ga0496102_0359344 3300048905 Bacteria 1371
871 Ga0496102_0409707 3300048905 Bacteria 1274
872 Ga0496103_0009466 3300048906 Bacteria 5768
873 Ga0496103_0098195 3300048906 Bacteria 1852
874 Ga0496103_0166468 3300048906 Bacteria 1414
875 Ga0496104_0023166 3300048907 Bacteria 5708
876 Ga0496104_0048118 3300048907 Bacteria 4020
877 Ga0496104_0089064 3300048907 Bacteria 2948
878 Ga0496104_0089328 3300048907 Bacteria 2944
879 Ga0496104_0208456 3300048907 Bacteria 1866
880 Ga0496104_0586477 3300048907 Bacteria 1025
881 Ga0496104_0618704 3300048907 Unclassified 993
882 Ga0496105_0005175 3300048908 Bacteria 9889
883 Ga0496105_0008326 3300048908 Bacteria 8060
884 Ga0496105_0038665 3300048908 Bacteria 3930
885 Ga0496105_0064818 3300048908 Bacteria 3015
886 Ga0496105_0086200 3300048908 Bacteria 2595
887 Ga0496106_0009146 3300048909 Bacteria 7316
888 Ga0496106_0016076 3300048909 Bacteria 5533
889 Ga0496106_0025577 3300048909 Bacteria 4394
890 Ga0496106_0037974 3300048909 Bacteria 3603
891 Ga0496106_0410340 3300048909 Bacteria 1089
892 Ga0496107_0011757 3300048910 Bacteria 6106
893 Ga0496107_0016606 3300048910 Bacteria 5172
894 Ga0496107_0024830 3300048910 Bacteria 4241
895 Ga0496107_0073591 3300048910 Bacteria 2485
896 Ga0496108_0004497 3300048911 Bacteria 11232
897 Ga0496108_0017997 3300048911 Bacteria 5780
898 Ga0496108_0049009 3300048911 Bacteria 3533
899 Ga0496108_0054923 3300048911 Unclassified 3343
900 Ga0496108_0188418 3300048911 Bacteria 1787
901 Ga0496108_0293878 3300048911 Bacteria 1415
902 Ga0496108_0294878 3300048911 Bacteria 1412
903 Ga0496109_0010777 3300048912 Bacteria 7825
904 Ga0496109_0025155 3300048912 Bacteria 5302
905 Ga0496109_0033171 3300048912 Bacteria 4644
906 Ga0496109_0037156 3300048912 Bacteria 4400
907 Ga0496109_0089941 3300048912 Bacteria 2839
908 Ga0496109_0174307 3300048912 Bacteria 2018
909 Ga0496109_0185597 3300048912 Bacteria 1954
910 Ga0496109_0251956 3300048912 Bacteria 1663
911 Ga0496109_0257922 3300048912 Bacteria 1642
912 Ga0496109_0383252 3300048912 Bacteria 1328
913 Ga0496110_0002589 3300048913 Bacteria 13606
914 Ga0496110_0032189 3300048913 Bacteria 4527
915 Ga0496110_0039149 3300048913 Bacteria 4127
916 Ga0496110_0041405 3300048913 Bacteria 4019
917 Ga0496110_0048802 3300048913 Bacteria 3712
918 Ga0496110_0065340 3300048913 Bacteria 3216
919 Ga0496110_0258403 3300048913 Bacteria 1585
920 Ga0496110_0266724 3300048913 Bacteria 1559
921 Ga0496110_0485042 3300048913 Bacteria 1126
922 Ga0496111_0005335 3300048914 Bacteria 8216
923 Ga0496111_0007386 3300048914 Bacteria 7197
924 Ga0496111_0007877 3300048914 Bacteria 7021
925 Ga0496111_0017416 3300048914 Bacteria 4968
926 Ga0496112_0001415 3300048915 Bacteria 18349
927 Ga0496112_0003186 3300048915 Bacteria 13491
928 Ga0496112_0016093 3300048915 Bacteria 6993
929 Ga0496112_0017575 3300048915 Bacteria 6723
930 Ga0496112_0056051 3300048915 Bacteria 3878
931 Ga0496112_0066559 3300048915 Bacteria 3555
932 Ga0496112_0069221 3300048915 Bacteria 3486
933 Ga0496112_0160331 3300048915 Bacteria 2216
934 Ga0496112_0241187 3300048915 Bacteria 1760
935 Ga0496112_0262402 3300048915 Bacteria 1677
936 Ga0496113_0026770 3300048916 Bacteria 4127
937 Ga0496113_0112846 3300048916 Bacteria 2118
938 Ga0496113_0427377 3300048916 Bacteria 1064
939 Ga0496113_0576068 3300048916 Bacteria 902
940 Ga0496114_0000593 3300048917 Bacteria 26747
941 Ga0496114_0003060 3300048917 Bacteria 12810
942 Ga0496114_0004918 3300048917 Bacteria 10410
943 Ga0496114_0010412 3300048917 Bacteria 7397
944 Ga0496114_0012526 3300048917 Bacteria 6791
945 Ga0496114_0031336 3300048917 Bacteria 4376
946 Ga0496114_0118729 3300048917 Bacteria 2272
947 Ga0496114_0132376 3300048917 Bacteria 2154
948 Ga0496115_0002884 3300048918 Bacteria 12387
949 Ga0496115_0019565 3300048918 Bacteria 5212
950 Ga0496115_0023989 3300048918 Bacteria 4737
951 Ga0496115_0060072 3300048918 Bacteria 3062
952 Ga0496115_0550829 3300048918 Bacteria 922
953 Ga0501031_0003201 3300049568 Bacteria 10506
954 Ga0501031_0010316 3300049568 Bacteria 6086
955 Ga0501031_0027189 3300049568 Bacteria 3730
956 Ga0501031_0028064 3300049568 Bacteria 3668
957 Ga0501032_0003510 3300049569 Bacteria 11978
958 Ga0501032_0034078 3300049569 Bacteria 3487
959 Ga0501032_0145374 3300049569 Bacteria 1561
960 Ga0501032_0214418 3300049569 Bacteria 1254
961 Ga0501032_0271383 3300049569 Bacteria 1099
962 Ga0501033_0009336 3300049570 Bacteria 7552
963 Ga0501033_0011029 3300049570 Bacteria 6920
964 Ga0501033_0251144 3300049570 Bacteria 1253
965 Ga0501033_0305487 3300049570 Bacteria 1119
966 Ga0501034_0052801 3300049571 Bacteria 4094
967 Ga0501034_0110725 3300049571 Bacteria 2737
968 Ga0501036_0016353 3300049572 Bacteria 6198
969 Ga0501036_0018678 3300049572 Bacteria 5813
970 Ga0501036_0037239 3300049572 Bacteria 4115
971 Ga0501036_0143921 3300049572 Bacteria 2011
972 Ga0501036_0230343 3300049572 Unclassified 1555
973 Ga0501037_0005161 3300049573 Bacteria 9501
974 Ga0501037_0032379 3300049573 Bacteria 3860
975 Ga0501037_0040856 3300049573 Bacteria 3413
976 Ga0501037_0155602 3300049573 Bacteria 1632
977 Ga0501038_0002125 3300049574 Bacteria 18378
978 Ga0501038_0028671 3300049574 Bacteria 4944
979 Ga0501038_0130409 3300049574 Unclassified 2064
980 Ga0501038_0237867 3300049574 Bacteria 1447
981 Ga0501038_0240788 3300049574 Bacteria 1436
982 Ga0501039_0008922 3300049575 Bacteria 7639
983 Ga0501039_0011096 3300049575 Bacteria 6866
984 Ga0501039_0041616 3300049575 Bacteria 3549
985 Ga0501039_0097716 3300049575 Bacteria 2290
986 Ga0501040_0008306 3300049576 Bacteria 6752
987 Ga0501040_0041715 3300049576 Bacteria 3125
988 Ga0501040_0275674 3300049576 Bacteria 1201
989 Ga0501041_0002077 3300049577 Bacteria 11274
990 Ga0501041_0005126 3300049577 Bacteria 7643
991 Ga0501041_0019846 3300049577 Bacteria 4015
992 Ga0501041_0096415 3300049577 Bacteria 1828
993 Ga0501042_0003373 3300049578 Bacteria 10017
994 Ga0501042_0014660 3300049578 Bacteria 5353
995 Ga0501042_0055816 3300049578 Unclassified 2819
996 Ga0501042_0081887 3300049578 Bacteria 2313
997 Ga0501042_0117341 3300049578 Bacteria 1916
998 Ga0501042_0193332 3300049578 Bacteria 1467
999 Ga0501042_0338062 3300049578 Bacteria 1088
1000 Ga0501043_0020365 3300049579 Bacteria 5203
1001 Ga0501043_0037251 3300049579 Bacteria 3825
1002 Ga0501043_0363167 3300049579 Bacteria 1099
1003 Ga0501046_0019560 3300049580 Bacteria 5614
1004 Ga0501046_0305282 3300049580 Bacteria 1161
1005 Ga0501048_0004447 3300049582 Bacteria 10681
1006 Ga0501048_0030532 3300049582 Bacteria 3898
1007 Ga0501048_0030933 3300049582 Bacteria 3874
1008 Ga0501048_0045087 3300049582 Bacteria 3151
1009 Ga0501048_0072852 3300049582 Bacteria 2424
1010 Ga0501067_0009512 3300049583 Bacteria 5383
1011 Ga0501067_0085384 3300049583 Bacteria 1751
1012 Ga0501068_0001537 3300049584 Bacteria 12263
1013 Ga0501068_0005706 3300049584 Bacteria 6821
1014 Ga0501068_0006272 3300049584 Bacteria 6544
1015 Ga0501068_0025712 3300049584 Bacteria 3464
1016 Ga0501068_0093277 3300049584 Bacteria 1860
1017 Ga0501069_0005348 3300049585 Bacteria 6678
1018 Ga0501069_0005484 3300049585 Bacteria 6600
1019 Ga0501069_0006946 3300049585 Bacteria 5918
1020 Ga0501069_0017146 3300049585 Bacteria 3894
1021 Ga0501069_0106449 3300049585 Bacteria 1594
1022 Ga0501069_0114398 3300049585 Bacteria 1538
1023 Ga0501070_0000932 3300049586 Bacteria 26359
1024 Ga0501070_0002071 3300049586 Bacteria 17606
1025 Ga0501070_0011151 3300049586 Bacteria 7586
1026 Ga0501070_0020037 3300049586 Bacteria 5608
1027 Ga0501070_0121834 3300049586 Bacteria 2155
1028 Ga0501070_0213984 3300049586 Bacteria 1581
1029 Ga0501070_0356231 3300049586 Bacteria 1187
1030 Ga0501071_0008317 3300049587 Bacteria 6854
1031 Ga0501071_0010584 3300049587 Bacteria 6187
1032 Ga0501071_0017401 3300049587 Bacteria 4956
1033 Ga0501071_0068518 3300049587 Bacteria 2582
1034 Ga0501071_0163411 3300049587 Bacteria 1665
1035 Ga0501071_0241836 3300049587 Unclassified 1361
1036 Ga0501072_0008089 3300049588 Bacteria 7980
1037 Ga0501072_0011971 3300049588 Bacteria 6627
1038 Ga0501072_0022954 3300049588 Bacteria 4843
1039 Ga0501072_0035498 3300049588 Bacteria 3905
1040 Ga0501072_0040293 3300049588 Bacteria 3668
1041 Ga0501072_0065467 3300049588 Bacteria 2866
1042 Ga0501072_0093560 3300049588 Bacteria 2388
1043 Ga0501072_0101103 3300049588 Bacteria 2291
1044 Ga0501072_0164049 3300049588 Bacteria 1772
1045 Ga0501073_0029889 3300049589 Bacteria 3891
1046 Ga0501073_0075243 3300049589 Bacteria 2350
1047 Ga0501073_0096106 3300049589 Bacteria 2057
1048 Ga0501073_0268369 3300049589 Bacteria 1178
1049 Ga0501074_0009335 3300049590 Bacteria 7125
1050 Ga0501074_0029313 3300049590 Bacteria 3986
1051 Ga0501074_0092050 3300049590 Bacteria 2171
1052 Ga0501074_0138061 3300049590 Bacteria 1744
1053 Ga0501074_0180786 3300049590 Bacteria 1505
1054 Ga0501075_0003177 3300049591 Bacteria 11004
1055 Ga0501075_0009635 3300049591 Bacteria 6763
1056 Ga0501075_0051824 3300049591 Bacteria 3086
1057 Ga0501075_0098589 3300049591 Bacteria 2218
1058 Ga0501075_0133061 3300049591 Bacteria 1895
1059 Ga0501075_0246597 3300049591 Bacteria 1361
1060 Ga0501076_0006779 3300049592 Bacteria 8310
1061 Ga0501076_0008556 3300049592 Bacteria 7504
1062 Ga0501076_0016816 3300049592 Bacteria 5551
1063 Ga0501076_0038033 3300049592 Unclassified 3776
1064 Ga0501076_0056547 3300049592 Bacteria 3114
1065 Ga0501076_0060231 3300049592 Bacteria 3020
1066 Ga0501076_0081383 3300049592 Bacteria 2600
1067 Ga0501076_0482884 3300049592 Bacteria 1021
1068 Ga0501077_0002696 3300049593 Bacteria 10645
1069 Ga0501077_0004113 3300049593 Bacteria 8782
1070 Ga0501077_0021974 3300049593 Bacteria 4040
1071 Ga0501077_0043824 3300049593 Bacteria 2843
1072 Ga0501077_0046241 3300049593 Bacteria 2766
1073 Ga0501077_0053737 3300049593 Bacteria 2557
1074 Ga0501079_0002599 3300049741 Bacteria 13122
1075 Ga0501079_0006044 3300049741 Bacteria 9074
1076 Ga0501079_0018929 3300049741 Bacteria 5261
1077 Ga0501079_0112580 3300049741 Bacteria 2115
1078 Ga0501079_0128028 3300049741 Unclassified 1975
1079 Ga0501079_0302104 3300049741 Bacteria 1252
1080 Ga0501080_0003099 3300049742 Bacteria 14676
1081 Ga0501080_0009875 3300049742 Bacteria 8718
1082 Ga0501080_0011017 3300049742 Bacteria 8277
1083 Ga0501080_0015234 3300049742 Bacteria 7086
1084 Ga0501080_0015236 3300049742 Bacteria 7086
1085 Ga0501080_0030090 3300049742 Bacteria 5057
1086 Ga0501080_0042851 3300049742 Bacteria 4213
1087 Ga0501080_0128843 3300049742 Bacteria 2343
1088 Ga0501080_0245813 3300049742 Bacteria 1632
1089 Ga0501080_0249400 3300049742 Unclassified 1619
1090 Ga0501080_0323400 3300049742 Bacteria 1396
1091 Ga0501080_0598069 3300049742 Bacteria 979
1092 Ga0501081_0006015 3300049743 Bacteria 7856
1093 Ga0501081_0012121 3300049743 Bacteria 5652
1094 Ga0501081_0027399 3300049743 Bacteria 3844
1095 Ga0501081_0046325 3300049743 Bacteria 2989
1096 Ga0501081_0057695 3300049743 Bacteria 2685
1097 Ga0501081_0074805 3300049743 Bacteria 2363
1098 Ga0501083_0001150 3300049744 Bacteria 17794
1099 Ga0501083_0009072 3300049744 Bacteria 7022
1100 Ga0501083_0033347 3300049744 Bacteria 3527
1101 Ga0501083_0073318 3300049744 Bacteria 2276
1102 Ga0501083_0132962 3300049744 Bacteria 1631
1103 Ga0501035_0029051 3300049822 Bacteria 5042
1104 Ga0501035_0051815 3300049822 Bacteria 3673
1105 Ga0501035_0207160 3300049822 Unclassified 1679
1106 Ga0501035_0425194 3300049822 Bacteria 1102
1107 Ga0501035_0439416 3300049822 Bacteria 1081
1108 Ga0501044_0032685 3300049823 Bacteria 5469
1109 Ga0501044_0046195 3300049823 Bacteria 4510
1110 Ga0501044_0074258 3300049823 Bacteria 3455
1111 Ga0501045_0004472 3300049824 Bacteria 9653
1112 Ga0501045_0007706 3300049824 Bacteria 7490
1113 Ga0501045_0015025 3300049824 Bacteria 5495
1114 Ga0501045_0316369 3300049824 Bacteria 1161
1115 nmdc:mga03683_50388_c1 3300050489 Bacteria 1735
1116 nmdc:mga06z11_55334_c1 3300050494 Bacteria 2048
1117 nmdc:mga05p37_218628_c1 3300050507 Bacteria 2300
1118 nmdc:mga05p37_28125_c1 3300050507 Bacteria 6852
1119 nmdc:mga05p37_42550_c1 3300050507 Bacteria 5582
1120 nmdc:mga05p37_69520_c1 3300050507 Bacteria 4331
1121 nmdc:mga05p37_91230_c1 3300050507 Bacteria 3754
1122 nmdc:mga09592_372152_c1 3300050508 Bacteria 1236
1123 nmdc:mga09592_97006_c1 3300050508 Bacteria 2522
1124 nmdc:mga06r32_436727_c1 3300050510 Unclassified 1289
1125 nmdc:mga06r32_559548_c1 3300050510 Bacteria 1117
1126 nmdc:mga08y16_112287_c1 3300050511 Bacteria 2837
1127 nmdc:mga08y16_128888_c1 3300050511 Bacteria 2632
1128 nmdc:mga08y16_313864_c1 3300050511 Bacteria 1614
1129 nmdc:mga08y16_350857_c1 3300050511 Bacteria 1516
1130 nmdc:mga08y16_40122_c1 3300050511 Bacteria 4908
1131 nmdc:mga0n895_3110_c1 3300050512 Bacteria 13221
1132 nmdc:mga0rr50_22496_c1 3300050513 Bacteria 4328
1133 nmdc:mga08x19_246563_c1 3300050514 Bacteria 1232
1134 nmdc:mga08x19_328248_c1 3300050514 Bacteria 1065
1135 nmdc:mga0a205_132300_c1 3300050515 Bacteria 2395
1136 nmdc:mga0a205_38193_c1 3300050515 Bacteria 4618
1137 Ga0495601_0013877 3300053077 Bacteria 4851
1138 Ga0495601_0026505 3300053077 Bacteria 3579
1139 Ga0495601_0193108 3300053077 Bacteria 1331
1140 Ga0495612_0023733 3300053078 Bacteria 2462
1141 Ga0495612_0044779 3300053078 Bacteria 1811
1142 Ga0495595_0003172 3300053084 Bacteria 6521
1143 Ga0495595_0034736 3300053084 Bacteria 2282
1144 Ga0495595_0039666 3300053084 Bacteria 2149
1145 Ga0495595_0190490 3300053084 Bacteria 1019
1146 Ga0495619_0008553 3300053085 Bacteria 6476
1147 Ga0495619_0008933 3300053085 Bacteria 6324
1148 Ga0495619_0010495 3300053085 Bacteria 5828
1149 Ga0495619_0061892 3300053085 Bacteria 2491
1150 Ga0495619_0283205 3300053085 Bacteria 1149
1151 Ga0495619_0337062 3300053085 Bacteria 1044
1152 Ga0501084_0008364 3300054114 Bacteria 8542
1153 Ga0501084_0027752 3300054114 Bacteria 4730
1154 Ga0501084_0045011 3300054114 Bacteria 3695
1155 Ga0501084_0051198 3300054114 Bacteria 3456
1156 Ga0501084_0057429 3300054114 Bacteria 3257
1157 Ga0501084_0228959 3300054114 Bacteria 1569
1158 Ga0501084_0244646 3300054114 Bacteria 1514
1159 Ga0501084_0471443 3300054114 Bacteria 1061
1160 Ga0501082_0010110 3300060353 Bacteria 8127
1161 Ga0501082_0017296 3300060353 Bacteria 6211
1162 Ga0501082_0018315 3300060353 Bacteria 6030
1163 Ga0501082_0033000 3300060353 Bacteria 4465
1164 Ga0501082_0069746 3300060353 Bacteria 3027
1165 Ga0501082_0182563 3300060353 Bacteria 1825
1166 Ga0466962_0004475 3300061719 Bacteria 6699
1167 Ga0530510_0002954 3300061734 Bacteria 11663
1168 Ga0530510_0034472 3300061734 Bacteria 3647
1169 Ga0530510_0034484 3300061734 Bacteria 3646
1170 Ga0530510_0041507 3300061734 Unclassified 3322
1171 Ga0530510_0056043 3300061734 Bacteria 2847
1172 Ga0530510_0079718 3300061734 Unclassified 2382
1173 Ga0530510_0085852 3300061734 Bacteria 2293
1174 Ga0530510_0124561 3300061734 Bacteria 1893
1175 Ga0530510_0249544 3300061734 Bacteria 1322
1176 Ga0530510_0310018 3300061734 Unclassified 1182
1177 3006975249 3006973921 Bacteria 4423788
1178 Ga0501040_0184988
1179 JGI24747J21853_1005485
1180 JGI24749J21850_1009238
1181 JGI24744J21845_10003353
1182 JGI25407J50210_10000579
1183 JGI25407J50210_10005452
1184 Ga0070658_10010114
1185 Ga0070658_10028070
1186 Ga0070658_10071971
1187 Ga0070658_10072608
1188 Ga0070658_10471760
1189 Ga0070676_10045076
1190 Ga0070683_100004095
1191 Ga0070683_100231028
1192 Ga0070683_100256172
1193 Ga0070683_100514878
1194 Ga0070670_100018158
1195 Ga0070666_10114532
1196 Ga0070680_100005086
1197 Ga0070680_100007837
1198 Ga0070680_100008703
1199 Ga0070680_100200540
1200 Ga0070682_100024789
1201 Ga0070682_100061448
1202 Ga0070682_100188816
1203 Ga0068868_100040658
1204 Ga0068868_100062012
1205 Ga0070660_100003574
1206 Ga0070660_100004622
1207 Ga0070660_100154823
1208 Ga0070660_100331784
1209 Ga0070689_100047182
1210 Ga0070691_10032809
1211 Ga0070687_100037970
1212 Ga0070687_100177880
1213 Ga0070661_100016782
1214 Ga0070661_100030295
1215 Ga0070661_100065760
1216 Ga0070661_100066365
1217 Ga0070661_100125465
1218 Ga0070692_10219176
1219 Ga0070668_100064152
1220 Ga0070668_100181922
1221 Ga0070668_100354194
1222 Ga0070675_100013851
1223 Ga0070675_100093911
1224 Ga0070671_100016930
1225 Ga0070671_100060084
1226 Ga0070674_100001772
1227 Ga0070674_100014593
1228 Ga0070674_100024872
1229 Ga0070674_100032598
1230 Ga0070673_100017348
1231 Ga0070688_100002947
1232 Ga0070688_100025703
1233 Ga0070659_100054433
1234 Ga0070659_100129110
1235 Ga0070703_10070945
1236 Ga0070709_10136862
1237 Ga0070714_100004907
1238 Ga0070714_100069502
1239 Ga0070714_100303136
1240 Ga0070714_100417020
1241 Ga0070714_100580937
1242 Ga0070713_100171490
1243 Ga0070710_10045044
1244 Ga0070701_10012352
1245 Ga0070701_10093551
1246 Ga0070711_100219247
1247 Ga0070711_100262425
1248 Ga0070700_100008291
1249 Ga0070694_100049597
1250 Ga0070708_100272235
1251 Ga0070663_100042192
1252 Ga0070663_100054447
1253 Ga0070663_100142404
1254 Ga0070678_100021853
1255 Ga0070678_100233863
1256 Ga0070662_100026269
1257 Ga0070662_100089419
1258 Ga0070681_10000749
1259 Ga0070681_10002438
1260 Ga0070681_10006655
1261 Ga0070681_10010692
1262 Ga0070681_10020308
1263 Ga0070681_10145901
1264 Ga0070681_10198909
1265 Ga0070681_10210855
1266 Ga0070681_10484398
1267 Ga0068867_100053297
1268 Ga0070685_10003250
1269 Ga0070685_10004853
1270 Ga0070706_100024656
1271 Ga0070706_100033735
1272 Ga0070706_100088077
1273 Ga0070707_100024051
1274 Ga0070707_100170370
1275 Ga0070707_100224763
1276 Ga0070707_100270323
1277 Ga0070707_100344456
1278 Ga0070698_100010130
1279 Ga0070698_100038621
1280 Ga0070698_100099283
1281 Ga0070698_100120471
1282 Ga0070698_100242003
1283 Ga0070699_100033541
1284 Ga0070699_100085618
1285 Ga0070699_100287386
1286 Ga0070679_100016743
1287 Ga0070679_100032625
1288 Ga0070679_100038005
1289 Ga0070679_100038029
1290 Ga0070679_100066304
1291 Ga0070679_100085126
1292 Ga0070679_100152562
1293 Ga0070679_100513908
1294 Ga0070684_100007703
1295 Ga0070684_100008812
1296 Ga0070684_100016168
1297 Ga0070684_100024755
1298 Ga0070684_100027123
1299 Ga0070684_100135701
1300 Ga0070684_100186885
1301 Ga0070684_100242356
1302 Ga0070684_100385272
1303 Ga0070684_100522997
1304 Ga0068853_100062429
1305 Ga0070672_100017544
1306 Ga0070672_100039052
1307 Ga0070686_100017035
1308 Ga0070686_100100217
1309 Ga0070696_100030807
1310 Ga0070696_100039316
1311 Ga0070693_100005691
1312 Ga0070693_100010318
1313 Ga0070693_100028214
1314 Ga0070665_100019078
1315 Ga0070665_100020625
1316 Ga0070665_100022583
1317 Ga0070704_100022283
1318 Ga0070704_100121350
1319 Ga0068855_100013479
1320 Ga0068855_100017889
1321 Ga0068855_100043921
1322 Ga0068855_100105880
1323 Ga0068855_100198402
1324 Ga0070664_100004370
1325 Ga0070664_100213325
1326 Ga0070664_100497186
1327 Ga0068857_100056589
1328 Ga0068857_100128737
1329 Ga0068857_100133197
1330 Ga0068856_100157818
1331 Ga0068856_100233310
1332 Ga0068856_100417472
1333 Ga0070702_100049892
1334 Ga0070702_100079449
1335 Ga0070702_100091583
1336 Ga0068852_100038105
1337 Ga0068852_100322301
1338 Ga0068859_100350113
1339 Ga0068859_100382935
1340 Ga0068864_100013928
1341 Ga0068866_10021168
1342 Ga0068866_10025200
1343 Ga0068866_10190184
1344 Ga0068851_10223941
1345 Ga0068870_10158297
1346 Ga0068870_10272311
1347 Ga0068862_100277854
1348 Ga0081455_10027165
1349 Ga0081455_10027400
1350 Ga0081455_10040735
1351 Ga0081455_10049314
1352 Ga0081455_10052841
1353 Ga0081455_10092006
1354 Ga0081455_10095463
1355 Ga0081455_10162487
1356 Ga0081455_10206461
1357 Ga0081455_10265364
1358 Ga0081538_10000455
1359 Ga0081538_10000458
1360 Ga0081538_10000515
1361 Ga0081538_10010281
1362 Ga0081538_10018466
1363 Ga0081539_10001762
1364 Ga0081539_10003734
1365 Ga0081539_10063314
1366 Ga0075365_10165455
1367 Ga0075363_100059917
1368 Ga0075432_10002033
1369 Ga0070716_100138938
1370 Ga0070716_100269572
1371 Ga0070712_100010028
1372 Ga0070712_100068415
1373 Ga0075362_10037521
1374 Ga0075367_10021905
1375 Ga0097621_100016451
1376 Ga0068871_100008154
1377 Ga0068871_100187969
1378 Ga0068871_100279383
1379 Ga0075428_100003088
1380 Ga0075428_100010638
1381 Ga0075430_100031259
1382 Ga0075431_100100516
1383 Ga0075431_100152582
1384 Ga0075433_10015575
1385 Ga0075433_10112863
1386 Ga0075434_100042180
1387 Ga0075429_100001412
1388 Ga0068865_100039665
1389 Ga0068865_100187153
1390 Ga0097620_100350113
1391 Ga0097620_100382938
1392 Ga0075435_100149343
1393 Ga0105240_10004372
1394 Ga0105240_10062989
1395 Ga0105240_10079949
1396 Ga0105240_10099590
1397 Ga0105240_10181998
1398 Ga0111539_10017279
1399 Ga0111539_10095782
1400 Ga0111539_10238313
1401 Ga0105245_10009977
1402 Ga0105245_10026745
1403 Ga0105245_10035862
1404 Ga0105245_10074826
1405 Ga0105245_10120838
1406 Ga0105245_10127228
1407 Ga0105245_10234160
1408 Ga0105247_10095101
1409 Ga0114129_10012486
1410 Ga0114129_10020559
1411 Ga0114129_10021264
1412 Ga0114129_10029801
1413 Ga0114129_10052837
1414 Ga0114129_10622484
1415 Ga0105243_10133205
1416 Ga0105243_10153483
1417 Ga0105241_10101612
1418 Ga0105241_10245744
1419 Ga0105241_10280763
1420 Ga0105241_10311481
1421 Ga0105241_10558167
1422 Ga0105242_10061575
1423 Ga0105242_10066836
1424 Ga0105242_10429614
1425 Ga0105248_10077735
1426 Ga0105248_10128764
1427 Ga0105248_10424847
1428 Ga0105237_10080751
1429 Ga0105238_10036976
1430 Ga0105238_10046749
1431 Ga0105238_10527902
1432 Ga0105249_10008732
1433 Ga0105249_10119310
1434 Ga0105249_10862687
1435 Ga0105239_10087029
1436 Ga0105239_10121458
1437 Ga0105239_10405184
1438 Ga0105246_10005883
1439 Ga0157373_10211878
1440 Ga0157373_10269605
1441 Ga0157370_10082774
1442 Ga0157370_10167968
1443 Ga0157370_10191642
1444 Ga0157370_10392594
1445 Ga0157369_10003856
1446 Ga0157369_10004745
1447 Ga0157369_10029338
1448 Ga0157369_10039271
1449 Ga0157369_10048490
1450 Ga0157369_10184825
1451 Ga0157374_10107277
1452 Ga0157378_10090796
1453 Ga0157378_10199513
1454 Ga0157372_10027331
1455 Ga0157372_10048606
1456 Ga0157372_10073700
1457 Ga0157372_10256476
1458 Ga0157372_10263658
1459 Ga0157372_10857237
1460 Ga0163163_10084462
1461 Ga0163163_10203039
1462 Ga0157380_10040578
1463 Ga0157380_10303123
1464 Ga0182008_10006292
1465 Ga0157377_10000547
1466 Ga0157377_10003389
1467 Ga0157377_10005877
1468 Ga0157377_10068948
1469 Ga0157376_10105467
1470 Ga0157376_10223600
1471 Ga0182006_1015081
1472 Ga0182007_10030994
1473 Ga0163161_10131043
1474 Ga0206356_10498829
1475 Ga0206356_10525729
1476 Ga0206356_10612284
1477 Ga0206356_11589996
1478 Ga0206350_11494092
1479 Ga0206354_10607152
1480 Ga0206354_11210031
1481 Ga0206353_10294127
1482 Ga0206353_10558386
1483 Ga0206353_11428389
1484 Ga0206353_11672605
1485 Ga0213876_10036081
1486 Ga0213871_10078276
1487 Ga0224712_10031602
1488 Ga0224712_10162561
1489 Ga0207653_10012709
1490 Ga0207692_10328132
1491 Ga0207642_10118456
1492 Ga0207710_10144375
1493 Ga0207688_10000094
1494 Ga0207688_10019905
1495 Ga0207680_10294154
1496 Ga0207647_10038076
1497 Ga0207685_10087548
1498 Ga0207699_10392315
1499 Ga0207645_10019320
1500 Ga0207645_10026266
1501 Ga0207643_10044103
1502 Ga0207643_10180953
1503 Ga0207643_10198724
1504 Ga0207705_10086371
1505 Ga0207705_10096333
1506 Ga0207705_10109308
1507 Ga0207684_10070766
1508 Ga0207654_10029202
1509 Ga0207654_10278423
1510 Ga0207707_10005506
1511 Ga0207707_10010668
1512 Ga0207707_10021783
1513 Ga0207707_10037026
1514 Ga0207707_10046052
1515 Ga0207707_10067519
1516 Ga0207707_10078633
1517 Ga0207707_10117638
1518 Ga0207707_10177487
1519 Ga0207707_10226531
1520 Ga0207707_10306253
1521 Ga0207707_10382509
1522 Ga0207695_10061774
1523 Ga0207695_10072269
1524 Ga0207695_10079390
1525 Ga0207695_10226265
1526 Ga0207693_10004208
1527 Ga0207693_10075887
1528 Ga0207693_10097505
1529 Ga0207693_10114673
1530 Ga0207663_10007048
1531 Ga0207663_10229788
1532 Ga0207660_10005764
1533 Ga0207660_10104625
1534 Ga0207660_10128034
1535 Ga0207660_10162060
1536 Ga0207662_10051778
1537 Ga0207657_10000486
1538 Ga0207657_10005329
1539 Ga0207657_10006205
1540 Ga0207657_10008281
1541 Ga0207657_10008995
1542 Ga0207657_10033911
1543 Ga0207657_10065773
1544 Ga0207657_10114156
1545 Ga0207657_10166715
1546 Ga0207657_10191748
1547 Ga0207657_10288463
1548 Ga0207657_10307160
1549 Ga0207649_10013306
1550 Ga0207649_10044263
1551 Ga0207649_10100556
1552 Ga0207649_10108045
1553 Ga0207649_10113426
1554 Ga0207652_10001978
1555 Ga0207652_10010935
1556 Ga0207652_10026105
1557 Ga0207652_10027508
1558 Ga0207652_10056406
1559 Ga0207652_10112977
1560 Ga0207652_10114613
1561 Ga0207652_10125163
1562 Ga0207652_10152932
1563 Ga0207652_10189815
1564 Ga0207652_10335258
1565 Ga0207652_10434052
1566 Ga0207652_10530626
1567 Ga0207646_10003257
1568 Ga0207646_10010936
1569 Ga0207646_10227617
1570 Ga0207646_10337827
1571 Ga0207646_10513022
1572 Ga0207681_10431991
1573 Ga0207650_10010951
1574 Ga0207659_10116000
1575 Ga0207659_10386869
1576 Ga0207687_10020244
1577 Ga0207687_10027128
1578 Ga0207687_10028849
1579 Ga0207687_10074672
1580 Ga0207700_10060593
1581 Ga0207700_10079616
1582 Ga0207700_10110286
1583 Ga0207664_10016700
1584 Ga0207664_10141390
1585 Ga0207664_10249969
1586 Ga0207664_10284909
1587 Ga0207664_10362933
1588 Ga0207644_10268609
1589 Ga0207690_10037999
1590 Ga0207690_10237158
1591 Ga0207690_10496472
1592 Ga0207706_10049875
1593 Ga0207706_10094871
1594 Ga0207686_10233774
1595 Ga0207709_10017746
1596 Ga0207709_10068356
1597 Ga0207670_10147357
1598 Ga0207704_10003174
1599 Ga0207704_10090206
1600 Ga0207704_10112229
1601 Ga0207665_10002976
1602 Ga0207665_10018558
1603 Ga0207665_10057948
1604 Ga0207691_10001755
1605 Ga0207691_10046257
1606 Ga0207661_10000201
1607 Ga0207661_10002757
1608 Ga0207661_10009671
1609 Ga0207661_10010459
1610 Ga0207661_10056215
1611 Ga0207661_10068415
1612 Ga0207661_10216815
1613 Ga0207661_10245970
1614 Ga0207661_10263153
1615 Ga0207661_10356026
1616 Ga0207679_10036426
1617 Ga0207679_10070406
1618 Ga0207679_10215149
1619 Ga0207667_10052081
1620 Ga0207667_10075232
1621 Ga0207667_10083657
1622 Ga0207667_10083914
1623 Ga0207667_10086985
1624 Ga0207667_10111711
1625 Ga0207667_10271048
1626 Ga0207667_10404179
1627 Ga0207651_10140063
1628 Ga0207712_10067585
1629 Ga0207640_10122345
1630 Ga0207677_10007340
1631 Ga0207677_10014913
1632 Ga0207677_10089545
1633 Ga0207639_10028058
1634 Ga0207639_10092125
1635 Ga0207678_10021047
1636 Ga0207678_10031345
1637 Ga0207678_10117281
1638 Ga0207708_10003971
1639 Ga0207708_10031574
1640 Ga0207708_10035802
1641 Ga0207702_10054613
1642 Ga0207702_10121978
1643 Ga0207702_10364862
1644 Ga0207648_10002974
1645 Ga0207648_10025033
1646 Ga0207648_10052994
1647 Ga0207674_10126655
1648 Ga0207674_10210356
1649 Ga0207675_100113166
1650 Ga0207675_100778403
1651 Ga0207683_10000336
1652 Ga0207683_10002398
1653 Ga0207683_10400721
1654 Ga0207428_10000181
1655 Ga0207428_10024668
1656 Ga0207428_10061006
1657 Ga0268266_10097446
1658 Ga0268266_10222108
1659 Ga0265337_1045371
1660 Ga0265319_1000793
1661 Ga0265319_1014624
1662 Ga0265334_10000386
1663 Ga0265334_10009904
1664 Ga0265318_10000286
1665 Ga0265318_10021450
1666 Ga0265322_10001453
1667 Ga0265322_10010248
1668 Ga0265322_10017878
1669 Ga0265336_10008751
1670 Ga0265336_10067368
1671 Ga0265336_10071407
1672 Ga0265338_10009739
1673 Ga0265338_10011205
1674 Ga0265338_10019353
1675 Ga0265338_10036811
1676 Ga0265338_10339145
1677 Ga0265330_10000170
1678 Ga0265330_10036568
1679 Ga0265332_10000981
1680 Ga0265328_10001374
1681 Ga0265320_10023330
1682 Ga0265320_10049072
1683 Ga0265320_10060916
1684 Ga0265325_10000058
1685 Ga0265325_10049478
1686 Ga0265329_10017346
1687 Ga0265339_10019338
1688 Ga0265331_10017968
1689 Ga0265331_10063184
1690 Ga0265316_10000700
1691 Ga0265316_10065958
1692 Ga0265316_10089729
1693 Ga0307408_100553090
1694 Ga0265313_10004445
1695 Ga0265313_10007060
1696 Ga0265313_10022340
1697 Ga0265314_10000982
1698 Ga0265314_10016166
1699 Ga0265342_10035168
1700 Ga0265342_10187648
1701 Ga0307410_10029304
1702 Ga0307407_10012046
1703 Ga0307416_100020230
1704 Ga0307416_100225345
1705 Ga0307416_100230816
1706 Ga0307414_10008145
1707 Ga0307415_100027981
1708 Ga0307415_100049647
1709 Ga0307415_100060903
1710 Ga0373926_0119270
1711 Ga0373944_0010158
1712 Ga0373944_0018005
1713 Ga0373936_0012443
1714 Ga0373936_0072092
1715 Ga0373939_0045655
1716 Ga0373945_0010892
1717 Ga0373960_0021354
1718 Ga0373943_0002996
1719 Ga0373943_0004269
1720 Ga0373943_0019523
1721 Ga0373943_0047963
1722 Ga0373943_0344038
1723 Ga0373946_0083899
1724 Ga0373946_0152879
1725 Ga0373955_0016428
1726 Ga0373931_0212180
1727 Ga0373935_0149716
1728 Ga0373935_0164504
1729 Ga0373927_0198982
1730 Ga0373947_0000833
1731 Ga0373947_0001712
1732 Ga0373937_0041775
1733 Ga0373937_0198068
1734 Ga0373925_0016345
1735 Ga0373925_0044987
1736 Ga0395899_0001122
1737 Ga0395899_0003567
1738 Ga0395899_0003675
1739 Ga0395899_0009564
1740 Ga0395899_0014177
1741 Ga0395899_0015791
1742 Ga0395899_0027155
1743 Ga0395899_0036471
1744 Ga0395899_0043149
1745 Ga0395899_0045379
1746 Ga0395899_0075332
1747 Ga0395899_0108555
1748 Ga0395899_0152547
1749 Ga0395900_0001349
1750 Ga0395900_0002317
1751 Ga0395900_0003438
1752 Ga0395900_0004581
1753 Ga0395900_0005036
1754 Ga0395900_0005715
1755 Ga0395900_0011577
1756 Ga0395900_0014881
1757 Ga0395900_0024327
1758 Ga0395900_0032544
1759 Ga0395900_0034179
1760 Ga0395900_0036326
1761 Ga0395900_0065851
1762 Ga0395900_0068057
1763 Ga0395900_0147508
1764 Ga0395900_0149433
1765 Ga0395900_0176430
1766 Ga0395900_0178244
1767 Ga0395900_0209854
1768 Ga0395898_0002618
1769 Ga0395898_0002928
1770 Ga0395898_0004496
1771 Ga0395898_0006072
1772 Ga0395898_0009074
1773 Ga0395898_0014383
1774 Ga0395898_0015704
1775 Ga0395898_0021626
1776 Ga0395898_0022174
1777 Ga0395898_0025821
1778 Ga0395898_0026581
1779 Ga0395898_0045256
1780 Ga0395898_0069052
1781 Ga0395898_0073070
1782 Ga0395898_0085464
1783 Ga0395898_0187663
1784 Ga0395898_0738309
1785 Ga0395905_0001947
1786 Ga0395905_0002131
1787 Ga0395905_0002582
1788 Ga0395905_0005008
1789 Ga0395905_0006203
1790 Ga0395905_0008425
1791 Ga0395905_0015805
1792 Ga0395905_0024156
1793 Ga0395905_0044546
1794 Ga0395905_0050246
1795 Ga0395905_0084583
1796 Ga0395905_0099069
1797 Ga0395905_0110244
1798 Ga0395905_0120539
1799 Ga0395905_0121651
1800 Ga0395905_0135861
1801 Ga0395905_0313090
1802 Ga0395905_0443029
1803 Ga0436364_0295591
1804 Ga0395901_0001080
1805 Ga0395901_0001102
1806 Ga0395901_0001138
1807 Ga0395901_0003562
1808 Ga0395901_0007015
1809 Ga0395901_0009409
1810 Ga0395901_0010905
1811 Ga0395901_0029784
1812 Ga0395901_0031149
1813 Ga0395901_0039156
1814 Ga0395901_0045318
1815 Ga0395901_0062833
1816 Ga0395901_0076575
1817 Ga0395901_0082141
1818 Ga0395901_0088453
1819 Ga0395901_0091183
1820 Ga0395901_0143020
1821 Ga0395901_0167454
1822 Ga0395901_0230906
1823 Ga0395901_0264308
1824 Ga0395901_0282790
1825 Ga0395901_0478750
1826 Ga0395901_0489810
1827 Ga0395901_0506229
1828 Ga0395901_0591578
1829 Ga0395901_0626422
1830 Ga0395901_0653884
1831 Ga0395901_0692770
1832 Ga0436365_0524403
1833 Ga0436360_0030209
1834 Ga0439454_011277
1835 Ga0450920_002093
1836 Ga0450920_011205
1837 Ga0450906_007585
1838 Ga0450907_007292
1839 Ga0439435_0067289
1840 Ga0450918_014047
1841 Ga0466966_0007345
1842 Ga0466966_0072926
1843 Ga0466966_0107538
1844 Ga0466966_0138439
1845 Ga0466966_0155542
1846 Ga0466966_0297373
1847 Ga0466961_0025742
1848 Ga0466961_0041172
1849 Ga0466961_0043612
1850 Ga0466963_0002467
1851 Ga0466963_0003262
1852 Ga0466963_0004896
1853 Ga0466963_0011367
1854 Ga0466963_0014410
1855 Ga0466963_0019410
1856 Ga0466963_0040786
1857 Ga0466963_0163992
1858 Ga0466963_0217901
1859 Ga0466963_0226032
1860 Ga0466963_0295502
1861 Ga0466963_0386235
1862 Ga0466964_0018528
1863 Ga0466964_0027730
1864 Ga0466964_0034153
1865 Ga0466964_0105857
1866 Ga0466971_0052537
1867 Ga0466968_0048332
1868 Ga0466970_0110321
1869 Ga0466970_0205699
1870 Ga0466957_0000320
1871 Ga0466957_0022515
1872 Ga0466957_0043882
1873 Ga0466957_0063556
1874 Ga0466957_0084439
1875 Ga0466957_0112594
1876 Ga0466959_0001566
1877 Ga0466959_0008520
1878 Ga0466959_0070655
1879 Ga0451576_0219917
1880 Ga0466958_0002644
1881 Ga0466958_0003728
1882 Ga0466958_0020531
1883 Ga0466958_0031910
1884 Ga0466958_0081214
1885 Ga0466958_0083725
1886 Ga0466958_0196188
1887 Ga0466958_0227667
1888 Ga0466967_0000433
1889 Ga0466967_0003672
1890 Ga0466967_0005278
1891 Ga0466967_0005373
1892 Ga0466967_0006777
1893 Ga0466967_0023511
1894 Ga0466967_0025397
1895 Ga0466967_0036147
1896 Ga0466967_0045092
1897 Ga0466967_0045547
1898 Ga0466967_0055596
1899 Ga0466967_0076599
1900 Ga0466967_0101528
1901 Ga0466967_0164052
1902 Ga0466967_0274943
1903 Ga0466967_0309850
1904 Ga0466967_0313094
1905 Ga0466967_0327137
1906 Ga0466967_0334028
1907 Ga0466967_0356058
1908 Ga0466967_0393684
1909 Ga0466967_0445857
1910 Ga0495592_0078399
1911 Ga0495592_0107950
1912 Ga0495603_0235075
1913 Ga0495629_0000983
1914 Ga0495629_0005386
1915 Ga0495629_0034794
1916 Ga0495629_0096744
1917 Ga0495629_0141512
1918 Ga0495629_0169960
1919 Ga0495641_0000513
1920 Ga0495641_0013891
1921 Ga0495651_0008831
1922 Ga0495651_0028727
1923 Ga0495651_0036582
1924 Ga0495651_0057837
1925 Ga0495651_0195228
1926 Ga0495653_0015091
1927 Ga0495653_0052672
1928 Ga0495653_0064933
1929 Ga0495653_0188068
1930 Ga0495582_0000553
1931 Ga0495582_0024252
1932 Ga0495582_0029202
1933 Ga0495582_0112345
1934 Ga0495582_0184146
1935 Ga0495605_0058685
1936 Ga0495639_0007896
1937 Ga0495662_0004812
1938 Ga0495662_0033415
1939 Ga0495584_0009844
1940 Ga0495584_0093197
1941 Ga0495594_0089921
1942 Ga0495607_0030538
1943 Ga0495608_0010647
1944 Ga0495608_0010965
1945 Ga0495608_0266532
1946 Ga0495618_0049002
1947 Ga0495628_0047013
1948 Ga0495628_0074653
1949 Ga0495628_0127796
1950 Ga0495630_0030060
1951 Ga0495630_0048094
1952 Ga0495630_0070624
1953 Ga0495630_0391229
1954 Ga0495630_0432050
1955 Ga0495666_0054385
1956 Ga0495642_0028078
1957 Ga0495652_0033764
1958 Ga0495652_0035874
1959 Ga0495652_0317714
1960 Ga0495652_0328103
1961 Ga0495665_0010478
1962 Ga0495640_0015840
1963 Ga0495640_0145796
1964 Ga0495640_0221328
1965 Ga0495586_0182651
1966 Ga0495587_0016056
1967 Ga0495587_0093812
1968 Ga0495587_0258003
1969 Ga0495609_0042385
1970 Ga0495645_0012630
1971 Ga0495667_0004861
1972 Ga0495667_0011321
1973 Ga0495667_0034880
1974 Ga0495656_0021831
1975 Ga0495656_0025895
1976 Ga0495634_0017514
1977 Ga0495634_0080784
1978 Ga0495634_0083952
1979 Ga0495635_0017038
1980 Ga0495635_0023772
1981 Ga0495635_0029893
1982 Ga0495659_0010780
1983 Ga0495588_0001267
1984 Ga0495657_0006323
1985 Ga0495657_0022761
1986 Ga0495657_0062826
1987 Ga0495657_0112843
1988 Ga0495599_0088633
1989 Ga0495623_0018829
1990 Ga0495623_0265680
1991 Ga0495646_0033710
1992 Ga0495646_0055715
1993 Ga0495658_0000300
1994 Ga0495658_0146923
1995 Ga0495613_0010487
1996 Ga0495613_0101516
1997 Ga0495670_0067555
1998 Ga0495589_0016095
1999 Ga0495600_0102147
2000 Ga0495581_0019593
2001 Ga0495581_0082333
2002 Ga0495581_0182959
2003 Ga0495581_0183047
2004 Ga0495604_0133055
2005 Ga0495604_0269756
2006 Ga0495674_0003155
2007 Ga0495674_0050062
2008 Ga0495674_0320536
2009 Ga0495676_0001459
2010 Ga0495676_0035504
2011 Ga0495676_0036083
2012 Ga0495680_0003282
2013 Ga0495680_0004330
2014 Ga0495680_0009818
2015 Ga0495680_0046182
2016 Ga0495680_0078517
2017 Ga0495675_0049893
2018 Ga0495675_0079610
2019 Ga0495677_0011247
2020 Ga0495593_0006091
2021 Ga0495593_0102297
2022 Ga0495593_0112650
2023 Ga0495602_0186760
2024 Ga0495602_0278559
2025 Ga0495614_0044451
2026 Ga0495614_0077464
2027 Ga0496100_0004882
2028 Ga0496100_0025294
2029 Ga0496100_0033693
2030 Ga0496100_0509100
2031 Ga0496101_0001389
2032 Ga0496101_0003760
2033 Ga0496101_0004977
2034 Ga0496101_0027434
2035 Ga0496101_0096938
2036 Ga0496101_0107889
2037 Ga0496101_0139754
2038 Ga0496101_0168157
2039 Ga0496101_0326731
2040 Ga0496102_0003545
2041 Ga0496102_0051719
2042 Ga0496102_0058391
2043 Ga0496102_0069568
2044 Ga0496102_0142564
2045 Ga0496102_0163665
2046 Ga0496102_0323173
2047 Ga0496102_0359344
2048 Ga0496102_0409707
2049 Ga0496103_0009466
2050 Ga0496103_0098195
2051 Ga0496103_0166468
2052 Ga0496104_0023166
2053 Ga0496104_0048118
2054 Ga0496104_0089064
2055 Ga0496104_0089328
2056 Ga0496104_0208456
2057 Ga0496104_0586477
2058 Ga0496104_0618704
2059 Ga0496105_0005175
2060 Ga0496105_0008326
2061 Ga0496105_0038665
2062 Ga0496105_0064818
2063 Ga0496105_0086200
2064 Ga0496106_0009146
2065 Ga0496106_0016076
2066 Ga0496106_0025577
2067 Ga0496106_0037974
2068 Ga0496106_0410340
2069 Ga0496107_0011757
2070 Ga0496107_0016606
2071 Ga0496107_0024830
2072 Ga0496107_0073591
2073 Ga0496108_0004497
2074 Ga0496108_0017997
2075 Ga0496108_0049009
2076 Ga0496108_0054923
2077 Ga0496108_0188418
2078 Ga0496108_0293878
2079 Ga0496108_0294878
2080 Ga0496109_0010777
2081 Ga0496109_0025155
2082 Ga0496109_0033171
2083 Ga0496109_0037156
2084 Ga0496109_0089941
2085 Ga0496109_0174307
2086 Ga0496109_0185597
2087 Ga0496109_0251956
2088 Ga0496109_0257922
2089 Ga0496109_0383252
2090 Ga0496110_0002589
2091 Ga0496110_0032189
2092 Ga0496110_0039149
2093 Ga0496110_0041405
2094 Ga0496110_0048802
2095 Ga0496110_0065340
2096 Ga0496110_0258403
2097 Ga0496110_0266724
2098 Ga0496110_0485042
2099 Ga0496111_0005335
2100 Ga0496111_0007386
2101 Ga0496111_0007877
2102 Ga0496111_0017416
2103 Ga0496112_0001415
2104 Ga0496112_0003186
2105 Ga0496112_0016093
2106 Ga0496112_0017575
2107 Ga0496112_0056051
2108 Ga0496112_0066559
2109 Ga0496112_0069221
2110 Ga0496112_0160331
2111 Ga0496112_0241187
2112 Ga0496112_0262402
2113 Ga0496113_0026770
2114 Ga0496113_0112846
2115 Ga0496113_0427377
2116 Ga0496113_0576068
2117 Ga0496114_0000593
2118 Ga0496114_0003060
2119 Ga0496114_0004918
2120 Ga0496114_0010412
2121 Ga0496114_0012526
2122 Ga0496114_0031336
2123 Ga0496114_0118729
2124 Ga0496114_0132376
2125 Ga0496115_0002884
2126 Ga0496115_0019565
2127 Ga0496115_0023989
2128 Ga0496115_0060072
2129 Ga0496115_0550829
2130 Ga0501031_0003201
2131 Ga0501031_0010316
2132 Ga0501031_0027189
2133 Ga0501031_0028064
2134 Ga0501032_0003510
2135 Ga0501032_0034078
2136 Ga0501032_0145374
2137 Ga0501032_0214418
2138 Ga0501032_0271383
2139 Ga0501033_0009336
2140 Ga0501033_0011029
2141 Ga0501033_0251144
2142 Ga0501033_0305487
2143 Ga0501034_0052801
2144 Ga0501034_0110725
2145 Ga0501036_0016353
2146 Ga0501036_0018678
2147 Ga0501036_0037239
2148 Ga0501036_0143921
2149 Ga0501036_0230343
2150 Ga0501037_0005161
2151 Ga0501037_0032379
2152 Ga0501037_0040856
2153 Ga0501037_0155602
2154 Ga0501038_0002125
2155 Ga0501038_0028671
2156 Ga0501038_0130409
2157 Ga0501038_0237867
2158 Ga0501038_0240788
2159 Ga0501039_0008922
2160 Ga0501039_0011096
2161 Ga0501039_0041616
2162 Ga0501039_0097716
2163 Ga0501040_0008306
2164 Ga0501040_0041715
2165 Ga0501040_0275674
2166 Ga0501041_0002077
2167 Ga0501041_0005126
2168 Ga0501041_0019846
2169 Ga0501041_0096415
2170 Ga0501042_0003373
2171 Ga0501042_0014660
2172 Ga0501042_0055816
2173 Ga0501042_0081887
2174 Ga0501042_0117341
2175 Ga0501042_0193332
2176 Ga0501042_0338062
2177 Ga0501043_0020365
2178 Ga0501043_0037251
2179 Ga0501043_0363167
2180 Ga0501046_0019560
2181 Ga0501046_0305282
2182 Ga0501048_0004447
2183 Ga0501048_0030532
2184 Ga0501048_0030933
2185 Ga0501048_0045087
2186 Ga0501048_0072852
2187 Ga0501067_0009512
2188 Ga0501067_0085384
2189 Ga0501068_0001537
2190 Ga0501068_0005706
2191 Ga0501068_0006272
2192 Ga0501068_0025712
2193 Ga0501068_0093277
2194 Ga0501069_0005348
2195 Ga0501069_0005484
2196 Ga0501069_0006946
2197 Ga0501069_0017146
2198 Ga0501069_0106449
2199 Ga0501069_0114398
2200 Ga0501070_0000932
2201 Ga0501070_0002071
2202 Ga0501070_0011151
2203 Ga0501070_0020037
2204 Ga0501070_0121834
2205 Ga0501070_0213984
2206 Ga0501070_0356231
2207 Ga0501071_0008317
2208 Ga0501071_0010584
2209 Ga0501071_0017401
2210 Ga0501071_0068518
2211 Ga0501071_0163411
2212 Ga0501071_0241836
2213 Ga0501072_0008089
2214 Ga0501072_0011971
2215 Ga0501072_0022954
2216 Ga0501072_0035498
2217 Ga0501072_0040293
2218 Ga0501072_0065467
2219 Ga0501072_0093560
2220 Ga0501072_0101103
2221 Ga0501072_0164049
2222 Ga0501073_0029889
2223 Ga0501073_0075243
2224 Ga0501073_0096106
2225 Ga0501073_0268369
2226 Ga0501074_0009335
2227 Ga0501074_0029313
2228 Ga0501074_0092050
2229 Ga0501074_0138061
2230 Ga0501074_0180786
2231 Ga0501075_0003177
2232 Ga0501075_0009635
2233 Ga0501075_0051824
2234 Ga0501075_0098589
2235 Ga0501075_0133061
2236 Ga0501075_0246597
2237 Ga0501076_0006779
2238 Ga0501076_0008556
2239 Ga0501076_0016816
2240 Ga0501076_0038033
2241 Ga0501076_0056547
2242 Ga0501076_0060231
2243 Ga0501076_0081383
2244 Ga0501076_0482884
2245 Ga0501077_0002696
2246 Ga0501077_0004113
2247 Ga0501077_0021974
2248 Ga0501077_0043824
2249 Ga0501077_0046241
2250 Ga0501077_0053737
2251 Ga0501079_0002599
2252 Ga0501079_0006044
2253 Ga0501079_0018929
2254 Ga0501079_0112580
2255 Ga0501079_0128028
2256 Ga0501079_0302104
2257 Ga0501080_0003099
2258 Ga0501080_0009875
2259 Ga0501080_0011017
2260 Ga0501080_0015234
2261 Ga0501080_0015236
2262 Ga0501080_0030090
2263 Ga0501080_0042851
2264 Ga0501080_0128843
2265 Ga0501080_0245813
2266 Ga0501080_0249400
2267 Ga0501080_0323400
2268 Ga0501080_0598069
2269 Ga0501081_0006015
2270 Ga0501081_0012121
2271 Ga0501081_0027399
2272 Ga0501081_0046325
2273 Ga0501081_0057695
2274 Ga0501081_0074805
2275 Ga0501083_0001150
2276 Ga0501083_0009072
2277 Ga0501083_0033347
2278 Ga0501083_0073318
2279 Ga0501083_0132962
2280 Ga0501035_0029051
2281 Ga0501035_0051815
2282 Ga0501035_0207160
2283 Ga0501035_0425194
2284 Ga0501035_0439416
2285 Ga0501044_0032685
2286 Ga0501044_0046195
2287 Ga0501044_0074258
2288 Ga0501045_0004472
2289 Ga0501045_0007706
2290 Ga0501045_0015025
2291 Ga0501045_0316369
2292 nmdc:mga03683_50388_c1
2293 nmdc:mga06z11_55334_c1
2294 nmdc:mga05p37_218628_c1
2295 nmdc:mga05p37_28125_c1
2296 nmdc:mga05p37_42550_c1
2297 nmdc:mga05p37_69520_c1
2298 nmdc:mga05p37_91230_c1
2299 nmdc:mga09592_372152_c1
2300 nmdc:mga09592_97006_c1
2301 nmdc:mga06r32_436727_c1
2302 nmdc:mga06r32_559548_c1
2303 nmdc:mga08y16_112287_c1
2304 nmdc:mga08y16_128888_c1
2305 nmdc:mga08y16_313864_c1
2306 nmdc:mga08y16_350857_c1
2307 nmdc:mga08y16_40122_c1
2308 nmdc:mga0n895_3110_c1
2309 nmdc:mga0rr50_22496_c1
2310 nmdc:mga08x19_246563_c1
2311 nmdc:mga08x19_328248_c1
2312 nmdc:mga0a205_132300_c1
2313 nmdc:mga0a205_38193_c1
2314 Ga0495601_0013877
2315 Ga0495601_0026505
2316 Ga0495601_0193108
2317 Ga0495612_0023733
2318 Ga0495612_0044779
2319 Ga0495595_0003172
2320 Ga0495595_0034736
2321 Ga0495595_0039666
2322 Ga0495595_0190490
2323 Ga0495619_0008553
2324 Ga0495619_0008933
2325 Ga0495619_0010495
2326 Ga0495619_0061892
2327 Ga0495619_0283205
2328 Ga0495619_0337062
2329 Ga0501084_0008364
2330 Ga0501084_0027752
2331 Ga0501084_0045011
2332 Ga0501084_0051198
2333 Ga0501084_0057429
2334 Ga0501084_0228959
2335 Ga0501084_0244646
2336 Ga0501084_0471443
2337 Ga0501082_0010110
2338 Ga0501082_0017296
2339 Ga0501082_0018315
2340 Ga0501082_0033000
2341 Ga0501082_0069746
2342 Ga0501082_0182563
2343 Ga0466962_0004475
2344 Ga0530510_0002954
2345 Ga0530510_0034472
2346 Ga0530510_0034484
2347 Ga0530510_0041507
2348 Ga0530510_0056043
2349 Ga0530510_0079718
2350 Ga0530510_0085852
2351 Ga0530510_0124561
2352 Ga0530510_0249544
2353 Ga0530510_0310018
2354 3006975249

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

60

229

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

59

274

0.93

PF08659

KR

KR domain

11

212

0.83

PF00106

adh_short

short chain dehydrogenase

10

65

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5end-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg)(q152a) from vibrio cholerae 0.9382 5 269
2hq1-assembly1.cif.gz_A crystal structure of orf 1438 a putative glucose/ribitol dehydrogenase from clostridium thermocellum 0.9295 4 270
3osu-assembly1.cif.gz_B crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus 0.9291 9 269
7tzp-assembly3.cif.gz_G crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044 in complex with nadh 0.9273 1 270
4ure-assembly1.cif.gz_A molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 0.926 4 268
ID Description Score Start End Superfamily
2hq1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9295 4 270 3.40.50.720
3tzcB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.927 5 271 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9259 8 269 3.40.50.720
2hq1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9254 4 270 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9238 6 268 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V5DR57-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9442 4 269 GO:0004316
GO:0030497
GO:0051287
AF-A0A535HMS1-F1-model_v4 3-oxoacyl-ACP reductase FabG 0.9408 4 275 GO:0016491
AF-A0A7C1F794-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9381 4 269 GO:0004316
GO:0030497
GO:0051287
AF-A0A7C1GKR3-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9377 2 268 GO:0016491
AF-D5WXR6-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9367 4 269 GO:0016491

Map