F491240

General Info

Members Datasets Scaffolds Average Seq Length
1175 898 515 273

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10400100|Ga0105243_104001002
Length 295
Sequence VIDSSYQLRYLIEKIERRGNMTAIALFGAGGKMGYRLAKNLKGSRFDVRHVEVSDAGKARLKNDLGIDCVGADEGLAGADVVILAVPDTAIGKVATGIVGKLKPGTMVVALDAAAPFAGHLPERADLTYFVTHPCHPPIFNDETDMQAKKDHFGGLFAKQHIVSALMQGPEAAYDLGEEIAKVIWAPVMRSHRVTVDQMAMLEPGLSETVCASLLVVMRQAMDECVARGVPAEAARDFLLGHMNVLGAVIFKEVDGVFSDACNKAIEFGIPALMRDDWKKVFEPQEIAESIRRIT

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
10 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
11 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
12 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
13 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
14 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
15 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
16 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
17 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
18 2512875024 Mesorhizobium loti R88b Isolate Nodule
19 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
20 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
21 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
22 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
23 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
24 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
25 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
26 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
27 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
28 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
29 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
30 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
31 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
32 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
33 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
34 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
35 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
36 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
37 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
38 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
39 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
40 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
41 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
42 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
43 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
44 2516143018 Ensifer sp. BR816 Isolate Nodule
45 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
46 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
47 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
48 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
49 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
50 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
51 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
52 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
53 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
54 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
55 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
56 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
57 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
58 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
59 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
60 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
61 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
62 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
63 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
64 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
65 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
66 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
67 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
68 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
69 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
70 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
71 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
72 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
73 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
74 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
75 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
76 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
77 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
78 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
79 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
80 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
81 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
82 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
83 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
84 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
85 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
86 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
87 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
88 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
89 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
90 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
91 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
92 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
93 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
94 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
95 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
96 2643221599 Rhizobium sp. Root708 Isolate Unclassified
97 2643221607 Rhizobium sp. Root73 Isolate Unclassified
98 2643221610 Ensifer sp. Root74 Isolate Unclassified
99 2643221618 Ensifer sp. Root231 Isolate Unclassified
100 2643221626 Ensifer sp. Root31 Isolate Unclassified
101 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
102 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
103 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
104 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
105 2643221655 Ensifer sp. Root1252 Isolate Unclassified
106 2643221659 Ensifer sp. Root127 Isolate Unclassified
107 2643221675 Ensifer sp. Root1298 Isolate Unclassified
108 2643221680 Ensifer sp. Root1312 Isolate Unclassified
109 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
110 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
111 2643221698 Ensifer sp. Root142 Isolate Unclassified
112 2643221712 Ensifer sp. Root258 Isolate Unclassified
113 2643221726 Ensifer sp. Root954 Isolate Unclassified
114 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
115 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
116 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
117 2718217882 Rhizobium sp. N741 Isolate Nodule
118 2718217927 Rhizobium sp. N324 Isolate Nodule
119 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
120 2718218009 Rhizobium sp. N561 Isolate Nodule
121 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
122 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
123 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
124 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
125 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
126 2718218363 Rhizobium sp. N113 Isolate Nodule
127 2718218365 Rhizobium sp. N731 Isolate Nodule
128 2718218366 Rhizobium sp. N621 Isolate Nodule
129 2718218423 Rhizobium sp. N941 Isolate Nodule
130 2721755514 Rhizobium sp. N6212 Isolate Nodule
131 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
132 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
133 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
134 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
135 2721755809 Rhizobium sp. N541 Isolate Nodule
136 2721755810 Rhizobium sp. N871 Isolate Nodule
137 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
138 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
139 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
140 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
141 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
142 2728369365 Rhizobium sp. N1341 Isolate Nodule
143 2728369397 Rhizobium sp. N1314 Isolate Nodule
144 2738541293 Rhizobium sp. GV031 Isolate Unclassified
145 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
146 2751185800 Brucella pituitosa AA2 Isolate Unclassified
147 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
148 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
149 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
150 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
151 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
152 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
153 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
154 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
155 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
156 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
157 2791355260 Rhizobium sp. L9 Isolate Nodule
158 2791355261 Rhizobium sp. J15 Isolate Nodule
159 2791355263 Rhizobium chutanense C5 Isolate Nodule
160 2791355264 Rhizobium sp. S9 Isolate Nodule
161 2791355266 Rhizobium sp. L43 Isolate Nodule
162 2791355267 Rhizobium sp. L18 Isolate Nodule
163 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
164 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
165 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
166 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
167 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
168 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
169 2802429633 Rhizobium anhuiense J3 Isolate Nodule
170 2802429634 Rhizobium anhuiense S10 Isolate Nodule
171 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
172 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
173 2802429637 Rhizobium anhuiense C15 Isolate Nodule
174 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
175 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
176 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
177 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
178 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
179 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
180 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
181 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
182 2838048938 Rhizobium pisi 27/80 Isolate Nodule
183 2838061910 Rhizobium phaseoli L15 Isolate Nodule
184 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
185 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
186 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
187 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
188 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
189 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
190 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
191 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
192 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
193 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
194 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
195 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
196 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
197 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
198 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
199 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
200 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
201 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
202 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
203 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
204 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
205 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
206 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
207 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
208 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
209 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
210 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
211 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
212 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
213 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
214 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
215 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
216 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
217 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
218 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
219 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
220 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
221 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
222 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
223 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
224 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
225 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
226 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
227 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
228 2844163670 Ensifer sp. 1H6 Isolate Unclassified
229 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
230 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
231 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
232 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
233 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
234 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
235 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
236 2854911287 Brucella lupini LUP21 Isolate Unclassified
237 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
238 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
239 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
240 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
241 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
242 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
243 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
244 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
245 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
246 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
247 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
248 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
249 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
250 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
251 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
252 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
253 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
254 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
255 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
256 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
257 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
258 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
259 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
260 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
261 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
262 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
263 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
264 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
265 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
266 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
267 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
268 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
269 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
270 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
271 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
272 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
273 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
274 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
275 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
276 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
277 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
278 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
279 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
280 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
281 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
282 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
283 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
284 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
285 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
286 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
287 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
288 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
289 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
290 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
291 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
292 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
293 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
294 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
295 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
296 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
297 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
298 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
299 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
300 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
301 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
302 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
303 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
304 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
305 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
306 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
307 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
308 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
309 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
310 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
311 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
312 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
313 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
314 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
315 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
316 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
317 2909042592 Labrys sp. LIt4 Isolate Nodule
318 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
319 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
320 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
321 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
322 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
323 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
324 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
325 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
326 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
327 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
328 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
329 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
330 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
331 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
332 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
333 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
334 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
335 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
336 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
337 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
338 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
339 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
340 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
341 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
342 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
343 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
344 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
345 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
346 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
347 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
348 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
349 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
350 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
351 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
352 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
353 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
354 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
355 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
356 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
357 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
358 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
359 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
360 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
361 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
362 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
363 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
364 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
365 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
366 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
367 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
368 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
369 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
370 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
371 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
372 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
373 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
374 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
375 2933599457 Rhizobium phaseoli M3 Isolate Nodule
376 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
377 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
378 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
379 2936381700 Rhizobium chutanense C16 Isolate Unclassified
380 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
381 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
382 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
383 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
384 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
385 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
386 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
387 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
388 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
389 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
390 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
391 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
392 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
393 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
394 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
395 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
396 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
397 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
398 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
399 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
400 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
401 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
402 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
403 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
404 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
405 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
406 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
407 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
408 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
409 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
410 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
411 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
412 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
413 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
414 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
415 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
416 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
417 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
418 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
419 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
420 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
421 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
422 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
423 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
424 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
425 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
426 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
427 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
428 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
429 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
430 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
431 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
432 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
433 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
434 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
435 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
436 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
437 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
438 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
439 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
440 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
441 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
442 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
443 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
444 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
445 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
446 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
447 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
448 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
449 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
450 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
451 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
452 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
453 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
454 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
455 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
456 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
457 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
458 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
459 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
460 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
461 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
462 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
463 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
464 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
465 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
466 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
467 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
468 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
469 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
470 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
471 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
472 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
473 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
474 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
475 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
476 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
477 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
478 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
479 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
480 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
481 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
482 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
483 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
484 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
485 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
486 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
487 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
488 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
489 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
490 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
491 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
492 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
493 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
494 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
495 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
496 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
497 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
498 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
499 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
500 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
501 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
502 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
503 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
504 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
505 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
506 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
507 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
508 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
509 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
510 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
511 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
512 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
513 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
514 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
515 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
516 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
517 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
518 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
519 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
520 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
521 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
522 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
523 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
524 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
525 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
526 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
527 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
528 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
529 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
530 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
531 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
532 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
533 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
534 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
535 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
536 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
537 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
538 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
539 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
540 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
541 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
542 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
543 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
544 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
545 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
546 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
547 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
548 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
549 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
550 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
551 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
552 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
553 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
554 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
555 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
556 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
557 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
558 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
559 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
560 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
561 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
562 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
563 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
564 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
565 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
566 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
567 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
568 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
569 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
570 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
571 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
572 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
573 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
574 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
575 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
576 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
577 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
578 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
579 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
580 3004167301 Mesorhizobium loti 582 Isolate Unclassified
581 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
582 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
583 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
584 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
585 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
586 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
587 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
588 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
589 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
590 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
591 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
592 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
593 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
594 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
595 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
596 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
597 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
598 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
599 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
600 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
601 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
602 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
603 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
604 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
605 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
606 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
607 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
608 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
609 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
610 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
611 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
612 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
613 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
614 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
615 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
616 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
617 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
618 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
619 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
620 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
621 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
622 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
623 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
624 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
625 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
626 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
627 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
628 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
629 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
630 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
631 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
632 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
633 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
634 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
635 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
636 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
637 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
638 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
639 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
640 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
641 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
642 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
643 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
644 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
645 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
646 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
647 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
648 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
649 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
650 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
651 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
652 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
653 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
654 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
655 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
656 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
657 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
658 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
659 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
660 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
661 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
662 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
663 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
664 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
665 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
666 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
667 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
668 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
669 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
670 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
671 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
672 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
673 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
674 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
675 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
676 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
677 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
678 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
679 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
680 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
681 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
682 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
683 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
684 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
685 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
686 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
687 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
688 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
689 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
690 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
691 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
692 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
693 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
694 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
695 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
696 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
697 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
698 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
699 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
700 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
701 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
702 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
703 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
704 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
705 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
706 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
707 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
708 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
709 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
710 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
711 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
712 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
713 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
714 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
715 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
716 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
717 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
718 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
719 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
720 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
721 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
722 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
723 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
724 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
725 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
726 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
727 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
728 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
729 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
730 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
731 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
732 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
733 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
734 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
735 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
736 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
737 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
738 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
739 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
740 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
741 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
742 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
743 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
744 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
745 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
746 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
747 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
748 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
749 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
750 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
751 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
752 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
753 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
754 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
755 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
756 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
757 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
758 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
759 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
760 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
761 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
762 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
763 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
764 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
765 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
766 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
767 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
768 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
769 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
770 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
771 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
772 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
773 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
774 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
775 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
776 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
777 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
778 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
779 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
780 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
781 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
782 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
783 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
784 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
785 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
786 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
787 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
788 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
789 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
790 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
791 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
792 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
793 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
794 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
795 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
796 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
797 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
798 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
799 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
800 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
801 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
802 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
803 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
804 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
805 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
806 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
807 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
808 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
809 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
810 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
811 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
812 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
813 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
814 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
815 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
816 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
817 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
818 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
819 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
820 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
821 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
822 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
823 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
824 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
825 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
826 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
827 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
828 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
829 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
830 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
831 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
832 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
833 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
834 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
835 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
836 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
837 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
838 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
839 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
840 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
841 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
842 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
843 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
844 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
845 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
846 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
847 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
848 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
849 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
850 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
851 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
852 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
853 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
854 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
855 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
856 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
857 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
858 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
859 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
860 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
861 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
862 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
863 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
864 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
865 8005275841 Rhizobium sp. N4311 Isolate Nodule
866 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
867 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
868 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
869 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
870 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
871 8005382845 Rhizobium sp. R634 Isolate Nodule
872 8005395548 Rhizobium sp. R339 Isolate Nodule
873 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
874 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
875 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
876 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
877 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
878 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
879 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
880 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
881 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
882 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
883 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
884 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
885 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
886 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
887 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
888 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
889 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
890 8018176218 Rhizobium sp. N122 Isolate Nodule
891 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
892 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
893 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
894 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
895 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
896 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
897 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
898 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.83
Metatranscriptomes 0
Isolates 56.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.02
Nodule 46.55
Rhizoplane 1.36
Rhizosphere 21.28
Stem 0
Stem Tuber 0
Unclassified 13.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002929 3300001979 Bacteria 7591
2 JGI24740J21852_10003704 3300001979 Bacteria 6660
3 JGI25155J39150_1000015 3300002704 Bacteria 178839
4 JGI25155J39150_1000039 3300002704 Bacteria 91670
5 JGI25156J39149_1000007 3300002705 Bacteria 252108
6 JGI25156J39149_1000427 3300002705 Bacteria 26123
7 JGI25162J39368_1000248 3300002737 Bacteria 53932
8 JGI25162J39368_1001265 3300002737 Bacteria 14427
9 JGI25154J39366_1000051 3300002738 Bacteria 123608
10 JGI25154J39366_1000077 3300002738 Bacteria 90455
11 JGI25158J39367_1000619 3300002739 Bacteria 7054
12 JGI25158J39367_1008405 3300002739 Bacteria 1435
13 JGI25157J39369_1000012 3300002741 Bacteria 205167
14 JGI25157J39369_1000065 3300002741 Bacteria 98536
15 JGI25157J39369_1003126 3300002741 Bacteria 3554
16 JGI25152J39213_1000465 3300002773 Bacteria 23613
17 JGI25152J39213_1000472 3300002773 Bacteria 23443
18 JGI25152J39213_1004792 3300002773 Bacteria 4151
19 JGI25152J39213_1004925 3300002773 Bacteria 4051
20 JGI25152J39213_1008170 3300002773 Bacteria 2623
21 JGI25152J39213_1008377 3300002773 Bacteria 2571
22 JGI25152J39213_1012900 3300002773 Bacteria 1766
23 JGI25150J39212_1000219 3300002774 Bacteria 31283
24 JGI25150J39212_1004081 3300002774 Bacteria 3303
25 JGI25159J45721_1000036 3300002987 Bacteria 76363
26 JGI25159J45721_1000101 3300002987 Bacteria 41224
27 JGI25159J45721_1000321 3300002987 Bacteria 22253
28 JGI25159J45721_1015705 3300002987 Bacteria 1646
29 JGI25151J46595_10000007 3300003187 Bacteria 411751
30 JGI25151J46595_10000463 3300003187 Bacteria 38967
31 JGI25151J46595_10000667 3300003187 Bacteria 29187
32 JGI25165J46597_1000102 3300003214 Bacteria 155002
33 JGI25165J46597_1000280 3300003214 Bacteria 65126
34 JGI25153J46596_10000254 3300003215 Bacteria 43730
35 JGI25153J46596_10001626 3300003215 Bacteria 13317
36 JGI25153J46596_10002799 3300003215 Bacteria 9916
37 JGI25153J46596_10015061 3300003215 Bacteria 3173
38 JGI25153J46596_10019229 3300003215 Bacteria 2623
39 JGI25153J46596_10019269 3300003215 Bacteria 2620
40 JGI25160J50197_1000023 3300003354 Bacteria 200692
41 JGI25160J50197_1000060 3300003354 Bacteria 116870
42 JGI25160J50197_1001918 3300003354 Bacteria 9954
43 JGI25160J50197_1003006 3300003354 Bacteria 7693
44 JGI25160J50197_1004431 3300003354 Bacteria 6072
45 JGI25161J50226_1000012 3300003374 Bacteria 200668
46 JGI25161J50226_1000085 3300003374 Bacteria 76182
47 JGI25161J50226_1003468 3300003374 Bacteria 3596
48 Ga0055539_1007968 3300003752 Bacteria 1332
49 Ga0055532_1000005 3300003758 Bacteria 458107
50 Ga0055535_1010294 3300003761 Bacteria 1547
51 Ga0055542_1000516 3300003762 Bacteria 34984
52 Ga0055529_1002054 3300003763 Bacteria 4355
53 Ga0055526_1010257 3300003771 Bacteria 4381
54 Ga0055526_1023182 3300003771 Bacteria 2081
55 Ga0055524_1000668 3300003775 Bacteria 24115
56 Ga0055524_1001911 3300003775 Bacteria 11282
57 Ga0055524_1003923 3300003775 Bacteria 7044
58 Ga0055524_1007862 3300003775 Bacteria 4485
59 Ga0055528_1000098 3300003790 Bacteria 69408
60 Ga0055528_1010345 3300003790 Bacteria 3799
61 Ga0055528_1023585 3300003790 Bacteria 1872
62 Ga0055528_1028713 3300003790 Bacteria 1527
63 Ga0055540_1000209 3300003792 Bacteria 55602
64 Ga0055540_1000331 3300003792 Bacteria 41202
65 Ga0055540_1007076 3300003792 Bacteria 4311
66 Ga0055540_1010000 3300003792 Bacteria 3199
67 Ga0055543_1000009 3300004625 Bacteria 200706
68 Ga0055543_1000036 3300004625 Bacteria 126054
69 Ga0055543_1000456 3300004625 Bacteria 24226
70 Ga0055543_1001244 3300004625 Bacteria 10574
71 Ga0065165_1000064 3300005262 Bacteria 175153
72 Ga0065165_1000160 3300005262 Bacteria 116908
73 Ga0065165_1004819 3300005262 Bacteria 8031
74 Ga0065165_1010462 3300005262 Bacteria 4005
75 Ga0065165_1038647 3300005262 Bacteria 1437
76 Ga0070658_10084741 3300005327 Bacteria 2606
77 Ga0070658_10507521 3300005327 Bacteria 1042
78 Ga0070670_100000091 3300005331 Bacteria 85664
79 Ga0070666_10414433 3300005335 Bacteria 970
80 Ga0070663_100061340 3300005455 Bacteria 2708
81 Ga0070662_100282860 3300005457 Bacteria 1343
82 Ga0070665_100085721 3300005548 Bacteria 3156
83 Ga0070665_100127474 3300005548 Bacteria 2547
84 Ga0070665_100318075 3300005548 Bacteria 1560
85 Ga0070665_100427913 3300005548 Bacteria 1333
86 Ga0068855_100077744 3300005563 Bacteria 3850
87 Ga0068855_100158898 3300005563 Bacteria 2566
88 Ga0068855_100168949 3300005563 Bacteria 2477
89 Ga0068856_100014552 3300005614 Bacteria 7603
90 Ga0068856_100115886 3300005614 Bacteria 2679
91 Ga0068852_100059893 3300005616 Bacteria 3304
92 Ga0068852_100313587 3300005616 Bacteria 1521
93 Ga0081540_1033097 3300005983 Bacteria 2812
94 Ga0075365_10000172 3300006038 Bacteria 20817
95 Ga0075365_10001466 3300006038 Bacteria 10717
96 Ga0075365_10025992 3300006038 Bacteria 3711
97 Ga0075365_10026133 3300006038 Bacteria 3703
98 Ga0075365_10205622 3300006038 Bacteria 1380
99 Ga0075365_10362670 3300006038 Bacteria 1022
100 Ga0075368_10016305 3300006042 Bacteria 2769
101 Ga0075368_10036990 3300006042 Bacteria 1908
102 Ga0075363_100028079 3300006048 Bacteria 2891
103 Ga0075363_100087992 3300006048 Bacteria 1707
104 Ga0075363_100147532 3300006048 Bacteria 1327
105 Ga0075363_100212230 3300006048 Bacteria 1108
106 Ga0075364_10005092 3300006051 Bacteria 7617
107 Ga0075364_10151592 3300006051 Bacteria 1562
108 Ga0075364_10203081 3300006051 Bacteria 1343
109 Ga0075362_10001315 3300006177 Bacteria 7871
110 Ga0075362_10014772 3300006177 Bacteria 3160
111 Ga0075362_10019696 3300006177 Bacteria 2810
112 Ga0075362_10060749 3300006177 Bacteria 1709
113 Ga0075367_10000610 3300006178 Bacteria 13715
114 Ga0075367_10010220 3300006178 Bacteria 4923
115 Ga0075369_10009522 3300006186 Bacteria 3777
116 Ga0075369_10015575 3300006186 Bacteria 3055
117 Ga0075369_10035877 3300006186 Bacteria 2109
118 Ga0075369_10199926 3300006186 Bacteria 922
119 Ga0075366_10020620 3300006195 Bacteria 3826
120 Ga0075366_10071119 3300006195 Bacteria 2073
121 Ga0075370_10024328 3300006353 Bacteria 3344
122 Ga0075370_10060832 3300006353 Bacteria 2152
123 Ga0075370_10083295 3300006353 Bacteria 1840
124 Ga0068871_100558134 3300006358 Bacteria 1038
125 Ga0099826_10046495 3300006948 Bacteria 2957
126 Ga0105251_10063362 3300009011 Bacteria 1735
127 Ga0105250_10028565 3300009092 Bacteria 2246
128 Ga0105240_10447998 3300009093 Bacteria 1445
129 Ga0105240_10466817 3300009093 Bacteria 1409
130 Ga0105243_10044145 3300009148 Bacteria 3495
131 Ga0105243_10335769 3300009148 Bacteria 1382
132 Ga0105243_10400100 3300009148 Bacteria 1275
133 Ga0105241_10279619 3300009174 Bacteria 1425
134 Ga0105237_10093671 3300009545 Bacteria 2993
135 Ga0105237_10202804 3300009545 Bacteria 1984
136 Ga0105237_10481706 3300009545 Bacteria 1247
137 Ga0105238_10240918 3300009551 Bacteria 1786
138 Ga0123342_1013959 3300009766 Bacteria 7848
139 Ga0105239_10081004 3300010375 Bacteria 3573
140 Ga0105239_10098741 3300010375 Bacteria 3228
141 Ga0105239_10748260 3300010375 Bacteria 1119
142 Ga0105246_10161217 3300011119 Bacteria 1708
143 Ga0157371_10284446 3300013102 Bacteria 1195
144 Ga0157370_10066457 3300013104 Bacteria 3410
145 Ga0157370_10071003 3300013104 Bacteria 3286
146 Ga0157369_10399495 3300013105 Bacteria 1426
147 Ga0157378_10175215 3300013297 Bacteria 2014
148 Ga0157378_10761791 3300013297 Bacteria 991
149 Ga0163162_10227863 3300013306 Bacteria 1994
150 Ga0163162_10311892 3300013306 Bacteria 1705
151 Ga0182008_10013713 3300014497 Bacteria 4259
152 Ga0157376_10471664 3300014969 Bacteria 1228
153 Ga0182005_1004600 3300015265 Bacteria 4428
154 Ga0214544_1002772 3300021320 Bacteria 36640
155 Ga0214542_1001092 3300021321 Bacteria 54418
156 Ga0214542_1017459 3300021321 Bacteria 6471
157 Ga0214543_1000025 3300021327 Bacteria 225351
158 Ga0214543_1009334 3300021327 Bacteria 15337
159 Ga0228711_1000005 3300022739 Bacteria 215594
160 Ga0228710_1000018 3300022740 Bacteria 118600
161 Ga0209435_100006 3300025206 Bacteria 542459
162 Ga0209435_100043 3300025206 Bacteria 102049
163 Ga0209435_100050 3300025206 Bacteria 91356
164 Ga0209436_100133 3300025208 Bacteria 36901
165 Ga0209436_100661 3300025208 Bacteria 14676
166 Ga0209436_108885 3300025208 Bacteria 1956
167 Ga0209672_102334 3300025228 Bacteria 4796
168 Ga0209147_100011 3300025229 Bacteria 702140
169 Ga0209437_100062 3300025233 Bacteria 336900
170 Ga0209437_100259 3300025233 Bacteria 82489
171 Ga0209437_100281 3300025233 Bacteria 74945
172 Ga0209258_100385 3300025242 Bacteria 56396
173 Ga0207425_1000018 3300025245 Bacteria 411841
174 Ga0207425_1003306 3300025245 Bacteria 5222
175 Ga0209646_1000015 3300025246 Bacteria 542459
176 Ga0209646_1000161 3300025246 Bacteria 91356
177 Ga0209646_1002525 3300025246 Bacteria 4003
178 Ga0209026_1000046 3300025250 Bacteria 262031
179 Ga0209026_1000173 3300025250 Bacteria 98585
180 Ga0209026_1000327 3300025250 Bacteria 48226
181 Ga0209677_102857 3300025253 Bacteria 6087
182 Ga0209148_1000078 3300025254 Bacteria 296101
183 Ga0209759_1000005 3300025256 Bacteria 542459
184 Ga0209759_1000169 3300025256 Bacteria 110110
185 Ga0209759_1000321 3300025256 Bacteria 63590
186 Ga0209129_1000019 3300025258 Bacteria 460802
187 Ga0209129_1000026 3300025258 Bacteria 411839
188 Ga0209129_1000355 3300025258 Bacteria 38491
189 Ga0209129_1005510 3300025258 Bacteria 4446
190 Ga0209129_1009076 3300025258 Bacteria 2672
191 Ga0209233_1000082 3300025261 Bacteria 336320
192 Ga0209233_1000267 3300025261 Bacteria 74945
193 Ga0209455_1000193 3300025272 Bacteria 90413
194 Ga0209455_1007742 3300025272 Bacteria 2994
195 Ga0209673_1000132 3300025273 Bacteria 162349
196 Ga0209673_1000294 3300025273 Bacteria 93050
197 Ga0209673_1000769 3300025273 Bacteria 43317
198 Ga0209673_1004058 3300025273 Bacteria 8094
199 Ga0209673_1009831 3300025273 Bacteria 4097
200 Ga0209673_1020714 3300025273 Bacteria 2321
201 Ga0209130_1000019 3300025284 Bacteria 381993
202 Ga0209130_1000048 3300025284 Bacteria 233357
203 Ga0209130_1000136 3300025284 Bacteria 116996
204 Ga0209130_1000880 3300025284 Bacteria 24560
205 Ga0209025_1000035 3300025294 Bacteria 411841
206 Ga0209025_1000086 3300025294 Bacteria 262586
207 Ga0209025_1000260 3300025294 Bacteria 124240
208 Ga0209025_1000429 3300025294 Bacteria 83306
209 Ga0209025_1001953 3300025294 Bacteria 23804
210 Ga0209025_1002615 3300025294 Bacteria 18501
211 Ga0209025_1033127 3300025294 Bacteria 2396
212 Ga0209564_1000336 3300025295 Bacteria 90930
213 Ga0209564_1003025 3300025295 Bacteria 12006
214 Ga0209564_1004439 3300025295 Bacteria 8589
215 Ga0209564_1015925 3300025295 Bacteria 3031
216 Ga0209564_1024109 3300025295 Bacteria 2088
217 Ga0209758_1000040 3300025297 Bacteria 411841
218 Ga0209758_1000113 3300025297 Bacteria 202528
219 Ga0209758_1001643 3300025297 Bacteria 25398
220 Ga0209758_1001704 3300025297 Bacteria 24679
221 Ga0209758_1001926 3300025297 Bacteria 22572
222 Ga0209758_1003645 3300025297 Bacteria 13739
223 Ga0209050_1027588 3300025298 Bacteria 1867
224 Ga0209256_1000406 3300025299 Bacteria 68202
225 Ga0209256_1000458 3300025299 Bacteria 61611
226 Ga0209256_1002794 3300025299 Bacteria 13381
227 Ga0209256_1003916 3300025299 Bacteria 9837
228 Ga0209256_1005862 3300025299 Bacteria 6811
229 Ga0209256_1033673 3300025299 Bacteria 1374
230 Ga0207426_1000005 3300025302 Bacteria 1037188
231 Ga0207426_1000085 3300025302 Bacteria 293171
232 Ga0207426_1000136 3300025302 Bacteria 201401
233 Ga0207426_1000253 3300025302 Bacteria 116996
234 Ga0207426_1000282 3300025302 Bacteria 104108
235 Ga0207426_1001460 3300025302 Bacteria 19554
236 Ga0209051_1000027 3300025303 Bacteria 412172
237 Ga0209051_1000683 3300025303 Bacteria 37689
238 Ga0209051_1009482 3300025303 Bacteria 5012
239 Ga0209051_1031954 3300025303 Bacteria 2016
240 Ga0209051_1033827 3300025303 Bacteria 1925
241 Ga0209257_1002682 3300025304 Bacteria 17053
242 Ga0209257_1045051 3300025304 Bacteria 1283
243 Ga0207697_10112743 3300025315 Bacteria 1165
244 Ga0207647_10094323 3300025904 Bacteria 1783
245 Ga0207647_10109953 3300025904 Bacteria 1630
246 Ga0207645_10233473 3300025907 Bacteria 1214
247 Ga0207654_10185523 3300025911 Bacteria 1360
248 Ga0207695_10001787 3300025913 Bacteria 33929
249 Ga0207695_10073535 3300025913 Bacteria 3483
250 Ga0207695_10092791 3300025913 Bacteria 3029
251 Ga0207695_10242221 3300025913 Bacteria 1704
252 Ga0207671_10001180 3300025914 Bacteria 31086
253 Ga0207671_10093157 3300025914 Bacteria 2272
254 Ga0207671_10427833 3300025914 Bacteria 1053
255 Ga0207657_10084423 3300025919 Bacteria 2661
256 Ga0207681_10107413 3300025923 Bacteria 2024
257 Ga0207694_10438262 3300025924 Bacteria 1090
258 Ga0207650_10000723 3300025925 Bacteria 25614
259 Ga0207644_10081718 3300025931 Bacteria 2389
260 Ga0207709_10031495 3300025935 Bacteria 3098
261 Ga0207667_10011758 3300025949 Bacteria 10150
262 Ga0207667_10151194 3300025949 Bacteria 2389
263 Ga0207640_10031700 3300025981 Bacteria 3269
264 Ga0207639_10030476 3300026041 Bacteria 3956
265 Ga0207678_10109651 3300026067 Bacteria 2354
266 Ga0207678_10118778 3300026067 Bacteria 2256
267 Ga0207702_10187823 3300026078 Bacteria 1907
268 Ga0207648_10213992 3300026089 Bacteria 1711
269 Ga0209281_1000111 3300027111 Bacteria 215615
270 Ga0209281_1000324 3300027111 Bacteria 84060
271 Ga0209371_1001530 3300027312 Bacteria 15320
272 Ga0209282_1000012 3300027666 Bacteria 215614
273 Ga0209813_10001917 3300027866 Bacteria 4688
274 Ga0268266_10237125 3300028379 Bacteria 1682
275 Ga0268266_10502036 3300028379 Bacteria 1158
276 Ga0268266_10660093 3300028379 Bacteria 1007
277 Ga0307515_10000600 3300028794 Bacteria 83981
278 Ga0307515_10009781 3300028794 Bacteria 18477
279 Ga0307515_10020996 3300028794 Bacteria 11605
280 Ga0268256_1008348 3300030500 Bacteria 3558
281 Ga0307513_10011937 3300031456 Bacteria 10755
282 Ga0307513_10047322 3300031456 Bacteria 4680
283 Ga0307516_10082289 3300031730 Bacteria 3061
284 Ga0307405_10008618 3300031731 Bacteria 5182
285 Ga0307412_10092257 3300031911 Bacteria 2122
286 Ga0315914_1000007 3300031967 Bacteria 215597
287 Ga0307409_100124291 3300031995 Bacteria 2192
288 Ga0307510_10117355 3300033180 Bacteria 2379
289 Ga0307510_10135414 3300033180 Bacteria 2122
290 Ga0315913_1000003 3300033430 Bacteria 215608
291 Ga0315915_1000011 3300033464 Bacteria 215597
292 Ga0373935_0170708 3300035692 Bacteria 1488
293 Ga0395900_0114319 3300037418 Bacteria 2770
294 Ga0395905_0002837 3300037471 Bacteria 18981
295 Ga0395905_0014703 3300037471 Bacteria 7464
296 Ga0395901_0487128 3300038443 Bacteria 1257
297 Ga0400483_053333 3300039062 Bacteria 4251
298 Ga0400483_207099 3300039062 Bacteria 1889
299 Ga0400483_248197 3300039062 Bacteria 15606
300 Ga0436361_0461858 3300039447 Bacteria 1249
301 Ga0439465_0007152 3300041413 Bacteria 3548
302 Ga0439465_0084896 3300041413 Bacteria 1077
303 Ga0451807_0129412 3300041486 Bacteria 1394
304 Ga0451833_0686416 3300041491 Bacteria 1333
305 Ga0451837_0068141 3300041494 Bacteria 1880
306 Ga0451839_1281927 3300041496 Bacteria 1113
307 Ga0451845_0137671 3300041501 Bacteria 3871
308 Ga0451849_0442680 3300041505 Bacteria 1094
309 Ga0450911_000950 3300042115 Bacteria 7568
310 Ga0466970_0024161 3300044765 Bacteria 3177
311 Ga0466958_0105608 3300045836 Bacteria 1755
312 Ga0466967_0064933 3300045976 Bacteria 3248
313 Ga0495638_0010418 3300046460 Bacteria 6457
314 Ga0495638_0016913 3300046460 Bacteria 4875
315 Ga0495638_0036817 3300046460 Bacteria 3115
316 Ga0495638_0057351 3300046460 Bacteria 2415
317 Ga0495582_0104979 3300046473 Bacteria 1584
318 Ga0495605_0010332 3300046474 Bacteria 5226
319 Ga0495662_0007048 3300046476 Bacteria 5583
320 Ga0495585_0043690 3300046492 Bacteria 2505
321 Ga0495585_0057352 3300046492 Bacteria 2149
322 Ga0495607_0048625 3300046501 Bacteria 2479
323 Ga0495583_0007023 3300046506 Bacteria 7203
324 Ga0495606_0070429 3300046507 Bacteria 2205
325 Ga0495610_0039308 3300046512 Bacteria 2394
326 Ga0495610_0093831 3300046512 Bacteria 1355
327 Ga0495616_0022870 3300046513 Bacteria 3370
328 Ga0495632_0000580 3300046519 Bacteria 33943
329 Ga0495632_0050768 3300046519 Bacteria 2044
330 Ga0495632_0136501 3300046519 Bacteria 1140
331 Ga0495643_0050726 3300046522 Bacteria 2234
332 Ga0495643_0063215 3300046522 Bacteria 1958
333 Ga0495648_0149659 3300046524 Bacteria 1219
334 Ga0495587_0053800 3300046536 Bacteria 2373
335 Ga0495622_0054120 3300046557 Bacteria 1862
336 Ga0495633_0056048 3300046558 Bacteria 1852
337 Ga0495633_0112875 3300046558 Bacteria 1260
338 Ga0495668_0005998 3300046616 Bacteria 8065
339 Ga0495668_0026359 3300046616 Bacteria 3299
340 Ga0495668_0061969 3300046616 Bacteria 2062
341 Ga0495611_0055176 3300046648 Bacteria 1797
342 Ga0495625_0005332 3300046660 Bacteria 11778
343 Ga0495625_0156277 3300046660 Bacteria 1530
344 Ga0495625_0177144 3300046660 Bacteria 1420
345 Ga0495625_0192444 3300046660 Bacteria 1350
346 Ga0495588_0046862 3300046674 Bacteria 2218
347 Ga0495588_0202711 3300046674 Bacteria 1048
348 Ga0495657_0041489 3300046675 Bacteria 3148
349 Ga0495670_0089120 3300046691 Bacteria 1578
350 Ga0495649_0078547 3300046694 Bacteria 1766
351 Ga0495600_0044239 3300046809 Bacteria 2905
352 Ga0495660_0129272 3300046810 Bacteria 1269
353 Ga0495604_0298541 3300047317 Bacteria 1082
354 Ga0495672_0033153 3300047320 Bacteria 3203
355 Ga0495687_048937 3300047443 Bacteria 1810
356 Ga0495686_0000090 3300047472 Bacteria 193179
357 Ga0495686_0028957 3300047472 Bacteria 3605
358 Ga0495686_0179551 3300047472 Bacteria 1227
359 Ga0495626_0036637 3300048091 Bacteria 2336
360 Ga0496100_0077211 3300048903 Bacteria 2238
361 Ga0496101_0195619 3300048904 Bacteria 1562
362 Ga0496102_0006548 3300048905 Bacteria 9945
363 Ga0496102_0096533 3300048905 Bacteria 2740
364 Ga0496102_0233839 3300048905 Bacteria 1733
365 Ga0496104_0006663 3300048907 Bacteria 10165
366 Ga0496105_0013397 3300048908 Bacteria 6507
367 Ga0496106_0010859 3300048909 Bacteria 6729
368 Ga0496110_0068147 3300048913 Bacteria 3149
369 Ga0496112_0138438 3300048915 Bacteria 2404
370 Ga0496113_0134848 3300048916 Bacteria 1939
371 Ga0496113_0381006 3300048916 Bacteria 1132
372 Ga0496114_0080049 3300048917 Bacteria 2759
373 Ga0496116_0012255 3300048919 Bacteria 7012
374 Ga0496116_0015393 3300048919 Bacteria 6046
375 Ga0496116_0029090 3300048919 Bacteria 3989
376 Ga0496116_0124313 3300048919 Bacteria 1485
377 Ga0496118_0023323 3300048921 Bacteria 5378
378 Ga0496118_0035125 3300048921 Bacteria 4076
379 Ga0496118_0199529 3300048921 Bacteria 1187
380 Ga0496119_0005459 3300048922 Bacteria 12172
381 Ga0496119_0109201 3300048922 Bacteria 1538
382 Ga0496120_0027697 3300048923 Bacteria 3481
383 Ga0496121_0033217 3300048924 Bacteria 4673
384 Ga0496121_0042909 3300048924 Bacteria 3925
385 Ga0496121_0057064 3300048924 Bacteria 3239
386 Ga0496121_0064534 3300048924 Bacteria 2985
387 Ga0496121_0108000 3300048924 Bacteria 2129
388 Ga0496121_0141279 3300048924 Bacteria 1786
389 Ga0496121_0257131 3300048924 Bacteria 1208
390 Ga0496122_0000032 3300048925 Bacteria 327099
391 Ga0496122_0012353 3300048925 Bacteria 8520
392 Ga0496122_0015169 3300048925 Bacteria 7384
393 Ga0496122_0051078 3300048925 Bacteria 3146
394 Ga0496122_0054557 3300048925 Bacteria 3000
395 Ga0496123_0000093 3300048926 Bacteria 179205
396 Ga0496123_0042260 3300048926 Bacteria 3148
397 Ga0496123_0060381 3300048926 Bacteria 2445
398 Ga0496123_0069607 3300048926 Bacteria 2208
399 Ga0496123_0125794 3300048926 Bacteria 1431
400 Ga0496123_0154125 3300048926 Bacteria 1235
401 Ga0496124_0000462 3300048927 Bacteria 70383
402 Ga0496124_0033583 3300048927 Bacteria 4512
403 Ga0496124_0037008 3300048927 Bacteria 4248
404 Ga0496124_0058531 3300048927 Bacteria 3240
405 Ga0496124_0062278 3300048927 Bacteria 3122
406 Ga0496124_0062682 3300048927 Bacteria 3110
407 Ga0496124_0211750 3300048927 Bacteria 1466
408 Ga0496124_0223496 3300048927 Bacteria 1414
409 Ga0496125_0000041 3300048928 Bacteria 310158
410 Ga0496125_0000256 3300048928 Bacteria 109696
411 Ga0496125_0035663 3300048928 Bacteria 4357
412 Ga0496125_0065455 3300048928 Bacteria 2879
413 Ga0496126_0000299 3300048929 Bacteria 105208
414 Ga0496126_0031652 3300048929 Bacteria 4993
415 Ga0496126_0059530 3300048929 Bacteria 3439
416 Ga0496126_0205133 3300048929 Bacteria 1662
417 Ga0496126_0436567 3300048929 Bacteria 1056
418 Ga0501031_0042691 3300049568 Bacteria 2959
419 Ga0501032_0002804 3300049569 Bacteria 13554
420 Ga0501033_0000230 3300049570 Bacteria 53911
421 Ga0501033_0003721 3300049570 Bacteria 12406
422 Ga0501033_0034559 3300049570 Bacteria 3791
423 Ga0501033_0133747 3300049570 Bacteria 1795
424 Ga0501034_0006050 3300049571 Bacteria 13067
425 Ga0501034_0157348 3300049571 Bacteria 2245
426 Ga0501036_0003490 3300049572 Bacteria 12566
427 Ga0501036_0013901 3300049572 Bacteria 6694
428 Ga0501036_0097039 3300049572 Bacteria 2492
429 Ga0501037_0000168 3300049573 Bacteria 61484
430 Ga0501037_0006255 3300049573 Bacteria 8703
431 Ga0501037_0081368 3300049573 Bacteria 2348
432 Ga0501037_0220950 3300049573 Bacteria 1333
433 Ga0501038_0037392 3300049574 Bacteria 4256
434 Ga0501039_0002578 3300049575 Bacteria 13540
435 Ga0501039_0003147 3300049575 Bacteria 12348
436 Ga0501040_0046610 3300049576 Bacteria 2959
437 Ga0501041_0047053 3300049577 Bacteria 2625
438 Ga0501042_0074543 3300049578 Bacteria 2429
439 Ga0501043_0000005 3300049579 Bacteria 254466
440 Ga0501043_0003499 3300049579 Bacteria 12912
441 Ga0501043_0020903 3300049579 Bacteria 5133
442 Ga0501043_0244018 3300049579 Bacteria 1385
443 Ga0501046_0001795 3300049580 Bacteria 20473
444 Ga0501046_0107718 3300049580 Bacteria 2132
445 Ga0501047_0003954 3300049581 Bacteria 13934
446 Ga0501047_0091469 3300049581 Bacteria 2921
447 Ga0501047_0165623 3300049581 Bacteria 2081
448 Ga0501047_0219239 3300049581 Bacteria 1759
449 Ga0501047_0335658 3300049581 Bacteria 1350
450 Ga0501048_0053391 3300049582 Bacteria 2874
451 Ga0501048_0084355 3300049582 Bacteria 2240
452 Ga0501068_0054375 3300049584 Bacteria 2425
453 Ga0501069_0000011 3300049585 Bacteria 153214
454 Ga0501070_0000055 3300049586 Bacteria 99156
455 Ga0501070_0041312 3300049586 Bacteria 3842
456 Ga0501071_0021385 3300049587 Bacteria 4504
457 Ga0501071_0256306 3300049587 Bacteria 1321
458 Ga0501073_0006917 3300049589 Bacteria 8445
459 Ga0501074_0000039 3300049590 Bacteria 60866
460 Ga0501075_0042175 3300049591 Bacteria 3421
461 Ga0501077_0237820 3300049593 Bacteria 1158
462 Ga0501080_0003073 3300049742 Bacteria 14742
463 Ga0501080_0094202 3300049742 Bacteria 2781
464 Ga0501080_0243924 3300049742 Bacteria 1639
465 Ga0501083_0000180 3300049744 Bacteria 40737
466 Ga0501083_0013857 3300049744 Bacteria 5636
467 Ga0501035_0000938 3300049822 Bacteria 30768
468 Ga0501035_0003248 3300049822 Bacteria 15578
469 Ga0501044_0001322 3300049823 Bacteria 29176
470 Ga0501044_0093752 3300049823 Bacteria 3027
471 Ga0501044_0153060 3300049823 Bacteria 2288
472 Ga0501044_0261919 3300049823 Bacteria 1667
473 Ga0501045_0051923 3300049824 Bacteria 2992
474 Ga0501045_0061123 3300049824 Bacteria 2763
475 Ga0501045_0299384 3300049824 Bacteria 1197
476 nmdc:mga03683_37146_c1 3300050489 Bacteria 1984
477 nmdc:mga00v17_47269_c1 3300050491 Bacteria 2606
478 nmdc:mga00v17_92493_c1 3300050491 Bacteria 1901
479 nmdc:mga0yw44_61545_c1 3300050492 Bacteria 2304
480 nmdc:mga0yw44_7008_c1 3300050492 Bacteria 5512
481 nmdc:mga0k408_164931_c1 3300050493 Bacteria 1320
482 nmdc:mga0k408_249901_c1 3300050493 Bacteria 1059
483 nmdc:mga06z11_73582_c1 3300050494 Bacteria 1815
484 nmdc:mga06z11_9009_c1 3300050494 Bacteria 4191
485 nmdc:mga04h51_2629_c1 3300050495 Bacteria 4276
486 nmdc:mga07m45_325388_c1 3300050496 Bacteria 894
487 nmdc:mga0sz30_20678_c1 3300050516 Bacteria 2656
488 nmdc:mga0sz30_5210_c1 3300050516 Bacteria 4758
489 Ga0500610_0178789 3300053079 Bacteria 1041
490 Ga0495655_0019354 3300053083 Bacteria 1511
491 Ga0495619_0027540 3300053085 Bacteria 3661
492 Ga0500578_0208189 3300053086 Bacteria 1194
493 Ga0500557_004079 3300053105 Bacteria 3008
494 Ga0500569_045854 3300053109 Bacteria 1300
495 Ga0500608_051256 3300053122 Bacteria 1983
496 Ga0500618_000870 3300053125 Bacteria 16127
497 Ga0500618_016039 3300053125 Bacteria 1882
498 Ga0500658_0008530 3300053134 Bacteria 3784
499 Ga0500568_0000070 3300053139 Bacteria 99663
500 Ga0500568_0006143 3300053139 Bacteria 6076
501 Ga0500568_0014722 3300053139 Bacteria 3521
502 Ga0500590_017148 3300053148 Bacteria 3744
503 Ga0500616_0047310 3300053153 Bacteria 2284
504 Ga0500620_001067 3300053155 Bacteria 4839
505 Ga0500622_0000207 3300053156 Bacteria 62384
506 Ga0500627_0024448 3300053158 Bacteria 2473
507 Ga0500627_0038432 3300053158 Bacteria 2046
508 Ga0500627_0062772 3300053158 Bacteria 1636
509 Ga0500636_0259783 3300053177 Bacteria 880
510 Ga0500611_033516 3300053727 Bacteria 1081
511 Ga0500611_046080 3300053727 Bacteria 979
512 Ga0500645_011310 3300053730 Bacteria 2919
513 Ga0501084_0109316 3300054114 Bacteria 2323
514 Ga0501084_0389354 3300054114 Bacteria 1178
515 Ga0501082_0501350 3300060353 Bacteria 1061

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0034559 Ga0501033_0034559_12_743 243
2 3300026041 Ga0207639_10030476 Ga0207639_100304762 245
3 iso_pu_bacteria 2585427530 2585557648 254
4 3300028379 Ga0268266_10660093 Ga0268266_106600932 255
5 3300041413 Ga0439465_0084896 Ga0439465_0084896_26_853 255
6 3300053139 Ga0500568_0000070 Ga0500568_0000070_60960_61856 255
7 3300006048 Ga0075363_100212230 Ga0075363_1002122302 257
8 iso_pu_bacteria 2615840626 2616312245 257
9 3300031731 Ga0307405_10008618 Ga0307405_100086185 259
10 iso_pu_bacteria 3004289098 3004293291 259
11 3300005331 Ga0070670_100000091 Ga0070670_10000009119 263
12 3300005614 Ga0068856_100014552 Ga0068856_1000145522 263
13 3300025233 Ga0209437_100062 Ga0209437_100062233 263
14 3300025261 Ga0209233_1000082 Ga0209233_1000082233 263
15 3300025925 Ga0207650_10000723 Ga0207650_1000072320 263
16 3300049581 Ga0501047_0335658 Ga0501047_0335658_518_1309 263
17 3300053079 Ga0500610_0178789 Ga0500610_0178789_231_1022 263
18 3300053158 Ga0500627_0024448 Ga0500627_0024448_401_1192 263
19 3300060353 Ga0501082_0501350 Ga0501082_0501350_248_1039 263
20 iso_pu_bacteria 2960624210 2960625641 264
21 3300046660 Ga0495625_0192444 Ga0495625_0192444_158_985 266
22 3300002704 JGI25155J39150_1000039 JGI25155J39150_100003975 268
23 3300002705 JGI25156J39149_1000427 JGI25156J39149_100042718 268
24 3300002738 JGI25154J39366_1000077 JGI25154J39366_100007775 268
25 3300002741 JGI25157J39369_1000065 JGI25157J39369_100006575 268
26 3300003758 Ga0055532_1000005 Ga0055532_1000005381 268
27 3300003761 Ga0055535_1010294 Ga0055535_10102942 268
28 3300005563 Ga0068855_100077744 Ga0068855_1000777442 268
29 3300025206 Ga0209435_100043 Ga0209435_10004329 268
30 3300025206 Ga0209435_100050 Ga0209435_10005067 268
31 3300025229 Ga0209147_100011 Ga0209147_10001154 268
32 3300025233 Ga0209437_100259 Ga0209437_10025955 268
33 3300025242 Ga0209258_100385 Ga0209258_10038540 268
34 3300025246 Ga0209646_1000161 Ga0209646_100016167 268
35 3300025250 Ga0209026_1000173 Ga0209026_100017328 268
36 3300025256 Ga0209759_1000169 Ga0209759_100016990 268
37 3300025949 Ga0207667_10011758 Ga0207667_100117584 268
38 3300048919 Ga0496116_0029090 Ga0496116_0029090_1446_2282 268
39 3300048924 Ga0496121_0042909 Ga0496121_0042909_379_1215 268
40 3300048928 Ga0496125_0000256 Ga0496125_0000256_45044_45874 268
41 3300053125 Ga0500618_000870 Ga0500618_000870_8750_9583 268
42 3300053177 Ga0500636_0259783 Ga0500636_0259783_25_858 268
43 iso_pu_bacteria 2551306093 2551744330 269
44 iso_pu_bacteria 2512875026 2512968959 270
45 iso_pu_bacteria 2513237089 2513605979 270
46 iso_pu_bacteria 2513237156 2513985133 270
47 iso_pu_bacteria 2513237160 2514005988 270
48 iso_pu_bacteria 2517487022 2517566288 270
49 iso_pu_bacteria 2802428858 2802719808 270
50 iso_pu_bacteria 2802428859 2802727811 270
51 iso_pu_bacteria 2802428860 2802733311 270
52 iso_pu_bacteria 2802428861 2802738867 270
53 iso_pu_bacteria 2802428862 2802745534 270
54 iso_pu_bacteria 2802428863 2802751299 270
55 iso_pu_bacteria 2889790730 2889794632 270
56 iso_pu_bacteria 2915980308 2915984089 270
57 iso_pu_bacteria 2916061851 2916063398 270
58 iso_pu_bacteria 2921250672 2921256624 270
59 iso_pu_bacteria 2937029754 2937033211 270
60 iso_pu_bacteria 2937036028 2937037660 270
61 iso_pu_bacteria 2937078374 2937084500 270
62 iso_pu_bacteria 2937084907 2937087079 270
63 iso_pu_bacteria 2937843397 2937847707 270
64 iso_pu_bacteria 2957375807 2957381252 270
65 iso_pu_bacteria 2957437181 2957437750 270
66 iso_pu_bacteria 2960591022 2960596910 270
67 iso_pu_bacteria 2960631154 2960631588 270
68 iso_pu_bacteria 2960680706 2960684739 270
69 iso_pu_bacteria 2960693952 2960699898 270
70 iso_pu_bacteria 2967686174 2967689422 270
71 iso_pu_bacteria 2967728569 2967730765 270
72 iso_pu_bacteria 2970026789 2970028550 270
73 iso_pu_bacteria 2970122695 2970125586 270
74 iso_pu_bacteria 2970143518 2970146100 270
75 iso_pu_bacteria 2977530762 2977534819 270
76 iso_pu_bacteria 2977544691 2977545335 270
77 iso_pu_bacteria 8003999396 8004004758 270
78 iso_pu_bacteria 2503198000 2503203827 271
79 iso_pu_bacteria 2508501122 2509110453 271
80 iso_pu_bacteria 2508501123 2509117356 271
81 iso_pu_bacteria 2508501127 2509141383 271
82 iso_pu_bacteria 2509276018 2509369193 271
83 iso_pu_bacteria 2509276019 2509379468 271
84 iso_pu_bacteria 2509276021 2509391087 271
85 iso_pu_bacteria 2509276022 2509398188 271
86 iso_pu_bacteria 2510065019 2510135979 271
87 iso_pu_bacteria 2510065059 2510316915 271
88 iso_pu_bacteria 2510461076 2510892521 271
89 iso_pu_bacteria 2510917022 2511135542 271
90 iso_pu_bacteria 2510917028 2511181541 271
91 iso_pu_bacteria 2510917030 2511197367 271
92 iso_pu_bacteria 2511231052 2511497028 271
93 iso_pu_bacteria 2512047086 2512529482 271
94 iso_pu_bacteria 2512875016 2512929124 271
95 iso_pu_bacteria 2512875024 2512963928 271
96 iso_pu_bacteria 2513237084 2513568282 271
97 iso_pu_bacteria 2513237085 2513578177 271
98 iso_pu_bacteria 2513237086 2513582800 271
99 iso_pu_bacteria 2513237090 2513611303 271
100 iso_pu_bacteria 2513237091 2513614857 271
101 iso_pu_bacteria 2513237093 2513634814 271
102 iso_pu_bacteria 2513237103 2513713824 271
103 iso_pu_bacteria 2513237138 2513866138 271
104 iso_pu_bacteria 2513237143 2513901692 271
105 iso_pu_bacteria 2513237144 2513911974 271
106 iso_pu_bacteria 2513237146 2513923741 271
107 iso_pu_bacteria 2513237159 2514000818 271
108 iso_pu_bacteria 2513237162 2514021918 271
109 iso_pu_bacteria 2513237164 2514035804 271
110 iso_pu_bacteria 2513237305 2514421669 271
111 iso_pu_bacteria 2515075009 2515109079 271
112 iso_pu_bacteria 2515154107 2515609823 271
113 iso_pu_bacteria 2515154107 2515611604 271
114 iso_pu_bacteria 2515154113 2515632416 271
115 iso_pu_bacteria 2515154114 2515640697 271
116 iso_pu_bacteria 2515154116 2515661635 271
117 iso_pu_bacteria 2515154134 2515737895 271
118 iso_pu_bacteria 2516653046 2516895742 271
119 iso_pu_bacteria 2516653077 2517041407 271
120 iso_pu_bacteria 2516653085 2517079958 271
121 iso_pu_bacteria 2517093000 2517097979 271
122 iso_pu_bacteria 2517287029 2517410235 271
123 iso_pu_bacteria 2524023209 2524459256 271
124 iso_pu_bacteria 2524023209 2524461761 271
125 iso_pu_bacteria 2529292951 2530648504 271
126 iso_pu_bacteria 2534681796 2535520236 271
127 iso_pu_bacteria 2551306084 2551678791 271
128 iso_pu_bacteria 2551306084 2551682029 271
129 iso_pu_bacteria 2551306085 2551683341 271
130 iso_pu_bacteria 2551306086 2551696792 271
131 iso_pu_bacteria 2551306087 2551700835 271
132 iso_pu_bacteria 2551306089 2551714346 271
133 iso_pu_bacteria 2551306091 2551727744 271
134 iso_pu_bacteria 2551306092 2551735836 271
135 iso_pu_bacteria 2558860100 2558861403 271
136 iso_pu_bacteria 2558860100 2558867051 271
137 iso_pu_bacteria 2582581283 2585167125 271
138 iso_pu_bacteria 2582581294 2585200684 271
139 iso_pu_bacteria 2582581298 2585226822 271
140 iso_pu_bacteria 2582581299 2585230294 271
141 iso_pu_bacteria 2582581304 2585255268 271
142 iso_pu_bacteria 2582581306 2585270261 271
143 iso_pu_bacteria 2582581307 2585272617 271
144 iso_pu_bacteria 2582581308 2585281177 271
145 iso_pu_bacteria 2582581308 2585283014 271
146 iso_pu_bacteria 2582581315 2585327263 271
147 iso_pu_bacteria 2582581315 2585328653 271
148 iso_pu_bacteria 2582581316 2585335258 271
149 iso_pu_bacteria 2582581316 2585335570 271
150 iso_pu_bacteria 2582581865 2585390483 271
151 iso_pu_bacteria 2582581866 2585397990 271
152 iso_pu_bacteria 2582581867 2585404751 271
153 iso_pu_bacteria 2585427526 2585525802 271
154 iso_pu_bacteria 2585427528 2585541652 271
155 iso_pu_bacteria 2585427529 2585550237 271
156 iso_pu_bacteria 2585427531 2585562285 271
157 iso_pu_bacteria 2585427590 2585823390 271
158 iso_pu_bacteria 2585427593 2585840129 271
159 iso_pu_bacteria 2585427594 2585842654 271
160 iso_pu_bacteria 2585427608 2585896721 271
161 iso_pu_bacteria 2585427609 2585906548 271
162 iso_pu_bacteria 2585428125 2587981970 271
163 iso_pu_bacteria 2588253730 2588514362 271
164 iso_pu_bacteria 2597489875 2597815633 271
165 iso_pu_bacteria 2599185156 2599335323 271
166 iso_pu_bacteria 2599185170 2599415772 271
167 iso_pu_bacteria 2615840624 2616294798 271
168 iso_pu_bacteria 2615840698 2616551939 271
169 iso_pu_bacteria 2617270742 2617385582 271
170 iso_pu_bacteria 2643221595 2643986385 271
171 iso_pu_bacteria 2643221599 2644003978 271
172 iso_pu_bacteria 2643221607 2644048149 271
173 iso_pu_bacteria 2643221610 2644067208 271
174 iso_pu_bacteria 2643221618 2644105960 271
175 iso_pu_bacteria 2643221626 2644147075 271
176 iso_pu_bacteria 2643221627 2644152617 271
177 iso_pu_bacteria 2643221634 2644195469 271
178 iso_pu_bacteria 2643221636 2644203371 271
179 iso_pu_bacteria 2643221643 2644237754 271
180 iso_pu_bacteria 2643221655 2644310572 271
181 iso_pu_bacteria 2643221659 2644334643 271
182 iso_pu_bacteria 2643221675 2644418300 271
183 iso_pu_bacteria 2643221680 2644451722 271
184 iso_pu_bacteria 2643221686 2644480942 271
185 iso_pu_bacteria 2643221689 2644497601 271
186 iso_pu_bacteria 2643221698 2644545162 271
187 iso_pu_bacteria 2643221712 2644612674 271
188 iso_pu_bacteria 2643221726 2644691265 271
189 iso_pu_bacteria 2667528174 2671114444 271
190 iso_pu_bacteria 2687453392 2688600709 271
191 iso_pu_bacteria 2690316117 2692319467 271
192 iso_pu_bacteria 2718217882 2719184435 271
193 iso_pu_bacteria 2718217927 2719389157 271
194 iso_pu_bacteria 2718217997 2719669242 271
195 iso_pu_bacteria 2718218009 2719728455 271
196 iso_pu_bacteria 2718218199 2720489936 271
197 iso_pu_bacteria 2718218232 2720610600 271
198 iso_pu_bacteria 2718218233 2720618170 271
199 iso_pu_bacteria 2718218235 2720629181 271
200 iso_pu_bacteria 2718218269 2720773261 271
201 iso_pu_bacteria 2718218363 2721144143 271
202 iso_pu_bacteria 2718218365 2721156240 271
203 iso_pu_bacteria 2718218366 2721161518 271
204 iso_pu_bacteria 2718218423 2721401923 271
205 iso_pu_bacteria 2721755514 2722842663 271
206 iso_pu_bacteria 2721755556 2723030671 271
207 iso_pu_bacteria 2721755684 2723565088 271
208 iso_pu_bacteria 2721755685 2723570388 271
209 iso_pu_bacteria 2721755686 2723578169 271
210 iso_pu_bacteria 2721755809 2724035756 271
211 iso_pu_bacteria 2721755810 2724041480 271
212 iso_pu_bacteria 2721755819 2724093290 271
213 iso_pu_bacteria 2721755822 2724101935 271
214 iso_pu_bacteria 2721755823 2724113607 271
215 iso_pu_bacteria 2724679232 2725947058 271
216 iso_pu_bacteria 2728369352 2730111204 271
217 iso_pu_bacteria 2728369365 2730160551 271
218 iso_pu_bacteria 2728369397 2730295773 271
219 iso_pu_bacteria 2738541293 2738799838 271
220 iso_pu_bacteria 2738541333 2739036266 271
221 iso_pu_bacteria 2751185800 2753357091 271
222 iso_pu_bacteria 2751185821 2753461450 271
223 iso_pu_bacteria 2756170246 2756672692 271
224 iso_pu_bacteria 2758568016 2758639377 271
225 iso_pu_bacteria 2765235942 2766069243 271
226 iso_pu_bacteria 2775507266 2778176582 271
227 iso_pu_bacteria 2791355091 2792624106 271
228 iso_pu_bacteria 2791355092 2792629482 271
229 iso_pu_bacteria 2791355094 2792640741 271
230 iso_pu_bacteria 2791355094 2792641161 271
231 iso_pu_bacteria 2791355123 2792745575 271
232 iso_pu_bacteria 2791355253 2793280421 271
233 iso_pu_bacteria 2791355260 2793323154 271
234 iso_pu_bacteria 2791355261 2793330494 271
235 iso_pu_bacteria 2791355263 2793342779 271
236 iso_pu_bacteria 2791355264 2793345320 271
237 iso_pu_bacteria 2791355266 2793363356 271
238 iso_pu_bacteria 2791355267 2793365048 271
239 iso_pu_bacteria 2802429633 2806046369 271
240 iso_pu_bacteria 2802429634 2806053095 271
241 iso_pu_bacteria 2802429635 2806059697 271
242 iso_pu_bacteria 2802429636 2806068565 271
243 iso_pu_bacteria 2802429637 2806074987 271
244 iso_pu_bacteria 2818991448 2819607569 271
245 iso_pu_bacteria 2818991453 2819641714 271
246 iso_pu_bacteria 2818991453 2819642708 271
247 iso_pu_bacteria 2821443989 2821449681 271
248 iso_pu_bacteria 2837651117 2837654022 271
249 iso_pu_bacteria 2837678835 2837679666 271
250 iso_pu_bacteria 2838016132 2838016556 271
251 iso_pu_bacteria 2838029111 2838032069 271
252 iso_pu_bacteria 2838035591 2838035889 271
253 iso_pu_bacteria 2838048938 2838050005 271
254 iso_pu_bacteria 2838061910 2838064339 271
255 iso_pu_bacteria 2838068647 2838069090 271
256 iso_pu_bacteria 2838661181 2838665077 271
257 iso_pu_bacteria 2838686498 2838687687 271
258 iso_pu_bacteria 2838729681 2838735574 271
259 iso_pu_bacteria 2838742623 2838748476 271
260 iso_pu_bacteria 2841734538 2841735256 271
261 iso_pu_bacteria 2841851746 2841854234 271
262 iso_pu_bacteria 2841864319 2841865576 271
263 iso_pu_bacteria 2842110456 2842111370 271
264 iso_pu_bacteria 2842156927 2842159398 271
265 iso_pu_bacteria 2842163707 2842163837 271
266 iso_pu_bacteria 2842180545 2842183033 271
267 iso_pu_bacteria 2842217011 2842223829 271
268 iso_pu_bacteria 2842229732 2842232744 271
269 iso_pu_bacteria 2842243621 2842247013 271
270 iso_pu_bacteria 2842257432 2842259301 271
271 iso_pu_bacteria 2842264693 2842265430 271
272 iso_pu_bacteria 2842271015 2842272281 271
273 iso_pu_bacteria 2842285085 2842287870 271
274 iso_pu_bacteria 2842298080 2842301044 271
275 iso_pu_bacteria 2842298080 2842303235 271
276 iso_pu_bacteria 2842304105 2842309257 271
277 iso_pu_bacteria 2842311132 2842313580 271
278 iso_pu_bacteria 2842341865 2842345506 271
279 iso_pu_bacteria 2842357229 2842359941 271
280 iso_pu_bacteria 2842363717 2842363802 271
281 iso_pu_bacteria 2842395702 2842397263 271
282 iso_pu_bacteria 2842402390 2842405136 271
283 iso_pu_bacteria 2842409023 2842412107 271
284 iso_pu_bacteria 2842415677 2842418366 271
285 iso_pu_bacteria 2842422224 2842422280 271
286 iso_pu_bacteria 2842428310 2842428519 271
287 iso_pu_bacteria 2842434925 2842435133 271
288 iso_pu_bacteria 2842441272 2842442004 271
289 iso_pu_bacteria 2842447887 2842447949 271
290 iso_pu_bacteria 2842462802 2842462945 271
291 iso_pu_bacteria 2842469257 2842469465 271
292 iso_pu_bacteria 2842475841 2842478801 271
293 iso_pu_bacteria 2842482326 2842486513 271
294 iso_pu_bacteria 2842502639 2842505880 271
295 iso_pu_bacteria 2842509118 2842513775 271
296 iso_pu_bacteria 2842521101 2842525445 271
297 iso_pu_bacteria 2842922631 2842927053 271
298 iso_pu_bacteria 2844002411 2844005148 271
299 iso_pu_bacteria 2844009547 2844016059 271
300 iso_pu_bacteria 2844163670 2844165660 271
301 iso_pu_bacteria 2844454524 2844460682 271
302 iso_pu_bacteria 2844533157 2844539898 271
303 iso_pu_bacteria 2847417321 2847422032 271
304 iso_pu_bacteria 2847670302 2847672773 271
305 iso_pu_bacteria 2848992105 2848997009 271
306 iso_pu_bacteria 2850079185 2850084631 271
307 iso_pu_bacteria 2852387548 2852395036 271
308 iso_pu_bacteria 2854911287 2854915007 271
309 iso_pu_bacteria 2855825444 2855829441 271
310 iso_pu_bacteria 2855839649 2855844540 271
311 iso_pu_bacteria 2855872281 2855872789 271
312 iso_pu_bacteria 2855872281 2855875003 271
313 iso_pu_bacteria 2856314179 2856314724 271
314 iso_pu_bacteria 2856320880 2856326471 271
315 iso_pu_bacteria 2856328259 2856330159 271
316 iso_pu_bacteria 2856334872 2856339579 271
317 iso_pu_bacteria 2856356410 2856362870 271
318 iso_pu_bacteria 2856364286 2856371482 271
319 iso_pu_bacteria 2857349434 2857349542 271
320 iso_pu_bacteria 2857367948 2857374634 271
321 iso_pu_bacteria 2857516855 2857518242 271
322 iso_pu_bacteria 2858800743 2858805999 271
323 iso_pu_bacteria 2869169390 2869170706 271
324 iso_pu_bacteria 2869234852 2869234930 271
325 iso_pu_bacteria 2869249662 2869255247 271
326 iso_pu_bacteria 2869256925 2869259157 271
327 iso_pu_bacteria 2869264136 2869265067 271
328 iso_pu_bacteria 2869271264 2869274894 271
329 iso_pu_bacteria 2869278585 2869283906 271
330 iso_pu_bacteria 2869285874 2869289597 271
331 iso_pu_bacteria 2871429161 2871431663 271
332 iso_pu_bacteria 2871435913 2871437328 271
333 iso_pu_bacteria 2871451962 2871455761 271
334 iso_pu_bacteria 2871459585 2871460316 271
335 iso_pu_bacteria 2871466892 2871468818 271
336 iso_pu_bacteria 2871474448 2871479228 271
337 iso_pu_bacteria 2871481445 2871485089 271
338 iso_pu_bacteria 2874109183 2874110423 271
339 iso_pu_bacteria 2874116593 2874117264 271
340 iso_pu_bacteria 2874123672 2874131383 271
341 iso_pu_bacteria 2874131515 2874135555 271
342 iso_pu_bacteria 2874139085 2874144525 271
343 iso_pu_bacteria 2874146452 2874154805 271
344 iso_pu_bacteria 2874155637 2874162186 271
345 iso_pu_bacteria 2874162495 2874164142 271
346 iso_pu_bacteria 2874168670 2874171146 271
347 iso_pu_bacteria 2876363079 2876367318 271
348 iso_pu_bacteria 2876369609 2876374168 271
349 iso_pu_bacteria 2876386047 2876387628 271
350 iso_pu_bacteria 2876399893 2876401800 271
351 iso_pu_bacteria 2876406927 2876411065 271
352 iso_pu_bacteria 2876413966 2876420371 271
353 iso_pu_bacteria 2876420981 2876425573 271
354 iso_pu_bacteria 2878035449 2878036195 271
355 iso_pu_bacteria 2878730984 2878735808 271
356 iso_pu_bacteria 2878738818 2878744099 271
357 iso_pu_bacteria 2878745973 2878748269 271
358 iso_pu_bacteria 2878774303 2878774944 271
359 iso_pu_bacteria 2878781027 2878781054 271
360 iso_pu_bacteria 2878788777 2878796013 271
361 iso_pu_bacteria 2881147464 2881151090 271
362 iso_pu_bacteria 2881861095 2881863070 271
363 iso_pu_bacteria 2882632389 2882637537 271
364 iso_pu_bacteria 2885312484 2885315672 271
365 iso_pu_bacteria 2885318864 2885323298 271
366 iso_pu_bacteria 2888337043 2888341621 271
367 iso_pu_bacteria 2888343758 2888349271 271
368 iso_pu_bacteria 2891373044 2891375909 271
369 iso_pu_bacteria 2894817345 2894820753 271
370 iso_pu_bacteria 2896384573 2896385555 271
371 iso_pu_bacteria 2903448605 2903453212 271
372 iso_pu_bacteria 2903492973 2903505841 271
373 iso_pu_bacteria 2903513507 2903514514 271
374 iso_pu_bacteria 2903521522 2903526809 271
375 iso_pu_bacteria 2903528002 2903530572 271
376 iso_pu_bacteria 2904578770 2904583871 271
377 iso_pu_bacteria 2906308376 2906311886 271
378 iso_pu_bacteria 2906321335 2906323623 271
379 iso_pu_bacteria 2906363423 2906364953 271
380 iso_pu_bacteria 2906370794 2906371414 271
381 iso_pu_bacteria 2906378014 2906385013 271
382 iso_pu_bacteria 2906386501 2906391076 271
383 iso_pu_bacteria 2906393657 2906394923 271
384 iso_pu_bacteria 2906401398 2906403405 271
385 iso_pu_bacteria 2906408224 2906409829 271
386 iso_pu_bacteria 2906414383 2906414913 271
387 iso_pu_bacteria 2906427513 2906434161 271
388 iso_pu_bacteria 2909042592 2909045439 271
389 iso_pu_bacteria 2915650412 2915654482 271
390 iso_pu_bacteria 2915986958 2915989918 271
391 iso_pu_bacteria 2915993759 2915993916 271
392 iso_pu_bacteria 2916000859 2916003331 271
393 iso_pu_bacteria 2916007675 2916007841 271
394 iso_pu_bacteria 2916014648 2916015724 271
395 iso_pu_bacteria 2916021584 2916021749 271
396 iso_pu_bacteria 2916028427 2916028441 271
397 iso_pu_bacteria 2916035215 2916037443 271
398 iso_pu_bacteria 2916041962 2916042100 271
399 iso_pu_bacteria 2916048683 2916048873 271
400 iso_pu_bacteria 2916055098 2916059778 271
401 iso_pu_bacteria 2916068649 2916071024 271
402 iso_pu_bacteria 2916076590 2916081253 271
403 iso_pu_bacteria 2919100787 2919102182 271
404 iso_pu_bacteria 2919408235 2919413167 271
405 iso_pu_bacteria 2921201388 2921202200 271
406 iso_pu_bacteria 2921208531 2921212693 271
407 iso_pu_bacteria 2921237296 2921237421 271
408 iso_pu_bacteria 2921244191 2921250049 271
409 iso_pu_bacteria 2921257292 2921259372 271
410 iso_pu_bacteria 2921263974 2921268179 271
411 iso_pu_bacteria 2921282425 2921282951 271
412 iso_pu_bacteria 2921289301 2921294661 271
413 iso_pu_bacteria 2922151315 2922153123 271
414 iso_pu_bacteria 2922172374 2922176266 271
415 iso_pu_bacteria 2922178524 2922179647 271
416 iso_pu_bacteria 2923556063 2923562411 271
417 iso_pu_bacteria 2924144063 2924148060 271
418 iso_pu_bacteria 2924150972 2924157099 271
419 iso_pu_bacteria 2924158325 2924161790 271
420 iso_pu_bacteria 2924165586 2924165626 271
421 iso_pu_bacteria 2924172951 2924174954 271
422 iso_pu_bacteria 2924179722 2924181024 271
423 iso_pu_bacteria 2924186466 2924188209 271
424 iso_pu_bacteria 2924193448 2924196902 271
425 iso_pu_bacteria 2924200457 2924200619 271
426 iso_pu_bacteria 2924207177 2924207242 271
427 iso_pu_bacteria 2924214083 2924217304 271
428 iso_pu_bacteria 2924221636 2924224167 271
429 iso_pu_bacteria 2924228884 2924228959 271
430 iso_pu_bacteria 2924710171 2924714973 271
431 iso_pu_bacteria 2924718760 2924719271 271
432 iso_pu_bacteria 2924733363 2924737537 271
433 iso_pu_bacteria 2924741084 2924741477 271
434 iso_pu_bacteria 2924748358 2924752480 271
435 iso_pu_bacteria 2924754689 2924758462 271
436 iso_pu_bacteria 2924762789 2924769086 271
437 iso_pu_bacteria 2924776078 2924782016 271
438 iso_pu_bacteria 2924784321 2924786105 271
439 iso_pu_bacteria 2928521798 2928526057 271
440 iso_pu_bacteria 2933016740 2933017721 271
441 iso_pu_bacteria 2933570622 2933575642 271
442 iso_pu_bacteria 2933586486 2933587924 271
443 iso_pu_bacteria 2933599457 2933599757 271
444 iso_pu_bacteria 2935901341 2935902937 271
445 iso_pu_bacteria 2936367885 2936374157 271
446 iso_pu_bacteria 2936375103 2936375324 271
447 iso_pu_bacteria 2936381700 2936387046 271
448 iso_pu_bacteria 2936996657 2936996711 271
449 iso_pu_bacteria 2936996657 2936999043 271
450 iso_pu_bacteria 2937002841 2937003082 271
451 iso_pu_bacteria 2937009748 2937009931 271
452 iso_pu_bacteria 2937016420 2937020368 271
453 iso_pu_bacteria 2937023124 2937025250 271
454 iso_pu_bacteria 2937042894 2937047247 271
455 iso_pu_bacteria 2937049772 2937050667 271
456 iso_pu_bacteria 2937056579 2937058468 271
457 iso_pu_bacteria 2937063883 2937064009 271
458 iso_pu_bacteria 2937071275 2937072338 271
459 iso_pu_bacteria 2937091812 2937094333 271
460 iso_pu_bacteria 2937098957 2937101527 271
461 iso_pu_bacteria 2937106411 2937110127 271
462 iso_pu_bacteria 2937113482 2937115512 271
463 iso_pu_bacteria 2937119839 2937120007 271
464 iso_pu_bacteria 2937126314 2937128125 271
465 iso_pu_bacteria 2937813078 2937818295 271
466 iso_pu_bacteria 2937836603 2937839554 271
467 iso_pu_bacteria 2937848649 2937850907 271
468 iso_pu_bacteria 2937861824 2937866986 271
469 iso_pu_bacteria 2937868953 2937875313 271
470 iso_pu_bacteria 2937877337 2937884657 271
471 iso_pu_bacteria 2937972304 2937977928 271
472 iso_pu_bacteria 2937980651 2937983464 271
473 iso_pu_bacteria 2941499720 2941505461 271
474 iso_pu_bacteria 2954011201 2954011850 271
475 iso_pu_bacteria 2957382221 2957382358 271
476 iso_pu_bacteria 2957388812 2957395433 271
477 iso_pu_bacteria 2957395598 2957400801 271
478 iso_pu_bacteria 2957402308 2957404196 271
479 iso_pu_bacteria 2957408893 2957414871 271
480 iso_pu_bacteria 2957422303 2957429743 271
481 iso_pu_bacteria 2957430029 2957432119 271
482 iso_pu_bacteria 2957443900 2957445921 271
483 iso_pu_bacteria 2957450854 2957451025 271
484 iso_pu_bacteria 2957457609 2957461665 271
485 iso_pu_bacteria 2957464669 2957467989 271
486 iso_pu_bacteria 2957471148 2957474603 271
487 iso_pu_bacteria 2957478035 2957483381 271
488 iso_pu_bacteria 2957484790 2957487252 271
489 iso_pu_bacteria 2957491536 2957496488 271
490 iso_pu_bacteria 2957498199 2957504824 271
491 iso_pu_bacteria 2957505466 2957505625 271
492 iso_pu_bacteria 2958034702 2958040296 271
493 iso_pu_bacteria 2958041894 2958045083 271
494 iso_pu_bacteria 2958041894 2958055144 271
495 iso_pu_bacteria 2958071322 2958075747 271
496 iso_pu_bacteria 2958084443 2958091965 271
497 iso_pu_bacteria 2958092219 2958096277 271
498 iso_pu_bacteria 2958108152 2958111768 271
499 iso_pu_bacteria 2958122699 2958128408 271
500 iso_pu_bacteria 2958130278 2958133970 271
501 iso_pu_bacteria 2958137437 2958141812 271
502 iso_pu_bacteria 2958144490 2958151461 271
503 iso_pu_bacteria 2958158011 2958159172 271
504 iso_pu_bacteria 2958179912 2958183616 271
505 iso_pu_bacteria 2960584000 2960584198 271
506 iso_pu_bacteria 2960597568 2960603009 271
507 iso_pu_bacteria 2960603979 2960604076 271
508 iso_pu_bacteria 2960610863 2960611031 271
509 iso_pu_bacteria 2960617483 2960622396 271
510 iso_pu_bacteria 2960637947 2960639810 271
511 iso_pu_bacteria 2960645483 2960649152 271
512 iso_pu_bacteria 2960652885 2960659682 271
513 iso_pu_bacteria 2960660292 2960663779 271
514 iso_pu_bacteria 2960667422 2960667590 271
515 iso_pu_bacteria 2960674078 2960676499 271
516 iso_pu_bacteria 2961077736 2961081582 271
517 iso_pu_bacteria 2961136820 2961139657 271
518 iso_pu_bacteria 2961183825 2961186191 271
519 iso_pu_bacteria 2963644680 2963650111 271
520 iso_pu_bacteria 2964607997 2964610093 271
521 iso_pu_bacteria 2964615318 2964615553 271
522 iso_pu_bacteria 2964621998 2964626089 271
523 iso_pu_bacteria 2964628898 2964629046 271
524 iso_pu_bacteria 2964636051 2964636153 271
525 iso_pu_bacteria 2964643177 2964643345 271
526 iso_pu_bacteria 2964649959 2964653884 271
527 iso_pu_bacteria 2964656573 2964656755 271
528 iso_pu_bacteria 2964663802 2964663971 271
529 iso_pu_bacteria 2964670856 2964676609 271
530 iso_pu_bacteria 2964678106 2964678122 271
531 iso_pu_bacteria 2964685014 2964689000 271
532 iso_pu_bacteria 2964691889 2964694101 271
533 iso_pu_bacteria 2964698721 2964698942 271
534 iso_pu_bacteria 2964705432 2964711169 271
535 iso_pu_bacteria 2964712639 2964717857 271
536 iso_pu_bacteria 2964719344 2964723375 271
537 iso_pu_bacteria 2965025482 2965027399 271
538 iso_pu_bacteria 2965032056 2965039699 271
539 iso_pu_bacteria 2965040258 2965044052 271
540 iso_pu_bacteria 2965047637 2965048471 271
541 iso_pu_bacteria 2965062239 2965065198 271
542 iso_pu_bacteria 2965089291 2965092716 271
543 iso_pu_bacteria 2965102966 2965106688 271
544 iso_pu_bacteria 2965110997 2965115574 271
545 iso_pu_bacteria 2967664464 2967664595 271
546 iso_pu_bacteria 2967671571 2967671740 271
547 iso_pu_bacteria 2967678726 2967681341 271
548 iso_pu_bacteria 2967693043 2967698484 271
549 iso_pu_bacteria 2967699805 2967699835 271
550 iso_pu_bacteria 2967706974 2967714072 271
551 iso_pu_bacteria 2967714385 2967718556 271
552 iso_pu_bacteria 2967721400 2967721440 271
553 iso_pu_bacteria 2967735183 2967737376 271
554 iso_pu_bacteria 2967742019 2967744401 271
555 iso_pu_bacteria 2967748971 2967749141 271
556 iso_pu_bacteria 2967755722 2967755892 271
557 iso_pu_bacteria 2967762386 2967762449 271
558 iso_pu_bacteria 2967769361 2967769483 271
559 iso_pu_bacteria 2967775926 2967775996 271
560 iso_pu_bacteria 2968016561 2968022077 271
561 iso_pu_bacteria 2968083720 2968086578 271
562 iso_pu_bacteria 2968091066 2968094569 271
563 iso_pu_bacteria 2970019648 2970019778 271
564 iso_pu_bacteria 2970033650 2970033820 271
565 iso_pu_bacteria 2970040964 2970044001 271
566 iso_pu_bacteria 2970047711 2970053146 271
567 iso_pu_bacteria 2970054988 2970055645 271
568 iso_pu_bacteria 2970061556 2970063821 271
569 iso_pu_bacteria 2970068827 2970068996 271
570 iso_pu_bacteria 2970076120 2970078046 271
571 iso_pu_bacteria 2970082768 2970084428 271
572 iso_pu_bacteria 2970088815 2970091936 271
573 iso_pu_bacteria 2970095765 2970095935 271
574 iso_pu_bacteria 2970102677 2970102847 271
575 iso_pu_bacteria 2970109326 2970111308 271
576 iso_pu_bacteria 2970116247 2970119091 271
577 iso_pu_bacteria 2970129317 2970135295 271
578 iso_pu_bacteria 2970136068 2970136092 271
579 iso_pu_bacteria 2970149975 2970152092 271
580 iso_pu_bacteria 2970156795 2970159940 271
581 iso_pu_bacteria 2970164137 2970165516 271
582 iso_pu_bacteria 2970170962 2970171151 271
583 iso_pu_bacteria 2970177841 2970180054 271
584 iso_pu_bacteria 2970184632 2970188176 271
585 iso_pu_bacteria 2970191845 2970191890 271
586 iso_pu_bacteria 2970469710 2970474667 271
587 iso_pu_bacteria 2970489779 2970491797 271
588 iso_pu_bacteria 2970510686 2970511007 271
589 iso_pu_bacteria 2970524798 2970531135 271
590 iso_pu_bacteria 2970532167 2970536018 271
591 iso_pu_bacteria 2970540015 2970540793 271
592 iso_pu_bacteria 2970547951 2970549654 271
593 iso_pu_bacteria 2970593180 2970598519 271
594 iso_pu_bacteria 2970619444 2970620765 271
595 iso_pu_bacteria 2970627176 2970629056 271
596 iso_pu_bacteria 2977516862 2977519504 271
597 iso_pu_bacteria 2977523885 2977525906 271
598 iso_pu_bacteria 2977537788 2977539800 271
599 iso_pu_bacteria 2977551784 2977556120 271
600 iso_pu_bacteria 2977558990 2977559034 271
601 iso_pu_bacteria 2977565890 2977566115 271
602 iso_pu_bacteria 2977572785 2977573582 271
603 iso_pu_bacteria 2977579622 2977585064 271
604 iso_pu_bacteria 2977843712 2977850953 271
605 iso_pu_bacteria 2977851361 2977855748 271
606 iso_pu_bacteria 2977858184 2977862793 271
607 iso_pu_bacteria 2977864932 2977868520 271
608 iso_pu_bacteria 2977872689 2977877311 271
609 iso_pu_bacteria 2977898635 2977904455 271
610 iso_pu_bacteria 2977907340 2977909274 271
611 iso_pu_bacteria 2977915119 2977922096 271
612 iso_pu_bacteria 2977922695 2977923883 271
613 iso_pu_bacteria 2977935797 2977937367 271
614 iso_pu_bacteria 2977942078 2977944274 271
615 iso_pu_bacteria 2977950692 2977951202 271
616 iso_pu_bacteria 2977957713 2977959584 271
617 iso_pu_bacteria 2979764755 2979766931 271
618 iso_pu_bacteria 2979772303 2979774168 271
619 iso_pu_bacteria 2979793036 2979797564 271
620 iso_pu_bacteria 2987636660 2987645449 271
621 iso_pu_bacteria 2987645492 2987649855 271
622 iso_pu_bacteria 2987666974 2987672938 271
623 iso_pu_bacteria 2987673487 2987676141 271
624 iso_pu_bacteria 2989349275 2989354425 271
625 iso_pu_bacteria 2989771324 2989772891 271
626 iso_pu_bacteria 2995392953 2995394554 271
627 iso_pu_bacteria 2996348954 2996354076 271
628 iso_pu_bacteria 2996386984 2996391176 271
629 iso_pu_bacteria 3000135777 3000141151 271
630 iso_pu_bacteria 3003930520 3003931803 271
631 iso_pu_bacteria 3004167301 3004171596 271
632 iso_pu_bacteria 3004195979 3004201977 271
633 iso_pu_bacteria 3004203850 3004206356 271
634 iso_pu_bacteria 3004211236 3004213321 271
635 iso_pu_bacteria 3004218560 3004221393 271
636 iso_pu_bacteria 3004232784 3004235827 271
637 iso_pu_bacteria 3004239961 3004246558 271
638 iso_pu_bacteria 3004248173 3004255595 271
639 iso_pu_bacteria 3004268573 3004270193 271
640 iso_pu_bacteria 3004275668 3004280744 271
641 iso_pu_bacteria 3004334049 3004338888 271
642 iso_pu_bacteria 3005409236 3005414678 271
643 iso_pu_bacteria 3005416602 3005421979 271
644 iso_pu_bacteria 3005445848 3005452029 271
645 iso_pu_bacteria 3005452660 3005458523 271
646 iso_pu_bacteria 639633055 639645155 271
647 iso_pu_bacteria 643692032 643824058 271
648 iso_pu_bacteria 643692032 643824880 271
649 iso_pu_bacteria 648276728 648735552 271
650 iso_pu_bacteria 649633066 649875162 271
651 iso_pu_bacteria 8003992118 8003997064 271
652 iso_pu_bacteria 8004300914 8004307046 271
653 iso_pu_bacteria 8004312739 8004314865 271
654 iso_pu_bacteria 8004361976 8004369209 271
655 iso_pu_bacteria 8004387939 8004391475 271
656 iso_pu_bacteria 8004445564 8004446402 271
657 iso_pu_bacteria 8004633249 8004638659 271
658 iso_pu_bacteria 8004640170 8004643758 271
659 iso_pu_bacteria 8004695233 8004702834 271
660 iso_pu_bacteria 8004714634 8004716844 271
661 iso_pu_bacteria 8004727605 8004733612 271
662 iso_pu_bacteria 8005275841 8005277497 271
663 iso_pu_bacteria 8005282627 8005285001 271
664 iso_pu_bacteria 8005301065 8005306369 271
665 iso_pu_bacteria 8005307578 8005307709 271
666 iso_pu_bacteria 8005314921 8005321260 271
667 iso_pu_bacteria 8005376324 8005380029 271
668 iso_pu_bacteria 8005382845 8005383549 271
669 iso_pu_bacteria 8005395548 8005399084 271
670 iso_pu_bacteria 8005430974 8005433550 271
671 iso_pu_bacteria 8005460587 8005467432 271
672 iso_pu_bacteria 8005484373 8005489977 271
673 iso_pu_bacteria 8005497431 8005502440 271
674 iso_pu_bacteria 8005542996 8005547974 271
675 iso_pu_bacteria 8005556819 8005563549 271
676 iso_pu_bacteria 8005563573 8005565325 271
677 iso_pu_bacteria 8005570704 8005572374 271
678 iso_pu_bacteria 8005619151 8005624802 271
679 iso_pu_bacteria 8005626139 8005626202 271
680 iso_pu_bacteria 8005645114 8005650863 271
681 iso_pu_bacteria 8005668836 8005673867 271
682 iso_pu_bacteria 8005682033 8005687827 271
683 iso_pu_bacteria 8005688590 8005693935 271
684 iso_pu_bacteria 8005695170 8005701305 271
685 iso_pu_bacteria 8018127388 8018131846 271
686 iso_pu_bacteria 8018163183 8018165717 271
687 iso_pu_bacteria 8018176218 8018179157 271
688 iso_pu_bacteria 8023680758 8023687896 271
689 iso_pu_bacteria 8024479707 8024484835 271
690 iso_pu_bacteria 8024486573 8024493125 271
691 iso_pu_bacteria 8054558443 8054560430 271
692 iso_pu_bacteria 8055617313 8055623699 271
693 iso_pu_bacteria 8056375014 8056377792 271
694 iso_pu_bacteria 8057575449 8057576302 271
695 iso_pu_bacteria 8057874678 8057877809 271
696 3300006042 Ga0075368_10036990 Ga0075368_100369902 274
697 3300006048 Ga0075363_100087992 Ga0075363_1000879922 274
698 3300006195 Ga0075366_10071119 Ga0075366_100711192 274
699 3300006948 Ga0099826_10046495 Ga0099826_100464951 274
700 3300022739 Ga0228711_1000005 Ga0228711_100000553 274
701 3300022740 Ga0228710_1000018 Ga0228710_100001853 274
702 3300027111 Ga0209281_1000111 Ga0209281_100011153 274
703 3300027666 Ga0209282_1000012 Ga0209282_100001253 274
704 3300027866 Ga0209813_10001917 Ga0209813_100019173 274
705 3300031730 Ga0307516_10082289 Ga0307516_100822893 274
706 3300031967 Ga0315914_1000007 Ga0315914_1000007161 274
707 3300033180 Ga0307510_10117355 Ga0307510_101173553 274
708 3300033430 Ga0315913_1000003 Ga0315913_100000353 274
709 3300033464 Ga0315915_1000011 Ga0315915_1000011161 274
710 3300049572 Ga0501036_0013901 Ga0501036_0013901_5225_6049 274
711 3300049575 Ga0501039_0003147 Ga0501039_0003147_3002_3826 274
712 3300049576 Ga0501040_0046610 Ga0501040_0046610_583_1407 274
713 3300049577 Ga0501041_0047053 Ga0501041_0047053_129_953 274
714 3300049578 Ga0501042_0074543 Ga0501042_0074543_1182_2006 274
715 3300049579 Ga0501043_0244018 Ga0501043_0244018_504_1328 274
716 3300049580 Ga0501046_0107718 Ga0501046_0107718_99_923 274
717 3300049582 Ga0501048_0053391 Ga0501048_0053391_351_1175 274
718 3300049591 Ga0501075_0042175 Ga0501075_0042175_887_1711 274
719 3300049593 Ga0501077_0237820 Ga0501077_0237820_284_1108 274
720 3300049823 Ga0501044_0153060 Ga0501044_0153060_38_862 274
721 3300049824 Ga0501045_0061123 Ga0501045_0061123_1754_2578 274
722 3300050493 nmdc:mga0k408_164931_c1 nmdc:mga0k408_164931_c1_315_1139 274
723 3300050494 nmdc:mga06z11_9009_c1 nmdc:mga06z11_9009_c1_759_1583 274
724 3300050495 nmdc:mga04h51_2629_c1 nmdc:mga04h51_2629_c1_627_1451 274
725 3300054114 Ga0501084_0109316 Ga0501084_0109316_1443_2267 274
726 iso_pu_bacteria 2856342000 2856346085 274
727 3300001979 JGI24740J21852_10002929 JGI24740J21852_100029292 275
728 3300001979 JGI24740J21852_10003704 JGI24740J21852_100037045 275
729 3300002704 JGI25155J39150_1000015 JGI25155J39150_100001571 275
730 3300002705 JGI25156J39149_1000007 JGI25156J39149_100000771 275
731 3300002737 JGI25162J39368_1000248 JGI25162J39368_100024812 275
732 3300002737 JGI25162J39368_1001265 JGI25162J39368_100126514 275
733 3300002738 JGI25154J39366_1000051 JGI25154J39366_1000051101 275
734 3300002739 JGI25158J39367_1000619 JGI25158J39367_10006192 275
735 3300002739 JGI25158J39367_1008405 JGI25158J39367_10084051 275
736 3300002741 JGI25157J39369_1000012 JGI25157J39369_1000012129 275
737 3300002741 JGI25157J39369_1003126 JGI25157J39369_10031264 275
738 3300002773 JGI25152J39213_1000465 JGI25152J39213_100046523 275
739 3300002773 JGI25152J39213_1000472 JGI25152J39213_10004729 275
740 3300002773 JGI25152J39213_1004792 JGI25152J39213_10047922 275
741 3300002773 JGI25152J39213_1004925 JGI25152J39213_10049252 275
742 3300002773 JGI25152J39213_1008170 JGI25152J39213_10081702 275
743 3300002773 JGI25152J39213_1008377 JGI25152J39213_10083772 275
744 3300002773 JGI25152J39213_1012900 JGI25152J39213_10129002 275
745 3300002774 JGI25150J39212_1000219 JGI25150J39212_100021923 275
746 3300002774 JGI25150J39212_1004081 JGI25150J39212_10040812 275
747 3300002987 JGI25159J45721_1000036 JGI25159J45721_100003630 275
748 3300002987 JGI25159J45721_1000101 JGI25159J45721_10001014 275
749 3300002987 JGI25159J45721_1000321 JGI25159J45721_10003217 275
750 3300002987 JGI25159J45721_1015705 JGI25159J45721_10157052 275
751 3300003187 JGI25151J46595_10000007 JGI25151J46595_10000007147 275
752 3300003187 JGI25151J46595_10000463 JGI25151J46595_100004635 275
753 3300003187 JGI25151J46595_10000667 JGI25151J46595_100006674 275
754 3300003214 JGI25165J46597_1000102 JGI25165J46597_1000102127 275
755 3300003214 JGI25165J46597_1000280 JGI25165J46597_100028026 275
756 3300003215 JGI25153J46596_10000254 JGI25153J46596_1000025431 275
757 3300003215 JGI25153J46596_10001626 JGI25153J46596_100016269 275
758 3300003215 JGI25153J46596_10002799 JGI25153J46596_100027993 275
759 3300003215 JGI25153J46596_10015061 JGI25153J46596_100150611 275
760 3300003215 JGI25153J46596_10019229 JGI25153J46596_100192292 275
761 3300003215 JGI25153J46596_10019269 JGI25153J46596_100192692 275
762 3300003354 JGI25160J50197_1000023 JGI25160J50197_1000023118 275
763 3300003354 JGI25160J50197_1000060 JGI25160J50197_100006049 275
764 3300003354 JGI25160J50197_1001918 JGI25160J50197_10019189 275
765 3300003354 JGI25160J50197_1003006 JGI25160J50197_10030066 275
766 3300003354 JGI25160J50197_1004431 JGI25160J50197_10044316 275
767 3300003374 JGI25161J50226_1000012 JGI25161J50226_1000012118 275
768 3300003374 JGI25161J50226_1000085 JGI25161J50226_100008525 275
769 3300003374 JGI25161J50226_1003468 JGI25161J50226_10034684 275
770 3300003752 Ga0055539_1007968 Ga0055539_10079681 275
771 3300003762 Ga0055542_1000516 Ga0055542_10005163 275
772 3300003763 Ga0055529_1002054 Ga0055529_10020542 275
773 3300003771 Ga0055526_1010257 Ga0055526_10102573 275
774 3300003771 Ga0055526_1023182 Ga0055526_10231822 275
775 3300003775 Ga0055524_1000668 Ga0055524_100066817 275
776 3300003775 Ga0055524_1001911 Ga0055524_10019118 275
777 3300003775 Ga0055524_1003923 Ga0055524_10039234 275
778 3300003775 Ga0055524_1007862 Ga0055524_10078623 275
779 3300003790 Ga0055528_1000098 Ga0055528_100009864 275
780 3300003790 Ga0055528_1010345 Ga0055528_10103454 275
781 3300003790 Ga0055528_1023585 Ga0055528_10235852 275
782 3300003790 Ga0055528_1028713 Ga0055528_10287132 275
783 3300003792 Ga0055540_1000209 Ga0055540_10002094 275
784 3300003792 Ga0055540_1000331 Ga0055540_100033111 275
785 3300003792 Ga0055540_1007076 Ga0055540_10070762 275
786 3300003792 Ga0055540_1010000 Ga0055540_10100003 275
787 3300004625 Ga0055543_1000009 Ga0055543_1000009118 275
788 3300004625 Ga0055543_1000036 Ga0055543_1000036101 275
789 3300004625 Ga0055543_1000456 Ga0055543_100045621 275
790 3300004625 Ga0055543_1001244 Ga0055543_10012445 275
791 3300005262 Ga0065165_1000064 Ga0065165_100006480 275
792 3300005262 Ga0065165_1000160 Ga0065165_100016083 275
793 3300005262 Ga0065165_1004819 Ga0065165_10048197 275
794 3300005262 Ga0065165_1010462 Ga0065165_10104623 275
795 3300005262 Ga0065165_1038647 Ga0065165_10386472 275
796 3300005327 Ga0070658_10084741 Ga0070658_100847413 275
797 3300005327 Ga0070658_10507521 Ga0070658_105075211 275
798 3300005335 Ga0070666_10414433 Ga0070666_104144331 275
799 3300005455 Ga0070663_100061340 Ga0070663_1000613403 275
800 3300005457 Ga0070662_100282860 Ga0070662_1002828601 275
801 3300005548 Ga0070665_100085721 Ga0070665_1000857213 275
802 3300005548 Ga0070665_100127474 Ga0070665_1001274743 275
803 3300005548 Ga0070665_100318075 Ga0070665_1003180752 275
804 3300005548 Ga0070665_100427913 Ga0070665_1004279132 275
805 3300005563 Ga0068855_100158898 Ga0068855_1001588982 275
806 3300005563 Ga0068855_100168949 Ga0068855_1001689492 275
807 3300005614 Ga0068856_100115886 Ga0068856_1001158865 275
808 3300005616 Ga0068852_100059893 Ga0068852_1000598933 275
809 3300005616 Ga0068852_100313587 Ga0068852_1003135872 275
810 3300005983 Ga0081540_1033097 Ga0081540_10330972 275
811 3300006038 Ga0075365_10000172 Ga0075365_100001724 275
812 3300006038 Ga0075365_10001466 Ga0075365_100014664 275
813 3300006038 Ga0075365_10025992 Ga0075365_100259925 275
814 3300006038 Ga0075365_10026133 Ga0075365_100261332 275
815 3300006038 Ga0075365_10205622 Ga0075365_102056222 275
816 3300006038 Ga0075365_10362670 Ga0075365_103626701 275
817 3300006042 Ga0075368_10016305 Ga0075368_100163054 275
818 3300006048 Ga0075363_100028079 Ga0075363_1000280792 275
819 3300006048 Ga0075363_100147532 Ga0075363_1001475321 275
820 3300006051 Ga0075364_10005092 Ga0075364_100050923 275
821 3300006051 Ga0075364_10151592 Ga0075364_101515922 275
822 3300006051 Ga0075364_10203081 Ga0075364_102030812 275
823 3300006177 Ga0075362_10001315 Ga0075362_100013154 275
824 3300006177 Ga0075362_10014772 Ga0075362_100147725 275
825 3300006177 Ga0075362_10019696 Ga0075362_100196965 275
826 3300006177 Ga0075362_10060749 Ga0075362_100607492 275
827 3300006178 Ga0075367_10000610 Ga0075367_100006105 275
828 3300006178 Ga0075367_10010220 Ga0075367_100102204 275
829 3300006186 Ga0075369_10009522 Ga0075369_100095223 275
830 3300006186 Ga0075369_10015575 Ga0075369_100155752 275
831 3300006186 Ga0075369_10035877 Ga0075369_100358772 275
832 3300006186 Ga0075369_10199926 Ga0075369_101999261 275
833 3300006195 Ga0075366_10020620 Ga0075366_100206202 275
834 3300006353 Ga0075370_10024328 Ga0075370_100243284 275
835 3300006353 Ga0075370_10060832 Ga0075370_100608322 275
836 3300006353 Ga0075370_10083295 Ga0075370_100832952 275
837 3300006358 Ga0068871_100558134 Ga0068871_1005581341 275
838 3300009011 Ga0105251_10063362 Ga0105251_100633621 275
839 3300009092 Ga0105250_10028565 Ga0105250_100285652 275
840 3300009093 Ga0105240_10447998 Ga0105240_104479981 275
841 3300009093 Ga0105240_10466817 Ga0105240_104668171 275
842 3300009148 Ga0105243_10044145 Ga0105243_100441453 275
843 3300009148 Ga0105243_10335769 Ga0105243_103357691 275
844 3300009148 Ga0105243_10400100 Ga0105243_104001002 275
845 3300009174 Ga0105241_10279619 Ga0105241_102796192 275
846 3300009545 Ga0105237_10093671 Ga0105237_100936711 275
847 3300009545 Ga0105237_10202804 Ga0105237_102028042 275
848 3300009545 Ga0105237_10481706 Ga0105237_104817062 275
849 3300009551 Ga0105238_10240918 Ga0105238_102409182 275
850 3300009766 Ga0123342_1013959 Ga0123342_10139594 275
851 3300010375 Ga0105239_10081004 Ga0105239_100810042 275
852 3300010375 Ga0105239_10098741 Ga0105239_100987412 275
853 3300010375 Ga0105239_10748260 Ga0105239_107482602 275
854 3300011119 Ga0105246_10161217 Ga0105246_101612172 275
855 3300013102 Ga0157371_10284446 Ga0157371_102844462 275
856 3300013104 Ga0157370_10066457 Ga0157370_100664571 275
857 3300013104 Ga0157370_10071003 Ga0157370_100710033 275
858 3300013105 Ga0157369_10399495 Ga0157369_103994952 275
859 3300013297 Ga0157378_10175215 Ga0157378_101752152 275
860 3300013297 Ga0157378_10761791 Ga0157378_107617911 275
861 3300013306 Ga0163162_10227863 Ga0163162_102278632 275
862 3300013306 Ga0163162_10311892 Ga0163162_103118922 275
863 3300014497 Ga0182008_10013713 Ga0182008_100137133 275
864 3300014969 Ga0157376_10471664 Ga0157376_104716642 275
865 3300015265 Ga0182005_1004600 Ga0182005_10046004 275
866 3300021320 Ga0214544_1002772 Ga0214544_100277217 275
867 3300021321 Ga0214542_1001092 Ga0214542_100109230 275
868 3300021321 Ga0214542_1017459 Ga0214542_10174595 275
869 3300021327 Ga0214543_1000025 Ga0214543_1000025201 275
870 3300021327 Ga0214543_1009334 Ga0214543_10093343 275
871 3300025206 Ga0209435_100006 Ga0209435_100006455 275
872 3300025208 Ga0209436_100133 Ga0209436_10013312 275
873 3300025208 Ga0209436_100661 Ga0209436_1006618 275
874 3300025208 Ga0209436_108885 Ga0209436_1088851 275
875 3300025228 Ga0209672_102334 Ga0209672_1023344 275
876 3300025233 Ga0209437_100281 Ga0209437_10028126 275
877 3300025245 Ga0207425_1000018 Ga0207425_1000018184 275
878 3300025245 Ga0207425_1003306 Ga0207425_10033062 275
879 3300025246 Ga0209646_1000015 Ga0209646_100001579 275
880 3300025246 Ga0209646_1002525 Ga0209646_10025252 275
881 3300025250 Ga0209026_1000046 Ga0209026_100004679 275
882 3300025250 Ga0209026_1000327 Ga0209026_100032712 275
883 3300025253 Ga0209677_102857 Ga0209677_1028573 275
884 3300025254 Ga0209148_1000078 Ga0209148_1000078161 275
885 3300025256 Ga0209759_1000005 Ga0209759_1000005455 275
886 3300025256 Ga0209759_1000321 Ga0209759_100032161 275
887 3300025258 Ga0209129_1000019 Ga0209129_100001982 275
888 3300025258 Ga0209129_1000026 Ga0209129_1000026145 275
889 3300025258 Ga0209129_1000355 Ga0209129_100035525 275
890 3300025258 Ga0209129_1005510 Ga0209129_10055103 275
891 3300025258 Ga0209129_1009076 Ga0209129_10090763 275
892 3300025261 Ga0209233_1000267 Ga0209233_100026726 275
893 3300025272 Ga0209455_1000193 Ga0209455_100019322 275
894 3300025272 Ga0209455_1007742 Ga0209455_10077424 275
895 3300025273 Ga0209673_1000132 Ga0209673_100013279 275
896 3300025273 Ga0209673_1000294 Ga0209673_100029481 275
897 3300025273 Ga0209673_1000769 Ga0209673_100076923 275
898 3300025273 Ga0209673_1004058 Ga0209673_10040584 275
899 3300025273 Ga0209673_1009831 Ga0209673_10098312 275
900 3300025273 Ga0209673_1020714 Ga0209673_10207142 275
901 3300025284 Ga0209130_1000019 Ga0209130_1000019292 275
902 3300025284 Ga0209130_1000048 Ga0209130_100004880 275
903 3300025284 Ga0209130_1000136 Ga0209130_100013672 275
904 3300025284 Ga0209130_1000880 Ga0209130_100088021 275
905 3300025294 Ga0209025_1000035 Ga0209025_1000035145 275
906 3300025294 Ga0209025_1000086 Ga0209025_100008611 275
907 3300025294 Ga0209025_1000260 Ga0209025_100026042 275
908 3300025294 Ga0209025_1000429 Ga0209025_100042929 275
909 3300025294 Ga0209025_1001953 Ga0209025_10019533 275
910 3300025294 Ga0209025_1002615 Ga0209025_10026154 275
911 3300025294 Ga0209025_1033127 Ga0209025_10331272 275
912 3300025295 Ga0209564_1000336 Ga0209564_100033647 275
913 3300025295 Ga0209564_1003025 Ga0209564_100302511 275
914 3300025295 Ga0209564_1004439 Ga0209564_10044395 275
915 3300025295 Ga0209564_1015925 Ga0209564_10159253 275
916 3300025295 Ga0209564_1024109 Ga0209564_10241092 275
917 3300025297 Ga0209758_1000040 Ga0209758_1000040145 275
918 3300025297 Ga0209758_1000113 Ga0209758_100011360 275
919 3300025297 Ga0209758_1001643 Ga0209758_10016436 275
920 3300025297 Ga0209758_1001704 Ga0209758_10017048 275
921 3300025297 Ga0209758_1001926 Ga0209758_10019265 275
922 3300025297 Ga0209758_1003645 Ga0209758_100364513 275
923 3300025298 Ga0209050_1027588 Ga0209050_10275883 275
924 3300025299 Ga0209256_1000406 Ga0209256_100040623 275
925 3300025299 Ga0209256_1000458 Ga0209256_100045851 275
926 3300025299 Ga0209256_1002794 Ga0209256_10027947 275
927 3300025299 Ga0209256_1003916 Ga0209256_10039166 275
928 3300025299 Ga0209256_1005862 Ga0209256_10058627 275
929 3300025299 Ga0209256_1033673 Ga0209256_10336731 275
930 3300025302 Ga0207426_1000005 Ga0207426_1000005316 275
931 3300025302 Ga0207426_1000085 Ga0207426_1000085138 275
932 3300025302 Ga0207426_1000136 Ga0207426_100013680 275
933 3300025302 Ga0207426_1000253 Ga0207426_100025372 275
934 3300025302 Ga0207426_1000282 Ga0207426_100028255 275
935 3300025302 Ga0207426_1001460 Ga0207426_100146011 275
936 3300025303 Ga0209051_1000027 Ga0209051_1000027168 275
937 3300025303 Ga0209051_1000683 Ga0209051_100068316 275
938 3300025303 Ga0209051_1009482 Ga0209051_10094824 275
939 3300025303 Ga0209051_1031954 Ga0209051_10319542 275
940 3300025303 Ga0209051_1033827 Ga0209051_10338272 275
941 3300025304 Ga0209257_1002682 Ga0209257_100268215 275
942 3300025304 Ga0209257_1045051 Ga0209257_10450512 275
943 3300025315 Ga0207697_10112743 Ga0207697_101127432 275
944 3300025904 Ga0207647_10094323 Ga0207647_100943231 275
945 3300025904 Ga0207647_10109953 Ga0207647_101099532 275
946 3300025907 Ga0207645_10233473 Ga0207645_102334731 275
947 3300025911 Ga0207654_10185523 Ga0207654_101855231 275
948 3300025913 Ga0207695_10001787 Ga0207695_1000178729 275
949 3300025913 Ga0207695_10073535 Ga0207695_100735352 275
950 3300025913 Ga0207695_10092791 Ga0207695_100927911 275
951 3300025913 Ga0207695_10242221 Ga0207695_102422211 275
952 3300025914 Ga0207671_10001180 Ga0207671_100011804 275
953 3300025914 Ga0207671_10093157 Ga0207671_100931571 275
954 3300025914 Ga0207671_10427833 Ga0207671_104278331 275
955 3300025919 Ga0207657_10084423 Ga0207657_100844232 275
956 3300025923 Ga0207681_10107413 Ga0207681_101074132 275
957 3300025924 Ga0207694_10438262 Ga0207694_104382621 275
958 3300025931 Ga0207644_10081718 Ga0207644_100817181 275
959 3300025935 Ga0207709_10031495 Ga0207709_100314952 275
960 3300025949 Ga0207667_10151194 Ga0207667_101511941 275
961 3300025981 Ga0207640_10031700 Ga0207640_100317001 275
962 3300026067 Ga0207678_10109651 Ga0207678_101096511 275
963 3300026067 Ga0207678_10118778 Ga0207678_101187783 275
964 3300026078 Ga0207702_10187823 Ga0207702_101878233 275
965 3300026089 Ga0207648_10213992 Ga0207648_102139922 275
966 3300027111 Ga0209281_1000324 Ga0209281_100032457 275
967 3300027312 Ga0209371_1001530 Ga0209371_100153013 275
968 3300028379 Ga0268266_10237125 Ga0268266_102371252 275
969 3300028379 Ga0268266_10502036 Ga0268266_105020361 275
970 3300028794 Ga0307515_10000600 Ga0307515_1000060059 275
971 3300028794 Ga0307515_10009781 Ga0307515_100097813 275
972 3300028794 Ga0307515_10020996 Ga0307515_1002099611 275
973 3300030500 Ga0268256_1008348 Ga0268256_10083483 275
974 3300031456 Ga0307513_10011937 Ga0307513_100119376 275
975 3300031456 Ga0307513_10047322 Ga0307513_100473222 275
976 3300031911 Ga0307412_10092257 Ga0307412_100922571 275
977 3300031995 Ga0307409_100124291 Ga0307409_1001242912 275
978 3300033180 Ga0307510_10135414 Ga0307510_101354142 275
979 3300035692 Ga0373935_0170708 Ga0373935_0170708_64_891 275
980 3300037418 Ga0395900_0114319 Ga0395900_0114319_103_930 275
981 3300037471 Ga0395905_0002837 Ga0395905_0002837_2795_3622 275
982 3300037471 Ga0395905_0014703 Ga0395905_0014703_2880_3707 275
983 3300038443 Ga0395901_0487128 Ga0395901_0487128_230_1057 275
984 3300039062 Ga0400483_053333 Ga0400483_053333_1917_2744 275
985 3300039062 Ga0400483_207099 Ga0400483_207099_873_1700 275
986 3300039062 Ga0400483_248197 Ga0400483_248197_11781_12608 275
987 3300039447 Ga0436361_0461858 Ga0436361_0461858_278_1105 275
988 3300041413 Ga0439465_0007152 Ga0439465_0007152_2152_2979 275
989 3300041486 Ga0451807_0129412 Ga0451807_0129412_199_1026 275
990 3300041491 Ga0451833_0686416 Ga0451833_0686416_298_1161 275
991 3300041494 Ga0451837_0068141 Ga0451837_0068141_845_1708 275
992 3300041496 Ga0451839_1281927 Ga0451839_1281927_30_857 275
993 3300041501 Ga0451845_0137671 Ga0451845_0137671_2872_3699 275
994 3300041505 Ga0451849_0442680 Ga0451849_0442680_35_898 275
995 3300042115 Ga0450911_000950 Ga0450911_000950_3218_4048 275
996 3300044765 Ga0466970_0024161 Ga0466970_0024161_2133_2960 275
997 3300045836 Ga0466958_0105608 Ga0466958_0105608_188_1015 275
998 3300045976 Ga0466967_0064933 Ga0466967_0064933_644_1471 275
999 3300046460 Ga0495638_0010418 Ga0495638_0010418_2406_3233 275
1000 3300046460 Ga0495638_0016913 Ga0495638_0016913_3140_3967 275
1001 3300046460 Ga0495638_0036817 Ga0495638_0036817_896_1723 275
1002 3300046460 Ga0495638_0057351 Ga0495638_0057351_1111_1938 275
1003 3300046473 Ga0495582_0104979 Ga0495582_0104979_228_1055 275
1004 3300046474 Ga0495605_0010332 Ga0495605_0010332_1250_2077 275
1005 3300046476 Ga0495662_0007048 Ga0495662_0007048_4160_4987 275
1006 3300046492 Ga0495585_0043690 Ga0495585_0043690_1518_2345 275
1007 3300046492 Ga0495585_0057352 Ga0495585_0057352_1302_2129 275
1008 3300046501 Ga0495607_0048625 Ga0495607_0048625_1375_2202 275
1009 3300046506 Ga0495583_0007023 Ga0495583_0007023_2977_3804 275
1010 3300046507 Ga0495606_0070429 Ga0495606_0070429_598_1425 275
1011 3300046512 Ga0495610_0039308 Ga0495610_0039308_913_1740 275
1012 3300046512 Ga0495610_0093831 Ga0495610_0093831_92_919 275
1013 3300046513 Ga0495616_0022870 Ga0495616_0022870_2488_3315 275
1014 3300046519 Ga0495632_0000580 Ga0495632_0000580_3240_4067 275
1015 3300046519 Ga0495632_0050768 Ga0495632_0050768_557_1384 275
1016 3300046519 Ga0495632_0136501 Ga0495632_0136501_183_1010 275
1017 3300046522 Ga0495643_0050726 Ga0495643_0050726_801_1628 275
1018 3300046522 Ga0495643_0063215 Ga0495643_0063215_939_1766 275
1019 3300046524 Ga0495648_0149659 Ga0495648_0149659_171_998 275
1020 3300046536 Ga0495587_0053800 Ga0495587_0053800_438_1265 275
1021 3300046557 Ga0495622_0054120 Ga0495622_0054120_941_1768 275
1022 3300046558 Ga0495633_0056048 Ga0495633_0056048_398_1225 275
1023 3300046558 Ga0495633_0112875 Ga0495633_0112875_125_952 275
1024 3300046616 Ga0495668_0005998 Ga0495668_0005998_6544_7371 275
1025 3300046616 Ga0495668_0026359 Ga0495668_0026359_247_1074 275
1026 3300046616 Ga0495668_0061969 Ga0495668_0061969_464_1291 275
1027 3300046648 Ga0495611_0055176 Ga0495611_0055176_687_1514 275
1028 3300046660 Ga0495625_0005332 Ga0495625_0005332_663_1490 275
1029 3300046660 Ga0495625_0156277 Ga0495625_0156277_214_1041 275
1030 3300046660 Ga0495625_0177144 Ga0495625_0177144_51_878 275
1031 3300046674 Ga0495588_0046862 Ga0495588_0046862_1339_2166 275
1032 3300046674 Ga0495588_0202711 Ga0495588_0202711_170_997 275
1033 3300046675 Ga0495657_0041489 Ga0495657_0041489_158_985 275
1034 3300046691 Ga0495670_0089120 Ga0495670_0089120_49_876 275
1035 3300046694 Ga0495649_0078547 Ga0495649_0078547_780_1607 275
1036 3300046809 Ga0495600_0044239 Ga0495600_0044239_1927_2754 275
1037 3300046810 Ga0495660_0129272 Ga0495660_0129272_141_968 275
1038 3300047317 Ga0495604_0298541 Ga0495604_0298541_188_1015 275
1039 3300047320 Ga0495672_0033153 Ga0495672_0033153_917_1744 275
1040 3300047443 Ga0495687_048937 Ga0495687_048937_489_1316 275
1041 3300047472 Ga0495686_0000090 Ga0495686_0000090_111830_112657 275
1042 3300047472 Ga0495686_0028957 Ga0495686_0028957_2742_3569 275
1043 3300047472 Ga0495686_0179551 Ga0495686_0179551_108_935 275
1044 3300048091 Ga0495626_0036637 Ga0495626_0036637_1359_2186 275
1045 3300048903 Ga0496100_0077211 Ga0496100_0077211_210_1037 275
1046 3300048904 Ga0496101_0195619 Ga0496101_0195619_180_1007 275
1047 3300048905 Ga0496102_0006548 Ga0496102_0006548_2363_3190 275
1048 3300048905 Ga0496102_0096533 Ga0496102_0096533_37_864 275
1049 3300048905 Ga0496102_0233839 Ga0496102_0233839_137_964 275
1050 3300048907 Ga0496104_0006663 Ga0496104_0006663_6207_7034 275
1051 3300048908 Ga0496105_0013397 Ga0496105_0013397_3368_4195 275
1052 3300048909 Ga0496106_0010859 Ga0496106_0010859_521_1348 275
1053 3300048913 Ga0496110_0068147 Ga0496110_0068147_533_1360 275
1054 3300048915 Ga0496112_0138438 Ga0496112_0138438_169_996 275
1055 3300048916 Ga0496113_0134848 Ga0496113_0134848_379_1206 275
1056 3300048916 Ga0496113_0381006 Ga0496113_0381006_148_975 275
1057 3300048917 Ga0496114_0080049 Ga0496114_0080049_343_1170 275
1058 3300048919 Ga0496116_0012255 Ga0496116_0012255_562_1389 275
1059 3300048919 Ga0496116_0015393 Ga0496116_0015393_122_949 275
1060 3300048919 Ga0496116_0124313 Ga0496116_0124313_618_1445 275
1061 3300048921 Ga0496118_0023323 Ga0496118_0023323_2533_3360 275
1062 3300048921 Ga0496118_0035125 Ga0496118_0035125_3009_3836 275
1063 3300048921 Ga0496118_0199529 Ga0496118_0199529_262_1089 275
1064 3300048922 Ga0496119_0005459 Ga0496119_0005459_3391_4218 275
1065 3300048922 Ga0496119_0109201 Ga0496119_0109201_568_1395 275
1066 3300048923 Ga0496120_0027697 Ga0496120_0027697_2504_3331 275
1067 3300048924 Ga0496121_0033217 Ga0496121_0033217_1183_2010 275
1068 3300048924 Ga0496121_0057064 Ga0496121_0057064_1850_2677 275
1069 3300048924 Ga0496121_0064534 Ga0496121_0064534_170_997 275
1070 3300048924 Ga0496121_0108000 Ga0496121_0108000_299_1126 275
1071 3300048924 Ga0496121_0141279 Ga0496121_0141279_789_1616 275
1072 3300048924 Ga0496121_0257131 Ga0496121_0257131_361_1188 275
1073 3300048925 Ga0496122_0000032 Ga0496122_0000032_202831_203721 275
1074 3300048925 Ga0496122_0012353 Ga0496122_0012353_5752_6579 275
1075 3300048925 Ga0496122_0015169 Ga0496122_0015169_616_1443 275
1076 3300048925 Ga0496122_0051078 Ga0496122_0051078_370_1197 275
1077 3300048925 Ga0496122_0054557 Ga0496122_0054557_517_1344 275
1078 3300048926 Ga0496123_0000093 Ga0496123_0000093_41960_42850 275
1079 3300048926 Ga0496123_0042260 Ga0496123_0042260_1809_2636 275
1080 3300048926 Ga0496123_0060381 Ga0496123_0060381_1182_2009 275
1081 3300048926 Ga0496123_0069607 Ga0496123_0069607_325_1152 275
1082 3300048926 Ga0496123_0125794 Ga0496123_0125794_585_1412 275
1083 3300048926 Ga0496123_0154125 Ga0496123_0154125_10_837 275
1084 3300048927 Ga0496124_0000462 Ga0496124_0000462_14944_15771 275
1085 3300048927 Ga0496124_0033583 Ga0496124_0033583_2329_3156 275
1086 3300048927 Ga0496124_0037008 Ga0496124_0037008_2373_3200 275
1087 3300048927 Ga0496124_0058531 Ga0496124_0058531_1850_2677 275
1088 3300048927 Ga0496124_0062278 Ga0496124_0062278_2004_2831 275
1089 3300048927 Ga0496124_0062682 Ga0496124_0062682_503_1330 275
1090 3300048927 Ga0496124_0211750 Ga0496124_0211750_426_1253 275
1091 3300048927 Ga0496124_0223496 Ga0496124_0223496_456_1286 275
1092 3300048928 Ga0496125_0000041 Ga0496125_0000041_250091_250981 275
1093 3300048928 Ga0496125_0035663 Ga0496125_0035663_598_1425 275
1094 3300048928 Ga0496125_0065455 Ga0496125_0065455_252_1079 275
1095 3300048929 Ga0496126_0000299 Ga0496126_0000299_60344_61171 275
1096 3300048929 Ga0496126_0031652 Ga0496126_0031652_3872_4699 275
1097 3300048929 Ga0496126_0059530 Ga0496126_0059530_600_1427 275
1098 3300048929 Ga0496126_0205133 Ga0496126_0205133_307_1134 275
1099 3300048929 Ga0496126_0436567 Ga0496126_0436567_50_877 275
1100 3300049568 Ga0501031_0042691 Ga0501031_0042691_210_1037 275
1101 3300049569 Ga0501032_0002804 Ga0501032_0002804_10792_11619 275
1102 3300049570 Ga0501033_0000230 Ga0501033_0000230_45363_46229 275
1103 3300049570 Ga0501033_0003721 Ga0501033_0003721_10180_11007 275
1104 3300049570 Ga0501033_0133747 Ga0501033_0133747_397_1251 275
1105 3300049571 Ga0501034_0006050 Ga0501034_0006050_10305_11132 275
1106 3300049571 Ga0501034_0157348 Ga0501034_0157348_107_934 275
1107 3300049572 Ga0501036_0003490 Ga0501036_0003490_1933_2760 275
1108 3300049572 Ga0501036_0097039 Ga0501036_0097039_836_1702 275
1109 3300049573 Ga0501037_0000168 Ga0501037_0000168_54160_55026 275
1110 3300049573 Ga0501037_0006255 Ga0501037_0006255_5537_6364 275
1111 3300049573 Ga0501037_0081368 Ga0501037_0081368_353_1180 275
1112 3300049573 Ga0501037_0220950 Ga0501037_0220950_439_1266 275
1113 3300049574 Ga0501038_0037392 Ga0501038_0037392_466_1293 275
1114 3300049575 Ga0501039_0002578 Ga0501039_0002578_1936_2763 275
1115 3300049579 Ga0501043_0000005 Ga0501043_0000005_117410_118276 275
1116 3300049579 Ga0501043_0003499 Ga0501043_0003499_10797_11624 275
1117 3300049579 Ga0501043_0020903 Ga0501043_0020903_1839_2666 275
1118 3300049580 Ga0501046_0001795 Ga0501046_0001795_1366_2193 275
1119 3300049581 Ga0501047_0003954 Ga0501047_0003954_11172_11999 275
1120 3300049581 Ga0501047_0091469 Ga0501047_0091469_1771_2598 275
1121 3300049581 Ga0501047_0165623 Ga0501047_0165623_827_1654 275
1122 3300049581 Ga0501047_0219239 Ga0501047_0219239_412_1278 275
1123 3300049582 Ga0501048_0084355 Ga0501048_0084355_988_1815 275
1124 3300049584 Ga0501068_0054375 Ga0501068_0054375_837_1664 275
1125 3300049585 Ga0501069_0000011 Ga0501069_0000011_112721_113587 275
1126 3300049586 Ga0501070_0000055 Ga0501070_0000055_87978_88844 275
1127 3300049586 Ga0501070_0041312 Ga0501070_0041312_2442_3269 275
1128 3300049587 Ga0501071_0021385 Ga0501071_0021385_2667_3533 275
1129 3300049587 Ga0501071_0256306 Ga0501071_0256306_334_1161 275
1130 3300049589 Ga0501073_0006917 Ga0501073_0006917_4588_5454 275
1131 3300049590 Ga0501074_0000039 Ga0501074_0000039_55913_56779 275
1132 3300049742 Ga0501080_0003073 Ga0501080_0003073_1909_2775 275
1133 3300049742 Ga0501080_0094202 Ga0501080_0094202_712_1539 275
1134 3300049742 Ga0501080_0243924 Ga0501080_0243924_18_845 275
1135 3300049744 Ga0501083_0000180 Ga0501083_0000180_11072_11938 275
1136 3300049744 Ga0501083_0013857 Ga0501083_0013857_3856_4683 275
1137 3300049822 Ga0501035_0000938 Ga0501035_0000938_20541_21407 275
1138 3300049822 Ga0501035_0003248 Ga0501035_0003248_12816_13643 275
1139 3300049823 Ga0501044_0001322 Ga0501044_0001322_20521_21387 275
1140 3300049823 Ga0501044_0093752 Ga0501044_0093752_100_927 275
1141 3300049823 Ga0501044_0261919 Ga0501044_0261919_723_1550 275
1142 3300049824 Ga0501045_0051923 Ga0501045_0051923_1395_2222 275
1143 3300049824 Ga0501045_0299384 Ga0501045_0299384_332_1159 275
1144 3300050489 nmdc:mga03683_37146_c1 nmdc:mga03683_37146_c1_220_1047 275
1145 3300050491 nmdc:mga00v17_47269_c1 nmdc:mga00v17_47269_c1_1035_1862 275
1146 3300050491 nmdc:mga00v17_92493_c1 nmdc:mga00v17_92493_c1_964_1836 275
1147 3300050492 nmdc:mga0yw44_61545_c1 nmdc:mga0yw44_61545_c1_1242_2069 275
1148 3300050492 nmdc:mga0yw44_7008_c1 nmdc:mga0yw44_7008_c1_2821_3693 275
1149 3300050493 nmdc:mga0k408_249901_c1 nmdc:mga0k408_249901_c1_145_972 275
1150 3300050494 nmdc:mga06z11_73582_c1 nmdc:mga06z11_73582_c1_290_1162 275
1151 3300050496 nmdc:mga07m45_325388_c1 nmdc:mga07m45_325388_c1_21_848 275
1152 3300050516 nmdc:mga0sz30_20678_c1 nmdc:mga0sz30_20678_c1_249_1076 275
1153 3300050516 nmdc:mga0sz30_5210_c1 nmdc:mga0sz30_5210_c1_965_1792 275
1154 3300053083 Ga0495655_0019354 Ga0495655_0019354_289_1116 275
1155 3300053085 Ga0495619_0027540 Ga0495619_0027540_1056_1883 275
1156 3300053086 Ga0500578_0208189 Ga0500578_0208189_244_1071 275
1157 3300053105 Ga0500557_004079 Ga0500557_004079_1879_2706 275
1158 3300053109 Ga0500569_045854 Ga0500569_045854_260_1087 275
1159 3300053122 Ga0500608_051256 Ga0500608_051256_237_1064 275
1160 3300053125 Ga0500618_016039 Ga0500618_016039_849_1676 275
1161 3300053134 Ga0500658_0008530 Ga0500658_0008530_366_1193 275
1162 3300053139 Ga0500568_0006143 Ga0500568_0006143_2988_3815 275
1163 3300053139 Ga0500568_0014722 Ga0500568_0014722_2126_2953 275
1164 3300053148 Ga0500590_017148 Ga0500590_017148_1157_1984 275
1165 3300053153 Ga0500616_0047310 Ga0500616_0047310_690_1517 275
1166 3300053155 Ga0500620_001067 Ga0500620_001067_3217_4083 275
1167 3300053156 Ga0500622_0000207 Ga0500622_0000207_59725_60552 275
1168 3300053158 Ga0500627_0038432 Ga0500627_0038432_527_1354 275
1169 3300053158 Ga0500627_0062772 Ga0500627_0062772_718_1545 275
1170 3300053727 Ga0500611_033516 Ga0500611_033516_178_1005 275
1171 3300053727 Ga0500611_046080 Ga0500611_046080_103_930 275
1172 3300053730 Ga0500645_011310 Ga0500645_011310_303_1130 275
1173 3300054114 Ga0501084_0389354 Ga0501084_0389354_234_1061 275
1174 iso_pu_bacteria 2516143018 2516207910 275
1175 iso_pu_bacteria 637000159 637078884 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16896

PGDH_C

Phosphogluconate dehydrogenase (decarboxylating) C-term

141

295

0.99

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

23

117

0.89

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

23

115

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t57-assembly1.cif.gz_A-2 crystal structure of a semialdehyde dehydrogenase nad-binding protein from cupriavidus necator in complex with calcium and nad 0.9362 1 275
5t57-assembly1.cif.gz_A-2 crystal structure of a semialdehyde dehydrogenase nad-binding protein from cupriavidus necator in complex with calcium and nad 0.933 1 275
3c24-assembly1.cif.gz_B crystal structure of a putative oxidoreductase (yp_511008.1) from jannaschia sp. ccs1 at 1.62 a resolution 0.9221 2 274
3c24-assembly1.cif.gz_B crystal structure of a putative oxidoreductase (yp_511008.1) from jannaschia sp. ccs1 at 1.62 a resolution 0.9031 2 274
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.7989 3 93
ID Description Score Start End Superfamily
5t57A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9602 1 174 3.40.50.720
5t57A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9496 1 174 3.40.50.720
3c24B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9469 2 174 3.40.50.720
3c24B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9254 2 174 3.40.50.720
af_Q58582_1_364_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8395 2 35 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A4R1WWN5-F1-model_v4 Coenzyme F420-dependent NADP oxidoreductase-like protein 1.003 1 91
AF-A0A4Z1C3Y9-F1-model_v4 Semialdehyde dehydrogenase 0.9959 1 83
AF-A0A3C0PKF1-F1-model_v4 Semialdehyde dehydrogenase 0.9949 1 60
AF-A0A5R2N7Q4-F1-model_v4 Semialdehyde dehydrogenase 0.9929 1 107
AF-A0A4R1WWN5-F1-model_v4 Coenzyme F420-dependent NADP oxidoreductase-like protein 0.9917 1 91

Feature Viewer

pLDDT pTM Quality
89.3 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map