F491240
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1175 | 898 | 515 | 273 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10400100|Ga0105243_104001002 |
| Length | 295 |
| Sequence | VIDSSYQLRYLIEKIERRGNMTAIALFGAGGKMGYRLAKNLKGSRFDVRHVEVSDAGKARLKNDLGIDCVGADEGLAGADVVILAVPDTAIGKVATGIVGKLKPGTMVVALDAAAPFAGHLPERADLTYFVTHPCHPPIFNDETDMQAKKDHFGGLFAKQHIVSALMQGPEAAYDLGEEIAKVIWAPVMRSHRVTVDQMAMLEPGLSETVCASLLVVMRQAMDECVARGVPAEAARDFLLGHMNVLGAVIFKEVDGVFSDACNKAIEFGIPALMRDDWKKVFEPQEIAESIRRIT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 8 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 9 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 10 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 11 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 12 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 13 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 14 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 15 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 16 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 17 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 18 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 19 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 20 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 21 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 22 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 23 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 24 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 25 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 26 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 27 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 28 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 29 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 30 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 31 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 32 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 33 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 34 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 35 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 36 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 37 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 38 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 39 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 40 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 41 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 42 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 43 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 44 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 45 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 46 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 47 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 48 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 49 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 50 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 51 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 52 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 53 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 54 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 55 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 56 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 57 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 58 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 59 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 60 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 61 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 62 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 63 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 64 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 65 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 66 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 67 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 68 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 69 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 70 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 71 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 72 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 73 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 74 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 75 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 76 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 77 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 78 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 79 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 80 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 81 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 82 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 83 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 84 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 85 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 86 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 87 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 88 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 89 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 90 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 91 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 92 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 93 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 94 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 95 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 96 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 97 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 98 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 99 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 100 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 101 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 102 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 103 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 104 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 105 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 106 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 107 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 108 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 109 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 110 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 111 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 112 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 113 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 114 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 115 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 116 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 117 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 118 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 119 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 120 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 121 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 122 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 123 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 124 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 125 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 126 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 127 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 128 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 129 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 130 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 131 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 132 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 133 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 134 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 135 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 136 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 137 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 138 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 139 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 140 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 141 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 142 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 143 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 144 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 145 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 146 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 147 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 148 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 149 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 150 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 151 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 152 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 153 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 154 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 155 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 156 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 157 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 158 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 159 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 160 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 161 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 162 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 163 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 164 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 165 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 166 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 167 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 168 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 169 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 170 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 171 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 172 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 173 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 174 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 175 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 176 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 177 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 178 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 179 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 180 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 181 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 182 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 183 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 184 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 185 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 186 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 187 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 188 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 189 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 190 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 191 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 192 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 193 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 194 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 195 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 196 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 197 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 198 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 199 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 200 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 201 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 202 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 203 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 204 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 205 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 206 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 207 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 208 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 209 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 210 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 211 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 212 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 213 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 214 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 215 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 216 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 217 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 218 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 219 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 220 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 221 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 222 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 223 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 224 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 225 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 226 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 227 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 228 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 229 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 230 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 231 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 232 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 233 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 234 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 235 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 236 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 237 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 238 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 239 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 240 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 241 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 242 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 243 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 244 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 245 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 246 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 247 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 248 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 249 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 250 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 251 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 252 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 253 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 254 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 255 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 256 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 257 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 258 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 259 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 260 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 261 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 262 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 263 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 264 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 265 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 266 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 267 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 268 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 269 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 270 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 271 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 272 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 273 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 274 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 275 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 276 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 277 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 278 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 279 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 280 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 281 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 282 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 283 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 284 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 285 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 286 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 287 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 288 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 289 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 290 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 291 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 292 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 293 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 294 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 295 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 296 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 297 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 298 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 299 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 300 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 301 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 302 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 303 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 304 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 305 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 306 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 307 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 308 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 309 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 310 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 311 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 312 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 313 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 314 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 315 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 316 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 317 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 318 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 319 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 320 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 321 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 322 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 323 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 324 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 325 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 326 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 327 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 328 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 329 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 330 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 331 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 332 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 333 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 334 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 335 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 336 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 337 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 338 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 339 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 340 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 341 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 342 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 343 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 344 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 345 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 346 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 347 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 348 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 349 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 350 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 351 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 352 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 353 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 354 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 355 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 356 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 357 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 358 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 359 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 360 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 361 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 362 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 363 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 364 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 365 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 366 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 367 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 368 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 369 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 370 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 371 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 372 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 373 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 374 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 375 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 376 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 377 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 378 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 379 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 380 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 381 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 382 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 383 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 384 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 385 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 386 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 387 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 388 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 389 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 390 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 391 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 392 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 393 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 394 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 395 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 396 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 397 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 398 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 399 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 400 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 401 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 402 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 403 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 404 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 405 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 406 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 407 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 408 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 409 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 410 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 411 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 412 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 413 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 414 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 415 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 416 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 417 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 418 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 419 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 420 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 421 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 422 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 423 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 424 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 425 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 426 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 427 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 428 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 429 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 430 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 431 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 432 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 433 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 434 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 435 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 436 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 437 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 438 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 439 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 440 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 441 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 442 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 443 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 444 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 445 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 446 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 447 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 448 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 449 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 450 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 451 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 452 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 453 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 454 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 455 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 456 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 457 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 458 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 459 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 460 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 461 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 462 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 463 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 464 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 465 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 466 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 467 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 468 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 469 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 470 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 471 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 472 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 473 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 474 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 475 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 476 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 477 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 478 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 479 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 480 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 481 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 482 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 483 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 484 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 485 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 486 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 487 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 488 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 489 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 490 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 491 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 492 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 493 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 494 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 495 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 496 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 497 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 498 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 499 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 500 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 501 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 502 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 503 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 504 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 505 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 506 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 507 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 508 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 509 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 510 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 511 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 512 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 513 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 514 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 515 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 516 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 517 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 518 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 519 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 520 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 521 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 522 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 523 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 524 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 525 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 526 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 527 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 528 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 529 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 530 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 531 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 532 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 533 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 534 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 535 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 536 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 537 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 538 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 539 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 540 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 541 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 542 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 543 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 544 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 545 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 546 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 547 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 548 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 549 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 550 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 551 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 552 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 553 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 554 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 555 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 556 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 557 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 558 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 559 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 560 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 561 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 562 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 563 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 564 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 565 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 566 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 567 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 568 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 569 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 570 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 571 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 572 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 573 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 574 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 575 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 576 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 577 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 578 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 579 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 580 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 581 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 582 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 583 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 584 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 585 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 586 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 587 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 588 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 589 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 590 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 591 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 592 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 593 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 594 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 595 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 596 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 597 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 598 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 599 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 600 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 601 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 602 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 603 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 604 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 605 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 606 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 607 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 608 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 609 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 610 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 611 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 612 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 613 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 614 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 615 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 616 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 617 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 618 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 619 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 620 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 621 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 622 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 623 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 624 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 625 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 626 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 627 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 628 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 629 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 630 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 631 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 632 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 633 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 634 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 635 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 636 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 637 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 638 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 639 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 640 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 641 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 642 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 643 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 644 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 645 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 646 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 647 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 648 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 649 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 650 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 651 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 652 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 653 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 654 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 655 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 656 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 657 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 658 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 659 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 660 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 661 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 662 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 663 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 664 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 665 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 666 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 667 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 668 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 669 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 670 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 671 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 672 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 673 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 674 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 675 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 676 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 677 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 678 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 679 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 680 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 681 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 682 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 683 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 684 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 685 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 686 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 687 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 688 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 689 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 690 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 691 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 692 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 693 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 694 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 695 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 696 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 697 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 698 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 699 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 700 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 701 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 702 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 703 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 704 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 705 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 706 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 707 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 708 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 709 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 710 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 711 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 712 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 713 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 714 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 715 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 716 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 717 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 718 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 719 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 720 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 721 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 722 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 723 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 724 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 725 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 726 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 727 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 728 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 729 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 730 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 731 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 732 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 733 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 734 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 735 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 736 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 737 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 738 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 739 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 740 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 741 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 742 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 743 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 744 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 745 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 746 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 747 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 748 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 749 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 750 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 751 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 752 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 753 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 754 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 755 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 756 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 757 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 761 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 764 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 765 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 766 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 767 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 773 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 774 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 775 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 776 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 777 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 778 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 779 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 780 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 781 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 782 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 783 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 784 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 785 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 786 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 787 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 788 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 789 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 790 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 791 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 792 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 793 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 794 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 795 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 796 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 797 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 798 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 799 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 800 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 801 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 802 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 803 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 804 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 805 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 806 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 807 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 808 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 809 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 810 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 811 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 812 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 813 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 814 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 815 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 816 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 817 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 818 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 819 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 820 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 821 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 822 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 823 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 824 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 825 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 826 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 827 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 828 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 829 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 830 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 831 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 832 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 833 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 834 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 835 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 836 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 837 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 838 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 839 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 840 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 841 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 842 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 843 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 844 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 845 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 846 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 847 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 848 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 849 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 850 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 851 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 852 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 853 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 854 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 855 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 856 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 857 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 858 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 859 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 860 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 861 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 862 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 863 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 864 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 865 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 866 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 867 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 868 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 869 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 870 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 871 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 872 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 873 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 874 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 875 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 876 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 877 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 878 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 879 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 880 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 881 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 882 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 883 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 884 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 885 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 886 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 887 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 888 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 889 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 890 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 891 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 892 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 893 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 894 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 895 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 896 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 897 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 898 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 43.83 |
| Metatranscriptomes | 0 |
| Isolates | 56.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.02 |
| Nodule | 46.55 |
| Rhizoplane | 1.36 |
| Rhizosphere | 21.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002929 | 3300001979 | Bacteria | 7591 |
| 2 | JGI24740J21852_10003704 | 3300001979 | Bacteria | 6660 |
| 3 | JGI25155J39150_1000015 | 3300002704 | Bacteria | 178839 |
| 4 | JGI25155J39150_1000039 | 3300002704 | Bacteria | 91670 |
| 5 | JGI25156J39149_1000007 | 3300002705 | Bacteria | 252108 |
| 6 | JGI25156J39149_1000427 | 3300002705 | Bacteria | 26123 |
| 7 | JGI25162J39368_1000248 | 3300002737 | Bacteria | 53932 |
| 8 | JGI25162J39368_1001265 | 3300002737 | Bacteria | 14427 |
| 9 | JGI25154J39366_1000051 | 3300002738 | Bacteria | 123608 |
| 10 | JGI25154J39366_1000077 | 3300002738 | Bacteria | 90455 |
| 11 | JGI25158J39367_1000619 | 3300002739 | Bacteria | 7054 |
| 12 | JGI25158J39367_1008405 | 3300002739 | Bacteria | 1435 |
| 13 | JGI25157J39369_1000012 | 3300002741 | Bacteria | 205167 |
| 14 | JGI25157J39369_1000065 | 3300002741 | Bacteria | 98536 |
| 15 | JGI25157J39369_1003126 | 3300002741 | Bacteria | 3554 |
| 16 | JGI25152J39213_1000465 | 3300002773 | Bacteria | 23613 |
| 17 | JGI25152J39213_1000472 | 3300002773 | Bacteria | 23443 |
| 18 | JGI25152J39213_1004792 | 3300002773 | Bacteria | 4151 |
| 19 | JGI25152J39213_1004925 | 3300002773 | Bacteria | 4051 |
| 20 | JGI25152J39213_1008170 | 3300002773 | Bacteria | 2623 |
| 21 | JGI25152J39213_1008377 | 3300002773 | Bacteria | 2571 |
| 22 | JGI25152J39213_1012900 | 3300002773 | Bacteria | 1766 |
| 23 | JGI25150J39212_1000219 | 3300002774 | Bacteria | 31283 |
| 24 | JGI25150J39212_1004081 | 3300002774 | Bacteria | 3303 |
| 25 | JGI25159J45721_1000036 | 3300002987 | Bacteria | 76363 |
| 26 | JGI25159J45721_1000101 | 3300002987 | Bacteria | 41224 |
| 27 | JGI25159J45721_1000321 | 3300002987 | Bacteria | 22253 |
| 28 | JGI25159J45721_1015705 | 3300002987 | Bacteria | 1646 |
| 29 | JGI25151J46595_10000007 | 3300003187 | Bacteria | 411751 |
| 30 | JGI25151J46595_10000463 | 3300003187 | Bacteria | 38967 |
| 31 | JGI25151J46595_10000667 | 3300003187 | Bacteria | 29187 |
| 32 | JGI25165J46597_1000102 | 3300003214 | Bacteria | 155002 |
| 33 | JGI25165J46597_1000280 | 3300003214 | Bacteria | 65126 |
| 34 | JGI25153J46596_10000254 | 3300003215 | Bacteria | 43730 |
| 35 | JGI25153J46596_10001626 | 3300003215 | Bacteria | 13317 |
| 36 | JGI25153J46596_10002799 | 3300003215 | Bacteria | 9916 |
| 37 | JGI25153J46596_10015061 | 3300003215 | Bacteria | 3173 |
| 38 | JGI25153J46596_10019229 | 3300003215 | Bacteria | 2623 |
| 39 | JGI25153J46596_10019269 | 3300003215 | Bacteria | 2620 |
| 40 | JGI25160J50197_1000023 | 3300003354 | Bacteria | 200692 |
| 41 | JGI25160J50197_1000060 | 3300003354 | Bacteria | 116870 |
| 42 | JGI25160J50197_1001918 | 3300003354 | Bacteria | 9954 |
| 43 | JGI25160J50197_1003006 | 3300003354 | Bacteria | 7693 |
| 44 | JGI25160J50197_1004431 | 3300003354 | Bacteria | 6072 |
| 45 | JGI25161J50226_1000012 | 3300003374 | Bacteria | 200668 |
| 46 | JGI25161J50226_1000085 | 3300003374 | Bacteria | 76182 |
| 47 | JGI25161J50226_1003468 | 3300003374 | Bacteria | 3596 |
| 48 | Ga0055539_1007968 | 3300003752 | Bacteria | 1332 |
| 49 | Ga0055532_1000005 | 3300003758 | Bacteria | 458107 |
| 50 | Ga0055535_1010294 | 3300003761 | Bacteria | 1547 |
| 51 | Ga0055542_1000516 | 3300003762 | Bacteria | 34984 |
| 52 | Ga0055529_1002054 | 3300003763 | Bacteria | 4355 |
| 53 | Ga0055526_1010257 | 3300003771 | Bacteria | 4381 |
| 54 | Ga0055526_1023182 | 3300003771 | Bacteria | 2081 |
| 55 | Ga0055524_1000668 | 3300003775 | Bacteria | 24115 |
| 56 | Ga0055524_1001911 | 3300003775 | Bacteria | 11282 |
| 57 | Ga0055524_1003923 | 3300003775 | Bacteria | 7044 |
| 58 | Ga0055524_1007862 | 3300003775 | Bacteria | 4485 |
| 59 | Ga0055528_1000098 | 3300003790 | Bacteria | 69408 |
| 60 | Ga0055528_1010345 | 3300003790 | Bacteria | 3799 |
| 61 | Ga0055528_1023585 | 3300003790 | Bacteria | 1872 |
| 62 | Ga0055528_1028713 | 3300003790 | Bacteria | 1527 |
| 63 | Ga0055540_1000209 | 3300003792 | Bacteria | 55602 |
| 64 | Ga0055540_1000331 | 3300003792 | Bacteria | 41202 |
| 65 | Ga0055540_1007076 | 3300003792 | Bacteria | 4311 |
| 66 | Ga0055540_1010000 | 3300003792 | Bacteria | 3199 |
| 67 | Ga0055543_1000009 | 3300004625 | Bacteria | 200706 |
| 68 | Ga0055543_1000036 | 3300004625 | Bacteria | 126054 |
| 69 | Ga0055543_1000456 | 3300004625 | Bacteria | 24226 |
| 70 | Ga0055543_1001244 | 3300004625 | Bacteria | 10574 |
| 71 | Ga0065165_1000064 | 3300005262 | Bacteria | 175153 |
| 72 | Ga0065165_1000160 | 3300005262 | Bacteria | 116908 |
| 73 | Ga0065165_1004819 | 3300005262 | Bacteria | 8031 |
| 74 | Ga0065165_1010462 | 3300005262 | Bacteria | 4005 |
| 75 | Ga0065165_1038647 | 3300005262 | Bacteria | 1437 |
| 76 | Ga0070658_10084741 | 3300005327 | Bacteria | 2606 |
| 77 | Ga0070658_10507521 | 3300005327 | Bacteria | 1042 |
| 78 | Ga0070670_100000091 | 3300005331 | Bacteria | 85664 |
| 79 | Ga0070666_10414433 | 3300005335 | Bacteria | 970 |
| 80 | Ga0070663_100061340 | 3300005455 | Bacteria | 2708 |
| 81 | Ga0070662_100282860 | 3300005457 | Bacteria | 1343 |
| 82 | Ga0070665_100085721 | 3300005548 | Bacteria | 3156 |
| 83 | Ga0070665_100127474 | 3300005548 | Bacteria | 2547 |
| 84 | Ga0070665_100318075 | 3300005548 | Bacteria | 1560 |
| 85 | Ga0070665_100427913 | 3300005548 | Bacteria | 1333 |
| 86 | Ga0068855_100077744 | 3300005563 | Bacteria | 3850 |
| 87 | Ga0068855_100158898 | 3300005563 | Bacteria | 2566 |
| 88 | Ga0068855_100168949 | 3300005563 | Bacteria | 2477 |
| 89 | Ga0068856_100014552 | 3300005614 | Bacteria | 7603 |
| 90 | Ga0068856_100115886 | 3300005614 | Bacteria | 2679 |
| 91 | Ga0068852_100059893 | 3300005616 | Bacteria | 3304 |
| 92 | Ga0068852_100313587 | 3300005616 | Bacteria | 1521 |
| 93 | Ga0081540_1033097 | 3300005983 | Bacteria | 2812 |
| 94 | Ga0075365_10000172 | 3300006038 | Bacteria | 20817 |
| 95 | Ga0075365_10001466 | 3300006038 | Bacteria | 10717 |
| 96 | Ga0075365_10025992 | 3300006038 | Bacteria | 3711 |
| 97 | Ga0075365_10026133 | 3300006038 | Bacteria | 3703 |
| 98 | Ga0075365_10205622 | 3300006038 | Bacteria | 1380 |
| 99 | Ga0075365_10362670 | 3300006038 | Bacteria | 1022 |
| 100 | Ga0075368_10016305 | 3300006042 | Bacteria | 2769 |
| 101 | Ga0075368_10036990 | 3300006042 | Bacteria | 1908 |
| 102 | Ga0075363_100028079 | 3300006048 | Bacteria | 2891 |
| 103 | Ga0075363_100087992 | 3300006048 | Bacteria | 1707 |
| 104 | Ga0075363_100147532 | 3300006048 | Bacteria | 1327 |
| 105 | Ga0075363_100212230 | 3300006048 | Bacteria | 1108 |
| 106 | Ga0075364_10005092 | 3300006051 | Bacteria | 7617 |
| 107 | Ga0075364_10151592 | 3300006051 | Bacteria | 1562 |
| 108 | Ga0075364_10203081 | 3300006051 | Bacteria | 1343 |
| 109 | Ga0075362_10001315 | 3300006177 | Bacteria | 7871 |
| 110 | Ga0075362_10014772 | 3300006177 | Bacteria | 3160 |
| 111 | Ga0075362_10019696 | 3300006177 | Bacteria | 2810 |
| 112 | Ga0075362_10060749 | 3300006177 | Bacteria | 1709 |
| 113 | Ga0075367_10000610 | 3300006178 | Bacteria | 13715 |
| 114 | Ga0075367_10010220 | 3300006178 | Bacteria | 4923 |
| 115 | Ga0075369_10009522 | 3300006186 | Bacteria | 3777 |
| 116 | Ga0075369_10015575 | 3300006186 | Bacteria | 3055 |
| 117 | Ga0075369_10035877 | 3300006186 | Bacteria | 2109 |
| 118 | Ga0075369_10199926 | 3300006186 | Bacteria | 922 |
| 119 | Ga0075366_10020620 | 3300006195 | Bacteria | 3826 |
| 120 | Ga0075366_10071119 | 3300006195 | Bacteria | 2073 |
| 121 | Ga0075370_10024328 | 3300006353 | Bacteria | 3344 |
| 122 | Ga0075370_10060832 | 3300006353 | Bacteria | 2152 |
| 123 | Ga0075370_10083295 | 3300006353 | Bacteria | 1840 |
| 124 | Ga0068871_100558134 | 3300006358 | Bacteria | 1038 |
| 125 | Ga0099826_10046495 | 3300006948 | Bacteria | 2957 |
| 126 | Ga0105251_10063362 | 3300009011 | Bacteria | 1735 |
| 127 | Ga0105250_10028565 | 3300009092 | Bacteria | 2246 |
| 128 | Ga0105240_10447998 | 3300009093 | Bacteria | 1445 |
| 129 | Ga0105240_10466817 | 3300009093 | Bacteria | 1409 |
| 130 | Ga0105243_10044145 | 3300009148 | Bacteria | 3495 |
| 131 | Ga0105243_10335769 | 3300009148 | Bacteria | 1382 |
| 132 | Ga0105243_10400100 | 3300009148 | Bacteria | 1275 |
| 133 | Ga0105241_10279619 | 3300009174 | Bacteria | 1425 |
| 134 | Ga0105237_10093671 | 3300009545 | Bacteria | 2993 |
| 135 | Ga0105237_10202804 | 3300009545 | Bacteria | 1984 |
| 136 | Ga0105237_10481706 | 3300009545 | Bacteria | 1247 |
| 137 | Ga0105238_10240918 | 3300009551 | Bacteria | 1786 |
| 138 | Ga0123342_1013959 | 3300009766 | Bacteria | 7848 |
| 139 | Ga0105239_10081004 | 3300010375 | Bacteria | 3573 |
| 140 | Ga0105239_10098741 | 3300010375 | Bacteria | 3228 |
| 141 | Ga0105239_10748260 | 3300010375 | Bacteria | 1119 |
| 142 | Ga0105246_10161217 | 3300011119 | Bacteria | 1708 |
| 143 | Ga0157371_10284446 | 3300013102 | Bacteria | 1195 |
| 144 | Ga0157370_10066457 | 3300013104 | Bacteria | 3410 |
| 145 | Ga0157370_10071003 | 3300013104 | Bacteria | 3286 |
| 146 | Ga0157369_10399495 | 3300013105 | Bacteria | 1426 |
| 147 | Ga0157378_10175215 | 3300013297 | Bacteria | 2014 |
| 148 | Ga0157378_10761791 | 3300013297 | Bacteria | 991 |
| 149 | Ga0163162_10227863 | 3300013306 | Bacteria | 1994 |
| 150 | Ga0163162_10311892 | 3300013306 | Bacteria | 1705 |
| 151 | Ga0182008_10013713 | 3300014497 | Bacteria | 4259 |
| 152 | Ga0157376_10471664 | 3300014969 | Bacteria | 1228 |
| 153 | Ga0182005_1004600 | 3300015265 | Bacteria | 4428 |
| 154 | Ga0214544_1002772 | 3300021320 | Bacteria | 36640 |
| 155 | Ga0214542_1001092 | 3300021321 | Bacteria | 54418 |
| 156 | Ga0214542_1017459 | 3300021321 | Bacteria | 6471 |
| 157 | Ga0214543_1000025 | 3300021327 | Bacteria | 225351 |
| 158 | Ga0214543_1009334 | 3300021327 | Bacteria | 15337 |
| 159 | Ga0228711_1000005 | 3300022739 | Bacteria | 215594 |
| 160 | Ga0228710_1000018 | 3300022740 | Bacteria | 118600 |
| 161 | Ga0209435_100006 | 3300025206 | Bacteria | 542459 |
| 162 | Ga0209435_100043 | 3300025206 | Bacteria | 102049 |
| 163 | Ga0209435_100050 | 3300025206 | Bacteria | 91356 |
| 164 | Ga0209436_100133 | 3300025208 | Bacteria | 36901 |
| 165 | Ga0209436_100661 | 3300025208 | Bacteria | 14676 |
| 166 | Ga0209436_108885 | 3300025208 | Bacteria | 1956 |
| 167 | Ga0209672_102334 | 3300025228 | Bacteria | 4796 |
| 168 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 169 | Ga0209437_100062 | 3300025233 | Bacteria | 336900 |
| 170 | Ga0209437_100259 | 3300025233 | Bacteria | 82489 |
| 171 | Ga0209437_100281 | 3300025233 | Bacteria | 74945 |
| 172 | Ga0209258_100385 | 3300025242 | Bacteria | 56396 |
| 173 | Ga0207425_1000018 | 3300025245 | Bacteria | 411841 |
| 174 | Ga0207425_1003306 | 3300025245 | Bacteria | 5222 |
| 175 | Ga0209646_1000015 | 3300025246 | Bacteria | 542459 |
| 176 | Ga0209646_1000161 | 3300025246 | Bacteria | 91356 |
| 177 | Ga0209646_1002525 | 3300025246 | Bacteria | 4003 |
| 178 | Ga0209026_1000046 | 3300025250 | Bacteria | 262031 |
| 179 | Ga0209026_1000173 | 3300025250 | Bacteria | 98585 |
| 180 | Ga0209026_1000327 | 3300025250 | Bacteria | 48226 |
| 181 | Ga0209677_102857 | 3300025253 | Bacteria | 6087 |
| 182 | Ga0209148_1000078 | 3300025254 | Bacteria | 296101 |
| 183 | Ga0209759_1000005 | 3300025256 | Bacteria | 542459 |
| 184 | Ga0209759_1000169 | 3300025256 | Bacteria | 110110 |
| 185 | Ga0209759_1000321 | 3300025256 | Bacteria | 63590 |
| 186 | Ga0209129_1000019 | 3300025258 | Bacteria | 460802 |
| 187 | Ga0209129_1000026 | 3300025258 | Bacteria | 411839 |
| 188 | Ga0209129_1000355 | 3300025258 | Bacteria | 38491 |
| 189 | Ga0209129_1005510 | 3300025258 | Bacteria | 4446 |
| 190 | Ga0209129_1009076 | 3300025258 | Bacteria | 2672 |
| 191 | Ga0209233_1000082 | 3300025261 | Bacteria | 336320 |
| 192 | Ga0209233_1000267 | 3300025261 | Bacteria | 74945 |
| 193 | Ga0209455_1000193 | 3300025272 | Bacteria | 90413 |
| 194 | Ga0209455_1007742 | 3300025272 | Bacteria | 2994 |
| 195 | Ga0209673_1000132 | 3300025273 | Bacteria | 162349 |
| 196 | Ga0209673_1000294 | 3300025273 | Bacteria | 93050 |
| 197 | Ga0209673_1000769 | 3300025273 | Bacteria | 43317 |
| 198 | Ga0209673_1004058 | 3300025273 | Bacteria | 8094 |
| 199 | Ga0209673_1009831 | 3300025273 | Bacteria | 4097 |
| 200 | Ga0209673_1020714 | 3300025273 | Bacteria | 2321 |
| 201 | Ga0209130_1000019 | 3300025284 | Bacteria | 381993 |
| 202 | Ga0209130_1000048 | 3300025284 | Bacteria | 233357 |
| 203 | Ga0209130_1000136 | 3300025284 | Bacteria | 116996 |
| 204 | Ga0209130_1000880 | 3300025284 | Bacteria | 24560 |
| 205 | Ga0209025_1000035 | 3300025294 | Bacteria | 411841 |
| 206 | Ga0209025_1000086 | 3300025294 | Bacteria | 262586 |
| 207 | Ga0209025_1000260 | 3300025294 | Bacteria | 124240 |
| 208 | Ga0209025_1000429 | 3300025294 | Bacteria | 83306 |
| 209 | Ga0209025_1001953 | 3300025294 | Bacteria | 23804 |
| 210 | Ga0209025_1002615 | 3300025294 | Bacteria | 18501 |
| 211 | Ga0209025_1033127 | 3300025294 | Bacteria | 2396 |
| 212 | Ga0209564_1000336 | 3300025295 | Bacteria | 90930 |
| 213 | Ga0209564_1003025 | 3300025295 | Bacteria | 12006 |
| 214 | Ga0209564_1004439 | 3300025295 | Bacteria | 8589 |
| 215 | Ga0209564_1015925 | 3300025295 | Bacteria | 3031 |
| 216 | Ga0209564_1024109 | 3300025295 | Bacteria | 2088 |
| 217 | Ga0209758_1000040 | 3300025297 | Bacteria | 411841 |
| 218 | Ga0209758_1000113 | 3300025297 | Bacteria | 202528 |
| 219 | Ga0209758_1001643 | 3300025297 | Bacteria | 25398 |
| 220 | Ga0209758_1001704 | 3300025297 | Bacteria | 24679 |
| 221 | Ga0209758_1001926 | 3300025297 | Bacteria | 22572 |
| 222 | Ga0209758_1003645 | 3300025297 | Bacteria | 13739 |
| 223 | Ga0209050_1027588 | 3300025298 | Bacteria | 1867 |
| 224 | Ga0209256_1000406 | 3300025299 | Bacteria | 68202 |
| 225 | Ga0209256_1000458 | 3300025299 | Bacteria | 61611 |
| 226 | Ga0209256_1002794 | 3300025299 | Bacteria | 13381 |
| 227 | Ga0209256_1003916 | 3300025299 | Bacteria | 9837 |
| 228 | Ga0209256_1005862 | 3300025299 | Bacteria | 6811 |
| 229 | Ga0209256_1033673 | 3300025299 | Bacteria | 1374 |
| 230 | Ga0207426_1000005 | 3300025302 | Bacteria | 1037188 |
| 231 | Ga0207426_1000085 | 3300025302 | Bacteria | 293171 |
| 232 | Ga0207426_1000136 | 3300025302 | Bacteria | 201401 |
| 233 | Ga0207426_1000253 | 3300025302 | Bacteria | 116996 |
| 234 | Ga0207426_1000282 | 3300025302 | Bacteria | 104108 |
| 235 | Ga0207426_1001460 | 3300025302 | Bacteria | 19554 |
| 236 | Ga0209051_1000027 | 3300025303 | Bacteria | 412172 |
| 237 | Ga0209051_1000683 | 3300025303 | Bacteria | 37689 |
| 238 | Ga0209051_1009482 | 3300025303 | Bacteria | 5012 |
| 239 | Ga0209051_1031954 | 3300025303 | Bacteria | 2016 |
| 240 | Ga0209051_1033827 | 3300025303 | Bacteria | 1925 |
| 241 | Ga0209257_1002682 | 3300025304 | Bacteria | 17053 |
| 242 | Ga0209257_1045051 | 3300025304 | Bacteria | 1283 |
| 243 | Ga0207697_10112743 | 3300025315 | Bacteria | 1165 |
| 244 | Ga0207647_10094323 | 3300025904 | Bacteria | 1783 |
| 245 | Ga0207647_10109953 | 3300025904 | Bacteria | 1630 |
| 246 | Ga0207645_10233473 | 3300025907 | Bacteria | 1214 |
| 247 | Ga0207654_10185523 | 3300025911 | Bacteria | 1360 |
| 248 | Ga0207695_10001787 | 3300025913 | Bacteria | 33929 |
| 249 | Ga0207695_10073535 | 3300025913 | Bacteria | 3483 |
| 250 | Ga0207695_10092791 | 3300025913 | Bacteria | 3029 |
| 251 | Ga0207695_10242221 | 3300025913 | Bacteria | 1704 |
| 252 | Ga0207671_10001180 | 3300025914 | Bacteria | 31086 |
| 253 | Ga0207671_10093157 | 3300025914 | Bacteria | 2272 |
| 254 | Ga0207671_10427833 | 3300025914 | Bacteria | 1053 |
| 255 | Ga0207657_10084423 | 3300025919 | Bacteria | 2661 |
| 256 | Ga0207681_10107413 | 3300025923 | Bacteria | 2024 |
| 257 | Ga0207694_10438262 | 3300025924 | Bacteria | 1090 |
| 258 | Ga0207650_10000723 | 3300025925 | Bacteria | 25614 |
| 259 | Ga0207644_10081718 | 3300025931 | Bacteria | 2389 |
| 260 | Ga0207709_10031495 | 3300025935 | Bacteria | 3098 |
| 261 | Ga0207667_10011758 | 3300025949 | Bacteria | 10150 |
| 262 | Ga0207667_10151194 | 3300025949 | Bacteria | 2389 |
| 263 | Ga0207640_10031700 | 3300025981 | Bacteria | 3269 |
| 264 | Ga0207639_10030476 | 3300026041 | Bacteria | 3956 |
| 265 | Ga0207678_10109651 | 3300026067 | Bacteria | 2354 |
| 266 | Ga0207678_10118778 | 3300026067 | Bacteria | 2256 |
| 267 | Ga0207702_10187823 | 3300026078 | Bacteria | 1907 |
| 268 | Ga0207648_10213992 | 3300026089 | Bacteria | 1711 |
| 269 | Ga0209281_1000111 | 3300027111 | Bacteria | 215615 |
| 270 | Ga0209281_1000324 | 3300027111 | Bacteria | 84060 |
| 271 | Ga0209371_1001530 | 3300027312 | Bacteria | 15320 |
| 272 | Ga0209282_1000012 | 3300027666 | Bacteria | 215614 |
| 273 | Ga0209813_10001917 | 3300027866 | Bacteria | 4688 |
| 274 | Ga0268266_10237125 | 3300028379 | Bacteria | 1682 |
| 275 | Ga0268266_10502036 | 3300028379 | Bacteria | 1158 |
| 276 | Ga0268266_10660093 | 3300028379 | Bacteria | 1007 |
| 277 | Ga0307515_10000600 | 3300028794 | Bacteria | 83981 |
| 278 | Ga0307515_10009781 | 3300028794 | Bacteria | 18477 |
| 279 | Ga0307515_10020996 | 3300028794 | Bacteria | 11605 |
| 280 | Ga0268256_1008348 | 3300030500 | Bacteria | 3558 |
| 281 | Ga0307513_10011937 | 3300031456 | Bacteria | 10755 |
| 282 | Ga0307513_10047322 | 3300031456 | Bacteria | 4680 |
| 283 | Ga0307516_10082289 | 3300031730 | Bacteria | 3061 |
| 284 | Ga0307405_10008618 | 3300031731 | Bacteria | 5182 |
| 285 | Ga0307412_10092257 | 3300031911 | Bacteria | 2122 |
| 286 | Ga0315914_1000007 | 3300031967 | Bacteria | 215597 |
| 287 | Ga0307409_100124291 | 3300031995 | Bacteria | 2192 |
| 288 | Ga0307510_10117355 | 3300033180 | Bacteria | 2379 |
| 289 | Ga0307510_10135414 | 3300033180 | Bacteria | 2122 |
| 290 | Ga0315913_1000003 | 3300033430 | Bacteria | 215608 |
| 291 | Ga0315915_1000011 | 3300033464 | Bacteria | 215597 |
| 292 | Ga0373935_0170708 | 3300035692 | Bacteria | 1488 |
| 293 | Ga0395900_0114319 | 3300037418 | Bacteria | 2770 |
| 294 | Ga0395905_0002837 | 3300037471 | Bacteria | 18981 |
| 295 | Ga0395905_0014703 | 3300037471 | Bacteria | 7464 |
| 296 | Ga0395901_0487128 | 3300038443 | Bacteria | 1257 |
| 297 | Ga0400483_053333 | 3300039062 | Bacteria | 4251 |
| 298 | Ga0400483_207099 | 3300039062 | Bacteria | 1889 |
| 299 | Ga0400483_248197 | 3300039062 | Bacteria | 15606 |
| 300 | Ga0436361_0461858 | 3300039447 | Bacteria | 1249 |
| 301 | Ga0439465_0007152 | 3300041413 | Bacteria | 3548 |
| 302 | Ga0439465_0084896 | 3300041413 | Bacteria | 1077 |
| 303 | Ga0451807_0129412 | 3300041486 | Bacteria | 1394 |
| 304 | Ga0451833_0686416 | 3300041491 | Bacteria | 1333 |
| 305 | Ga0451837_0068141 | 3300041494 | Bacteria | 1880 |
| 306 | Ga0451839_1281927 | 3300041496 | Bacteria | 1113 |
| 307 | Ga0451845_0137671 | 3300041501 | Bacteria | 3871 |
| 308 | Ga0451849_0442680 | 3300041505 | Bacteria | 1094 |
| 309 | Ga0450911_000950 | 3300042115 | Bacteria | 7568 |
| 310 | Ga0466970_0024161 | 3300044765 | Bacteria | 3177 |
| 311 | Ga0466958_0105608 | 3300045836 | Bacteria | 1755 |
| 312 | Ga0466967_0064933 | 3300045976 | Bacteria | 3248 |
| 313 | Ga0495638_0010418 | 3300046460 | Bacteria | 6457 |
| 314 | Ga0495638_0016913 | 3300046460 | Bacteria | 4875 |
| 315 | Ga0495638_0036817 | 3300046460 | Bacteria | 3115 |
| 316 | Ga0495638_0057351 | 3300046460 | Bacteria | 2415 |
| 317 | Ga0495582_0104979 | 3300046473 | Bacteria | 1584 |
| 318 | Ga0495605_0010332 | 3300046474 | Bacteria | 5226 |
| 319 | Ga0495662_0007048 | 3300046476 | Bacteria | 5583 |
| 320 | Ga0495585_0043690 | 3300046492 | Bacteria | 2505 |
| 321 | Ga0495585_0057352 | 3300046492 | Bacteria | 2149 |
| 322 | Ga0495607_0048625 | 3300046501 | Bacteria | 2479 |
| 323 | Ga0495583_0007023 | 3300046506 | Bacteria | 7203 |
| 324 | Ga0495606_0070429 | 3300046507 | Bacteria | 2205 |
| 325 | Ga0495610_0039308 | 3300046512 | Bacteria | 2394 |
| 326 | Ga0495610_0093831 | 3300046512 | Bacteria | 1355 |
| 327 | Ga0495616_0022870 | 3300046513 | Bacteria | 3370 |
| 328 | Ga0495632_0000580 | 3300046519 | Bacteria | 33943 |
| 329 | Ga0495632_0050768 | 3300046519 | Bacteria | 2044 |
| 330 | Ga0495632_0136501 | 3300046519 | Bacteria | 1140 |
| 331 | Ga0495643_0050726 | 3300046522 | Bacteria | 2234 |
| 332 | Ga0495643_0063215 | 3300046522 | Bacteria | 1958 |
| 333 | Ga0495648_0149659 | 3300046524 | Bacteria | 1219 |
| 334 | Ga0495587_0053800 | 3300046536 | Bacteria | 2373 |
| 335 | Ga0495622_0054120 | 3300046557 | Bacteria | 1862 |
| 336 | Ga0495633_0056048 | 3300046558 | Bacteria | 1852 |
| 337 | Ga0495633_0112875 | 3300046558 | Bacteria | 1260 |
| 338 | Ga0495668_0005998 | 3300046616 | Bacteria | 8065 |
| 339 | Ga0495668_0026359 | 3300046616 | Bacteria | 3299 |
| 340 | Ga0495668_0061969 | 3300046616 | Bacteria | 2062 |
| 341 | Ga0495611_0055176 | 3300046648 | Bacteria | 1797 |
| 342 | Ga0495625_0005332 | 3300046660 | Bacteria | 11778 |
| 343 | Ga0495625_0156277 | 3300046660 | Bacteria | 1530 |
| 344 | Ga0495625_0177144 | 3300046660 | Bacteria | 1420 |
| 345 | Ga0495625_0192444 | 3300046660 | Bacteria | 1350 |
| 346 | Ga0495588_0046862 | 3300046674 | Bacteria | 2218 |
| 347 | Ga0495588_0202711 | 3300046674 | Bacteria | 1048 |
| 348 | Ga0495657_0041489 | 3300046675 | Bacteria | 3148 |
| 349 | Ga0495670_0089120 | 3300046691 | Bacteria | 1578 |
| 350 | Ga0495649_0078547 | 3300046694 | Bacteria | 1766 |
| 351 | Ga0495600_0044239 | 3300046809 | Bacteria | 2905 |
| 352 | Ga0495660_0129272 | 3300046810 | Bacteria | 1269 |
| 353 | Ga0495604_0298541 | 3300047317 | Bacteria | 1082 |
| 354 | Ga0495672_0033153 | 3300047320 | Bacteria | 3203 |
| 355 | Ga0495687_048937 | 3300047443 | Bacteria | 1810 |
| 356 | Ga0495686_0000090 | 3300047472 | Bacteria | 193179 |
| 357 | Ga0495686_0028957 | 3300047472 | Bacteria | 3605 |
| 358 | Ga0495686_0179551 | 3300047472 | Bacteria | 1227 |
| 359 | Ga0495626_0036637 | 3300048091 | Bacteria | 2336 |
| 360 | Ga0496100_0077211 | 3300048903 | Bacteria | 2238 |
| 361 | Ga0496101_0195619 | 3300048904 | Bacteria | 1562 |
| 362 | Ga0496102_0006548 | 3300048905 | Bacteria | 9945 |
| 363 | Ga0496102_0096533 | 3300048905 | Bacteria | 2740 |
| 364 | Ga0496102_0233839 | 3300048905 | Bacteria | 1733 |
| 365 | Ga0496104_0006663 | 3300048907 | Bacteria | 10165 |
| 366 | Ga0496105_0013397 | 3300048908 | Bacteria | 6507 |
| 367 | Ga0496106_0010859 | 3300048909 | Bacteria | 6729 |
| 368 | Ga0496110_0068147 | 3300048913 | Bacteria | 3149 |
| 369 | Ga0496112_0138438 | 3300048915 | Bacteria | 2404 |
| 370 | Ga0496113_0134848 | 3300048916 | Bacteria | 1939 |
| 371 | Ga0496113_0381006 | 3300048916 | Bacteria | 1132 |
| 372 | Ga0496114_0080049 | 3300048917 | Bacteria | 2759 |
| 373 | Ga0496116_0012255 | 3300048919 | Bacteria | 7012 |
| 374 | Ga0496116_0015393 | 3300048919 | Bacteria | 6046 |
| 375 | Ga0496116_0029090 | 3300048919 | Bacteria | 3989 |
| 376 | Ga0496116_0124313 | 3300048919 | Bacteria | 1485 |
| 377 | Ga0496118_0023323 | 3300048921 | Bacteria | 5378 |
| 378 | Ga0496118_0035125 | 3300048921 | Bacteria | 4076 |
| 379 | Ga0496118_0199529 | 3300048921 | Bacteria | 1187 |
| 380 | Ga0496119_0005459 | 3300048922 | Bacteria | 12172 |
| 381 | Ga0496119_0109201 | 3300048922 | Bacteria | 1538 |
| 382 | Ga0496120_0027697 | 3300048923 | Bacteria | 3481 |
| 383 | Ga0496121_0033217 | 3300048924 | Bacteria | 4673 |
| 384 | Ga0496121_0042909 | 3300048924 | Bacteria | 3925 |
| 385 | Ga0496121_0057064 | 3300048924 | Bacteria | 3239 |
| 386 | Ga0496121_0064534 | 3300048924 | Bacteria | 2985 |
| 387 | Ga0496121_0108000 | 3300048924 | Bacteria | 2129 |
| 388 | Ga0496121_0141279 | 3300048924 | Bacteria | 1786 |
| 389 | Ga0496121_0257131 | 3300048924 | Bacteria | 1208 |
| 390 | Ga0496122_0000032 | 3300048925 | Bacteria | 327099 |
| 391 | Ga0496122_0012353 | 3300048925 | Bacteria | 8520 |
| 392 | Ga0496122_0015169 | 3300048925 | Bacteria | 7384 |
| 393 | Ga0496122_0051078 | 3300048925 | Bacteria | 3146 |
| 394 | Ga0496122_0054557 | 3300048925 | Bacteria | 3000 |
| 395 | Ga0496123_0000093 | 3300048926 | Bacteria | 179205 |
| 396 | Ga0496123_0042260 | 3300048926 | Bacteria | 3148 |
| 397 | Ga0496123_0060381 | 3300048926 | Bacteria | 2445 |
| 398 | Ga0496123_0069607 | 3300048926 | Bacteria | 2208 |
| 399 | Ga0496123_0125794 | 3300048926 | Bacteria | 1431 |
| 400 | Ga0496123_0154125 | 3300048926 | Bacteria | 1235 |
| 401 | Ga0496124_0000462 | 3300048927 | Bacteria | 70383 |
| 402 | Ga0496124_0033583 | 3300048927 | Bacteria | 4512 |
| 403 | Ga0496124_0037008 | 3300048927 | Bacteria | 4248 |
| 404 | Ga0496124_0058531 | 3300048927 | Bacteria | 3240 |
| 405 | Ga0496124_0062278 | 3300048927 | Bacteria | 3122 |
| 406 | Ga0496124_0062682 | 3300048927 | Bacteria | 3110 |
| 407 | Ga0496124_0211750 | 3300048927 | Bacteria | 1466 |
| 408 | Ga0496124_0223496 | 3300048927 | Bacteria | 1414 |
| 409 | Ga0496125_0000041 | 3300048928 | Bacteria | 310158 |
| 410 | Ga0496125_0000256 | 3300048928 | Bacteria | 109696 |
| 411 | Ga0496125_0035663 | 3300048928 | Bacteria | 4357 |
| 412 | Ga0496125_0065455 | 3300048928 | Bacteria | 2879 |
| 413 | Ga0496126_0000299 | 3300048929 | Bacteria | 105208 |
| 414 | Ga0496126_0031652 | 3300048929 | Bacteria | 4993 |
| 415 | Ga0496126_0059530 | 3300048929 | Bacteria | 3439 |
| 416 | Ga0496126_0205133 | 3300048929 | Bacteria | 1662 |
| 417 | Ga0496126_0436567 | 3300048929 | Bacteria | 1056 |
| 418 | Ga0501031_0042691 | 3300049568 | Bacteria | 2959 |
| 419 | Ga0501032_0002804 | 3300049569 | Bacteria | 13554 |
| 420 | Ga0501033_0000230 | 3300049570 | Bacteria | 53911 |
| 421 | Ga0501033_0003721 | 3300049570 | Bacteria | 12406 |
| 422 | Ga0501033_0034559 | 3300049570 | Bacteria | 3791 |
| 423 | Ga0501033_0133747 | 3300049570 | Bacteria | 1795 |
| 424 | Ga0501034_0006050 | 3300049571 | Bacteria | 13067 |
| 425 | Ga0501034_0157348 | 3300049571 | Bacteria | 2245 |
| 426 | Ga0501036_0003490 | 3300049572 | Bacteria | 12566 |
| 427 | Ga0501036_0013901 | 3300049572 | Bacteria | 6694 |
| 428 | Ga0501036_0097039 | 3300049572 | Bacteria | 2492 |
| 429 | Ga0501037_0000168 | 3300049573 | Bacteria | 61484 |
| 430 | Ga0501037_0006255 | 3300049573 | Bacteria | 8703 |
| 431 | Ga0501037_0081368 | 3300049573 | Bacteria | 2348 |
| 432 | Ga0501037_0220950 | 3300049573 | Bacteria | 1333 |
| 433 | Ga0501038_0037392 | 3300049574 | Bacteria | 4256 |
| 434 | Ga0501039_0002578 | 3300049575 | Bacteria | 13540 |
| 435 | Ga0501039_0003147 | 3300049575 | Bacteria | 12348 |
| 436 | Ga0501040_0046610 | 3300049576 | Bacteria | 2959 |
| 437 | Ga0501041_0047053 | 3300049577 | Bacteria | 2625 |
| 438 | Ga0501042_0074543 | 3300049578 | Bacteria | 2429 |
| 439 | Ga0501043_0000005 | 3300049579 | Bacteria | 254466 |
| 440 | Ga0501043_0003499 | 3300049579 | Bacteria | 12912 |
| 441 | Ga0501043_0020903 | 3300049579 | Bacteria | 5133 |
| 442 | Ga0501043_0244018 | 3300049579 | Bacteria | 1385 |
| 443 | Ga0501046_0001795 | 3300049580 | Bacteria | 20473 |
| 444 | Ga0501046_0107718 | 3300049580 | Bacteria | 2132 |
| 445 | Ga0501047_0003954 | 3300049581 | Bacteria | 13934 |
| 446 | Ga0501047_0091469 | 3300049581 | Bacteria | 2921 |
| 447 | Ga0501047_0165623 | 3300049581 | Bacteria | 2081 |
| 448 | Ga0501047_0219239 | 3300049581 | Bacteria | 1759 |
| 449 | Ga0501047_0335658 | 3300049581 | Bacteria | 1350 |
| 450 | Ga0501048_0053391 | 3300049582 | Bacteria | 2874 |
| 451 | Ga0501048_0084355 | 3300049582 | Bacteria | 2240 |
| 452 | Ga0501068_0054375 | 3300049584 | Bacteria | 2425 |
| 453 | Ga0501069_0000011 | 3300049585 | Bacteria | 153214 |
| 454 | Ga0501070_0000055 | 3300049586 | Bacteria | 99156 |
| 455 | Ga0501070_0041312 | 3300049586 | Bacteria | 3842 |
| 456 | Ga0501071_0021385 | 3300049587 | Bacteria | 4504 |
| 457 | Ga0501071_0256306 | 3300049587 | Bacteria | 1321 |
| 458 | Ga0501073_0006917 | 3300049589 | Bacteria | 8445 |
| 459 | Ga0501074_0000039 | 3300049590 | Bacteria | 60866 |
| 460 | Ga0501075_0042175 | 3300049591 | Bacteria | 3421 |
| 461 | Ga0501077_0237820 | 3300049593 | Bacteria | 1158 |
| 462 | Ga0501080_0003073 | 3300049742 | Bacteria | 14742 |
| 463 | Ga0501080_0094202 | 3300049742 | Bacteria | 2781 |
| 464 | Ga0501080_0243924 | 3300049742 | Bacteria | 1639 |
| 465 | Ga0501083_0000180 | 3300049744 | Bacteria | 40737 |
| 466 | Ga0501083_0013857 | 3300049744 | Bacteria | 5636 |
| 467 | Ga0501035_0000938 | 3300049822 | Bacteria | 30768 |
| 468 | Ga0501035_0003248 | 3300049822 | Bacteria | 15578 |
| 469 | Ga0501044_0001322 | 3300049823 | Bacteria | 29176 |
| 470 | Ga0501044_0093752 | 3300049823 | Bacteria | 3027 |
| 471 | Ga0501044_0153060 | 3300049823 | Bacteria | 2288 |
| 472 | Ga0501044_0261919 | 3300049823 | Bacteria | 1667 |
| 473 | Ga0501045_0051923 | 3300049824 | Bacteria | 2992 |
| 474 | Ga0501045_0061123 | 3300049824 | Bacteria | 2763 |
| 475 | Ga0501045_0299384 | 3300049824 | Bacteria | 1197 |
| 476 | nmdc:mga03683_37146_c1 | 3300050489 | Bacteria | 1984 |
| 477 | nmdc:mga00v17_47269_c1 | 3300050491 | Bacteria | 2606 |
| 478 | nmdc:mga00v17_92493_c1 | 3300050491 | Bacteria | 1901 |
| 479 | nmdc:mga0yw44_61545_c1 | 3300050492 | Bacteria | 2304 |
| 480 | nmdc:mga0yw44_7008_c1 | 3300050492 | Bacteria | 5512 |
| 481 | nmdc:mga0k408_164931_c1 | 3300050493 | Bacteria | 1320 |
| 482 | nmdc:mga0k408_249901_c1 | 3300050493 | Bacteria | 1059 |
| 483 | nmdc:mga06z11_73582_c1 | 3300050494 | Bacteria | 1815 |
| 484 | nmdc:mga06z11_9009_c1 | 3300050494 | Bacteria | 4191 |
| 485 | nmdc:mga04h51_2629_c1 | 3300050495 | Bacteria | 4276 |
| 486 | nmdc:mga07m45_325388_c1 | 3300050496 | Bacteria | 894 |
| 487 | nmdc:mga0sz30_20678_c1 | 3300050516 | Bacteria | 2656 |
| 488 | nmdc:mga0sz30_5210_c1 | 3300050516 | Bacteria | 4758 |
| 489 | Ga0500610_0178789 | 3300053079 | Bacteria | 1041 |
| 490 | Ga0495655_0019354 | 3300053083 | Bacteria | 1511 |
| 491 | Ga0495619_0027540 | 3300053085 | Bacteria | 3661 |
| 492 | Ga0500578_0208189 | 3300053086 | Bacteria | 1194 |
| 493 | Ga0500557_004079 | 3300053105 | Bacteria | 3008 |
| 494 | Ga0500569_045854 | 3300053109 | Bacteria | 1300 |
| 495 | Ga0500608_051256 | 3300053122 | Bacteria | 1983 |
| 496 | Ga0500618_000870 | 3300053125 | Bacteria | 16127 |
| 497 | Ga0500618_016039 | 3300053125 | Bacteria | 1882 |
| 498 | Ga0500658_0008530 | 3300053134 | Bacteria | 3784 |
| 499 | Ga0500568_0000070 | 3300053139 | Bacteria | 99663 |
| 500 | Ga0500568_0006143 | 3300053139 | Bacteria | 6076 |
| 501 | Ga0500568_0014722 | 3300053139 | Bacteria | 3521 |
| 502 | Ga0500590_017148 | 3300053148 | Bacteria | 3744 |
| 503 | Ga0500616_0047310 | 3300053153 | Bacteria | 2284 |
| 504 | Ga0500620_001067 | 3300053155 | Bacteria | 4839 |
| 505 | Ga0500622_0000207 | 3300053156 | Bacteria | 62384 |
| 506 | Ga0500627_0024448 | 3300053158 | Bacteria | 2473 |
| 507 | Ga0500627_0038432 | 3300053158 | Bacteria | 2046 |
| 508 | Ga0500627_0062772 | 3300053158 | Bacteria | 1636 |
| 509 | Ga0500636_0259783 | 3300053177 | Bacteria | 880 |
| 510 | Ga0500611_033516 | 3300053727 | Bacteria | 1081 |
| 511 | Ga0500611_046080 | 3300053727 | Bacteria | 979 |
| 512 | Ga0500645_011310 | 3300053730 | Bacteria | 2919 |
| 513 | Ga0501084_0109316 | 3300054114 | Bacteria | 2323 |
| 514 | Ga0501084_0389354 | 3300054114 | Bacteria | 1178 |
| 515 | Ga0501082_0501350 | 3300060353 | Bacteria | 1061 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049570 | Ga0501033_0034559 | Ga0501033_0034559_12_743 | 243 |
| 2 | 3300026041 | Ga0207639_10030476 | Ga0207639_100304762 | 245 |
| 3 | iso_pu_bacteria | 2585427530 | 2585557648 | 254 |
| 4 | 3300028379 | Ga0268266_10660093 | Ga0268266_106600932 | 255 |
| 5 | 3300041413 | Ga0439465_0084896 | Ga0439465_0084896_26_853 | 255 |
| 6 | 3300053139 | Ga0500568_0000070 | Ga0500568_0000070_60960_61856 | 255 |
| 7 | 3300006048 | Ga0075363_100212230 | Ga0075363_1002122302 | 257 |
| 8 | iso_pu_bacteria | 2615840626 | 2616312245 | 257 |
| 9 | 3300031731 | Ga0307405_10008618 | Ga0307405_100086185 | 259 |
| 10 | iso_pu_bacteria | 3004289098 | 3004293291 | 259 |
| 11 | 3300005331 | Ga0070670_100000091 | Ga0070670_10000009119 | 263 |
| 12 | 3300005614 | Ga0068856_100014552 | Ga0068856_1000145522 | 263 |
| 13 | 3300025233 | Ga0209437_100062 | Ga0209437_100062233 | 263 |
| 14 | 3300025261 | Ga0209233_1000082 | Ga0209233_1000082233 | 263 |
| 15 | 3300025925 | Ga0207650_10000723 | Ga0207650_1000072320 | 263 |
| 16 | 3300049581 | Ga0501047_0335658 | Ga0501047_0335658_518_1309 | 263 |
| 17 | 3300053079 | Ga0500610_0178789 | Ga0500610_0178789_231_1022 | 263 |
| 18 | 3300053158 | Ga0500627_0024448 | Ga0500627_0024448_401_1192 | 263 |
| 19 | 3300060353 | Ga0501082_0501350 | Ga0501082_0501350_248_1039 | 263 |
| 20 | iso_pu_bacteria | 2960624210 | 2960625641 | 264 |
| 21 | 3300046660 | Ga0495625_0192444 | Ga0495625_0192444_158_985 | 266 |
| 22 | 3300002704 | JGI25155J39150_1000039 | JGI25155J39150_100003975 | 268 |
| 23 | 3300002705 | JGI25156J39149_1000427 | JGI25156J39149_100042718 | 268 |
| 24 | 3300002738 | JGI25154J39366_1000077 | JGI25154J39366_100007775 | 268 |
| 25 | 3300002741 | JGI25157J39369_1000065 | JGI25157J39369_100006575 | 268 |
| 26 | 3300003758 | Ga0055532_1000005 | Ga0055532_1000005381 | 268 |
| 27 | 3300003761 | Ga0055535_1010294 | Ga0055535_10102942 | 268 |
| 28 | 3300005563 | Ga0068855_100077744 | Ga0068855_1000777442 | 268 |
| 29 | 3300025206 | Ga0209435_100043 | Ga0209435_10004329 | 268 |
| 30 | 3300025206 | Ga0209435_100050 | Ga0209435_10005067 | 268 |
| 31 | 3300025229 | Ga0209147_100011 | Ga0209147_10001154 | 268 |
| 32 | 3300025233 | Ga0209437_100259 | Ga0209437_10025955 | 268 |
| 33 | 3300025242 | Ga0209258_100385 | Ga0209258_10038540 | 268 |
| 34 | 3300025246 | Ga0209646_1000161 | Ga0209646_100016167 | 268 |
| 35 | 3300025250 | Ga0209026_1000173 | Ga0209026_100017328 | 268 |
| 36 | 3300025256 | Ga0209759_1000169 | Ga0209759_100016990 | 268 |
| 37 | 3300025949 | Ga0207667_10011758 | Ga0207667_100117584 | 268 |
| 38 | 3300048919 | Ga0496116_0029090 | Ga0496116_0029090_1446_2282 | 268 |
| 39 | 3300048924 | Ga0496121_0042909 | Ga0496121_0042909_379_1215 | 268 |
| 40 | 3300048928 | Ga0496125_0000256 | Ga0496125_0000256_45044_45874 | 268 |
| 41 | 3300053125 | Ga0500618_000870 | Ga0500618_000870_8750_9583 | 268 |
| 42 | 3300053177 | Ga0500636_0259783 | Ga0500636_0259783_25_858 | 268 |
| 43 | iso_pu_bacteria | 2551306093 | 2551744330 | 269 |
| 44 | iso_pu_bacteria | 2512875026 | 2512968959 | 270 |
| 45 | iso_pu_bacteria | 2513237089 | 2513605979 | 270 |
| 46 | iso_pu_bacteria | 2513237156 | 2513985133 | 270 |
| 47 | iso_pu_bacteria | 2513237160 | 2514005988 | 270 |
| 48 | iso_pu_bacteria | 2517487022 | 2517566288 | 270 |
| 49 | iso_pu_bacteria | 2802428858 | 2802719808 | 270 |
| 50 | iso_pu_bacteria | 2802428859 | 2802727811 | 270 |
| 51 | iso_pu_bacteria | 2802428860 | 2802733311 | 270 |
| 52 | iso_pu_bacteria | 2802428861 | 2802738867 | 270 |
| 53 | iso_pu_bacteria | 2802428862 | 2802745534 | 270 |
| 54 | iso_pu_bacteria | 2802428863 | 2802751299 | 270 |
| 55 | iso_pu_bacteria | 2889790730 | 2889794632 | 270 |
| 56 | iso_pu_bacteria | 2915980308 | 2915984089 | 270 |
| 57 | iso_pu_bacteria | 2916061851 | 2916063398 | 270 |
| 58 | iso_pu_bacteria | 2921250672 | 2921256624 | 270 |
| 59 | iso_pu_bacteria | 2937029754 | 2937033211 | 270 |
| 60 | iso_pu_bacteria | 2937036028 | 2937037660 | 270 |
| 61 | iso_pu_bacteria | 2937078374 | 2937084500 | 270 |
| 62 | iso_pu_bacteria | 2937084907 | 2937087079 | 270 |
| 63 | iso_pu_bacteria | 2937843397 | 2937847707 | 270 |
| 64 | iso_pu_bacteria | 2957375807 | 2957381252 | 270 |
| 65 | iso_pu_bacteria | 2957437181 | 2957437750 | 270 |
| 66 | iso_pu_bacteria | 2960591022 | 2960596910 | 270 |
| 67 | iso_pu_bacteria | 2960631154 | 2960631588 | 270 |
| 68 | iso_pu_bacteria | 2960680706 | 2960684739 | 270 |
| 69 | iso_pu_bacteria | 2960693952 | 2960699898 | 270 |
| 70 | iso_pu_bacteria | 2967686174 | 2967689422 | 270 |
| 71 | iso_pu_bacteria | 2967728569 | 2967730765 | 270 |
| 72 | iso_pu_bacteria | 2970026789 | 2970028550 | 270 |
| 73 | iso_pu_bacteria | 2970122695 | 2970125586 | 270 |
| 74 | iso_pu_bacteria | 2970143518 | 2970146100 | 270 |
| 75 | iso_pu_bacteria | 2977530762 | 2977534819 | 270 |
| 76 | iso_pu_bacteria | 2977544691 | 2977545335 | 270 |
| 77 | iso_pu_bacteria | 8003999396 | 8004004758 | 270 |
| 78 | iso_pu_bacteria | 2503198000 | 2503203827 | 271 |
| 79 | iso_pu_bacteria | 2508501122 | 2509110453 | 271 |
| 80 | iso_pu_bacteria | 2508501123 | 2509117356 | 271 |
| 81 | iso_pu_bacteria | 2508501127 | 2509141383 | 271 |
| 82 | iso_pu_bacteria | 2509276018 | 2509369193 | 271 |
| 83 | iso_pu_bacteria | 2509276019 | 2509379468 | 271 |
| 84 | iso_pu_bacteria | 2509276021 | 2509391087 | 271 |
| 85 | iso_pu_bacteria | 2509276022 | 2509398188 | 271 |
| 86 | iso_pu_bacteria | 2510065019 | 2510135979 | 271 |
| 87 | iso_pu_bacteria | 2510065059 | 2510316915 | 271 |
| 88 | iso_pu_bacteria | 2510461076 | 2510892521 | 271 |
| 89 | iso_pu_bacteria | 2510917022 | 2511135542 | 271 |
| 90 | iso_pu_bacteria | 2510917028 | 2511181541 | 271 |
| 91 | iso_pu_bacteria | 2510917030 | 2511197367 | 271 |
| 92 | iso_pu_bacteria | 2511231052 | 2511497028 | 271 |
| 93 | iso_pu_bacteria | 2512047086 | 2512529482 | 271 |
| 94 | iso_pu_bacteria | 2512875016 | 2512929124 | 271 |
| 95 | iso_pu_bacteria | 2512875024 | 2512963928 | 271 |
| 96 | iso_pu_bacteria | 2513237084 | 2513568282 | 271 |
| 97 | iso_pu_bacteria | 2513237085 | 2513578177 | 271 |
| 98 | iso_pu_bacteria | 2513237086 | 2513582800 | 271 |
| 99 | iso_pu_bacteria | 2513237090 | 2513611303 | 271 |
| 100 | iso_pu_bacteria | 2513237091 | 2513614857 | 271 |
| 101 | iso_pu_bacteria | 2513237093 | 2513634814 | 271 |
| 102 | iso_pu_bacteria | 2513237103 | 2513713824 | 271 |
| 103 | iso_pu_bacteria | 2513237138 | 2513866138 | 271 |
| 104 | iso_pu_bacteria | 2513237143 | 2513901692 | 271 |
| 105 | iso_pu_bacteria | 2513237144 | 2513911974 | 271 |
| 106 | iso_pu_bacteria | 2513237146 | 2513923741 | 271 |
| 107 | iso_pu_bacteria | 2513237159 | 2514000818 | 271 |
| 108 | iso_pu_bacteria | 2513237162 | 2514021918 | 271 |
| 109 | iso_pu_bacteria | 2513237164 | 2514035804 | 271 |
| 110 | iso_pu_bacteria | 2513237305 | 2514421669 | 271 |
| 111 | iso_pu_bacteria | 2515075009 | 2515109079 | 271 |
| 112 | iso_pu_bacteria | 2515154107 | 2515609823 | 271 |
| 113 | iso_pu_bacteria | 2515154107 | 2515611604 | 271 |
| 114 | iso_pu_bacteria | 2515154113 | 2515632416 | 271 |
| 115 | iso_pu_bacteria | 2515154114 | 2515640697 | 271 |
| 116 | iso_pu_bacteria | 2515154116 | 2515661635 | 271 |
| 117 | iso_pu_bacteria | 2515154134 | 2515737895 | 271 |
| 118 | iso_pu_bacteria | 2516653046 | 2516895742 | 271 |
| 119 | iso_pu_bacteria | 2516653077 | 2517041407 | 271 |
| 120 | iso_pu_bacteria | 2516653085 | 2517079958 | 271 |
| 121 | iso_pu_bacteria | 2517093000 | 2517097979 | 271 |
| 122 | iso_pu_bacteria | 2517287029 | 2517410235 | 271 |
| 123 | iso_pu_bacteria | 2524023209 | 2524459256 | 271 |
| 124 | iso_pu_bacteria | 2524023209 | 2524461761 | 271 |
| 125 | iso_pu_bacteria | 2529292951 | 2530648504 | 271 |
| 126 | iso_pu_bacteria | 2534681796 | 2535520236 | 271 |
| 127 | iso_pu_bacteria | 2551306084 | 2551678791 | 271 |
| 128 | iso_pu_bacteria | 2551306084 | 2551682029 | 271 |
| 129 | iso_pu_bacteria | 2551306085 | 2551683341 | 271 |
| 130 | iso_pu_bacteria | 2551306086 | 2551696792 | 271 |
| 131 | iso_pu_bacteria | 2551306087 | 2551700835 | 271 |
| 132 | iso_pu_bacteria | 2551306089 | 2551714346 | 271 |
| 133 | iso_pu_bacteria | 2551306091 | 2551727744 | 271 |
| 134 | iso_pu_bacteria | 2551306092 | 2551735836 | 271 |
| 135 | iso_pu_bacteria | 2558860100 | 2558861403 | 271 |
| 136 | iso_pu_bacteria | 2558860100 | 2558867051 | 271 |
| 137 | iso_pu_bacteria | 2582581283 | 2585167125 | 271 |
| 138 | iso_pu_bacteria | 2582581294 | 2585200684 | 271 |
| 139 | iso_pu_bacteria | 2582581298 | 2585226822 | 271 |
| 140 | iso_pu_bacteria | 2582581299 | 2585230294 | 271 |
| 141 | iso_pu_bacteria | 2582581304 | 2585255268 | 271 |
| 142 | iso_pu_bacteria | 2582581306 | 2585270261 | 271 |
| 143 | iso_pu_bacteria | 2582581307 | 2585272617 | 271 |
| 144 | iso_pu_bacteria | 2582581308 | 2585281177 | 271 |
| 145 | iso_pu_bacteria | 2582581308 | 2585283014 | 271 |
| 146 | iso_pu_bacteria | 2582581315 | 2585327263 | 271 |
| 147 | iso_pu_bacteria | 2582581315 | 2585328653 | 271 |
| 148 | iso_pu_bacteria | 2582581316 | 2585335258 | 271 |
| 149 | iso_pu_bacteria | 2582581316 | 2585335570 | 271 |
| 150 | iso_pu_bacteria | 2582581865 | 2585390483 | 271 |
| 151 | iso_pu_bacteria | 2582581866 | 2585397990 | 271 |
| 152 | iso_pu_bacteria | 2582581867 | 2585404751 | 271 |
| 153 | iso_pu_bacteria | 2585427526 | 2585525802 | 271 |
| 154 | iso_pu_bacteria | 2585427528 | 2585541652 | 271 |
| 155 | iso_pu_bacteria | 2585427529 | 2585550237 | 271 |
| 156 | iso_pu_bacteria | 2585427531 | 2585562285 | 271 |
| 157 | iso_pu_bacteria | 2585427590 | 2585823390 | 271 |
| 158 | iso_pu_bacteria | 2585427593 | 2585840129 | 271 |
| 159 | iso_pu_bacteria | 2585427594 | 2585842654 | 271 |
| 160 | iso_pu_bacteria | 2585427608 | 2585896721 | 271 |
| 161 | iso_pu_bacteria | 2585427609 | 2585906548 | 271 |
| 162 | iso_pu_bacteria | 2585428125 | 2587981970 | 271 |
| 163 | iso_pu_bacteria | 2588253730 | 2588514362 | 271 |
| 164 | iso_pu_bacteria | 2597489875 | 2597815633 | 271 |
| 165 | iso_pu_bacteria | 2599185156 | 2599335323 | 271 |
| 166 | iso_pu_bacteria | 2599185170 | 2599415772 | 271 |
| 167 | iso_pu_bacteria | 2615840624 | 2616294798 | 271 |
| 168 | iso_pu_bacteria | 2615840698 | 2616551939 | 271 |
| 169 | iso_pu_bacteria | 2617270742 | 2617385582 | 271 |
| 170 | iso_pu_bacteria | 2643221595 | 2643986385 | 271 |
| 171 | iso_pu_bacteria | 2643221599 | 2644003978 | 271 |
| 172 | iso_pu_bacteria | 2643221607 | 2644048149 | 271 |
| 173 | iso_pu_bacteria | 2643221610 | 2644067208 | 271 |
| 174 | iso_pu_bacteria | 2643221618 | 2644105960 | 271 |
| 175 | iso_pu_bacteria | 2643221626 | 2644147075 | 271 |
| 176 | iso_pu_bacteria | 2643221627 | 2644152617 | 271 |
| 177 | iso_pu_bacteria | 2643221634 | 2644195469 | 271 |
| 178 | iso_pu_bacteria | 2643221636 | 2644203371 | 271 |
| 179 | iso_pu_bacteria | 2643221643 | 2644237754 | 271 |
| 180 | iso_pu_bacteria | 2643221655 | 2644310572 | 271 |
| 181 | iso_pu_bacteria | 2643221659 | 2644334643 | 271 |
| 182 | iso_pu_bacteria | 2643221675 | 2644418300 | 271 |
| 183 | iso_pu_bacteria | 2643221680 | 2644451722 | 271 |
| 184 | iso_pu_bacteria | 2643221686 | 2644480942 | 271 |
| 185 | iso_pu_bacteria | 2643221689 | 2644497601 | 271 |
| 186 | iso_pu_bacteria | 2643221698 | 2644545162 | 271 |
| 187 | iso_pu_bacteria | 2643221712 | 2644612674 | 271 |
| 188 | iso_pu_bacteria | 2643221726 | 2644691265 | 271 |
| 189 | iso_pu_bacteria | 2667528174 | 2671114444 | 271 |
| 190 | iso_pu_bacteria | 2687453392 | 2688600709 | 271 |
| 191 | iso_pu_bacteria | 2690316117 | 2692319467 | 271 |
| 192 | iso_pu_bacteria | 2718217882 | 2719184435 | 271 |
| 193 | iso_pu_bacteria | 2718217927 | 2719389157 | 271 |
| 194 | iso_pu_bacteria | 2718217997 | 2719669242 | 271 |
| 195 | iso_pu_bacteria | 2718218009 | 2719728455 | 271 |
| 196 | iso_pu_bacteria | 2718218199 | 2720489936 | 271 |
| 197 | iso_pu_bacteria | 2718218232 | 2720610600 | 271 |
| 198 | iso_pu_bacteria | 2718218233 | 2720618170 | 271 |
| 199 | iso_pu_bacteria | 2718218235 | 2720629181 | 271 |
| 200 | iso_pu_bacteria | 2718218269 | 2720773261 | 271 |
| 201 | iso_pu_bacteria | 2718218363 | 2721144143 | 271 |
| 202 | iso_pu_bacteria | 2718218365 | 2721156240 | 271 |
| 203 | iso_pu_bacteria | 2718218366 | 2721161518 | 271 |
| 204 | iso_pu_bacteria | 2718218423 | 2721401923 | 271 |
| 205 | iso_pu_bacteria | 2721755514 | 2722842663 | 271 |
| 206 | iso_pu_bacteria | 2721755556 | 2723030671 | 271 |
| 207 | iso_pu_bacteria | 2721755684 | 2723565088 | 271 |
| 208 | iso_pu_bacteria | 2721755685 | 2723570388 | 271 |
| 209 | iso_pu_bacteria | 2721755686 | 2723578169 | 271 |
| 210 | iso_pu_bacteria | 2721755809 | 2724035756 | 271 |
| 211 | iso_pu_bacteria | 2721755810 | 2724041480 | 271 |
| 212 | iso_pu_bacteria | 2721755819 | 2724093290 | 271 |
| 213 | iso_pu_bacteria | 2721755822 | 2724101935 | 271 |
| 214 | iso_pu_bacteria | 2721755823 | 2724113607 | 271 |
| 215 | iso_pu_bacteria | 2724679232 | 2725947058 | 271 |
| 216 | iso_pu_bacteria | 2728369352 | 2730111204 | 271 |
| 217 | iso_pu_bacteria | 2728369365 | 2730160551 | 271 |
| 218 | iso_pu_bacteria | 2728369397 | 2730295773 | 271 |
| 219 | iso_pu_bacteria | 2738541293 | 2738799838 | 271 |
| 220 | iso_pu_bacteria | 2738541333 | 2739036266 | 271 |
| 221 | iso_pu_bacteria | 2751185800 | 2753357091 | 271 |
| 222 | iso_pu_bacteria | 2751185821 | 2753461450 | 271 |
| 223 | iso_pu_bacteria | 2756170246 | 2756672692 | 271 |
| 224 | iso_pu_bacteria | 2758568016 | 2758639377 | 271 |
| 225 | iso_pu_bacteria | 2765235942 | 2766069243 | 271 |
| 226 | iso_pu_bacteria | 2775507266 | 2778176582 | 271 |
| 227 | iso_pu_bacteria | 2791355091 | 2792624106 | 271 |
| 228 | iso_pu_bacteria | 2791355092 | 2792629482 | 271 |
| 229 | iso_pu_bacteria | 2791355094 | 2792640741 | 271 |
| 230 | iso_pu_bacteria | 2791355094 | 2792641161 | 271 |
| 231 | iso_pu_bacteria | 2791355123 | 2792745575 | 271 |
| 232 | iso_pu_bacteria | 2791355253 | 2793280421 | 271 |
| 233 | iso_pu_bacteria | 2791355260 | 2793323154 | 271 |
| 234 | iso_pu_bacteria | 2791355261 | 2793330494 | 271 |
| 235 | iso_pu_bacteria | 2791355263 | 2793342779 | 271 |
| 236 | iso_pu_bacteria | 2791355264 | 2793345320 | 271 |
| 237 | iso_pu_bacteria | 2791355266 | 2793363356 | 271 |
| 238 | iso_pu_bacteria | 2791355267 | 2793365048 | 271 |
| 239 | iso_pu_bacteria | 2802429633 | 2806046369 | 271 |
| 240 | iso_pu_bacteria | 2802429634 | 2806053095 | 271 |
| 241 | iso_pu_bacteria | 2802429635 | 2806059697 | 271 |
| 242 | iso_pu_bacteria | 2802429636 | 2806068565 | 271 |
| 243 | iso_pu_bacteria | 2802429637 | 2806074987 | 271 |
| 244 | iso_pu_bacteria | 2818991448 | 2819607569 | 271 |
| 245 | iso_pu_bacteria | 2818991453 | 2819641714 | 271 |
| 246 | iso_pu_bacteria | 2818991453 | 2819642708 | 271 |
| 247 | iso_pu_bacteria | 2821443989 | 2821449681 | 271 |
| 248 | iso_pu_bacteria | 2837651117 | 2837654022 | 271 |
| 249 | iso_pu_bacteria | 2837678835 | 2837679666 | 271 |
| 250 | iso_pu_bacteria | 2838016132 | 2838016556 | 271 |
| 251 | iso_pu_bacteria | 2838029111 | 2838032069 | 271 |
| 252 | iso_pu_bacteria | 2838035591 | 2838035889 | 271 |
| 253 | iso_pu_bacteria | 2838048938 | 2838050005 | 271 |
| 254 | iso_pu_bacteria | 2838061910 | 2838064339 | 271 |
| 255 | iso_pu_bacteria | 2838068647 | 2838069090 | 271 |
| 256 | iso_pu_bacteria | 2838661181 | 2838665077 | 271 |
| 257 | iso_pu_bacteria | 2838686498 | 2838687687 | 271 |
| 258 | iso_pu_bacteria | 2838729681 | 2838735574 | 271 |
| 259 | iso_pu_bacteria | 2838742623 | 2838748476 | 271 |
| 260 | iso_pu_bacteria | 2841734538 | 2841735256 | 271 |
| 261 | iso_pu_bacteria | 2841851746 | 2841854234 | 271 |
| 262 | iso_pu_bacteria | 2841864319 | 2841865576 | 271 |
| 263 | iso_pu_bacteria | 2842110456 | 2842111370 | 271 |
| 264 | iso_pu_bacteria | 2842156927 | 2842159398 | 271 |
| 265 | iso_pu_bacteria | 2842163707 | 2842163837 | 271 |
| 266 | iso_pu_bacteria | 2842180545 | 2842183033 | 271 |
| 267 | iso_pu_bacteria | 2842217011 | 2842223829 | 271 |
| 268 | iso_pu_bacteria | 2842229732 | 2842232744 | 271 |
| 269 | iso_pu_bacteria | 2842243621 | 2842247013 | 271 |
| 270 | iso_pu_bacteria | 2842257432 | 2842259301 | 271 |
| 271 | iso_pu_bacteria | 2842264693 | 2842265430 | 271 |
| 272 | iso_pu_bacteria | 2842271015 | 2842272281 | 271 |
| 273 | iso_pu_bacteria | 2842285085 | 2842287870 | 271 |
| 274 | iso_pu_bacteria | 2842298080 | 2842301044 | 271 |
| 275 | iso_pu_bacteria | 2842298080 | 2842303235 | 271 |
| 276 | iso_pu_bacteria | 2842304105 | 2842309257 | 271 |
| 277 | iso_pu_bacteria | 2842311132 | 2842313580 | 271 |
| 278 | iso_pu_bacteria | 2842341865 | 2842345506 | 271 |
| 279 | iso_pu_bacteria | 2842357229 | 2842359941 | 271 |
| 280 | iso_pu_bacteria | 2842363717 | 2842363802 | 271 |
| 281 | iso_pu_bacteria | 2842395702 | 2842397263 | 271 |
| 282 | iso_pu_bacteria | 2842402390 | 2842405136 | 271 |
| 283 | iso_pu_bacteria | 2842409023 | 2842412107 | 271 |
| 284 | iso_pu_bacteria | 2842415677 | 2842418366 | 271 |
| 285 | iso_pu_bacteria | 2842422224 | 2842422280 | 271 |
| 286 | iso_pu_bacteria | 2842428310 | 2842428519 | 271 |
| 287 | iso_pu_bacteria | 2842434925 | 2842435133 | 271 |
| 288 | iso_pu_bacteria | 2842441272 | 2842442004 | 271 |
| 289 | iso_pu_bacteria | 2842447887 | 2842447949 | 271 |
| 290 | iso_pu_bacteria | 2842462802 | 2842462945 | 271 |
| 291 | iso_pu_bacteria | 2842469257 | 2842469465 | 271 |
| 292 | iso_pu_bacteria | 2842475841 | 2842478801 | 271 |
| 293 | iso_pu_bacteria | 2842482326 | 2842486513 | 271 |
| 294 | iso_pu_bacteria | 2842502639 | 2842505880 | 271 |
| 295 | iso_pu_bacteria | 2842509118 | 2842513775 | 271 |
| 296 | iso_pu_bacteria | 2842521101 | 2842525445 | 271 |
| 297 | iso_pu_bacteria | 2842922631 | 2842927053 | 271 |
| 298 | iso_pu_bacteria | 2844002411 | 2844005148 | 271 |
| 299 | iso_pu_bacteria | 2844009547 | 2844016059 | 271 |
| 300 | iso_pu_bacteria | 2844163670 | 2844165660 | 271 |
| 301 | iso_pu_bacteria | 2844454524 | 2844460682 | 271 |
| 302 | iso_pu_bacteria | 2844533157 | 2844539898 | 271 |
| 303 | iso_pu_bacteria | 2847417321 | 2847422032 | 271 |
| 304 | iso_pu_bacteria | 2847670302 | 2847672773 | 271 |
| 305 | iso_pu_bacteria | 2848992105 | 2848997009 | 271 |
| 306 | iso_pu_bacteria | 2850079185 | 2850084631 | 271 |
| 307 | iso_pu_bacteria | 2852387548 | 2852395036 | 271 |
| 308 | iso_pu_bacteria | 2854911287 | 2854915007 | 271 |
| 309 | iso_pu_bacteria | 2855825444 | 2855829441 | 271 |
| 310 | iso_pu_bacteria | 2855839649 | 2855844540 | 271 |
| 311 | iso_pu_bacteria | 2855872281 | 2855872789 | 271 |
| 312 | iso_pu_bacteria | 2855872281 | 2855875003 | 271 |
| 313 | iso_pu_bacteria | 2856314179 | 2856314724 | 271 |
| 314 | iso_pu_bacteria | 2856320880 | 2856326471 | 271 |
| 315 | iso_pu_bacteria | 2856328259 | 2856330159 | 271 |
| 316 | iso_pu_bacteria | 2856334872 | 2856339579 | 271 |
| 317 | iso_pu_bacteria | 2856356410 | 2856362870 | 271 |
| 318 | iso_pu_bacteria | 2856364286 | 2856371482 | 271 |
| 319 | iso_pu_bacteria | 2857349434 | 2857349542 | 271 |
| 320 | iso_pu_bacteria | 2857367948 | 2857374634 | 271 |
| 321 | iso_pu_bacteria | 2857516855 | 2857518242 | 271 |
| 322 | iso_pu_bacteria | 2858800743 | 2858805999 | 271 |
| 323 | iso_pu_bacteria | 2869169390 | 2869170706 | 271 |
| 324 | iso_pu_bacteria | 2869234852 | 2869234930 | 271 |
| 325 | iso_pu_bacteria | 2869249662 | 2869255247 | 271 |
| 326 | iso_pu_bacteria | 2869256925 | 2869259157 | 271 |
| 327 | iso_pu_bacteria | 2869264136 | 2869265067 | 271 |
| 328 | iso_pu_bacteria | 2869271264 | 2869274894 | 271 |
| 329 | iso_pu_bacteria | 2869278585 | 2869283906 | 271 |
| 330 | iso_pu_bacteria | 2869285874 | 2869289597 | 271 |
| 331 | iso_pu_bacteria | 2871429161 | 2871431663 | 271 |
| 332 | iso_pu_bacteria | 2871435913 | 2871437328 | 271 |
| 333 | iso_pu_bacteria | 2871451962 | 2871455761 | 271 |
| 334 | iso_pu_bacteria | 2871459585 | 2871460316 | 271 |
| 335 | iso_pu_bacteria | 2871466892 | 2871468818 | 271 |
| 336 | iso_pu_bacteria | 2871474448 | 2871479228 | 271 |
| 337 | iso_pu_bacteria | 2871481445 | 2871485089 | 271 |
| 338 | iso_pu_bacteria | 2874109183 | 2874110423 | 271 |
| 339 | iso_pu_bacteria | 2874116593 | 2874117264 | 271 |
| 340 | iso_pu_bacteria | 2874123672 | 2874131383 | 271 |
| 341 | iso_pu_bacteria | 2874131515 | 2874135555 | 271 |
| 342 | iso_pu_bacteria | 2874139085 | 2874144525 | 271 |
| 343 | iso_pu_bacteria | 2874146452 | 2874154805 | 271 |
| 344 | iso_pu_bacteria | 2874155637 | 2874162186 | 271 |
| 345 | iso_pu_bacteria | 2874162495 | 2874164142 | 271 |
| 346 | iso_pu_bacteria | 2874168670 | 2874171146 | 271 |
| 347 | iso_pu_bacteria | 2876363079 | 2876367318 | 271 |
| 348 | iso_pu_bacteria | 2876369609 | 2876374168 | 271 |
| 349 | iso_pu_bacteria | 2876386047 | 2876387628 | 271 |
| 350 | iso_pu_bacteria | 2876399893 | 2876401800 | 271 |
| 351 | iso_pu_bacteria | 2876406927 | 2876411065 | 271 |
| 352 | iso_pu_bacteria | 2876413966 | 2876420371 | 271 |
| 353 | iso_pu_bacteria | 2876420981 | 2876425573 | 271 |
| 354 | iso_pu_bacteria | 2878035449 | 2878036195 | 271 |
| 355 | iso_pu_bacteria | 2878730984 | 2878735808 | 271 |
| 356 | iso_pu_bacteria | 2878738818 | 2878744099 | 271 |
| 357 | iso_pu_bacteria | 2878745973 | 2878748269 | 271 |
| 358 | iso_pu_bacteria | 2878774303 | 2878774944 | 271 |
| 359 | iso_pu_bacteria | 2878781027 | 2878781054 | 271 |
| 360 | iso_pu_bacteria | 2878788777 | 2878796013 | 271 |
| 361 | iso_pu_bacteria | 2881147464 | 2881151090 | 271 |
| 362 | iso_pu_bacteria | 2881861095 | 2881863070 | 271 |
| 363 | iso_pu_bacteria | 2882632389 | 2882637537 | 271 |
| 364 | iso_pu_bacteria | 2885312484 | 2885315672 | 271 |
| 365 | iso_pu_bacteria | 2885318864 | 2885323298 | 271 |
| 366 | iso_pu_bacteria | 2888337043 | 2888341621 | 271 |
| 367 | iso_pu_bacteria | 2888343758 | 2888349271 | 271 |
| 368 | iso_pu_bacteria | 2891373044 | 2891375909 | 271 |
| 369 | iso_pu_bacteria | 2894817345 | 2894820753 | 271 |
| 370 | iso_pu_bacteria | 2896384573 | 2896385555 | 271 |
| 371 | iso_pu_bacteria | 2903448605 | 2903453212 | 271 |
| 372 | iso_pu_bacteria | 2903492973 | 2903505841 | 271 |
| 373 | iso_pu_bacteria | 2903513507 | 2903514514 | 271 |
| 374 | iso_pu_bacteria | 2903521522 | 2903526809 | 271 |
| 375 | iso_pu_bacteria | 2903528002 | 2903530572 | 271 |
| 376 | iso_pu_bacteria | 2904578770 | 2904583871 | 271 |
| 377 | iso_pu_bacteria | 2906308376 | 2906311886 | 271 |
| 378 | iso_pu_bacteria | 2906321335 | 2906323623 | 271 |
| 379 | iso_pu_bacteria | 2906363423 | 2906364953 | 271 |
| 380 | iso_pu_bacteria | 2906370794 | 2906371414 | 271 |
| 381 | iso_pu_bacteria | 2906378014 | 2906385013 | 271 |
| 382 | iso_pu_bacteria | 2906386501 | 2906391076 | 271 |
| 383 | iso_pu_bacteria | 2906393657 | 2906394923 | 271 |
| 384 | iso_pu_bacteria | 2906401398 | 2906403405 | 271 |
| 385 | iso_pu_bacteria | 2906408224 | 2906409829 | 271 |
| 386 | iso_pu_bacteria | 2906414383 | 2906414913 | 271 |
| 387 | iso_pu_bacteria | 2906427513 | 2906434161 | 271 |
| 388 | iso_pu_bacteria | 2909042592 | 2909045439 | 271 |
| 389 | iso_pu_bacteria | 2915650412 | 2915654482 | 271 |
| 390 | iso_pu_bacteria | 2915986958 | 2915989918 | 271 |
| 391 | iso_pu_bacteria | 2915993759 | 2915993916 | 271 |
| 392 | iso_pu_bacteria | 2916000859 | 2916003331 | 271 |
| 393 | iso_pu_bacteria | 2916007675 | 2916007841 | 271 |
| 394 | iso_pu_bacteria | 2916014648 | 2916015724 | 271 |
| 395 | iso_pu_bacteria | 2916021584 | 2916021749 | 271 |
| 396 | iso_pu_bacteria | 2916028427 | 2916028441 | 271 |
| 397 | iso_pu_bacteria | 2916035215 | 2916037443 | 271 |
| 398 | iso_pu_bacteria | 2916041962 | 2916042100 | 271 |
| 399 | iso_pu_bacteria | 2916048683 | 2916048873 | 271 |
| 400 | iso_pu_bacteria | 2916055098 | 2916059778 | 271 |
| 401 | iso_pu_bacteria | 2916068649 | 2916071024 | 271 |
| 402 | iso_pu_bacteria | 2916076590 | 2916081253 | 271 |
| 403 | iso_pu_bacteria | 2919100787 | 2919102182 | 271 |
| 404 | iso_pu_bacteria | 2919408235 | 2919413167 | 271 |
| 405 | iso_pu_bacteria | 2921201388 | 2921202200 | 271 |
| 406 | iso_pu_bacteria | 2921208531 | 2921212693 | 271 |
| 407 | iso_pu_bacteria | 2921237296 | 2921237421 | 271 |
| 408 | iso_pu_bacteria | 2921244191 | 2921250049 | 271 |
| 409 | iso_pu_bacteria | 2921257292 | 2921259372 | 271 |
| 410 | iso_pu_bacteria | 2921263974 | 2921268179 | 271 |
| 411 | iso_pu_bacteria | 2921282425 | 2921282951 | 271 |
| 412 | iso_pu_bacteria | 2921289301 | 2921294661 | 271 |
| 413 | iso_pu_bacteria | 2922151315 | 2922153123 | 271 |
| 414 | iso_pu_bacteria | 2922172374 | 2922176266 | 271 |
| 415 | iso_pu_bacteria | 2922178524 | 2922179647 | 271 |
| 416 | iso_pu_bacteria | 2923556063 | 2923562411 | 271 |
| 417 | iso_pu_bacteria | 2924144063 | 2924148060 | 271 |
| 418 | iso_pu_bacteria | 2924150972 | 2924157099 | 271 |
| 419 | iso_pu_bacteria | 2924158325 | 2924161790 | 271 |
| 420 | iso_pu_bacteria | 2924165586 | 2924165626 | 271 |
| 421 | iso_pu_bacteria | 2924172951 | 2924174954 | 271 |
| 422 | iso_pu_bacteria | 2924179722 | 2924181024 | 271 |
| 423 | iso_pu_bacteria | 2924186466 | 2924188209 | 271 |
| 424 | iso_pu_bacteria | 2924193448 | 2924196902 | 271 |
| 425 | iso_pu_bacteria | 2924200457 | 2924200619 | 271 |
| 426 | iso_pu_bacteria | 2924207177 | 2924207242 | 271 |
| 427 | iso_pu_bacteria | 2924214083 | 2924217304 | 271 |
| 428 | iso_pu_bacteria | 2924221636 | 2924224167 | 271 |
| 429 | iso_pu_bacteria | 2924228884 | 2924228959 | 271 |
| 430 | iso_pu_bacteria | 2924710171 | 2924714973 | 271 |
| 431 | iso_pu_bacteria | 2924718760 | 2924719271 | 271 |
| 432 | iso_pu_bacteria | 2924733363 | 2924737537 | 271 |
| 433 | iso_pu_bacteria | 2924741084 | 2924741477 | 271 |
| 434 | iso_pu_bacteria | 2924748358 | 2924752480 | 271 |
| 435 | iso_pu_bacteria | 2924754689 | 2924758462 | 271 |
| 436 | iso_pu_bacteria | 2924762789 | 2924769086 | 271 |
| 437 | iso_pu_bacteria | 2924776078 | 2924782016 | 271 |
| 438 | iso_pu_bacteria | 2924784321 | 2924786105 | 271 |
| 439 | iso_pu_bacteria | 2928521798 | 2928526057 | 271 |
| 440 | iso_pu_bacteria | 2933016740 | 2933017721 | 271 |
| 441 | iso_pu_bacteria | 2933570622 | 2933575642 | 271 |
| 442 | iso_pu_bacteria | 2933586486 | 2933587924 | 271 |
| 443 | iso_pu_bacteria | 2933599457 | 2933599757 | 271 |
| 444 | iso_pu_bacteria | 2935901341 | 2935902937 | 271 |
| 445 | iso_pu_bacteria | 2936367885 | 2936374157 | 271 |
| 446 | iso_pu_bacteria | 2936375103 | 2936375324 | 271 |
| 447 | iso_pu_bacteria | 2936381700 | 2936387046 | 271 |
| 448 | iso_pu_bacteria | 2936996657 | 2936996711 | 271 |
| 449 | iso_pu_bacteria | 2936996657 | 2936999043 | 271 |
| 450 | iso_pu_bacteria | 2937002841 | 2937003082 | 271 |
| 451 | iso_pu_bacteria | 2937009748 | 2937009931 | 271 |
| 452 | iso_pu_bacteria | 2937016420 | 2937020368 | 271 |
| 453 | iso_pu_bacteria | 2937023124 | 2937025250 | 271 |
| 454 | iso_pu_bacteria | 2937042894 | 2937047247 | 271 |
| 455 | iso_pu_bacteria | 2937049772 | 2937050667 | 271 |
| 456 | iso_pu_bacteria | 2937056579 | 2937058468 | 271 |
| 457 | iso_pu_bacteria | 2937063883 | 2937064009 | 271 |
| 458 | iso_pu_bacteria | 2937071275 | 2937072338 | 271 |
| 459 | iso_pu_bacteria | 2937091812 | 2937094333 | 271 |
| 460 | iso_pu_bacteria | 2937098957 | 2937101527 | 271 |
| 461 | iso_pu_bacteria | 2937106411 | 2937110127 | 271 |
| 462 | iso_pu_bacteria | 2937113482 | 2937115512 | 271 |
| 463 | iso_pu_bacteria | 2937119839 | 2937120007 | 271 |
| 464 | iso_pu_bacteria | 2937126314 | 2937128125 | 271 |
| 465 | iso_pu_bacteria | 2937813078 | 2937818295 | 271 |
| 466 | iso_pu_bacteria | 2937836603 | 2937839554 | 271 |
| 467 | iso_pu_bacteria | 2937848649 | 2937850907 | 271 |
| 468 | iso_pu_bacteria | 2937861824 | 2937866986 | 271 |
| 469 | iso_pu_bacteria | 2937868953 | 2937875313 | 271 |
| 470 | iso_pu_bacteria | 2937877337 | 2937884657 | 271 |
| 471 | iso_pu_bacteria | 2937972304 | 2937977928 | 271 |
| 472 | iso_pu_bacteria | 2937980651 | 2937983464 | 271 |
| 473 | iso_pu_bacteria | 2941499720 | 2941505461 | 271 |
| 474 | iso_pu_bacteria | 2954011201 | 2954011850 | 271 |
| 475 | iso_pu_bacteria | 2957382221 | 2957382358 | 271 |
| 476 | iso_pu_bacteria | 2957388812 | 2957395433 | 271 |
| 477 | iso_pu_bacteria | 2957395598 | 2957400801 | 271 |
| 478 | iso_pu_bacteria | 2957402308 | 2957404196 | 271 |
| 479 | iso_pu_bacteria | 2957408893 | 2957414871 | 271 |
| 480 | iso_pu_bacteria | 2957422303 | 2957429743 | 271 |
| 481 | iso_pu_bacteria | 2957430029 | 2957432119 | 271 |
| 482 | iso_pu_bacteria | 2957443900 | 2957445921 | 271 |
| 483 | iso_pu_bacteria | 2957450854 | 2957451025 | 271 |
| 484 | iso_pu_bacteria | 2957457609 | 2957461665 | 271 |
| 485 | iso_pu_bacteria | 2957464669 | 2957467989 | 271 |
| 486 | iso_pu_bacteria | 2957471148 | 2957474603 | 271 |
| 487 | iso_pu_bacteria | 2957478035 | 2957483381 | 271 |
| 488 | iso_pu_bacteria | 2957484790 | 2957487252 | 271 |
| 489 | iso_pu_bacteria | 2957491536 | 2957496488 | 271 |
| 490 | iso_pu_bacteria | 2957498199 | 2957504824 | 271 |
| 491 | iso_pu_bacteria | 2957505466 | 2957505625 | 271 |
| 492 | iso_pu_bacteria | 2958034702 | 2958040296 | 271 |
| 493 | iso_pu_bacteria | 2958041894 | 2958045083 | 271 |
| 494 | iso_pu_bacteria | 2958041894 | 2958055144 | 271 |
| 495 | iso_pu_bacteria | 2958071322 | 2958075747 | 271 |
| 496 | iso_pu_bacteria | 2958084443 | 2958091965 | 271 |
| 497 | iso_pu_bacteria | 2958092219 | 2958096277 | 271 |
| 498 | iso_pu_bacteria | 2958108152 | 2958111768 | 271 |
| 499 | iso_pu_bacteria | 2958122699 | 2958128408 | 271 |
| 500 | iso_pu_bacteria | 2958130278 | 2958133970 | 271 |
| 501 | iso_pu_bacteria | 2958137437 | 2958141812 | 271 |
| 502 | iso_pu_bacteria | 2958144490 | 2958151461 | 271 |
| 503 | iso_pu_bacteria | 2958158011 | 2958159172 | 271 |
| 504 | iso_pu_bacteria | 2958179912 | 2958183616 | 271 |
| 505 | iso_pu_bacteria | 2960584000 | 2960584198 | 271 |
| 506 | iso_pu_bacteria | 2960597568 | 2960603009 | 271 |
| 507 | iso_pu_bacteria | 2960603979 | 2960604076 | 271 |
| 508 | iso_pu_bacteria | 2960610863 | 2960611031 | 271 |
| 509 | iso_pu_bacteria | 2960617483 | 2960622396 | 271 |
| 510 | iso_pu_bacteria | 2960637947 | 2960639810 | 271 |
| 511 | iso_pu_bacteria | 2960645483 | 2960649152 | 271 |
| 512 | iso_pu_bacteria | 2960652885 | 2960659682 | 271 |
| 513 | iso_pu_bacteria | 2960660292 | 2960663779 | 271 |
| 514 | iso_pu_bacteria | 2960667422 | 2960667590 | 271 |
| 515 | iso_pu_bacteria | 2960674078 | 2960676499 | 271 |
| 516 | iso_pu_bacteria | 2961077736 | 2961081582 | 271 |
| 517 | iso_pu_bacteria | 2961136820 | 2961139657 | 271 |
| 518 | iso_pu_bacteria | 2961183825 | 2961186191 | 271 |
| 519 | iso_pu_bacteria | 2963644680 | 2963650111 | 271 |
| 520 | iso_pu_bacteria | 2964607997 | 2964610093 | 271 |
| 521 | iso_pu_bacteria | 2964615318 | 2964615553 | 271 |
| 522 | iso_pu_bacteria | 2964621998 | 2964626089 | 271 |
| 523 | iso_pu_bacteria | 2964628898 | 2964629046 | 271 |
| 524 | iso_pu_bacteria | 2964636051 | 2964636153 | 271 |
| 525 | iso_pu_bacteria | 2964643177 | 2964643345 | 271 |
| 526 | iso_pu_bacteria | 2964649959 | 2964653884 | 271 |
| 527 | iso_pu_bacteria | 2964656573 | 2964656755 | 271 |
| 528 | iso_pu_bacteria | 2964663802 | 2964663971 | 271 |
| 529 | iso_pu_bacteria | 2964670856 | 2964676609 | 271 |
| 530 | iso_pu_bacteria | 2964678106 | 2964678122 | 271 |
| 531 | iso_pu_bacteria | 2964685014 | 2964689000 | 271 |
| 532 | iso_pu_bacteria | 2964691889 | 2964694101 | 271 |
| 533 | iso_pu_bacteria | 2964698721 | 2964698942 | 271 |
| 534 | iso_pu_bacteria | 2964705432 | 2964711169 | 271 |
| 535 | iso_pu_bacteria | 2964712639 | 2964717857 | 271 |
| 536 | iso_pu_bacteria | 2964719344 | 2964723375 | 271 |
| 537 | iso_pu_bacteria | 2965025482 | 2965027399 | 271 |
| 538 | iso_pu_bacteria | 2965032056 | 2965039699 | 271 |
| 539 | iso_pu_bacteria | 2965040258 | 2965044052 | 271 |
| 540 | iso_pu_bacteria | 2965047637 | 2965048471 | 271 |
| 541 | iso_pu_bacteria | 2965062239 | 2965065198 | 271 |
| 542 | iso_pu_bacteria | 2965089291 | 2965092716 | 271 |
| 543 | iso_pu_bacteria | 2965102966 | 2965106688 | 271 |
| 544 | iso_pu_bacteria | 2965110997 | 2965115574 | 271 |
| 545 | iso_pu_bacteria | 2967664464 | 2967664595 | 271 |
| 546 | iso_pu_bacteria | 2967671571 | 2967671740 | 271 |
| 547 | iso_pu_bacteria | 2967678726 | 2967681341 | 271 |
| 548 | iso_pu_bacteria | 2967693043 | 2967698484 | 271 |
| 549 | iso_pu_bacteria | 2967699805 | 2967699835 | 271 |
| 550 | iso_pu_bacteria | 2967706974 | 2967714072 | 271 |
| 551 | iso_pu_bacteria | 2967714385 | 2967718556 | 271 |
| 552 | iso_pu_bacteria | 2967721400 | 2967721440 | 271 |
| 553 | iso_pu_bacteria | 2967735183 | 2967737376 | 271 |
| 554 | iso_pu_bacteria | 2967742019 | 2967744401 | 271 |
| 555 | iso_pu_bacteria | 2967748971 | 2967749141 | 271 |
| 556 | iso_pu_bacteria | 2967755722 | 2967755892 | 271 |
| 557 | iso_pu_bacteria | 2967762386 | 2967762449 | 271 |
| 558 | iso_pu_bacteria | 2967769361 | 2967769483 | 271 |
| 559 | iso_pu_bacteria | 2967775926 | 2967775996 | 271 |
| 560 | iso_pu_bacteria | 2968016561 | 2968022077 | 271 |
| 561 | iso_pu_bacteria | 2968083720 | 2968086578 | 271 |
| 562 | iso_pu_bacteria | 2968091066 | 2968094569 | 271 |
| 563 | iso_pu_bacteria | 2970019648 | 2970019778 | 271 |
| 564 | iso_pu_bacteria | 2970033650 | 2970033820 | 271 |
| 565 | iso_pu_bacteria | 2970040964 | 2970044001 | 271 |
| 566 | iso_pu_bacteria | 2970047711 | 2970053146 | 271 |
| 567 | iso_pu_bacteria | 2970054988 | 2970055645 | 271 |
| 568 | iso_pu_bacteria | 2970061556 | 2970063821 | 271 |
| 569 | iso_pu_bacteria | 2970068827 | 2970068996 | 271 |
| 570 | iso_pu_bacteria | 2970076120 | 2970078046 | 271 |
| 571 | iso_pu_bacteria | 2970082768 | 2970084428 | 271 |
| 572 | iso_pu_bacteria | 2970088815 | 2970091936 | 271 |
| 573 | iso_pu_bacteria | 2970095765 | 2970095935 | 271 |
| 574 | iso_pu_bacteria | 2970102677 | 2970102847 | 271 |
| 575 | iso_pu_bacteria | 2970109326 | 2970111308 | 271 |
| 576 | iso_pu_bacteria | 2970116247 | 2970119091 | 271 |
| 577 | iso_pu_bacteria | 2970129317 | 2970135295 | 271 |
| 578 | iso_pu_bacteria | 2970136068 | 2970136092 | 271 |
| 579 | iso_pu_bacteria | 2970149975 | 2970152092 | 271 |
| 580 | iso_pu_bacteria | 2970156795 | 2970159940 | 271 |
| 581 | iso_pu_bacteria | 2970164137 | 2970165516 | 271 |
| 582 | iso_pu_bacteria | 2970170962 | 2970171151 | 271 |
| 583 | iso_pu_bacteria | 2970177841 | 2970180054 | 271 |
| 584 | iso_pu_bacteria | 2970184632 | 2970188176 | 271 |
| 585 | iso_pu_bacteria | 2970191845 | 2970191890 | 271 |
| 586 | iso_pu_bacteria | 2970469710 | 2970474667 | 271 |
| 587 | iso_pu_bacteria | 2970489779 | 2970491797 | 271 |
| 588 | iso_pu_bacteria | 2970510686 | 2970511007 | 271 |
| 589 | iso_pu_bacteria | 2970524798 | 2970531135 | 271 |
| 590 | iso_pu_bacteria | 2970532167 | 2970536018 | 271 |
| 591 | iso_pu_bacteria | 2970540015 | 2970540793 | 271 |
| 592 | iso_pu_bacteria | 2970547951 | 2970549654 | 271 |
| 593 | iso_pu_bacteria | 2970593180 | 2970598519 | 271 |
| 594 | iso_pu_bacteria | 2970619444 | 2970620765 | 271 |
| 595 | iso_pu_bacteria | 2970627176 | 2970629056 | 271 |
| 596 | iso_pu_bacteria | 2977516862 | 2977519504 | 271 |
| 597 | iso_pu_bacteria | 2977523885 | 2977525906 | 271 |
| 598 | iso_pu_bacteria | 2977537788 | 2977539800 | 271 |
| 599 | iso_pu_bacteria | 2977551784 | 2977556120 | 271 |
| 600 | iso_pu_bacteria | 2977558990 | 2977559034 | 271 |
| 601 | iso_pu_bacteria | 2977565890 | 2977566115 | 271 |
| 602 | iso_pu_bacteria | 2977572785 | 2977573582 | 271 |
| 603 | iso_pu_bacteria | 2977579622 | 2977585064 | 271 |
| 604 | iso_pu_bacteria | 2977843712 | 2977850953 | 271 |
| 605 | iso_pu_bacteria | 2977851361 | 2977855748 | 271 |
| 606 | iso_pu_bacteria | 2977858184 | 2977862793 | 271 |
| 607 | iso_pu_bacteria | 2977864932 | 2977868520 | 271 |
| 608 | iso_pu_bacteria | 2977872689 | 2977877311 | 271 |
| 609 | iso_pu_bacteria | 2977898635 | 2977904455 | 271 |
| 610 | iso_pu_bacteria | 2977907340 | 2977909274 | 271 |
| 611 | iso_pu_bacteria | 2977915119 | 2977922096 | 271 |
| 612 | iso_pu_bacteria | 2977922695 | 2977923883 | 271 |
| 613 | iso_pu_bacteria | 2977935797 | 2977937367 | 271 |
| 614 | iso_pu_bacteria | 2977942078 | 2977944274 | 271 |
| 615 | iso_pu_bacteria | 2977950692 | 2977951202 | 271 |
| 616 | iso_pu_bacteria | 2977957713 | 2977959584 | 271 |
| 617 | iso_pu_bacteria | 2979764755 | 2979766931 | 271 |
| 618 | iso_pu_bacteria | 2979772303 | 2979774168 | 271 |
| 619 | iso_pu_bacteria | 2979793036 | 2979797564 | 271 |
| 620 | iso_pu_bacteria | 2987636660 | 2987645449 | 271 |
| 621 | iso_pu_bacteria | 2987645492 | 2987649855 | 271 |
| 622 | iso_pu_bacteria | 2987666974 | 2987672938 | 271 |
| 623 | iso_pu_bacteria | 2987673487 | 2987676141 | 271 |
| 624 | iso_pu_bacteria | 2989349275 | 2989354425 | 271 |
| 625 | iso_pu_bacteria | 2989771324 | 2989772891 | 271 |
| 626 | iso_pu_bacteria | 2995392953 | 2995394554 | 271 |
| 627 | iso_pu_bacteria | 2996348954 | 2996354076 | 271 |
| 628 | iso_pu_bacteria | 2996386984 | 2996391176 | 271 |
| 629 | iso_pu_bacteria | 3000135777 | 3000141151 | 271 |
| 630 | iso_pu_bacteria | 3003930520 | 3003931803 | 271 |
| 631 | iso_pu_bacteria | 3004167301 | 3004171596 | 271 |
| 632 | iso_pu_bacteria | 3004195979 | 3004201977 | 271 |
| 633 | iso_pu_bacteria | 3004203850 | 3004206356 | 271 |
| 634 | iso_pu_bacteria | 3004211236 | 3004213321 | 271 |
| 635 | iso_pu_bacteria | 3004218560 | 3004221393 | 271 |
| 636 | iso_pu_bacteria | 3004232784 | 3004235827 | 271 |
| 637 | iso_pu_bacteria | 3004239961 | 3004246558 | 271 |
| 638 | iso_pu_bacteria | 3004248173 | 3004255595 | 271 |
| 639 | iso_pu_bacteria | 3004268573 | 3004270193 | 271 |
| 640 | iso_pu_bacteria | 3004275668 | 3004280744 | 271 |
| 641 | iso_pu_bacteria | 3004334049 | 3004338888 | 271 |
| 642 | iso_pu_bacteria | 3005409236 | 3005414678 | 271 |
| 643 | iso_pu_bacteria | 3005416602 | 3005421979 | 271 |
| 644 | iso_pu_bacteria | 3005445848 | 3005452029 | 271 |
| 645 | iso_pu_bacteria | 3005452660 | 3005458523 | 271 |
| 646 | iso_pu_bacteria | 639633055 | 639645155 | 271 |
| 647 | iso_pu_bacteria | 643692032 | 643824058 | 271 |
| 648 | iso_pu_bacteria | 643692032 | 643824880 | 271 |
| 649 | iso_pu_bacteria | 648276728 | 648735552 | 271 |
| 650 | iso_pu_bacteria | 649633066 | 649875162 | 271 |
| 651 | iso_pu_bacteria | 8003992118 | 8003997064 | 271 |
| 652 | iso_pu_bacteria | 8004300914 | 8004307046 | 271 |
| 653 | iso_pu_bacteria | 8004312739 | 8004314865 | 271 |
| 654 | iso_pu_bacteria | 8004361976 | 8004369209 | 271 |
| 655 | iso_pu_bacteria | 8004387939 | 8004391475 | 271 |
| 656 | iso_pu_bacteria | 8004445564 | 8004446402 | 271 |
| 657 | iso_pu_bacteria | 8004633249 | 8004638659 | 271 |
| 658 | iso_pu_bacteria | 8004640170 | 8004643758 | 271 |
| 659 | iso_pu_bacteria | 8004695233 | 8004702834 | 271 |
| 660 | iso_pu_bacteria | 8004714634 | 8004716844 | 271 |
| 661 | iso_pu_bacteria | 8004727605 | 8004733612 | 271 |
| 662 | iso_pu_bacteria | 8005275841 | 8005277497 | 271 |
| 663 | iso_pu_bacteria | 8005282627 | 8005285001 | 271 |
| 664 | iso_pu_bacteria | 8005301065 | 8005306369 | 271 |
| 665 | iso_pu_bacteria | 8005307578 | 8005307709 | 271 |
| 666 | iso_pu_bacteria | 8005314921 | 8005321260 | 271 |
| 667 | iso_pu_bacteria | 8005376324 | 8005380029 | 271 |
| 668 | iso_pu_bacteria | 8005382845 | 8005383549 | 271 |
| 669 | iso_pu_bacteria | 8005395548 | 8005399084 | 271 |
| 670 | iso_pu_bacteria | 8005430974 | 8005433550 | 271 |
| 671 | iso_pu_bacteria | 8005460587 | 8005467432 | 271 |
| 672 | iso_pu_bacteria | 8005484373 | 8005489977 | 271 |
| 673 | iso_pu_bacteria | 8005497431 | 8005502440 | 271 |
| 674 | iso_pu_bacteria | 8005542996 | 8005547974 | 271 |
| 675 | iso_pu_bacteria | 8005556819 | 8005563549 | 271 |
| 676 | iso_pu_bacteria | 8005563573 | 8005565325 | 271 |
| 677 | iso_pu_bacteria | 8005570704 | 8005572374 | 271 |
| 678 | iso_pu_bacteria | 8005619151 | 8005624802 | 271 |
| 679 | iso_pu_bacteria | 8005626139 | 8005626202 | 271 |
| 680 | iso_pu_bacteria | 8005645114 | 8005650863 | 271 |
| 681 | iso_pu_bacteria | 8005668836 | 8005673867 | 271 |
| 682 | iso_pu_bacteria | 8005682033 | 8005687827 | 271 |
| 683 | iso_pu_bacteria | 8005688590 | 8005693935 | 271 |
| 684 | iso_pu_bacteria | 8005695170 | 8005701305 | 271 |
| 685 | iso_pu_bacteria | 8018127388 | 8018131846 | 271 |
| 686 | iso_pu_bacteria | 8018163183 | 8018165717 | 271 |
| 687 | iso_pu_bacteria | 8018176218 | 8018179157 | 271 |
| 688 | iso_pu_bacteria | 8023680758 | 8023687896 | 271 |
| 689 | iso_pu_bacteria | 8024479707 | 8024484835 | 271 |
| 690 | iso_pu_bacteria | 8024486573 | 8024493125 | 271 |
| 691 | iso_pu_bacteria | 8054558443 | 8054560430 | 271 |
| 692 | iso_pu_bacteria | 8055617313 | 8055623699 | 271 |
| 693 | iso_pu_bacteria | 8056375014 | 8056377792 | 271 |
| 694 | iso_pu_bacteria | 8057575449 | 8057576302 | 271 |
| 695 | iso_pu_bacteria | 8057874678 | 8057877809 | 271 |
| 696 | 3300006042 | Ga0075368_10036990 | Ga0075368_100369902 | 274 |
| 697 | 3300006048 | Ga0075363_100087992 | Ga0075363_1000879922 | 274 |
| 698 | 3300006195 | Ga0075366_10071119 | Ga0075366_100711192 | 274 |
| 699 | 3300006948 | Ga0099826_10046495 | Ga0099826_100464951 | 274 |
| 700 | 3300022739 | Ga0228711_1000005 | Ga0228711_100000553 | 274 |
| 701 | 3300022740 | Ga0228710_1000018 | Ga0228710_100001853 | 274 |
| 702 | 3300027111 | Ga0209281_1000111 | Ga0209281_100011153 | 274 |
| 703 | 3300027666 | Ga0209282_1000012 | Ga0209282_100001253 | 274 |
| 704 | 3300027866 | Ga0209813_10001917 | Ga0209813_100019173 | 274 |
| 705 | 3300031730 | Ga0307516_10082289 | Ga0307516_100822893 | 274 |
| 706 | 3300031967 | Ga0315914_1000007 | Ga0315914_1000007161 | 274 |
| 707 | 3300033180 | Ga0307510_10117355 | Ga0307510_101173553 | 274 |
| 708 | 3300033430 | Ga0315913_1000003 | Ga0315913_100000353 | 274 |
| 709 | 3300033464 | Ga0315915_1000011 | Ga0315915_1000011161 | 274 |
| 710 | 3300049572 | Ga0501036_0013901 | Ga0501036_0013901_5225_6049 | 274 |
| 711 | 3300049575 | Ga0501039_0003147 | Ga0501039_0003147_3002_3826 | 274 |
| 712 | 3300049576 | Ga0501040_0046610 | Ga0501040_0046610_583_1407 | 274 |
| 713 | 3300049577 | Ga0501041_0047053 | Ga0501041_0047053_129_953 | 274 |
| 714 | 3300049578 | Ga0501042_0074543 | Ga0501042_0074543_1182_2006 | 274 |
| 715 | 3300049579 | Ga0501043_0244018 | Ga0501043_0244018_504_1328 | 274 |
| 716 | 3300049580 | Ga0501046_0107718 | Ga0501046_0107718_99_923 | 274 |
| 717 | 3300049582 | Ga0501048_0053391 | Ga0501048_0053391_351_1175 | 274 |
| 718 | 3300049591 | Ga0501075_0042175 | Ga0501075_0042175_887_1711 | 274 |
| 719 | 3300049593 | Ga0501077_0237820 | Ga0501077_0237820_284_1108 | 274 |
| 720 | 3300049823 | Ga0501044_0153060 | Ga0501044_0153060_38_862 | 274 |
| 721 | 3300049824 | Ga0501045_0061123 | Ga0501045_0061123_1754_2578 | 274 |
| 722 | 3300050493 | nmdc:mga0k408_164931_c1 | nmdc:mga0k408_164931_c1_315_1139 | 274 |
| 723 | 3300050494 | nmdc:mga06z11_9009_c1 | nmdc:mga06z11_9009_c1_759_1583 | 274 |
| 724 | 3300050495 | nmdc:mga04h51_2629_c1 | nmdc:mga04h51_2629_c1_627_1451 | 274 |
| 725 | 3300054114 | Ga0501084_0109316 | Ga0501084_0109316_1443_2267 | 274 |
| 726 | iso_pu_bacteria | 2856342000 | 2856346085 | 274 |
| 727 | 3300001979 | JGI24740J21852_10002929 | JGI24740J21852_100029292 | 275 |
| 728 | 3300001979 | JGI24740J21852_10003704 | JGI24740J21852_100037045 | 275 |
| 729 | 3300002704 | JGI25155J39150_1000015 | JGI25155J39150_100001571 | 275 |
| 730 | 3300002705 | JGI25156J39149_1000007 | JGI25156J39149_100000771 | 275 |
| 731 | 3300002737 | JGI25162J39368_1000248 | JGI25162J39368_100024812 | 275 |
| 732 | 3300002737 | JGI25162J39368_1001265 | JGI25162J39368_100126514 | 275 |
| 733 | 3300002738 | JGI25154J39366_1000051 | JGI25154J39366_1000051101 | 275 |
| 734 | 3300002739 | JGI25158J39367_1000619 | JGI25158J39367_10006192 | 275 |
| 735 | 3300002739 | JGI25158J39367_1008405 | JGI25158J39367_10084051 | 275 |
| 736 | 3300002741 | JGI25157J39369_1000012 | JGI25157J39369_1000012129 | 275 |
| 737 | 3300002741 | JGI25157J39369_1003126 | JGI25157J39369_10031264 | 275 |
| 738 | 3300002773 | JGI25152J39213_1000465 | JGI25152J39213_100046523 | 275 |
| 739 | 3300002773 | JGI25152J39213_1000472 | JGI25152J39213_10004729 | 275 |
| 740 | 3300002773 | JGI25152J39213_1004792 | JGI25152J39213_10047922 | 275 |
| 741 | 3300002773 | JGI25152J39213_1004925 | JGI25152J39213_10049252 | 275 |
| 742 | 3300002773 | JGI25152J39213_1008170 | JGI25152J39213_10081702 | 275 |
| 743 | 3300002773 | JGI25152J39213_1008377 | JGI25152J39213_10083772 | 275 |
| 744 | 3300002773 | JGI25152J39213_1012900 | JGI25152J39213_10129002 | 275 |
| 745 | 3300002774 | JGI25150J39212_1000219 | JGI25150J39212_100021923 | 275 |
| 746 | 3300002774 | JGI25150J39212_1004081 | JGI25150J39212_10040812 | 275 |
| 747 | 3300002987 | JGI25159J45721_1000036 | JGI25159J45721_100003630 | 275 |
| 748 | 3300002987 | JGI25159J45721_1000101 | JGI25159J45721_10001014 | 275 |
| 749 | 3300002987 | JGI25159J45721_1000321 | JGI25159J45721_10003217 | 275 |
| 750 | 3300002987 | JGI25159J45721_1015705 | JGI25159J45721_10157052 | 275 |
| 751 | 3300003187 | JGI25151J46595_10000007 | JGI25151J46595_10000007147 | 275 |
| 752 | 3300003187 | JGI25151J46595_10000463 | JGI25151J46595_100004635 | 275 |
| 753 | 3300003187 | JGI25151J46595_10000667 | JGI25151J46595_100006674 | 275 |
| 754 | 3300003214 | JGI25165J46597_1000102 | JGI25165J46597_1000102127 | 275 |
| 755 | 3300003214 | JGI25165J46597_1000280 | JGI25165J46597_100028026 | 275 |
| 756 | 3300003215 | JGI25153J46596_10000254 | JGI25153J46596_1000025431 | 275 |
| 757 | 3300003215 | JGI25153J46596_10001626 | JGI25153J46596_100016269 | 275 |
| 758 | 3300003215 | JGI25153J46596_10002799 | JGI25153J46596_100027993 | 275 |
| 759 | 3300003215 | JGI25153J46596_10015061 | JGI25153J46596_100150611 | 275 |
| 760 | 3300003215 | JGI25153J46596_10019229 | JGI25153J46596_100192292 | 275 |
| 761 | 3300003215 | JGI25153J46596_10019269 | JGI25153J46596_100192692 | 275 |
| 762 | 3300003354 | JGI25160J50197_1000023 | JGI25160J50197_1000023118 | 275 |
| 763 | 3300003354 | JGI25160J50197_1000060 | JGI25160J50197_100006049 | 275 |
| 764 | 3300003354 | JGI25160J50197_1001918 | JGI25160J50197_10019189 | 275 |
| 765 | 3300003354 | JGI25160J50197_1003006 | JGI25160J50197_10030066 | 275 |
| 766 | 3300003354 | JGI25160J50197_1004431 | JGI25160J50197_10044316 | 275 |
| 767 | 3300003374 | JGI25161J50226_1000012 | JGI25161J50226_1000012118 | 275 |
| 768 | 3300003374 | JGI25161J50226_1000085 | JGI25161J50226_100008525 | 275 |
| 769 | 3300003374 | JGI25161J50226_1003468 | JGI25161J50226_10034684 | 275 |
| 770 | 3300003752 | Ga0055539_1007968 | Ga0055539_10079681 | 275 |
| 771 | 3300003762 | Ga0055542_1000516 | Ga0055542_10005163 | 275 |
| 772 | 3300003763 | Ga0055529_1002054 | Ga0055529_10020542 | 275 |
| 773 | 3300003771 | Ga0055526_1010257 | Ga0055526_10102573 | 275 |
| 774 | 3300003771 | Ga0055526_1023182 | Ga0055526_10231822 | 275 |
| 775 | 3300003775 | Ga0055524_1000668 | Ga0055524_100066817 | 275 |
| 776 | 3300003775 | Ga0055524_1001911 | Ga0055524_10019118 | 275 |
| 777 | 3300003775 | Ga0055524_1003923 | Ga0055524_10039234 | 275 |
| 778 | 3300003775 | Ga0055524_1007862 | Ga0055524_10078623 | 275 |
| 779 | 3300003790 | Ga0055528_1000098 | Ga0055528_100009864 | 275 |
| 780 | 3300003790 | Ga0055528_1010345 | Ga0055528_10103454 | 275 |
| 781 | 3300003790 | Ga0055528_1023585 | Ga0055528_10235852 | 275 |
| 782 | 3300003790 | Ga0055528_1028713 | Ga0055528_10287132 | 275 |
| 783 | 3300003792 | Ga0055540_1000209 | Ga0055540_10002094 | 275 |
| 784 | 3300003792 | Ga0055540_1000331 | Ga0055540_100033111 | 275 |
| 785 | 3300003792 | Ga0055540_1007076 | Ga0055540_10070762 | 275 |
| 786 | 3300003792 | Ga0055540_1010000 | Ga0055540_10100003 | 275 |
| 787 | 3300004625 | Ga0055543_1000009 | Ga0055543_1000009118 | 275 |
| 788 | 3300004625 | Ga0055543_1000036 | Ga0055543_1000036101 | 275 |
| 789 | 3300004625 | Ga0055543_1000456 | Ga0055543_100045621 | 275 |
| 790 | 3300004625 | Ga0055543_1001244 | Ga0055543_10012445 | 275 |
| 791 | 3300005262 | Ga0065165_1000064 | Ga0065165_100006480 | 275 |
| 792 | 3300005262 | Ga0065165_1000160 | Ga0065165_100016083 | 275 |
| 793 | 3300005262 | Ga0065165_1004819 | Ga0065165_10048197 | 275 |
| 794 | 3300005262 | Ga0065165_1010462 | Ga0065165_10104623 | 275 |
| 795 | 3300005262 | Ga0065165_1038647 | Ga0065165_10386472 | 275 |
| 796 | 3300005327 | Ga0070658_10084741 | Ga0070658_100847413 | 275 |
| 797 | 3300005327 | Ga0070658_10507521 | Ga0070658_105075211 | 275 |
| 798 | 3300005335 | Ga0070666_10414433 | Ga0070666_104144331 | 275 |
| 799 | 3300005455 | Ga0070663_100061340 | Ga0070663_1000613403 | 275 |
| 800 | 3300005457 | Ga0070662_100282860 | Ga0070662_1002828601 | 275 |
| 801 | 3300005548 | Ga0070665_100085721 | Ga0070665_1000857213 | 275 |
| 802 | 3300005548 | Ga0070665_100127474 | Ga0070665_1001274743 | 275 |
| 803 | 3300005548 | Ga0070665_100318075 | Ga0070665_1003180752 | 275 |
| 804 | 3300005548 | Ga0070665_100427913 | Ga0070665_1004279132 | 275 |
| 805 | 3300005563 | Ga0068855_100158898 | Ga0068855_1001588982 | 275 |
| 806 | 3300005563 | Ga0068855_100168949 | Ga0068855_1001689492 | 275 |
| 807 | 3300005614 | Ga0068856_100115886 | Ga0068856_1001158865 | 275 |
| 808 | 3300005616 | Ga0068852_100059893 | Ga0068852_1000598933 | 275 |
| 809 | 3300005616 | Ga0068852_100313587 | Ga0068852_1003135872 | 275 |
| 810 | 3300005983 | Ga0081540_1033097 | Ga0081540_10330972 | 275 |
| 811 | 3300006038 | Ga0075365_10000172 | Ga0075365_100001724 | 275 |
| 812 | 3300006038 | Ga0075365_10001466 | Ga0075365_100014664 | 275 |
| 813 | 3300006038 | Ga0075365_10025992 | Ga0075365_100259925 | 275 |
| 814 | 3300006038 | Ga0075365_10026133 | Ga0075365_100261332 | 275 |
| 815 | 3300006038 | Ga0075365_10205622 | Ga0075365_102056222 | 275 |
| 816 | 3300006038 | Ga0075365_10362670 | Ga0075365_103626701 | 275 |
| 817 | 3300006042 | Ga0075368_10016305 | Ga0075368_100163054 | 275 |
| 818 | 3300006048 | Ga0075363_100028079 | Ga0075363_1000280792 | 275 |
| 819 | 3300006048 | Ga0075363_100147532 | Ga0075363_1001475321 | 275 |
| 820 | 3300006051 | Ga0075364_10005092 | Ga0075364_100050923 | 275 |
| 821 | 3300006051 | Ga0075364_10151592 | Ga0075364_101515922 | 275 |
| 822 | 3300006051 | Ga0075364_10203081 | Ga0075364_102030812 | 275 |
| 823 | 3300006177 | Ga0075362_10001315 | Ga0075362_100013154 | 275 |
| 824 | 3300006177 | Ga0075362_10014772 | Ga0075362_100147725 | 275 |
| 825 | 3300006177 | Ga0075362_10019696 | Ga0075362_100196965 | 275 |
| 826 | 3300006177 | Ga0075362_10060749 | Ga0075362_100607492 | 275 |
| 827 | 3300006178 | Ga0075367_10000610 | Ga0075367_100006105 | 275 |
| 828 | 3300006178 | Ga0075367_10010220 | Ga0075367_100102204 | 275 |
| 829 | 3300006186 | Ga0075369_10009522 | Ga0075369_100095223 | 275 |
| 830 | 3300006186 | Ga0075369_10015575 | Ga0075369_100155752 | 275 |
| 831 | 3300006186 | Ga0075369_10035877 | Ga0075369_100358772 | 275 |
| 832 | 3300006186 | Ga0075369_10199926 | Ga0075369_101999261 | 275 |
| 833 | 3300006195 | Ga0075366_10020620 | Ga0075366_100206202 | 275 |
| 834 | 3300006353 | Ga0075370_10024328 | Ga0075370_100243284 | 275 |
| 835 | 3300006353 | Ga0075370_10060832 | Ga0075370_100608322 | 275 |
| 836 | 3300006353 | Ga0075370_10083295 | Ga0075370_100832952 | 275 |
| 837 | 3300006358 | Ga0068871_100558134 | Ga0068871_1005581341 | 275 |
| 838 | 3300009011 | Ga0105251_10063362 | Ga0105251_100633621 | 275 |
| 839 | 3300009092 | Ga0105250_10028565 | Ga0105250_100285652 | 275 |
| 840 | 3300009093 | Ga0105240_10447998 | Ga0105240_104479981 | 275 |
| 841 | 3300009093 | Ga0105240_10466817 | Ga0105240_104668171 | 275 |
| 842 | 3300009148 | Ga0105243_10044145 | Ga0105243_100441453 | 275 |
| 843 | 3300009148 | Ga0105243_10335769 | Ga0105243_103357691 | 275 |
| 844 | 3300009148 | Ga0105243_10400100 | Ga0105243_104001002 | 275 |
| 845 | 3300009174 | Ga0105241_10279619 | Ga0105241_102796192 | 275 |
| 846 | 3300009545 | Ga0105237_10093671 | Ga0105237_100936711 | 275 |
| 847 | 3300009545 | Ga0105237_10202804 | Ga0105237_102028042 | 275 |
| 848 | 3300009545 | Ga0105237_10481706 | Ga0105237_104817062 | 275 |
| 849 | 3300009551 | Ga0105238_10240918 | Ga0105238_102409182 | 275 |
| 850 | 3300009766 | Ga0123342_1013959 | Ga0123342_10139594 | 275 |
| 851 | 3300010375 | Ga0105239_10081004 | Ga0105239_100810042 | 275 |
| 852 | 3300010375 | Ga0105239_10098741 | Ga0105239_100987412 | 275 |
| 853 | 3300010375 | Ga0105239_10748260 | Ga0105239_107482602 | 275 |
| 854 | 3300011119 | Ga0105246_10161217 | Ga0105246_101612172 | 275 |
| 855 | 3300013102 | Ga0157371_10284446 | Ga0157371_102844462 | 275 |
| 856 | 3300013104 | Ga0157370_10066457 | Ga0157370_100664571 | 275 |
| 857 | 3300013104 | Ga0157370_10071003 | Ga0157370_100710033 | 275 |
| 858 | 3300013105 | Ga0157369_10399495 | Ga0157369_103994952 | 275 |
| 859 | 3300013297 | Ga0157378_10175215 | Ga0157378_101752152 | 275 |
| 860 | 3300013297 | Ga0157378_10761791 | Ga0157378_107617911 | 275 |
| 861 | 3300013306 | Ga0163162_10227863 | Ga0163162_102278632 | 275 |
| 862 | 3300013306 | Ga0163162_10311892 | Ga0163162_103118922 | 275 |
| 863 | 3300014497 | Ga0182008_10013713 | Ga0182008_100137133 | 275 |
| 864 | 3300014969 | Ga0157376_10471664 | Ga0157376_104716642 | 275 |
| 865 | 3300015265 | Ga0182005_1004600 | Ga0182005_10046004 | 275 |
| 866 | 3300021320 | Ga0214544_1002772 | Ga0214544_100277217 | 275 |
| 867 | 3300021321 | Ga0214542_1001092 | Ga0214542_100109230 | 275 |
| 868 | 3300021321 | Ga0214542_1017459 | Ga0214542_10174595 | 275 |
| 869 | 3300021327 | Ga0214543_1000025 | Ga0214543_1000025201 | 275 |
| 870 | 3300021327 | Ga0214543_1009334 | Ga0214543_10093343 | 275 |
| 871 | 3300025206 | Ga0209435_100006 | Ga0209435_100006455 | 275 |
| 872 | 3300025208 | Ga0209436_100133 | Ga0209436_10013312 | 275 |
| 873 | 3300025208 | Ga0209436_100661 | Ga0209436_1006618 | 275 |
| 874 | 3300025208 | Ga0209436_108885 | Ga0209436_1088851 | 275 |
| 875 | 3300025228 | Ga0209672_102334 | Ga0209672_1023344 | 275 |
| 876 | 3300025233 | Ga0209437_100281 | Ga0209437_10028126 | 275 |
| 877 | 3300025245 | Ga0207425_1000018 | Ga0207425_1000018184 | 275 |
| 878 | 3300025245 | Ga0207425_1003306 | Ga0207425_10033062 | 275 |
| 879 | 3300025246 | Ga0209646_1000015 | Ga0209646_100001579 | 275 |
| 880 | 3300025246 | Ga0209646_1002525 | Ga0209646_10025252 | 275 |
| 881 | 3300025250 | Ga0209026_1000046 | Ga0209026_100004679 | 275 |
| 882 | 3300025250 | Ga0209026_1000327 | Ga0209026_100032712 | 275 |
| 883 | 3300025253 | Ga0209677_102857 | Ga0209677_1028573 | 275 |
| 884 | 3300025254 | Ga0209148_1000078 | Ga0209148_1000078161 | 275 |
| 885 | 3300025256 | Ga0209759_1000005 | Ga0209759_1000005455 | 275 |
| 886 | 3300025256 | Ga0209759_1000321 | Ga0209759_100032161 | 275 |
| 887 | 3300025258 | Ga0209129_1000019 | Ga0209129_100001982 | 275 |
| 888 | 3300025258 | Ga0209129_1000026 | Ga0209129_1000026145 | 275 |
| 889 | 3300025258 | Ga0209129_1000355 | Ga0209129_100035525 | 275 |
| 890 | 3300025258 | Ga0209129_1005510 | Ga0209129_10055103 | 275 |
| 891 | 3300025258 | Ga0209129_1009076 | Ga0209129_10090763 | 275 |
| 892 | 3300025261 | Ga0209233_1000267 | Ga0209233_100026726 | 275 |
| 893 | 3300025272 | Ga0209455_1000193 | Ga0209455_100019322 | 275 |
| 894 | 3300025272 | Ga0209455_1007742 | Ga0209455_10077424 | 275 |
| 895 | 3300025273 | Ga0209673_1000132 | Ga0209673_100013279 | 275 |
| 896 | 3300025273 | Ga0209673_1000294 | Ga0209673_100029481 | 275 |
| 897 | 3300025273 | Ga0209673_1000769 | Ga0209673_100076923 | 275 |
| 898 | 3300025273 | Ga0209673_1004058 | Ga0209673_10040584 | 275 |
| 899 | 3300025273 | Ga0209673_1009831 | Ga0209673_10098312 | 275 |
| 900 | 3300025273 | Ga0209673_1020714 | Ga0209673_10207142 | 275 |
| 901 | 3300025284 | Ga0209130_1000019 | Ga0209130_1000019292 | 275 |
| 902 | 3300025284 | Ga0209130_1000048 | Ga0209130_100004880 | 275 |
| 903 | 3300025284 | Ga0209130_1000136 | Ga0209130_100013672 | 275 |
| 904 | 3300025284 | Ga0209130_1000880 | Ga0209130_100088021 | 275 |
| 905 | 3300025294 | Ga0209025_1000035 | Ga0209025_1000035145 | 275 |
| 906 | 3300025294 | Ga0209025_1000086 | Ga0209025_100008611 | 275 |
| 907 | 3300025294 | Ga0209025_1000260 | Ga0209025_100026042 | 275 |
| 908 | 3300025294 | Ga0209025_1000429 | Ga0209025_100042929 | 275 |
| 909 | 3300025294 | Ga0209025_1001953 | Ga0209025_10019533 | 275 |
| 910 | 3300025294 | Ga0209025_1002615 | Ga0209025_10026154 | 275 |
| 911 | 3300025294 | Ga0209025_1033127 | Ga0209025_10331272 | 275 |
| 912 | 3300025295 | Ga0209564_1000336 | Ga0209564_100033647 | 275 |
| 913 | 3300025295 | Ga0209564_1003025 | Ga0209564_100302511 | 275 |
| 914 | 3300025295 | Ga0209564_1004439 | Ga0209564_10044395 | 275 |
| 915 | 3300025295 | Ga0209564_1015925 | Ga0209564_10159253 | 275 |
| 916 | 3300025295 | Ga0209564_1024109 | Ga0209564_10241092 | 275 |
| 917 | 3300025297 | Ga0209758_1000040 | Ga0209758_1000040145 | 275 |
| 918 | 3300025297 | Ga0209758_1000113 | Ga0209758_100011360 | 275 |
| 919 | 3300025297 | Ga0209758_1001643 | Ga0209758_10016436 | 275 |
| 920 | 3300025297 | Ga0209758_1001704 | Ga0209758_10017048 | 275 |
| 921 | 3300025297 | Ga0209758_1001926 | Ga0209758_10019265 | 275 |
| 922 | 3300025297 | Ga0209758_1003645 | Ga0209758_100364513 | 275 |
| 923 | 3300025298 | Ga0209050_1027588 | Ga0209050_10275883 | 275 |
| 924 | 3300025299 | Ga0209256_1000406 | Ga0209256_100040623 | 275 |
| 925 | 3300025299 | Ga0209256_1000458 | Ga0209256_100045851 | 275 |
| 926 | 3300025299 | Ga0209256_1002794 | Ga0209256_10027947 | 275 |
| 927 | 3300025299 | Ga0209256_1003916 | Ga0209256_10039166 | 275 |
| 928 | 3300025299 | Ga0209256_1005862 | Ga0209256_10058627 | 275 |
| 929 | 3300025299 | Ga0209256_1033673 | Ga0209256_10336731 | 275 |
| 930 | 3300025302 | Ga0207426_1000005 | Ga0207426_1000005316 | 275 |
| 931 | 3300025302 | Ga0207426_1000085 | Ga0207426_1000085138 | 275 |
| 932 | 3300025302 | Ga0207426_1000136 | Ga0207426_100013680 | 275 |
| 933 | 3300025302 | Ga0207426_1000253 | Ga0207426_100025372 | 275 |
| 934 | 3300025302 | Ga0207426_1000282 | Ga0207426_100028255 | 275 |
| 935 | 3300025302 | Ga0207426_1001460 | Ga0207426_100146011 | 275 |
| 936 | 3300025303 | Ga0209051_1000027 | Ga0209051_1000027168 | 275 |
| 937 | 3300025303 | Ga0209051_1000683 | Ga0209051_100068316 | 275 |
| 938 | 3300025303 | Ga0209051_1009482 | Ga0209051_10094824 | 275 |
| 939 | 3300025303 | Ga0209051_1031954 | Ga0209051_10319542 | 275 |
| 940 | 3300025303 | Ga0209051_1033827 | Ga0209051_10338272 | 275 |
| 941 | 3300025304 | Ga0209257_1002682 | Ga0209257_100268215 | 275 |
| 942 | 3300025304 | Ga0209257_1045051 | Ga0209257_10450512 | 275 |
| 943 | 3300025315 | Ga0207697_10112743 | Ga0207697_101127432 | 275 |
| 944 | 3300025904 | Ga0207647_10094323 | Ga0207647_100943231 | 275 |
| 945 | 3300025904 | Ga0207647_10109953 | Ga0207647_101099532 | 275 |
| 946 | 3300025907 | Ga0207645_10233473 | Ga0207645_102334731 | 275 |
| 947 | 3300025911 | Ga0207654_10185523 | Ga0207654_101855231 | 275 |
| 948 | 3300025913 | Ga0207695_10001787 | Ga0207695_1000178729 | 275 |
| 949 | 3300025913 | Ga0207695_10073535 | Ga0207695_100735352 | 275 |
| 950 | 3300025913 | Ga0207695_10092791 | Ga0207695_100927911 | 275 |
| 951 | 3300025913 | Ga0207695_10242221 | Ga0207695_102422211 | 275 |
| 952 | 3300025914 | Ga0207671_10001180 | Ga0207671_100011804 | 275 |
| 953 | 3300025914 | Ga0207671_10093157 | Ga0207671_100931571 | 275 |
| 954 | 3300025914 | Ga0207671_10427833 | Ga0207671_104278331 | 275 |
| 955 | 3300025919 | Ga0207657_10084423 | Ga0207657_100844232 | 275 |
| 956 | 3300025923 | Ga0207681_10107413 | Ga0207681_101074132 | 275 |
| 957 | 3300025924 | Ga0207694_10438262 | Ga0207694_104382621 | 275 |
| 958 | 3300025931 | Ga0207644_10081718 | Ga0207644_100817181 | 275 |
| 959 | 3300025935 | Ga0207709_10031495 | Ga0207709_100314952 | 275 |
| 960 | 3300025949 | Ga0207667_10151194 | Ga0207667_101511941 | 275 |
| 961 | 3300025981 | Ga0207640_10031700 | Ga0207640_100317001 | 275 |
| 962 | 3300026067 | Ga0207678_10109651 | Ga0207678_101096511 | 275 |
| 963 | 3300026067 | Ga0207678_10118778 | Ga0207678_101187783 | 275 |
| 964 | 3300026078 | Ga0207702_10187823 | Ga0207702_101878233 | 275 |
| 965 | 3300026089 | Ga0207648_10213992 | Ga0207648_102139922 | 275 |
| 966 | 3300027111 | Ga0209281_1000324 | Ga0209281_100032457 | 275 |
| 967 | 3300027312 | Ga0209371_1001530 | Ga0209371_100153013 | 275 |
| 968 | 3300028379 | Ga0268266_10237125 | Ga0268266_102371252 | 275 |
| 969 | 3300028379 | Ga0268266_10502036 | Ga0268266_105020361 | 275 |
| 970 | 3300028794 | Ga0307515_10000600 | Ga0307515_1000060059 | 275 |
| 971 | 3300028794 | Ga0307515_10009781 | Ga0307515_100097813 | 275 |
| 972 | 3300028794 | Ga0307515_10020996 | Ga0307515_1002099611 | 275 |
| 973 | 3300030500 | Ga0268256_1008348 | Ga0268256_10083483 | 275 |
| 974 | 3300031456 | Ga0307513_10011937 | Ga0307513_100119376 | 275 |
| 975 | 3300031456 | Ga0307513_10047322 | Ga0307513_100473222 | 275 |
| 976 | 3300031911 | Ga0307412_10092257 | Ga0307412_100922571 | 275 |
| 977 | 3300031995 | Ga0307409_100124291 | Ga0307409_1001242912 | 275 |
| 978 | 3300033180 | Ga0307510_10135414 | Ga0307510_101354142 | 275 |
| 979 | 3300035692 | Ga0373935_0170708 | Ga0373935_0170708_64_891 | 275 |
| 980 | 3300037418 | Ga0395900_0114319 | Ga0395900_0114319_103_930 | 275 |
| 981 | 3300037471 | Ga0395905_0002837 | Ga0395905_0002837_2795_3622 | 275 |
| 982 | 3300037471 | Ga0395905_0014703 | Ga0395905_0014703_2880_3707 | 275 |
| 983 | 3300038443 | Ga0395901_0487128 | Ga0395901_0487128_230_1057 | 275 |
| 984 | 3300039062 | Ga0400483_053333 | Ga0400483_053333_1917_2744 | 275 |
| 985 | 3300039062 | Ga0400483_207099 | Ga0400483_207099_873_1700 | 275 |
| 986 | 3300039062 | Ga0400483_248197 | Ga0400483_248197_11781_12608 | 275 |
| 987 | 3300039447 | Ga0436361_0461858 | Ga0436361_0461858_278_1105 | 275 |
| 988 | 3300041413 | Ga0439465_0007152 | Ga0439465_0007152_2152_2979 | 275 |
| 989 | 3300041486 | Ga0451807_0129412 | Ga0451807_0129412_199_1026 | 275 |
| 990 | 3300041491 | Ga0451833_0686416 | Ga0451833_0686416_298_1161 | 275 |
| 991 | 3300041494 | Ga0451837_0068141 | Ga0451837_0068141_845_1708 | 275 |
| 992 | 3300041496 | Ga0451839_1281927 | Ga0451839_1281927_30_857 | 275 |
| 993 | 3300041501 | Ga0451845_0137671 | Ga0451845_0137671_2872_3699 | 275 |
| 994 | 3300041505 | Ga0451849_0442680 | Ga0451849_0442680_35_898 | 275 |
| 995 | 3300042115 | Ga0450911_000950 | Ga0450911_000950_3218_4048 | 275 |
| 996 | 3300044765 | Ga0466970_0024161 | Ga0466970_0024161_2133_2960 | 275 |
| 997 | 3300045836 | Ga0466958_0105608 | Ga0466958_0105608_188_1015 | 275 |
| 998 | 3300045976 | Ga0466967_0064933 | Ga0466967_0064933_644_1471 | 275 |
| 999 | 3300046460 | Ga0495638_0010418 | Ga0495638_0010418_2406_3233 | 275 |
| 1000 | 3300046460 | Ga0495638_0016913 | Ga0495638_0016913_3140_3967 | 275 |
| 1001 | 3300046460 | Ga0495638_0036817 | Ga0495638_0036817_896_1723 | 275 |
| 1002 | 3300046460 | Ga0495638_0057351 | Ga0495638_0057351_1111_1938 | 275 |
| 1003 | 3300046473 | Ga0495582_0104979 | Ga0495582_0104979_228_1055 | 275 |
| 1004 | 3300046474 | Ga0495605_0010332 | Ga0495605_0010332_1250_2077 | 275 |
| 1005 | 3300046476 | Ga0495662_0007048 | Ga0495662_0007048_4160_4987 | 275 |
| 1006 | 3300046492 | Ga0495585_0043690 | Ga0495585_0043690_1518_2345 | 275 |
| 1007 | 3300046492 | Ga0495585_0057352 | Ga0495585_0057352_1302_2129 | 275 |
| 1008 | 3300046501 | Ga0495607_0048625 | Ga0495607_0048625_1375_2202 | 275 |
| 1009 | 3300046506 | Ga0495583_0007023 | Ga0495583_0007023_2977_3804 | 275 |
| 1010 | 3300046507 | Ga0495606_0070429 | Ga0495606_0070429_598_1425 | 275 |
| 1011 | 3300046512 | Ga0495610_0039308 | Ga0495610_0039308_913_1740 | 275 |
| 1012 | 3300046512 | Ga0495610_0093831 | Ga0495610_0093831_92_919 | 275 |
| 1013 | 3300046513 | Ga0495616_0022870 | Ga0495616_0022870_2488_3315 | 275 |
| 1014 | 3300046519 | Ga0495632_0000580 | Ga0495632_0000580_3240_4067 | 275 |
| 1015 | 3300046519 | Ga0495632_0050768 | Ga0495632_0050768_557_1384 | 275 |
| 1016 | 3300046519 | Ga0495632_0136501 | Ga0495632_0136501_183_1010 | 275 |
| 1017 | 3300046522 | Ga0495643_0050726 | Ga0495643_0050726_801_1628 | 275 |
| 1018 | 3300046522 | Ga0495643_0063215 | Ga0495643_0063215_939_1766 | 275 |
| 1019 | 3300046524 | Ga0495648_0149659 | Ga0495648_0149659_171_998 | 275 |
| 1020 | 3300046536 | Ga0495587_0053800 | Ga0495587_0053800_438_1265 | 275 |
| 1021 | 3300046557 | Ga0495622_0054120 | Ga0495622_0054120_941_1768 | 275 |
| 1022 | 3300046558 | Ga0495633_0056048 | Ga0495633_0056048_398_1225 | 275 |
| 1023 | 3300046558 | Ga0495633_0112875 | Ga0495633_0112875_125_952 | 275 |
| 1024 | 3300046616 | Ga0495668_0005998 | Ga0495668_0005998_6544_7371 | 275 |
| 1025 | 3300046616 | Ga0495668_0026359 | Ga0495668_0026359_247_1074 | 275 |
| 1026 | 3300046616 | Ga0495668_0061969 | Ga0495668_0061969_464_1291 | 275 |
| 1027 | 3300046648 | Ga0495611_0055176 | Ga0495611_0055176_687_1514 | 275 |
| 1028 | 3300046660 | Ga0495625_0005332 | Ga0495625_0005332_663_1490 | 275 |
| 1029 | 3300046660 | Ga0495625_0156277 | Ga0495625_0156277_214_1041 | 275 |
| 1030 | 3300046660 | Ga0495625_0177144 | Ga0495625_0177144_51_878 | 275 |
| 1031 | 3300046674 | Ga0495588_0046862 | Ga0495588_0046862_1339_2166 | 275 |
| 1032 | 3300046674 | Ga0495588_0202711 | Ga0495588_0202711_170_997 | 275 |
| 1033 | 3300046675 | Ga0495657_0041489 | Ga0495657_0041489_158_985 | 275 |
| 1034 | 3300046691 | Ga0495670_0089120 | Ga0495670_0089120_49_876 | 275 |
| 1035 | 3300046694 | Ga0495649_0078547 | Ga0495649_0078547_780_1607 | 275 |
| 1036 | 3300046809 | Ga0495600_0044239 | Ga0495600_0044239_1927_2754 | 275 |
| 1037 | 3300046810 | Ga0495660_0129272 | Ga0495660_0129272_141_968 | 275 |
| 1038 | 3300047317 | Ga0495604_0298541 | Ga0495604_0298541_188_1015 | 275 |
| 1039 | 3300047320 | Ga0495672_0033153 | Ga0495672_0033153_917_1744 | 275 |
| 1040 | 3300047443 | Ga0495687_048937 | Ga0495687_048937_489_1316 | 275 |
| 1041 | 3300047472 | Ga0495686_0000090 | Ga0495686_0000090_111830_112657 | 275 |
| 1042 | 3300047472 | Ga0495686_0028957 | Ga0495686_0028957_2742_3569 | 275 |
| 1043 | 3300047472 | Ga0495686_0179551 | Ga0495686_0179551_108_935 | 275 |
| 1044 | 3300048091 | Ga0495626_0036637 | Ga0495626_0036637_1359_2186 | 275 |
| 1045 | 3300048903 | Ga0496100_0077211 | Ga0496100_0077211_210_1037 | 275 |
| 1046 | 3300048904 | Ga0496101_0195619 | Ga0496101_0195619_180_1007 | 275 |
| 1047 | 3300048905 | Ga0496102_0006548 | Ga0496102_0006548_2363_3190 | 275 |
| 1048 | 3300048905 | Ga0496102_0096533 | Ga0496102_0096533_37_864 | 275 |
| 1049 | 3300048905 | Ga0496102_0233839 | Ga0496102_0233839_137_964 | 275 |
| 1050 | 3300048907 | Ga0496104_0006663 | Ga0496104_0006663_6207_7034 | 275 |
| 1051 | 3300048908 | Ga0496105_0013397 | Ga0496105_0013397_3368_4195 | 275 |
| 1052 | 3300048909 | Ga0496106_0010859 | Ga0496106_0010859_521_1348 | 275 |
| 1053 | 3300048913 | Ga0496110_0068147 | Ga0496110_0068147_533_1360 | 275 |
| 1054 | 3300048915 | Ga0496112_0138438 | Ga0496112_0138438_169_996 | 275 |
| 1055 | 3300048916 | Ga0496113_0134848 | Ga0496113_0134848_379_1206 | 275 |
| 1056 | 3300048916 | Ga0496113_0381006 | Ga0496113_0381006_148_975 | 275 |
| 1057 | 3300048917 | Ga0496114_0080049 | Ga0496114_0080049_343_1170 | 275 |
| 1058 | 3300048919 | Ga0496116_0012255 | Ga0496116_0012255_562_1389 | 275 |
| 1059 | 3300048919 | Ga0496116_0015393 | Ga0496116_0015393_122_949 | 275 |
| 1060 | 3300048919 | Ga0496116_0124313 | Ga0496116_0124313_618_1445 | 275 |
| 1061 | 3300048921 | Ga0496118_0023323 | Ga0496118_0023323_2533_3360 | 275 |
| 1062 | 3300048921 | Ga0496118_0035125 | Ga0496118_0035125_3009_3836 | 275 |
| 1063 | 3300048921 | Ga0496118_0199529 | Ga0496118_0199529_262_1089 | 275 |
| 1064 | 3300048922 | Ga0496119_0005459 | Ga0496119_0005459_3391_4218 | 275 |
| 1065 | 3300048922 | Ga0496119_0109201 | Ga0496119_0109201_568_1395 | 275 |
| 1066 | 3300048923 | Ga0496120_0027697 | Ga0496120_0027697_2504_3331 | 275 |
| 1067 | 3300048924 | Ga0496121_0033217 | Ga0496121_0033217_1183_2010 | 275 |
| 1068 | 3300048924 | Ga0496121_0057064 | Ga0496121_0057064_1850_2677 | 275 |
| 1069 | 3300048924 | Ga0496121_0064534 | Ga0496121_0064534_170_997 | 275 |
| 1070 | 3300048924 | Ga0496121_0108000 | Ga0496121_0108000_299_1126 | 275 |
| 1071 | 3300048924 | Ga0496121_0141279 | Ga0496121_0141279_789_1616 | 275 |
| 1072 | 3300048924 | Ga0496121_0257131 | Ga0496121_0257131_361_1188 | 275 |
| 1073 | 3300048925 | Ga0496122_0000032 | Ga0496122_0000032_202831_203721 | 275 |
| 1074 | 3300048925 | Ga0496122_0012353 | Ga0496122_0012353_5752_6579 | 275 |
| 1075 | 3300048925 | Ga0496122_0015169 | Ga0496122_0015169_616_1443 | 275 |
| 1076 | 3300048925 | Ga0496122_0051078 | Ga0496122_0051078_370_1197 | 275 |
| 1077 | 3300048925 | Ga0496122_0054557 | Ga0496122_0054557_517_1344 | 275 |
| 1078 | 3300048926 | Ga0496123_0000093 | Ga0496123_0000093_41960_42850 | 275 |
| 1079 | 3300048926 | Ga0496123_0042260 | Ga0496123_0042260_1809_2636 | 275 |
| 1080 | 3300048926 | Ga0496123_0060381 | Ga0496123_0060381_1182_2009 | 275 |
| 1081 | 3300048926 | Ga0496123_0069607 | Ga0496123_0069607_325_1152 | 275 |
| 1082 | 3300048926 | Ga0496123_0125794 | Ga0496123_0125794_585_1412 | 275 |
| 1083 | 3300048926 | Ga0496123_0154125 | Ga0496123_0154125_10_837 | 275 |
| 1084 | 3300048927 | Ga0496124_0000462 | Ga0496124_0000462_14944_15771 | 275 |
| 1085 | 3300048927 | Ga0496124_0033583 | Ga0496124_0033583_2329_3156 | 275 |
| 1086 | 3300048927 | Ga0496124_0037008 | Ga0496124_0037008_2373_3200 | 275 |
| 1087 | 3300048927 | Ga0496124_0058531 | Ga0496124_0058531_1850_2677 | 275 |
| 1088 | 3300048927 | Ga0496124_0062278 | Ga0496124_0062278_2004_2831 | 275 |
| 1089 | 3300048927 | Ga0496124_0062682 | Ga0496124_0062682_503_1330 | 275 |
| 1090 | 3300048927 | Ga0496124_0211750 | Ga0496124_0211750_426_1253 | 275 |
| 1091 | 3300048927 | Ga0496124_0223496 | Ga0496124_0223496_456_1286 | 275 |
| 1092 | 3300048928 | Ga0496125_0000041 | Ga0496125_0000041_250091_250981 | 275 |
| 1093 | 3300048928 | Ga0496125_0035663 | Ga0496125_0035663_598_1425 | 275 |
| 1094 | 3300048928 | Ga0496125_0065455 | Ga0496125_0065455_252_1079 | 275 |
| 1095 | 3300048929 | Ga0496126_0000299 | Ga0496126_0000299_60344_61171 | 275 |
| 1096 | 3300048929 | Ga0496126_0031652 | Ga0496126_0031652_3872_4699 | 275 |
| 1097 | 3300048929 | Ga0496126_0059530 | Ga0496126_0059530_600_1427 | 275 |
| 1098 | 3300048929 | Ga0496126_0205133 | Ga0496126_0205133_307_1134 | 275 |
| 1099 | 3300048929 | Ga0496126_0436567 | Ga0496126_0436567_50_877 | 275 |
| 1100 | 3300049568 | Ga0501031_0042691 | Ga0501031_0042691_210_1037 | 275 |
| 1101 | 3300049569 | Ga0501032_0002804 | Ga0501032_0002804_10792_11619 | 275 |
| 1102 | 3300049570 | Ga0501033_0000230 | Ga0501033_0000230_45363_46229 | 275 |
| 1103 | 3300049570 | Ga0501033_0003721 | Ga0501033_0003721_10180_11007 | 275 |
| 1104 | 3300049570 | Ga0501033_0133747 | Ga0501033_0133747_397_1251 | 275 |
| 1105 | 3300049571 | Ga0501034_0006050 | Ga0501034_0006050_10305_11132 | 275 |
| 1106 | 3300049571 | Ga0501034_0157348 | Ga0501034_0157348_107_934 | 275 |
| 1107 | 3300049572 | Ga0501036_0003490 | Ga0501036_0003490_1933_2760 | 275 |
| 1108 | 3300049572 | Ga0501036_0097039 | Ga0501036_0097039_836_1702 | 275 |
| 1109 | 3300049573 | Ga0501037_0000168 | Ga0501037_0000168_54160_55026 | 275 |
| 1110 | 3300049573 | Ga0501037_0006255 | Ga0501037_0006255_5537_6364 | 275 |
| 1111 | 3300049573 | Ga0501037_0081368 | Ga0501037_0081368_353_1180 | 275 |
| 1112 | 3300049573 | Ga0501037_0220950 | Ga0501037_0220950_439_1266 | 275 |
| 1113 | 3300049574 | Ga0501038_0037392 | Ga0501038_0037392_466_1293 | 275 |
| 1114 | 3300049575 | Ga0501039_0002578 | Ga0501039_0002578_1936_2763 | 275 |
| 1115 | 3300049579 | Ga0501043_0000005 | Ga0501043_0000005_117410_118276 | 275 |
| 1116 | 3300049579 | Ga0501043_0003499 | Ga0501043_0003499_10797_11624 | 275 |
| 1117 | 3300049579 | Ga0501043_0020903 | Ga0501043_0020903_1839_2666 | 275 |
| 1118 | 3300049580 | Ga0501046_0001795 | Ga0501046_0001795_1366_2193 | 275 |
| 1119 | 3300049581 | Ga0501047_0003954 | Ga0501047_0003954_11172_11999 | 275 |
| 1120 | 3300049581 | Ga0501047_0091469 | Ga0501047_0091469_1771_2598 | 275 |
| 1121 | 3300049581 | Ga0501047_0165623 | Ga0501047_0165623_827_1654 | 275 |
| 1122 | 3300049581 | Ga0501047_0219239 | Ga0501047_0219239_412_1278 | 275 |
| 1123 | 3300049582 | Ga0501048_0084355 | Ga0501048_0084355_988_1815 | 275 |
| 1124 | 3300049584 | Ga0501068_0054375 | Ga0501068_0054375_837_1664 | 275 |
| 1125 | 3300049585 | Ga0501069_0000011 | Ga0501069_0000011_112721_113587 | 275 |
| 1126 | 3300049586 | Ga0501070_0000055 | Ga0501070_0000055_87978_88844 | 275 |
| 1127 | 3300049586 | Ga0501070_0041312 | Ga0501070_0041312_2442_3269 | 275 |
| 1128 | 3300049587 | Ga0501071_0021385 | Ga0501071_0021385_2667_3533 | 275 |
| 1129 | 3300049587 | Ga0501071_0256306 | Ga0501071_0256306_334_1161 | 275 |
| 1130 | 3300049589 | Ga0501073_0006917 | Ga0501073_0006917_4588_5454 | 275 |
| 1131 | 3300049590 | Ga0501074_0000039 | Ga0501074_0000039_55913_56779 | 275 |
| 1132 | 3300049742 | Ga0501080_0003073 | Ga0501080_0003073_1909_2775 | 275 |
| 1133 | 3300049742 | Ga0501080_0094202 | Ga0501080_0094202_712_1539 | 275 |
| 1134 | 3300049742 | Ga0501080_0243924 | Ga0501080_0243924_18_845 | 275 |
| 1135 | 3300049744 | Ga0501083_0000180 | Ga0501083_0000180_11072_11938 | 275 |
| 1136 | 3300049744 | Ga0501083_0013857 | Ga0501083_0013857_3856_4683 | 275 |
| 1137 | 3300049822 | Ga0501035_0000938 | Ga0501035_0000938_20541_21407 | 275 |
| 1138 | 3300049822 | Ga0501035_0003248 | Ga0501035_0003248_12816_13643 | 275 |
| 1139 | 3300049823 | Ga0501044_0001322 | Ga0501044_0001322_20521_21387 | 275 |
| 1140 | 3300049823 | Ga0501044_0093752 | Ga0501044_0093752_100_927 | 275 |
| 1141 | 3300049823 | Ga0501044_0261919 | Ga0501044_0261919_723_1550 | 275 |
| 1142 | 3300049824 | Ga0501045_0051923 | Ga0501045_0051923_1395_2222 | 275 |
| 1143 | 3300049824 | Ga0501045_0299384 | Ga0501045_0299384_332_1159 | 275 |
| 1144 | 3300050489 | nmdc:mga03683_37146_c1 | nmdc:mga03683_37146_c1_220_1047 | 275 |
| 1145 | 3300050491 | nmdc:mga00v17_47269_c1 | nmdc:mga00v17_47269_c1_1035_1862 | 275 |
| 1146 | 3300050491 | nmdc:mga00v17_92493_c1 | nmdc:mga00v17_92493_c1_964_1836 | 275 |
| 1147 | 3300050492 | nmdc:mga0yw44_61545_c1 | nmdc:mga0yw44_61545_c1_1242_2069 | 275 |
| 1148 | 3300050492 | nmdc:mga0yw44_7008_c1 | nmdc:mga0yw44_7008_c1_2821_3693 | 275 |
| 1149 | 3300050493 | nmdc:mga0k408_249901_c1 | nmdc:mga0k408_249901_c1_145_972 | 275 |
| 1150 | 3300050494 | nmdc:mga06z11_73582_c1 | nmdc:mga06z11_73582_c1_290_1162 | 275 |
| 1151 | 3300050496 | nmdc:mga07m45_325388_c1 | nmdc:mga07m45_325388_c1_21_848 | 275 |
| 1152 | 3300050516 | nmdc:mga0sz30_20678_c1 | nmdc:mga0sz30_20678_c1_249_1076 | 275 |
| 1153 | 3300050516 | nmdc:mga0sz30_5210_c1 | nmdc:mga0sz30_5210_c1_965_1792 | 275 |
| 1154 | 3300053083 | Ga0495655_0019354 | Ga0495655_0019354_289_1116 | 275 |
| 1155 | 3300053085 | Ga0495619_0027540 | Ga0495619_0027540_1056_1883 | 275 |
| 1156 | 3300053086 | Ga0500578_0208189 | Ga0500578_0208189_244_1071 | 275 |
| 1157 | 3300053105 | Ga0500557_004079 | Ga0500557_004079_1879_2706 | 275 |
| 1158 | 3300053109 | Ga0500569_045854 | Ga0500569_045854_260_1087 | 275 |
| 1159 | 3300053122 | Ga0500608_051256 | Ga0500608_051256_237_1064 | 275 |
| 1160 | 3300053125 | Ga0500618_016039 | Ga0500618_016039_849_1676 | 275 |
| 1161 | 3300053134 | Ga0500658_0008530 | Ga0500658_0008530_366_1193 | 275 |
| 1162 | 3300053139 | Ga0500568_0006143 | Ga0500568_0006143_2988_3815 | 275 |
| 1163 | 3300053139 | Ga0500568_0014722 | Ga0500568_0014722_2126_2953 | 275 |
| 1164 | 3300053148 | Ga0500590_017148 | Ga0500590_017148_1157_1984 | 275 |
| 1165 | 3300053153 | Ga0500616_0047310 | Ga0500616_0047310_690_1517 | 275 |
| 1166 | 3300053155 | Ga0500620_001067 | Ga0500620_001067_3217_4083 | 275 |
| 1167 | 3300053156 | Ga0500622_0000207 | Ga0500622_0000207_59725_60552 | 275 |
| 1168 | 3300053158 | Ga0500627_0038432 | Ga0500627_0038432_527_1354 | 275 |
| 1169 | 3300053158 | Ga0500627_0062772 | Ga0500627_0062772_718_1545 | 275 |
| 1170 | 3300053727 | Ga0500611_033516 | Ga0500611_033516_178_1005 | 275 |
| 1171 | 3300053727 | Ga0500611_046080 | Ga0500611_046080_103_930 | 275 |
| 1172 | 3300053730 | Ga0500645_011310 | Ga0500645_011310_303_1130 | 275 |
| 1173 | 3300054114 | Ga0501084_0389354 | Ga0501084_0389354_234_1061 | 275 |
| 1174 | iso_pu_bacteria | 2516143018 | 2516207910 | 275 |
| 1175 | iso_pu_bacteria | 637000159 | 637078884 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5t57-assembly1.cif.gz_A-2 | crystal structure of a semialdehyde dehydrogenase nad-binding protein from cupriavidus necator in complex with calcium and nad | 0.9362 | 1 | 275 |
| 5t57-assembly1.cif.gz_A-2 | crystal structure of a semialdehyde dehydrogenase nad-binding protein from cupriavidus necator in complex with calcium and nad | 0.933 | 1 | 275 |
| 3c24-assembly1.cif.gz_B | crystal structure of a putative oxidoreductase (yp_511008.1) from jannaschia sp. ccs1 at 1.62 a resolution | 0.9221 | 2 | 274 |
| 3c24-assembly1.cif.gz_B | crystal structure of a putative oxidoreductase (yp_511008.1) from jannaschia sp. ccs1 at 1.62 a resolution | 0.9031 | 2 | 274 |
| 7bvj-assembly3.cif.gz_C | udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) | 0.7989 | 3 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5t57A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9602 | 1 | 174 | 3.40.50.720 |
| 5t57A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9496 | 1 | 174 | 3.40.50.720 |
| 3c24B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9469 | 2 | 174 | 3.40.50.720 |
| 3c24B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9254 | 2 | 174 | 3.40.50.720 |
| af_Q58582_1_364_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8395 | 2 | 35 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R1WWN5-F1-model_v4 | Coenzyme F420-dependent NADP oxidoreductase-like protein | 1.003 | 1 | 91 |
|
| AF-A0A4Z1C3Y9-F1-model_v4 | Semialdehyde dehydrogenase | 0.9959 | 1 | 83 |
|
| AF-A0A3C0PKF1-F1-model_v4 | Semialdehyde dehydrogenase | 0.9949 | 1 | 60 |
|
| AF-A0A5R2N7Q4-F1-model_v4 | Semialdehyde dehydrogenase | 0.9929 | 1 | 107 |
|
| AF-A0A4R1WWN5-F1-model_v4 | Coenzyme F420-dependent NADP oxidoreductase-like protein | 0.9917 | 1 | 91 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar