F491215

General Info

Members Datasets Scaffolds Average Seq Length
1174 444 1113 147

Family's Representative Sequence

Representative Sequence 3300003479|Ga0006556J51387_1038975|Ga0006556J51387_10389752
Length 150
Sequence MNQRDLRTILLVEDSMADAEMAIDALREANLANPVVHVEDGVDCLDWLHRRGAYADRTEGDPENRAILLDIKMPRMDGLEVLKQLRSEDKWKRLPVVILSSSREESDLARSWDLGVNAYVLKPVDVQQFFTAVQTLGHFWAVLNQRPDGE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
6 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
7 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
8 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
9 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
10 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
11 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
12 2734482264 Dyella sp. AD052 Isolate Unclassified
13 2738543009 Luteibacter sp. OK325 Isolate Unclassified
14 2739367700 Dyella sp. YR388 Isolate Unclassified
15 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
16 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
17 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
18 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
19 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
20 2818991457 Xanthomonas translucens 569 Isolate Unclassified
21 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
22 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
23 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
24 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
25 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
26 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
27 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
28 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
29 2884411467 Dyella sp. AD56 Isolate Rhizosphere
30 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
31 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
32 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
33 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
34 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
35 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
36 2919085039 Luteibacter sp. 1214 Isolate Unclassified
37 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
38 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
39 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
40 2919404418 Luteibacter sp. 3190 Isolate Unclassified
41 2919513703 Luteimonas sp. 3794 Isolate Unclassified
42 2919675420 Luteimonas terrae 4099 Isolate Unclassified
43 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
44 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
45 2928963466 Dyella japonica 1073 Isolate Unclassified
46 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
47 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
48 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
49 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
50 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
51 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
52 2941471342 Luteibacter sp. 621 Isolate Unclassified
53 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
54 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
55 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
56 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
57 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
58 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
59 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
60 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
61 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
62 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
63 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
64 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
65 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
66 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
67 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
68 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
69 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
70 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
71 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
72 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
73 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
74 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
75 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
76 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
77 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
78 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
79 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
80 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
81 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
82 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
83 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
84 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
85 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
86 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
87 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
88 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
89 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
90 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
91 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
92 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
93 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
94 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
95 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
96 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
97 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
98 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
99 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
100 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
101 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
102 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
103 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
104 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
105 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
106 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
107 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
108 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
109 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
110 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
111 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
112 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
113 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
114 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
115 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
116 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
117 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
118 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
119 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
120 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
121 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
122 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
123 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
124 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
125 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
126 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
127 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
128 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
129 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
130 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
131 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
132 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
133 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
134 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
135 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
136 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
137 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
138 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
139 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
140 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
141 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
142 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
143 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
144 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
145 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
146 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
147 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
148 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
149 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
150 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
151 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
152 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
153 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
154 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
155 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
156 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
157 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
158 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
159 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
160 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
161 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
162 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
163 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
164 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
165 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
166 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
167 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
168 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
169 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
170 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
171 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
172 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
173 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
174 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
175 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
176 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
177 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
178 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
179 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
180 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
181 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
182 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
183 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
184 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
185 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
186 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
187 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
188 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
189 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
190 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
191 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
192 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
193 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
194 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
195 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
196 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
197 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
198 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
199 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
201 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
202 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
208 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
209 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
211 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
212 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
213 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
216 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
217 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
218 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
224 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
225 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
226 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
228 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
229 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
284 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
285 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
286 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
287 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
288 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
289 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
290 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
291 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
292 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
293 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
294 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
295 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
296 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
297 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
298 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
299 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
300 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
301 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
302 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
303 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
304 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
305 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
306 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
307 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
308 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
309 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
310 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
311 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
312 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
313 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
314 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
315 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
316 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
317 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
318 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
319 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
320 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
321 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
322 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
323 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
324 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
325 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
326 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
327 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
328 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
329 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
330 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
331 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
332 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
333 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
334 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
335 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
336 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
337 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
338 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
339 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
340 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
341 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
342 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
343 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
344 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
345 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
346 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
347 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
348 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
349 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
350 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
351 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
352 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
353 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
354 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
355 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
356 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
357 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
358 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
359 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
360 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
361 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
362 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
363 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
364 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
365 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
366 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
367 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
368 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
369 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
370 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
371 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
372 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
373 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
374 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
375 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
376 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
377 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
378 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
379 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
380 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
381 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
382 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
383 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
384 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
385 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
386 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
387 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
388 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
389 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
390 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
391 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
392 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
393 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
394 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
395 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
396 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
397 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
398 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
413 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
414 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
415 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
416 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
417 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
418 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
419 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
420 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
421 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
422 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
425 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
426 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
427 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
428 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
429 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
430 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
431 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
432 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
433 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
434 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
435 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
436 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
437 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
438 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
439 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
440 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
441 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
442 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
443 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
444 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.7
Metatranscriptomes 1.02
Isolates 5.28

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 13.63
Nodule 0.09
Rhizoplane 4.17
Rhizosphere 65.5
Stem 0
Stem Tuber 0
Unclassified 16.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2618757 2162886007 Bacteria 2735
2 SwRhRL2b_contig_3114300 2162886007 Bacteria 2725
3 SwRhRL2b_contig_3331867 2162886007 Bacteria 6230
4 JGI24736J21556_1002244 3300001904 Bacteria 3420
5 JGI24740J21852_10003541 3300001979 Bacteria 6841
6 JGI24739J22299_10007421 3300001989 Bacteria 4116
7 JGI24737J22298_10001144 3300001990 Bacteria 9328
8 JGI24735J21928_10005023 3300002067 Bacteria 4404
9 JGI24735J21928_10086322 3300002067 Bacteria 899
10 JGI24738J21930_10000044 3300002075 Bacteria 24745
11 JGI25156J39149_1010277 3300002705 Bacteria 2211
12 JGI25162J39368_1000811 3300002737 Bacteria 20620
13 JGI25162J39368_1001308 3300002737 Bacteria 14032
14 JGI25162J39368_1002798 3300002737 Bacteria 6147
15 JGI25154J39366_1006559 3300002738 Bacteria 1688
16 JGI25157J39369_1000433 3300002741 Bacteria 27238
17 JGI25157J39369_1000709 3300002741 Bacteria 17964
18 JGI25157J39369_1001069 3300002741 Bacteria 12362
19 JGI25163J39215_1000461 3300002771 Bacteria 12324
20 JGI25164J39214_1000030 3300002772 Bacteria 145974
21 JGI25164J39214_1000638 3300002772 Bacteria 14492
22 JGI25164J39214_1000720 3300002772 Bacteria 12503
23 JGI25164J39214_1000728 3300002772 Bacteria 12324
24 JGI25152J39213_1010967 3300002773 Bacteria 2032
25 JGI25150J39212_1000183 3300002774 Bacteria 35389
26 JGI25151J46595_10000271 3300003187 Bacteria 59472
27 JGI25165J46597_1000057 3300003214 Bacteria 217135
28 JGI25165J46597_1001248 3300003214 Bacteria 15033
29 JGI25165J46597_1001463 3300003214 Bacteria 12324
30 JGI25165J46597_1005256 3300003214 Bacteria 2543
31 JGI25153J46596_10000190 3300003215 Bacteria 59472
32 JGI25153J46596_10013331 3300003215 Bacteria 3478
33 rootH1_10006990 3300003316 Bacteria 4981
34 rootH1_10006990 3300003323 Bacteria 8851
35 rootH1_10039356 3300003316 Bacteria 4121
36 rootH2_10007042 3300003320 Bacteria 38280
37 rootH2_10083186 3300003320 Bacteria 1449
38 rootL2_10117941 3300003322 Bacteria 1331
39 rootH1_10043860 3300003323 Bacteria 2213
40 rootH1_10191640 3300003323 Bacteria 1016
41 Ga0006556J51387_1038975 3300003479 Bacteria 609
42 Ga0006560J51390_1045036 3300003565 Bacteria 874
43 Ga0006554J51385_1038764 3300003567 Bacteria 716
44 Ga0006562J51391_1121937 3300003578 Bacteria 3930
45 Ga0006562J51391_1121938 3300003578 Bacteria 2390
46 Ga0006562J51391_1153636 3300003578 Bacteria 8452
47 Ga0006562J51391_1153637 3300003578 Bacteria 8320
48 Ga0055538_1002435 3300003751 Bacteria 2742
49 Ga0055539_1001976 3300003752 Bacteria 3398
50 Ga0055533_1001436 3300003756 Bacteria 6298
51 Ga0055525_1000124 3300003759 Bacteria 116698
52 Ga0055527_1000111 3300003760 Bacteria 58194
53 Ga0055527_1000244 3300003760 Bacteria 33673
54 Ga0055527_1000337 3300003760 Bacteria 23995
55 Ga0055527_1010654 3300003760 Bacteria 1059
56 Ga0055535_1000238 3300003761 Bacteria 58182
57 Ga0055535_1000885 3300003761 Bacteria 20792
58 Ga0055535_1001411 3300003761 Bacteria 12324
59 Ga0055535_1002396 3300003761 Bacteria 6671
60 Ga0055535_1028867 3300003761 Bacteria 594
61 Ga0055542_1000170 3300003762 Bacteria 81222
62 Ga0055542_1000243 3300003762 Bacteria 62769
63 Ga0055542_1000272 3300003762 Bacteria 58181
64 Ga0055542_1000278 3300003762 Bacteria 57321
65 Ga0055542_1000359 3300003762 Bacteria 47683
66 Ga0055542_1001383 3300003762 Bacteria 12324
67 Ga0055529_1000137 3300003763 Bacteria 103695
68 Ga0055529_1000299 3300003763 Bacteria 57321
69 Ga0055529_1000446 3300003763 Bacteria 41042
70 Ga0055529_1001090 3300003763 Bacteria 12324
71 Ga0055529_1003065 3300003763 Bacteria 2916
72 Ga0055526_1000298 3300003771 Bacteria 41396
73 Ga0055537_1001342 3300003773 Bacteria 9995
74 Ga0055537_1001615 3300003773 Bacteria 8475
75 Ga0055536_1007759 3300003781 Bacteria 4744
76 Ga0055536_1008889 3300003781 Bacteria 4242
77 Ga0055534_1000145 3300003784 Bacteria 52879
78 Ga0055528_1002402 3300003790 Bacteria 10077
79 Ga0055531_10004333 3300003794 Bacteria 8681
80 Ga0055531_10036266 3300003794 Bacteria 1525
81 Ga0058692_1000053 3300003856 Bacteria 107166
82 Ga0058692_1000065 3300003856 Bacteria 89723
83 Ga0065165_1000201 3300005262 Bacteria 103327
84 Ga0065165_1001785 3300005262 Bacteria 21254
85 Ga0065704_10071470 3300005289 Bacteria 11010
86 Ga0065704_10071727 3300005289 Bacteria 10107
87 Ga0065704_10114879 3300005289 Bacteria 1882
88 Ga0070658_10318007 3300005327 Bacteria 1329
89 Ga0070658_11567879 3300005327 Bacteria 571
90 Ga0070683_100815547 3300005329 Bacteria 895
91 Ga0070690_100309231 3300005330 Bacteria 1135
92 Ga0070670_100001269 3300005331 Bacteria 20103
93 Ga0070677_10241607 3300005333 Bacteria 892
94 Ga0068869_100126402 3300005334 Bacteria 1961
95 Ga0068869_101643331 3300005334 Bacteria 573
96 Ga0070666_10000037 3300005335 Bacteria 116528
97 Ga0070666_10011462 3300005335 Bacteria 5565
98 Ga0070666_10119514 3300005335 Bacteria 1827
99 Ga0070666_10229203 3300005335 Bacteria 1312
100 Ga0070680_100816224 3300005336 Bacteria 804
101 Ga0070682_100006165 3300005337 Bacteria 6717
102 Ga0070682_100022545 3300005337 Bacteria 3731
103 Ga0070682_100450977 3300005337 Bacteria 985
104 Ga0070682_101003122 3300005337 Bacteria 693
105 Ga0070660_100148118 3300005339 Bacteria 1886
106 Ga0070689_100069640 3300005340 Bacteria 2745
107 Ga0070661_100014450 3300005344 Bacteria 5565
108 Ga0070661_100084409 3300005344 Bacteria 2346
109 Ga0070661_100109909 3300005344 Bacteria 2058
110 Ga0070661_100179497 3300005344 Bacteria 1610
111 Ga0070661_100263888 3300005344 Bacteria 1332
112 Ga0070661_100270257 3300005344 Bacteria 1316
113 Ga0070661_100406888 3300005344 Bacteria 1077
114 Ga0070692_10251142 3300005345 Bacteria 1059
115 Ga0070668_100002627 3300005347 Bacteria 13198
116 Ga0070668_100008971 3300005347 Bacteria 7426
117 Ga0070668_100082447 3300005347 Bacteria 2522
118 Ga0070668_100174478 3300005347 Bacteria 1752
119 Ga0070668_100339444 3300005347 Bacteria 1269
120 Ga0070668_100405656 3300005347 Bacteria 1164
121 Ga0070669_101213156 3300005353 Bacteria 652
122 Ga0070671_100496493 3300005355 Bacteria 1050
123 Ga0070673_100401624 3300005364 Bacteria 1226
124 Ga0070688_101301865 3300005365 Unclassified 587
125 Ga0070659_100005082 3300005366 Bacteria 9433
126 Ga0070659_100113653 3300005366 Bacteria 2187
127 Ga0070659_100157535 3300005366 Bacteria 1855
128 Ga0070659_100312204 3300005366 Bacteria 1313
129 Ga0070667_100007927 3300005367 Bacteria 8807
130 Ga0070667_100068192 3300005367 Bacteria 3027
131 Ga0070667_100079319 3300005367 Bacteria 2806
132 Ga0070667_100104525 3300005367 Bacteria 2450
133 Ga0070667_100108061 3300005367 Bacteria 2409
134 Ga0070667_100123401 3300005367 Bacteria 2255
135 Ga0070667_100731860 3300005367 Bacteria 916
136 Ga0070714_100001712 3300005435 Bacteria 15958
137 Ga0070714_100007367 3300005435 Bacteria 8561
138 Ga0070714_100755902 3300005435 Bacteria 940
139 Ga0070713_100000361 3300005436 Bacteria 29277
140 Ga0070713_100493298 3300005436 Bacteria 1155
141 Ga0070710_10078812 3300005437 Bacteria 1918
142 Ga0070710_10294604 3300005437 Bacteria 1057
143 Ga0070711_100328453 3300005439 Bacteria 1224
144 Ga0070663_100022897 3300005455 Bacteria 4181
145 Ga0070663_100061578 3300005455 Bacteria 2703
146 Ga0070663_100142296 3300005455 Bacteria 1832
147 Ga0070663_100206250 3300005455 Bacteria 1537
148 Ga0070663_100286973 3300005455 Bacteria 1313
149 Ga0070663_100318687 3300005455 Bacteria 1249
150 Ga0070678_100037145 3300005456 Bacteria 3417
151 Ga0070678_100410621 3300005456 Bacteria 1178
152 Ga0070678_101238262 3300005456 Bacteria 693
153 Ga0070681_10035249 3300005458 Bacteria 5026
154 Ga0070681_10050179 3300005458 Bacteria 4164
155 Ga0070681_10118761 3300005458 Bacteria 2581
156 Ga0070681_11306510 3300005458 Bacteria 648
157 Ga0068867_100398752 3300005459 Bacteria 1160
158 Ga0070685_10016651 3300005466 Bacteria 3921
159 Ga0070685_10525917 3300005466 Bacteria 841
160 Ga0070679_100107093 3300005530 Bacteria 2781
161 Ga0070679_100111320 3300005530 Bacteria 2724
162 Ga0070679_101408950 3300005530 Bacteria 643
163 Ga0070679_101475235 3300005530 Bacteria 627
164 Ga0070684_100039361 3300005535 Bacteria 4066
165 Ga0070684_101472516 3300005535 Bacteria 641
166 Ga0068853_100002888 3300005539 Bacteria 13037
167 Ga0068853_100006082 3300005539 Bacteria 9554
168 Ga0068853_100052408 3300005539 Bacteria 3515
169 Ga0068853_100058878 3300005539 Bacteria 3317
170 Ga0068853_100219542 3300005539 Bacteria 1736
171 Ga0068853_100355277 3300005539 Bacteria 1364
172 Ga0068853_100559743 3300005539 Bacteria 1084
173 Ga0070672_100146162 3300005543 Bacteria 1954
174 Ga0070696_100013156 3300005546 Bacteria 5551
175 Ga0070696_100029285 3300005546 Bacteria 3762
176 Ga0070693_100014292 3300005547 Bacteria 4064
177 Ga0070693_100021962 3300005547 Bacteria 3388
178 Ga0070693_100266050 3300005547 Bacteria 1142
179 Ga0070665_100027941 3300005548 Bacteria 5681
180 Ga0070665_100055239 3300005548 Bacteria 3982
181 Ga0070665_100084360 3300005548 Bacteria 3182
182 Ga0070665_100159999 3300005548 Bacteria 2254
183 Ga0070665_100242097 3300005548 Bacteria 1804
184 Ga0070665_100521598 3300005548 Bacteria 1200
185 Ga0068855_100009589 3300005563 Bacteria 11680
186 Ga0068855_100032401 3300005563 Bacteria 6241
187 Ga0068855_100119218 3300005563 Bacteria 3021
188 Ga0068855_100189913 3300005563 Bacteria 2318
189 Ga0068855_100193394 3300005563 Bacteria 2293
190 Ga0068855_100405053 3300005563 Bacteria 1494
191 Ga0068855_100455328 3300005563 Bacteria 1396
192 Ga0070664_100045909 3300005564 Bacteria 3690
193 Ga0068857_100003481 3300005577 Bacteria 13143
194 Ga0068857_100022263 3300005577 Bacteria 5575
195 Ga0068857_100022677 3300005577 Bacteria 5523
196 Ga0068857_100213600 3300005577 Bacteria 1761
197 Ga0068857_100248172 3300005577 Bacteria 1631
198 Ga0068857_100348155 3300005577 Bacteria 1372
199 Ga0068857_101127950 3300005577 Bacteria 758
200 Ga0068854_100000387 3300005578 Bacteria 27608
201 Ga0068854_100001064 3300005578 Bacteria 16495
202 Ga0068854_100015721 3300005578 Bacteria 5024
203 Ga0068854_100020609 3300005578 Bacteria 4465
204 Ga0068854_100515834 3300005578 Bacteria 1009
205 Ga0068856_100000074 3300005614 Bacteria 94656
206 Ga0068856_100002874 3300005614 Bacteria 17624
207 Ga0068856_100163284 3300005614 Bacteria 2239
208 Ga0068856_100728181 3300005614 Bacteria 1012
209 Ga0068852_100130482 3300005616 Bacteria 2314
210 Ga0068852_100169120 3300005616 Bacteria 2047
211 Ga0068859_100000414 3300005617 Bacteria 42532
212 Ga0068864_100050317 3300005618 Bacteria 3586
213 Ga0068861_100156731 3300005719 Bacteria 1874
214 Ga0068851_10000919 3300005834 Bacteria 12694
215 Ga0068851_10057100 3300005834 Bacteria 1992
216 Ga0068851_10326926 3300005834 Bacteria 887
217 Ga0068863_100218541 3300005841 Bacteria 1836
218 Ga0068858_100439287 3300005842 Bacteria 1257
219 Ga0068858_100608595 3300005842 Bacteria 1060
220 Ga0068858_101180759 3300005842 Bacteria 752
221 Ga0068860_100032336 3300005843 Bacteria 5027
222 Ga0068860_100101544 3300005843 Bacteria 2744
223 Ga0068860_100561495 3300005843 Bacteria 1144
224 Ga0068862_100000047 3300005844 Bacteria 151607
225 Ga0068862_100676586 3300005844 Bacteria 998
226 Ga0075365_10249900 3300006038 Bacteria 1246
227 Ga0075363_100865561 3300006048 Bacteria 552
228 Ga0075364_10000527 3300006051 Bacteria 19477
229 Ga0075364_10223826 3300006051 Bacteria 1277
230 Ga0075364_10440672 3300006051 Bacteria 890
231 Ga0075364_10507193 3300006051 Bacteria 825
232 Ga0070712_100386046 3300006175 Bacteria 1154
233 Ga0075369_10019233 3300006186 Bacteria 2787
234 Ga0075369_10084571 3300006186 Bacteria 1410
235 Ga0075369_10104761 3300006186 Bacteria 1271
236 Ga0097621_100098567 3300006237 Bacteria 2455
237 Ga0097621_100218754 3300006237 Bacteria 1659
238 Ga0097621_100333831 3300006237 Bacteria 1345
239 Ga0068871_100071471 3300006358 Bacteria 2854
240 Ga0068865_100079664 3300006881 Bacteria 2347
241 Ga0097620_100000414 3300006931 Bacteria 42532
242 Ga0105251_10000205 3300009011 Bacteria 59437
243 Ga0105244_10049736 3300009036 Bacteria 2140
244 Ga0105244_10099875 3300009036 Bacteria 1420
245 Ga0105244_10268482 3300009036 Bacteria 793
246 Ga0105240_10005042 3300009093 Bacteria 19810
247 Ga0105240_10005178 3300009093 Bacteria 19502
248 Ga0105240_10013068 3300009093 Bacteria 11426
249 Ga0105240_10035764 3300009093 Bacteria 6397
250 Ga0105240_10163465 3300009093 Bacteria 2642
251 Ga0105240_10520885 3300009093 Bacteria 1319
252 Ga0105240_10558200 3300009093 Bacteria 1266
253 Ga0105240_11511655 3300009093 Bacteria 704
254 Ga0105245_10888416 3300009098 Bacteria 932
255 Ga0105247_10001840 3300009101 Bacteria 14832
256 Ga0105247_10014538 3300009101 Bacteria 4721
257 Ga0105247_10111910 3300009101 Bacteria 1758
258 Ga0105243_10004757 3300009148 Bacteria 10671
259 Ga0105243_10006955 3300009148 Bacteria 8712
260 Ga0105241_10067467 3300009174 Bacteria 2769
261 Ga0105241_10959446 3300009174 Bacteria 797
262 Ga0105242_10619287 3300009176 Bacteria 1048
263 Ga0105242_12589625 3300009176 Bacteria 556
264 Ga0105248_10089766 3300009177 Bacteria 3460
265 Ga0105248_10150212 3300009177 Bacteria 2628
266 Ga0105248_10172774 3300009177 Bacteria 2436
267 Ga0105248_10787185 3300009177 Bacteria 1073
268 Ga0105237_10001725 3300009545 Bacteria 28243
269 Ga0105237_10002067 3300009545 Bacteria 25458
270 Ga0105237_10097369 3300009545 Bacteria 2932
271 Ga0105237_10590238 3300009545 Bacteria 1118
272 Ga0105237_10780722 3300009545 Bacteria 962
273 Ga0105237_11058689 3300009545 Bacteria 818
274 Ga0105238_10000154 3300009551 Bacteria 75243
275 Ga0105238_10010377 3300009551 Bacteria 9348
276 Ga0105238_10047250 3300009551 Bacteria 4342
277 Ga0105238_10124083 3300009551 Bacteria 2562
278 Ga0105238_10202153 3300009551 Bacteria 1963
279 Ga0105238_10276459 3300009551 Bacteria 1660
280 Ga0105249_10955365 3300009553 Bacteria 925
281 Ga0105239_10000174 3300010375 Bacteria 92922
282 Ga0105239_10024693 3300010375 Bacteria 6620
283 Ga0105239_10046999 3300010375 Bacteria 4729
284 Ga0105239_10059926 3300010375 Bacteria 4177
285 Ga0105239_10080628 3300010375 Bacteria 3581
286 Ga0105239_10219743 3300010375 Bacteria 2131
287 Ga0105239_12060874 3300010375 Bacteria 663
288 Ga0105246_10790792 3300011119 Bacteria 841
289 Ga0157314_1000162 3300012500 Bacteria 7310
290 Ga0157347_1008522 3300012502 Bacteria 1044
291 Ga0157373_10016438 3300013100 Bacteria 5397
292 Ga0157373_10055151 3300013100 Bacteria 2823
293 Ga0157373_10115095 3300013100 Bacteria 1891
294 Ga0157373_10477457 3300013100 Bacteria 899
295 Ga0157373_10948008 3300013100 Bacteria 640
296 Ga0157371_10000397 3300013102 Bacteria 54547
297 Ga0157371_10016074 3300013102 Bacteria 5594
298 Ga0157371_10043256 3300013102 Bacteria 3209
299 Ga0157371_10057626 3300013102 Bacteria 2755
300 Ga0157371_10057704 3300013102 Bacteria 2753
301 Ga0157371_10068392 3300013102 Bacteria 2514
302 Ga0157371_10185359 3300013102 Bacteria 1489
303 Ga0157371_10245966 3300013102 Bacteria 1287
304 Ga0157371_10319021 3300013102 Bacteria 1127
305 Ga0157370_10000645 3300013104 Bacteria 43455
306 Ga0157370_10000918 3300013104 Bacteria 37372
307 Ga0157370_10006625 3300013104 Bacteria 12727
308 Ga0157370_10009235 3300013104 Bacteria 10568
309 Ga0157370_10081287 3300013104 Bacteria 3049
310 Ga0157370_10087580 3300013104 Bacteria 2925
311 Ga0157370_10134541 3300013104 Bacteria 2305
312 Ga0157370_10149621 3300013104 Bacteria 2173
313 Ga0157370_10224821 3300013104 Bacteria 1738
314 Ga0157370_10228220 3300013104 Bacteria 1724
315 Ga0157370_10339408 3300013104 Bacteria 1385
316 Ga0157370_10489753 3300013104 Bacteria 1130
317 Ga0157370_10735098 3300013104 Bacteria 900
318 Ga0157370_11825855 3300013104 Bacteria 545
319 Ga0157369_10001935 3300013105 Bacteria 24956
320 Ga0157369_10025085 3300013105 Bacteria 6621
321 Ga0157369_10094432 3300013105 Bacteria 3192
322 Ga0157369_10812057 3300013105 Bacteria 961
323 Ga0157374_10502706 3300013296 Bacteria 1217
324 Ga0157374_11118948 3300013296 Bacteria 808
325 Ga0157374_11368832 3300013296 Bacteria 730
326 Ga0163162_10000647 3300013306 Bacteria 32241
327 Ga0163162_10274869 3300013306 Bacteria 1817
328 Ga0163162_10290633 3300013306 Bacteria 1766
329 Ga0163162_10935415 3300013306 Bacteria 978
330 Ga0157372_10047869 3300013307 Bacteria 4752
331 Ga0157372_10057975 3300013307 Bacteria 4329
332 Ga0157372_10067201 3300013307 Bacteria 4028
333 Ga0157372_10097567 3300013307 Bacteria 3352
334 Ga0157372_10230959 3300013307 Bacteria 2145
335 Ga0157372_10357196 3300013307 Bacteria 1702
336 Ga0157372_10678881 3300013307 Bacteria 1199
337 Ga0157372_10953889 3300013307 Bacteria 994
338 Ga0157372_11224815 3300013307 Bacteria 867
339 Ga0157375_10099128 3300013308 Bacteria 2992
340 Ga0157375_10498860 3300013308 Bacteria 1381
341 Ga0163163_10017040 3300014325 Bacteria 6767
342 Ga0182008_10000076 3300014497 Bacteria 77484
343 Ga0182008_10005245 3300014497 Bacteria 7416
344 Ga0182008_10007959 3300014497 Bacteria 5813
345 Ga0182008_10035211 3300014497 Bacteria 2509
346 Ga0182008_10088988 3300014497 Bacteria 1521
347 Ga0182008_10122433 3300014497 Bacteria 1293
348 Ga0157379_10120836 3300014968 Bacteria 2356
349 Ga0157379_11630904 3300014968 Bacteria 630
350 Ga0157376_10000993 3300014969 Bacteria 18506
351 Ga0157376_10024509 3300014969 Bacteria 4738
352 Ga0157376_10263789 3300014969 Bacteria 1615
353 Ga0157376_10475438 3300014969 Bacteria 1224
354 Ga0182006_1000061 3300015261 Bacteria 156823
355 Ga0182006_1001722 3300015261 Bacteria 12729
356 Ga0182007_10000079 3300015262 Bacteria 73543
357 Ga0182007_10009518 3300015262 Bacteria 3912
358 Ga0182007_10077784 3300015262 Bacteria 1088
359 Ga0182007_10372347 3300015262 Bacteria 540
360 Ga0182005_1000143 3300015265 Bacteria 50018
361 Ga0182005_1000166 3300015265 Bacteria 45594
362 Ga0182005_1001697 3300015265 Bacteria 8519
363 Ga0182005_1002148 3300015265 Bacteria 7283
364 Ga0182005_1010129 3300015265 Bacteria 2717
365 Ga0182005_1034793 3300015265 Bacteria 1370
366 Ga0182005_1051916 3300015265 Bacteria 1116
367 Ga0183369_1013 3300015685 Bacteria 222738
368 Ga0183361_10384 3300016635 Bacteria 1866
369 Ga0163161_10004941 3300017792 Bacteria 9277
370 Ga0163161_10005121 3300017792 Bacteria 9122
371 Ga0163161_10025799 3300017792 Bacteria 4161
372 Ga0163161_10555247 3300017792 Bacteria 942
373 Ga0206356_10642219 3300020070 Bacteria 1293
374 Ga0206354_10186273 3300020081 Bacteria 606
375 Ga0206353_10447291 3300020082 Bacteria 5302
376 Ga0206353_11756222 3300020082 Bacteria 3735
377 Ga0154015_1335098 3300020610 Bacteria 1047
378 Ga0209435_105590 3300025206 Bacteria 1407
379 Ga0209760_100356 3300025207 Bacteria 12705
380 Ga0209784_100011 3300025224 Bacteria 546770
381 Ga0209566_101229 3300025225 Bacteria 8874
382 Ga0209674_100309 3300025226 Bacteria 32721
383 Ga0209674_100464 3300025226 Bacteria 17901
384 Ga0209674_100792 3300025226 Bacteria 10633
385 Ga0209674_101920 3300025226 Bacteria 4882
386 Ga0209672_100005 3300025228 Bacteria 1069303
387 Ga0209672_100055 3300025228 Bacteria 221655
388 Ga0209672_100227 3300025228 Bacteria 43114
389 Ga0209672_100698 3300025228 Bacteria 16806
390 Ga0209672_101151 3300025228 Bacteria 10867
391 Ga0209672_115445 3300025228 Bacteria 855
392 Ga0209563_100045 3300025230 Bacteria 377102
393 Ga0207427_100053 3300025231 Bacteria 217191
394 Ga0207427_100134 3300025231 Bacteria 91077
395 Ga0207427_100150 3300025231 Bacteria 78685
396 Ga0207427_100872 3300025231 Bacteria 13293
397 Ga0207427_103431 3300025231 Bacteria 3343
398 Ga0207427_108763 3300025231 Bacteria 1113
399 Ga0209437_100005 3300025233 Bacteria 1071596
400 Ga0209437_100108 3300025233 Bacteria 217191
401 Ga0209437_100200 3300025233 Bacteria 119306
402 Ga0209437_100403 3300025233 Bacteria 40042
403 Ga0209437_100620 3300025233 Bacteria 21541
404 Ga0209437_100841 3300025233 Bacteria 13377
405 Ga0209437_117459 3300025233 Bacteria 941
406 Ga0209258_100006 3300025242 Bacteria 1069303
407 Ga0209258_100012 3300025242 Bacteria 825544
408 Ga0209258_100027 3300025242 Bacteria 518449
409 Ga0209258_100055 3300025242 Bacteria 337291
410 Ga0209258_100255 3300025242 Bacteria 94924
411 Ga0209258_102796 3300025242 Bacteria 4190
412 Ga0207425_1000148 3300025245 Bacteria 59862
413 Ga0209646_1000696 3300025246 Bacteria 12085
414 Ga0209646_1006720 3300025246 Bacteria 1918
415 Ga0209646_1019714 3300025246 Bacteria 979
416 Ga0209026_1000017 3300025250 Bacteria 385214
417 Ga0209026_1000055 3300025250 Bacteria 237197
418 Ga0209026_1000084 3300025250 Bacteria 186997
419 Ga0209026_1000324 3300025250 Bacteria 49893
420 Ga0209026_1001063 3300025250 Bacteria 13357
421 Ga0209026_1005157 3300025250 Bacteria 3595
422 Ga0209026_1013500 3300025250 Bacteria 1390
423 Ga0209026_1022893 3300025250 Bacteria 954
424 Ga0209677_100818 3300025253 Bacteria 15538
425 Ga0209148_1000001 3300025254 Bacteria 2545271
426 Ga0209148_1000002 3300025254 Bacteria 2399500
427 Ga0209148_1000012 3300025254 Bacteria 1069303
428 Ga0209148_1000014 3300025254 Bacteria 925277
429 Ga0209148_1000058 3300025254 Bacteria 357482
430 Ga0209148_1000221 3300025254 Bacteria 94627
431 Ga0209759_1000159 3300025256 Bacteria 116456
432 Ga0209759_1000191 3300025256 Bacteria 97876
433 Ga0209759_1001529 3300025256 Bacteria 12706
434 Ga0209759_1004295 3300025256 Bacteria 5365
435 Ga0209759_1010707 3300025256 Bacteria 2668
436 Ga0209759_1027478 3300025256 Bacteria 1174
437 Ga0209759_1027483 3300025256 Bacteria 1174
438 Ga0209129_1000239 3300025258 Bacteria 59863
439 Ga0209129_1000678 3300025258 Bacteria 22489
440 Ga0209129_1005899 3300025258 Bacteria 4152
441 Ga0209233_1000002 3300025261 Bacteria 2501366
442 Ga0209233_1000011 3300025261 Bacteria 1071611
443 Ga0209233_1000125 3300025261 Bacteria 217190
444 Ga0209233_1000193 3300025261 Bacteria 126812
445 Ga0209565_1000060 3300025263 Bacteria 188543
446 Ga0209455_1000008 3300025272 Bacteria 1069303
447 Ga0209455_1000014 3300025272 Bacteria 806601
448 Ga0209455_1000018 3300025272 Bacteria 718034
449 Ga0209455_1000019 3300025272 Bacteria 705658
450 Ga0209455_1000186 3300025272 Bacteria 97107
451 Ga0209455_1004299 3300025272 Bacteria 4713
452 Ga0209673_1000047 3300025273 Bacteria 289276
453 Ga0209673_1022642 3300025273 Bacteria 2162
454 Ga0209675_1000007 3300025291 Bacteria 683430
455 Ga0209675_1036976 3300025291 Bacteria 1101
456 Ga0209676_1000024 3300025292 Bacteria 578839
457 Ga0209676_1000411 3300025292 Bacteria 77084
458 Ga0209676_1011809 3300025292 Bacteria 3487
459 Ga0209025_1000048 3300025294 Bacteria 335574
460 Ga0209025_1124282 3300025294 Bacteria 764
461 Ga0209564_1000252 3300025295 Bacteria 114416
462 Ga0209564_1037410 3300025295 Bacteria 1368
463 Ga0209758_1000056 3300025297 Bacteria 335574
464 Ga0209758_1001258 3300025297 Bacteria 31388
465 Ga0209758_1012699 3300025297 Bacteria 4679
466 Ga0209758_1025441 3300025297 Bacteria 2598
467 Ga0209050_1005908 3300025298 Bacteria 7472
468 Ga0209050_1016485 3300025298 Bacteria 3019
469 Ga0209050_1052538 3300025298 Bacteria 1020
470 Ga0209256_1006105 3300025299 Bacteria 6539
471 Ga0209256_1006480 3300025299 Bacteria 6162
472 Ga0207426_1056760 3300025302 Bacteria 1142
473 Ga0209051_1011209 3300025303 Bacteria 4448
474 Ga0209051_1011461 3300025303 Bacteria 4375
475 Ga0209051_1046903 3300025303 Bacteria 1482
476 Ga0209257_1002415 3300025304 Bacteria 18677
477 Ga0209257_1006792 3300025304 Bacteria 7201
478 Ga0209257_1013734 3300025304 Bacteria 3560
479 Ga0209257_1078020 3300025304 Bacteria 857
480 Ga0207656_10004342 3300025321 Bacteria 4945
481 Ga0207656_10023360 3300025321 Bacteria 2489
482 Ga0207656_10047956 3300025321 Bacteria 1838
483 Ga0207713_1000196 3300025735 Bacteria 84000
484 Ga0207692_10095106 3300025898 Bacteria 1624
485 Ga0207710_10012235 3300025900 Bacteria 3610
486 Ga0207710_10223264 3300025900 Bacteria 936
487 Ga0207680_10000001 3300025903 Bacteria 1091453
488 Ga0207680_10029596 3300025903 Bacteria 3079
489 Ga0207680_10234913 3300025903 Bacteria 1261
490 Ga0207647_10000016 3300025904 Bacteria 130866
491 Ga0207647_10022789 3300025904 Bacteria 4154
492 Ga0207647_10299762 3300025904 Bacteria 915
493 Ga0207645_10019766 3300025907 Bacteria 4412
494 Ga0207705_10310846 3300025909 Bacteria 1210
495 Ga0207707_10026156 3300025912 Bacteria 5103
496 Ga0207707_10067580 3300025912 Bacteria 3113
497 Ga0207707_10133133 3300025912 Bacteria 2174
498 Ga0207707_11064395 3300025912 Bacteria 661
499 Ga0207695_10000791 3300025913 Bacteria 59405
500 Ga0207695_10000901 3300025913 Bacteria 53440
501 Ga0207695_10004123 3300025913 Bacteria 19960
502 Ga0207695_10008570 3300025913 Bacteria 12778
503 Ga0207695_10019904 3300025913 Bacteria 7712
504 Ga0207695_10115413 3300025913 Bacteria 2659
505 Ga0207695_10640935 3300025913 Bacteria 943
506 Ga0207695_10930165 3300025913 Bacteria 749
507 Ga0207671_10000011 3300025914 Bacteria 530349
508 Ga0207671_10000507 3300025914 Bacteria 52802
509 Ga0207671_10075974 3300025914 Bacteria 2513
510 Ga0207671_10503509 3300025914 Bacteria 965
511 Ga0207693_10159686 3300025915 Bacteria 1773
512 Ga0207660_10966478 3300025917 Bacteria 695
513 Ga0207657_10042402 3300025919 Bacteria 4015
514 Ga0207657_10230034 3300025919 Bacteria 1483
515 Ga0207649_10009846 3300025920 Bacteria 5239
516 Ga0207649_10012842 3300025920 Bacteria 4661
517 Ga0207649_10113683 3300025920 Bacteria 1813
518 Ga0207649_10140194 3300025920 Bacteria 1653
519 Ga0207649_10205853 3300025920 Bacteria 1393
520 Ga0207652_10085853 3300025921 Bacteria 2759
521 Ga0207652_10089120 3300025921 Bacteria 2708
522 Ga0207652_11246511 3300025921 Bacteria 646
523 Ga0207652_11264938 3300025921 Bacteria 640
524 Ga0207681_10959497 3300025923 Bacteria 717
525 Ga0207694_10002221 3300025924 Bacteria 15931
526 Ga0207694_10045353 3300025924 Bacteria 3396
527 Ga0207694_10052153 3300025924 Bacteria 3171
528 Ga0207694_10100065 3300025924 Bacteria 2296
529 Ga0207694_10854173 3300025924 Bacteria 769
530 Ga0207650_10018392 3300025925 Bacteria 4904
531 Ga0207650_10097225 3300025925 Bacteria 2260
532 Ga0207650_10108992 3300025925 Bacteria 2141
533 Ga0207650_10192154 3300025925 Bacteria 1631
534 Ga0207687_10517427 3300025927 Bacteria 998
535 Ga0207700_10001555 3300025928 Bacteria 13023
536 Ga0207700_10346377 3300025928 Bacteria 1293
537 Ga0207664_10001955 3300025929 Bacteria 13570
538 Ga0207664_10102215 3300025929 Bacteria 2370
539 Ga0207690_10005078 3300025932 Bacteria 7774
540 Ga0207690_10011474 3300025932 Bacteria 5297
541 Ga0207690_10012246 3300025932 Bacteria 5132
542 Ga0207690_10017735 3300025932 Bacteria 4353
543 Ga0207690_10149135 3300025932 Bacteria 1732
544 Ga0207690_10338562 3300025932 Bacteria 1187
545 Ga0207706_10012279 3300025933 Bacteria 7805
546 Ga0207709_10000527 3300025935 Bacteria 33281
547 Ga0207709_10031190 3300025935 Bacteria 3110
548 Ga0207670_10002199 3300025936 Bacteria 10196
549 Ga0207704_10798197 3300025938 Bacteria 788
550 Ga0207691_10029808 3300025940 Bacteria 5102
551 Ga0207711_10377098 3300025941 Bacteria 1316
552 Ga0207711_10749946 3300025941 Bacteria 910
553 Ga0207689_10136910 3300025942 Bacteria 2016
554 Ga0207689_10776219 3300025942 Bacteria 809
555 Ga0207679_10102422 3300025945 Bacteria 2242
556 Ga0207679_10120281 3300025945 Bacteria 2089
557 Ga0207667_10000249 3300025949 Bacteria 75885
558 Ga0207667_10001682 3300025949 Bacteria 27862
559 Ga0207667_10071449 3300025949 Bacteria 3608
560 Ga0207667_10090192 3300025949 Bacteria 3168
561 Ga0207667_10153833 3300025949 Bacteria 2367
562 Ga0207667_10172788 3300025949 Bacteria 2221
563 Ga0207667_10741052 3300025949 Bacteria 982
564 Ga0207651_10441385 3300025960 Bacteria 1115
565 Ga0207712_11535398 3300025961 Bacteria 597
566 Ga0207668_10018545 3300025972 Bacteria 4382
567 Ga0207668_10030206 3300025972 Bacteria 3560
568 Ga0207668_10050353 3300025972 Bacteria 2870
569 Ga0207668_10130870 3300025972 Bacteria 1916
570 Ga0207668_10646204 3300025972 Bacteria 925
571 Ga0207640_10000414 3300025981 Bacteria 26873
572 Ga0207640_10048509 3300025981 Bacteria 2745
573 Ga0207640_10053809 3300025981 Bacteria 2629
574 Ga0207640_10067226 3300025981 Bacteria 2397
575 Ga0207640_10134967 3300025981 Bacteria 1790
576 Ga0207640_10315350 3300025981 Bacteria 1243
577 Ga0207640_10466475 3300025981 Bacteria 1044
578 Ga0207658_10090529 3300025986 Bacteria 2371
579 Ga0207658_10131841 3300025986 Bacteria 2009
580 Ga0207658_10227377 3300025986 Bacteria 1573
581 Ga0207658_10300245 3300025986 Bacteria 1383
582 Ga0207677_10539889 3300026023 Bacteria 1014
583 Ga0207703_10018736 3300026035 Bacteria 5407
584 Ga0207703_10059957 3300026035 Bacteria 3109
585 Ga0207703_10683229 3300026035 Bacteria 975
586 Ga0207639_10006833 3300026041 Bacteria 7770
587 Ga0207639_10012777 3300026041 Bacteria 5858
588 Ga0207639_10050273 3300026041 Bacteria 3165
589 Ga0207639_10223020 3300026041 Bacteria 1629
590 Ga0207639_10336281 3300026041 Bacteria 1345
591 Ga0207639_10349456 3300026041 Bacteria 1320
592 Ga0207639_10906137 3300026041 Bacteria 824
593 Ga0207639_11334923 3300026041 Bacteria 673
594 Ga0207678_10007157 3300026067 Bacteria 9892
595 Ga0207678_10024651 3300026067 Bacteria 5254
596 Ga0207678_10050974 3300026067 Bacteria 3574
597 Ga0207678_10058436 3300026067 Bacteria 3318
598 Ga0207678_10063926 3300026067 Bacteria 3162
599 Ga0207678_10083087 3300026067 Bacteria 2739
600 Ga0207678_10328971 3300026067 Bacteria 1315
601 Ga0207678_10415398 3300026067 Bacteria 1166
602 Ga0207678_10652866 3300026067 Bacteria 924
603 Ga0207702_10000146 3300026078 Bacteria 82931
604 Ga0207702_10001245 3300026078 Bacteria 25719
605 Ga0207702_10128711 3300026078 Bacteria 2276
606 Ga0207702_10616825 3300026078 Bacteria 1065
607 Ga0207702_11802916 3300026078 Bacteria 604
608 Ga0207641_10066474 3300026088 Bacteria 3086
609 Ga0207641_10115199 3300026088 Bacteria 2390
610 Ga0207641_10306945 3300026088 Bacteria 1501
611 Ga0207648_10078265 3300026089 Bacteria 2884
612 Ga0207674_10021203 3300026116 Bacteria 7004
613 Ga0207674_10026552 3300026116 Bacteria 6146
614 Ga0207674_10042211 3300026116 Bacteria 4713
615 Ga0207674_10055044 3300026116 Bacteria 4048
616 Ga0207674_10153798 3300026116 Bacteria 2256
617 Ga0207674_10331733 3300026116 Bacteria 1471
618 Ga0207674_10402813 3300026116 Bacteria 1322
619 Ga0207674_11093899 3300026116 Bacteria 766
620 Ga0207675_100035110 3300026118 Bacteria 4677
621 Ga0207675_100800508 3300026118 Bacteria 956
622 Ga0207683_10041028 3300026121 Bacteria 4040
623 Ga0207683_10261286 3300026121 Bacteria 1581
624 Ga0207683_10563558 3300026121 Bacteria 1053
625 Ga0207683_11081420 3300026121 Bacteria 744
626 Ga0207698_10109762 3300026142 Bacteria 2309
627 Ga0207698_10257466 3300026142 Bacteria 1601
628 Ga0209371_1000018 3300027312 Bacteria 614700
629 Ga0209371_1000025 3300027312 Bacteria 450640
630 Ga0268266_10000075 3300028379 Bacteria 218045
631 Ga0268266_10059223 3300028379 Bacteria 3299
632 Ga0268266_10083058 3300028379 Bacteria 2796
633 Ga0268266_10248684 3300028379 Bacteria 1644
634 Ga0268266_10303900 3300028379 Bacteria 1489
635 Ga0268266_10848664 3300028379 Bacteria 883
636 Ga0268265_10003524 3300028380 Bacteria 11197
637 Ga0268265_10207763 3300028380 Bacteria 1704
638 Ga0268265_10573600 3300028380 Bacteria 1074
639 Ga0268264_10007592 3300028381 Bacteria 9043
640 Ga0268264_10051940 3300028381 Bacteria 3417
641 Ga0268264_10502894 3300028381 Bacteria 1182
642 Ga0268256_1000016 3300030500 Bacteria 614700
643 Ga0268256_1000027 3300030500 Bacteria 450640
644 Ga0316183_1005705 3300030742 Bacteria 10165
645 Ga0265332_10065294 3300031238 Bacteria 1554
646 Ga0307405_10092256 3300031731 Bacteria 2009
647 Ga0307405_10558131 3300031731 Bacteria 928
648 Ga0307413_10062116 3300031824 Bacteria 2309
649 Ga0307413_11120500 3300031824 Bacteria 681
650 Ga0307410_10728679 3300031852 Bacteria 838
651 Ga0307412_10000964 3300031911 Bacteria 16440
652 Ga0307412_10001490 3300031911 Bacteria 12997
653 Ga0307412_10063471 3300031911 Bacteria 2492
654 Ga0307416_100015400 3300032002 Bacteria 5282
655 Ga0307414_10002908 3300032004 Bacteria 9058
656 Ga0307414_11575943 3300032004 Bacteria 612
657 Ga0307510_10000590 3300033180 Bacteria 36615
658 Ga0307510_10106053 3300033180 Bacteria 2575
659 Ga0395899_0000076 3300037312 Bacteria 177673
660 Ga0395899_0010288 3300037312 Bacteria 7171
661 Ga0395899_0032873 3300037312 Bacteria 3897
662 Ga0395899_0237204 3300037312 Bacteria 1256
663 Ga0395900_0000024 3300037418 Bacteria 323480
664 Ga0395900_0012140 3300037418 Bacteria 8801
665 Ga0395900_0022584 3300037418 Bacteria 6437
666 Ga0395900_0152011 3300037418 Bacteria 2364
667 Ga0395898_0000044 3300037466 Bacteria 298164
668 Ga0395898_0000311 3300037466 Bacteria 112412
669 Ga0395898_0003642 3300037466 Bacteria 17126
670 Ga0395898_0044009 3300037466 Bacteria 4397
671 Ga0395898_0061745 3300037466 Bacteria 3640
672 Ga0395901_0005506 3300038443 Bacteria 12826
673 Ga0395901_0028241 3300038443 Bacteria 5771
674 Ga0395901_0065763 3300038443 Bacteria 3776
675 Ga0395901_0087865 3300038443 Bacteria 3250
676 Ga0395901_0317824 3300038443 Bacteria 1611
677 Ga0237819_00212 3300038705 Bacteria 21141
678 Ga0237819_05893 3300038705 Bacteria 1885
679 Ga0439436_0000039 3300041404 Bacteria 41518
680 Ga0439465_0001017 3300041413 Bacteria 8913
681 Ga0439465_0011754 3300041413 Bacteria 2743
682 Ga0451787_012880 3300041441 Bacteria 1033
683 Ga0451787_732297 3300041441 Bacteria 521
684 Ga0451789_0557839 3300041443 Bacteria 704
685 Ga0451791_0334252 3300041451 Bacteria 708
686 Ga0451791_1081702 3300041451 Bacteria 1751
687 Ga0451791_1511621 3300041451 Bacteria 1072
688 Ga0451793_1103512 3300041452 Bacteria 1202
689 Ga0451793_1363426 3300041452 Bacteria 2344
690 Ga0451793_1717557 3300041452 Bacteria 859
691 Ga0451797_0312273 3300041453 Bacteria 1169
692 Ga0451795_0526614 3300041456 Bacteria 912
693 Ga0451795_1129675 3300041456 Bacteria 1139
694 Ga0451795_1197460 3300041456 Bacteria 1815
695 Ga0451798_0726673 3300041458 Bacteria 833
696 Ga0451798_1163213 3300041458 Bacteria 832
697 Ga0451800_0088931 3300041459 Bacteria 9497
698 Ga0451802_0377263 3300041460 Bacteria 1589
699 Ga0451802_1987837 3300041460 Bacteria 614
700 Ga0451806_049713 3300041462 Bacteria 5708
701 Ga0451804_0181637 3300041463 Bacteria 5399
702 Ga0451807_0056970 3300041486 Bacteria 2312
703 Ga0451807_0135972 3300041486 Bacteria 1611
704 Ga0451807_0525217 3300041486 Bacteria 8261
705 Ga0451807_0552649 3300041486 Bacteria 1343
706 Ga0451807_0964614 3300041486 Bacteria 609
707 Ga0451835_0349548 3300041492 Bacteria 547
708 Ga0451837_0656892 3300041494 Bacteria 506
709 Ga0451837_0849547 3300041494 Bacteria 4433
710 Ga0451837_1853924 3300041494 Bacteria 1543
711 Ga0451841_0485890 3300041498 Bacteria 516
712 Ga0451841_0885665 3300041498 Bacteria 1030
713 Ga0451851_1026372 3300041507 Bacteria 594
714 Ga0451843_0242899 3300041509 Bacteria 833
715 Ga0451843_0356603 3300041509 Bacteria 821
716 Ga0451843_0493485 3300041509 Bacteria 1056
717 Ga0451843_0587814 3300041509 Bacteria 1482
718 Ga0451843_0878023 3300041509 Bacteria 712
719 Ga0451853_1123701 3300041512 Bacteria 2881
720 Ga0451853_1720595 3300041512 Bacteria 1242
721 Ga0451853_3798902 3300041512 Bacteria 664
722 Ga0439445_0016947 3300042004 Bacteria 1797
723 Ga0439432_003692 3300042006 Bacteria 5664
724 Ga0439432_012481 3300042006 Bacteria 2905
725 Ga0439449_0022177 3300042007 Bacteria 2376
726 Ga0439454_013215 3300042011 Bacteria 1130
727 Ga0450898_027898 3300042134 Bacteria 1024
728 Ga0450908_000089 3300042184 Bacteria 18451
729 Ga0466969_0009238 3300044656 Bacteria 5227
730 Ga0466969_0046501 3300044656 Bacteria 2152
731 Ga0466975_0209358 3300044661 Bacteria 1316
732 Ga0466982_0000012 3300044672 Bacteria 166823
733 Ga0466982_0000069 3300044672 Bacteria 28015
734 Ga0466965_0025175 3300044683 Bacteria 2880
735 Ga0466965_0341632 3300044683 Bacteria 818
736 Ga0466966_0003482 3300044684 Bacteria 10373
737 Ga0466961_0000828 3300044693 Bacteria 19354
738 Ga0466961_0026637 3300044693 Bacteria 3716
739 Ga0466961_0069665 3300044693 Bacteria 2232
740 Ga0466961_0373165 3300044693 Bacteria 867
741 Ga0466963_0193925 3300044694 Bacteria 1419
742 Ga0466963_0195888 3300044694 Bacteria 1412
743 Ga0466964_0000743 3300044706 Bacteria 10597
744 Ga0466971_0001267 3300044719 Bacteria 10528
745 Ga0466971_0071350 3300044719 Bacteria 1577
746 Ga0466971_0117432 3300044719 Bacteria 1230
747 Ga0466968_0004576 3300044735 Bacteria 5175
748 Ga0466968_0008972 3300044735 Bacteria 3842
749 Ga0466968_0163193 3300044735 Bacteria 1029
750 Ga0466970_0007120 3300044765 Bacteria 5597
751 Ga0466970_0021126 3300044765 Bacteria 3388
752 Ga0466957_0006148 3300044842 Bacteria 6777
753 Ga0466957_0011352 3300044842 Bacteria 5136
754 Ga0466957_0049587 3300044842 Bacteria 2553
755 Ga0466957_0102849 3300044842 Bacteria 1803
756 Ga0466960_0001585 3300044901 Bacteria 8319
757 Ga0466959_0000112 3300045049 Bacteria 52606
758 Ga0466959_0044047 3300045049 Bacteria 3288
759 Ga0466958_0009449 3300045836 Bacteria 5434
760 Ga0466958_0015748 3300045836 Bacteria 4341
761 Ga0466958_0074932 3300045836 Bacteria 2075
762 Ga0466958_0104766 3300045836 Bacteria 1762
763 Ga0466967_0078856 3300045976 Bacteria 2968
764 Ga0466967_0459289 3300045976 Bacteria 1245
765 Ga0466967_0470359 3300045976 Bacteria 1230
766 Ga0495617_000544 3300046452 Bacteria 19512
767 Ga0495617_000892 3300046452 Bacteria 14021
768 Ga0495638_0000248 3300046460 Bacteria 73332
769 Ga0495638_0000272 3300046460 Bacteria 69973
770 Ga0495638_0000526 3300046460 Bacteria 44654
771 Ga0495638_0001001 3300046460 Bacteria 28358
772 Ga0495638_0024024 3300046460 Bacteria 3979
773 Ga0495638_0222925 3300046460 Bacteria 1053
774 Ga0495650_0000430 3300046471 Bacteria 67718
775 Ga0495650_0001768 3300046471 Bacteria 19623
776 Ga0495650_0023427 3300046471 Bacteria 2939
777 Ga0495650_0268587 3300046471 Bacteria 576
778 Ga0495584_0000619 3300046491 Bacteria 23778
779 Ga0495585_0001031 3300046492 Bacteria 23176
780 Ga0495607_0000174 3300046501 Bacteria 68588
781 Ga0495607_0000363 3300046501 Bacteria 46637
782 Ga0495607_0013625 3300046501 Bacteria 5322
783 Ga0495583_0052863 3300046506 Bacteria 1845
784 Ga0495606_0003641 3300046507 Bacteria 16179
785 Ga0495606_0005439 3300046507 Bacteria 12201
786 Ga0495606_0005452 3300046507 Bacteria 12179
787 Ga0495606_0017085 3300046507 Bacteria 5502
788 Ga0495606_0027933 3300046507 Bacteria 3989
789 Ga0495610_0000298 3300046512 Bacteria 52207
790 Ga0495610_0004372 3300046512 Bacteria 10473
791 Ga0495610_0008074 3300046512 Bacteria 6886
792 Ga0495616_0000138 3300046513 Bacteria 63336
793 Ga0495616_0010777 3300046513 Bacteria 5271
794 Ga0495620_0000366 3300046515 Bacteria 31069
795 Ga0495620_0039587 3300046515 Bacteria 2081
796 Ga0495631_0000282 3300046518 Bacteria 35407
797 Ga0495631_0000825 3300046518 Bacteria 19797
798 Ga0495631_0002447 3300046518 Bacteria 10465
799 Ga0495632_0000010 3300046519 Bacteria 272360
800 Ga0495632_0006748 3300046519 Bacteria 7337
801 Ga0495632_0012628 3300046519 Bacteria 4861
802 Ga0495632_0062029 3300046519 Bacteria 1813
803 Ga0495637_0011078 3300046520 Bacteria 4341
804 Ga0495643_0001815 3300046522 Bacteria 18211
805 Ga0495648_0001511 3300046524 Bacteria 22786
806 Ga0495648_0003781 3300046524 Bacteria 13158
807 Ga0495663_0001114 3300046525 Bacteria 8681
808 Ga0495609_0003368 3300046538 Bacteria 9196
809 Ga0495633_0005215 3300046558 Bacteria 8016
810 Ga0495633_0006376 3300046558 Bacteria 7006
811 Ga0495668_0010274 3300046616 Bacteria 5679
812 Ga0495634_0229496 3300046642 Bacteria 1143
813 Ga0495611_0000003 3300046648 Bacteria 395679
814 Ga0495611_0000857 3300046648 Bacteria 16666
815 Ga0495625_0000019 3300046660 Bacteria 298330
816 Ga0495625_0013061 3300046660 Bacteria 6693
817 Ga0495625_0029482 3300046660 Bacteria 4102
818 Ga0495625_0044270 3300046660 Bacteria 3223
819 Ga0495625_0053218 3300046660 Bacteria 2896
820 Ga0495661_0001440 3300046665 Bacteria 19897
821 Ga0495670_0000500 3300046691 Bacteria 18592
822 Ga0495670_0006799 3300046691 Bacteria 5628
823 Ga0495670_0024353 3300046691 Bacteria 2991
824 Ga0495671_0001785 3300046692 Bacteria 13910
825 Ga0495649_0001469 3300046694 Bacteria 17717
826 Ga0495649_0032839 3300046694 Bacteria 2858
827 Ga0495649_0042529 3300046694 Bacteria 2483
828 Ga0495589_0000516 3300046794 Bacteria 27140
829 Ga0495660_0000125 3300046810 Bacteria 84503
830 Ga0495660_0000251 3300046810 Bacteria 51425
831 Ga0495660_0007665 3300046810 Bacteria 6341
832 Ga0495672_0000087 3300047320 Bacteria 154275
833 Ga0495683_0002304 3300047323 Bacteria 11628
834 Ga0495679_000017 3300047446 Bacteria 263230
835 Ga0495673_0000004 3300047469 Bacteria 1354526
836 Ga0495673_0000133 3300047469 Bacteria 137275
837 Ga0495673_0003063 3300047469 Bacteria 11239
838 Ga0495681_0014016 3300047470 Bacteria 4622
839 Ga0495686_0001096 3300047472 Bacteria 32214
840 Ga0495686_0001191 3300047472 Bacteria 30218
841 Ga0495686_0004003 3300047472 Bacteria 12335
842 Ga0495686_0015934 3300047472 Bacteria 5110
843 Ga0495686_0019484 3300047472 Bacteria 4532
844 Ga0495686_0025043 3300047472 Bacteria 3913
845 Ga0495686_0036584 3300047472 Bacteria 3150
846 Ga0496100_0014402 3300048903 Bacteria 4591
847 Ga0496100_0704745 3300048903 Bacteria 788
848 Ga0496101_0002766 3300048904 Bacteria 10773
849 Ga0496101_0047885 3300048904 Bacteria 3070
850 Ga0496101_1238904 3300048904 Bacteria 584
851 Ga0496102_0075090 3300048905 Bacteria 3107
852 Ga0496102_0287330 3300048905 Bacteria 1550
853 Ga0496102_0364253 3300048905 Bacteria 1361
854 Ga0496104_0559216 3300048907 Bacteria 1055
855 Ga0496105_0002445 3300048908 Bacteria 13441
856 Ga0496106_0003606 3300048909 Bacteria 11546
857 Ga0496106_0208989 3300048909 Bacteria 1554
858 Ga0496106_0967342 3300048909 Bacteria 670
859 Ga0496107_0071021 3300048910 Bacteria 2529
860 Ga0496107_0233178 3300048910 Bacteria 1370
861 Ga0496109_0111352 3300048912 Bacteria 2546
862 Ga0496114_0031279 3300048917 Bacteria 4379
863 Ga0496114_0091752 3300048917 Bacteria 2580
864 Ga0496114_0102534 3300048917 Bacteria 2445
865 Ga0496114_0332549 3300048917 Bacteria 1343
866 Ga0496115_0004754 3300048918 Bacteria 9854
867 Ga0496115_0010601 3300048918 Bacteria 6893
868 Ga0496115_0118390 3300048918 Bacteria 2178
869 Ga0496115_0192535 3300048918 Bacteria 1685
870 Ga0496116_0002572 3300048919 Bacteria 18929
871 Ga0496116_0028282 3300048919 Bacteria 4064
872 Ga0496116_0029042 3300048919 Bacteria 3993
873 Ga0496116_0227244 3300048919 Bacteria 950
874 Ga0496116_0302541 3300048919 Bacteria 760
875 Ga0496117_0000826 3300048920 Bacteria 47957
876 Ga0496117_0001430 3300048920 Bacteria 34487
877 Ga0496117_0003181 3300048920 Bacteria 19512
878 Ga0496117_0006061 3300048920 Bacteria 12411
879 Ga0496117_0006643 3300048920 Bacteria 11599
880 Ga0496117_0012390 3300048920 Bacteria 7521
881 Ga0496117_0043387 3300048920 Bacteria 3270
882 Ga0496117_0122362 3300048920 Bacteria 1596
883 Ga0496118_0001349 3300048921 Bacteria 37069
884 Ga0496118_0002050 3300048921 Bacteria 28460
885 Ga0496118_0003996 3300048921 Bacteria 17971
886 Ga0496118_0005088 3300048921 Bacteria 15130
887 Ga0496118_0006019 3300048921 Bacteria 13519
888 Ga0496118_0007465 3300048921 Bacteria 11572
889 Ga0496118_0007784 3300048921 Bacteria 11251
890 Ga0496118_0007889 3300048921 Bacteria 11154
891 Ga0496118_0008964 3300048921 Bacteria 10208
892 Ga0496118_0013651 3300048921 Bacteria 7666
893 Ga0496118_0020067 3300048921 Bacteria 5942
894 Ga0496118_0038408 3300048921 Bacteria 3838
895 Ga0496118_0051257 3300048921 Bacteria 3159
896 Ga0496118_0286888 3300048921 Bacteria 912
897 Ga0496119_0000248 3300048922 Bacteria 76311
898 Ga0496119_0000711 3300048922 Bacteria 44692
899 Ga0496119_0002773 3300048922 Bacteria 18816
900 Ga0496119_0014890 3300048922 Bacteria 6046
901 Ga0496120_0000143 3300048923 Bacteria 120051
902 Ga0496120_0000145 3300048923 Bacteria 119265
903 Ga0496120_0000273 3300048923 Bacteria 86248
904 Ga0496120_0000727 3300048923 Bacteria 48259
905 Ga0496121_0000251 3300048924 Bacteria 113931
906 Ga0496121_0000593 3300048924 Bacteria 67965
907 Ga0496121_0000898 3300048924 Bacteria 53787
908 Ga0496121_0001047 3300048924 Bacteria 49262
909 Ga0496121_0004863 3300048924 Bacteria 17653
910 Ga0496121_0023766 3300048924 Bacteria 5888
911 Ga0496121_0025804 3300048924 Bacteria 5561
912 Ga0496121_0056739 3300048924 Bacteria 3250
913 Ga0496121_0065955 3300048924 Bacteria 2942
914 Ga0496121_0081242 3300048924 Bacteria 2566
915 Ga0496121_0089821 3300048924 Bacteria 2403
916 Ga0496121_0098277 3300048924 Bacteria 2266
917 Ga0496121_0131867 3300048924 Bacteria 1868
918 Ga0496122_0000417 3300048925 Bacteria 90401
919 Ga0496122_0001140 3300048925 Bacteria 45568
920 Ga0496122_0008583 3300048925 Bacteria 10984
921 Ga0496122_0011466 3300048925 Bacteria 8971
922 Ga0496122_0020608 3300048925 Bacteria 5946
923 Ga0496122_0036471 3300048925 Bacteria 3974
924 Ga0496122_0071461 3300048925 Bacteria 2473
925 Ga0496123_0000137 3300048926 Bacteria 152169
926 Ga0496123_0000942 3300048926 Bacteria 45419
927 Ga0496123_0007239 3300048926 Bacteria 10534
928 Ga0496123_0010892 3300048926 Bacteria 7962
929 Ga0496123_0021928 3300048926 Bacteria 4943
930 Ga0496123_0029768 3300048926 Bacteria 4010
931 Ga0496123_0031779 3300048926 Bacteria 3833
932 Ga0496123_0045635 3300048926 Bacteria 2983
933 Ga0496123_0063311 3300048926 Bacteria 2364
934 Ga0496123_0072642 3300048926 Bacteria 2139
935 Ga0496123_0116758 3300048926 Bacteria 1511
936 Ga0496124_0000872 3300048927 Bacteria 49232
937 Ga0496124_0001043 3300048927 Bacteria 43756
938 Ga0496124_0001144 3300048927 Bacteria 41610
939 Ga0496124_0003834 3300048927 Bacteria 18012
940 Ga0496124_0006153 3300048927 Bacteria 13166
941 Ga0496124_0010529 3300048927 Bacteria 9354
942 Ga0496124_0026523 3300048927 Bacteria 5221
943 Ga0496124_0042811 3300048927 Bacteria 3895
944 Ga0496124_0090357 3300048927 Bacteria 2498
945 Ga0496124_0162760 3300048927 Bacteria 1737
946 Ga0496124_0199412 3300048927 Bacteria 1523
947 Ga0496124_0722157 3300048927 Bacteria 628
948 Ga0496125_0000239 3300048928 Bacteria 112926
949 Ga0496125_0000722 3300048928 Bacteria 54697
950 Ga0496125_0007774 3300048928 Bacteria 11344
951 Ga0496125_0010929 3300048928 Bacteria 9126
952 Ga0496125_0013105 3300048928 Bacteria 8174
953 Ga0496125_0013534 3300048928 Bacteria 8015
954 Ga0496125_0015985 3300048928 Bacteria 7226
955 Ga0496125_0018451 3300048928 Bacteria 6625
956 Ga0496125_0030132 3300048928 Bacteria 4859
957 Ga0496125_0033626 3300048928 Bacteria 4534
958 Ga0496125_0081010 3300048928 Bacteria 2482
959 Ga0496126_0000712 3300048929 Bacteria 60417
960 Ga0496126_0003861 3300048929 Bacteria 18507
961 Ga0496126_0006533 3300048929 Bacteria 12981
962 Ga0496126_0007552 3300048929 Bacteria 11892
963 Ga0496126_0013487 3300048929 Bacteria 8306
964 Ga0496126_0019684 3300048929 Bacteria 6642
965 Ga0496126_0093279 3300048929 Bacteria 2643
966 Ga0496126_0271707 3300048929 Bacteria 1407
967 Ga0496126_0281232 3300048929 Bacteria 1378
968 Ga0496126_0640184 3300048929 Bacteria 833
969 Ga0496126_1093662 3300048929 Bacteria 592
970 Ga0495678_001135 3300049459 Bacteria 22118
971 Ga0495678_036975 3300049459 Bacteria 1988
972 Ga0495682_0001686 3300049460 Bacteria 11265
973 Ga0495682_0003436 3300049460 Bacteria 7035
974 Ga0501031_0001635 3300049568 Bacteria 14045
975 Ga0501031_0010135 3300049568 Bacteria 6141
976 Ga0501032_0005139 3300049569 Bacteria 9761
977 Ga0501032_0007934 3300049569 Bacteria 7731
978 Ga0501032_0020747 3300049569 Bacteria 4574
979 Ga0501032_0055978 3300049569 Bacteria 2652
980 Ga0501033_0000413 3300049570 Bacteria 40930
981 Ga0501033_0001888 3300049570 Bacteria 18236
982 Ga0501033_0013037 3300049570 Bacteria 6337
983 Ga0501033_0019606 3300049570 Bacteria 5111
984 Ga0501033_0087536 3300049570 Bacteria 2280
985 Ga0501033_0189607 3300049570 Bacteria 1471
986 Ga0501033_0645283 3300049570 Bacteria 723
987 Ga0501034_0002433 3300049571 Bacteria 22486
988 Ga0501034_0004833 3300049571 Bacteria 14883
989 Ga0501034_0010658 3300049571 Bacteria 9553
990 Ga0501034_0015587 3300049571 Bacteria 7806
991 Ga0501034_0025803 3300049571 Bacteria 5985
992 Ga0501034_0209216 3300049571 Bacteria 1906
993 Ga0501036_0003345 3300049572 Bacteria 12802
994 Ga0501036_0019655 3300049572 Bacteria 5671
995 Ga0501036_0079456 3300049572 Bacteria 2774
996 Ga0501037_0013746 3300049573 Bacteria 5963
997 Ga0501037_0013910 3300049573 Bacteria 5929
998 Ga0501037_0029943 3300049573 Bacteria 4021
999 Ga0501037_0033163 3300049573 Bacteria 3814
1000 Ga0501037_0397141 3300049573 Bacteria 946
1001 Ga0501038_0001260 3300049574 Bacteria 23004
1002 Ga0501038_0004540 3300049574 Bacteria 12923
1003 Ga0501038_0034079 3300049574 Bacteria 4479
1004 Ga0501038_0147873 3300049574 Bacteria 1917
1005 Ga0501038_0151585 3300049574 Bacteria 1889
1006 Ga0501039_0008284 3300049575 Bacteria 7923
1007 Ga0501039_0223887 3300049575 Bacteria 1478
1008 Ga0501039_0406673 3300049575 Bacteria 1069
1009 Ga0501040_0003903 3300049576 Bacteria 9677
1010 Ga0501040_0131260 3300049576 Bacteria 1762
1011 Ga0501042_0003512 3300049578 Bacteria 9853
1012 Ga0501042_0127461 3300049578 Bacteria 1833
1013 Ga0501043_0006834 3300049579 Bacteria 9107
1014 Ga0501043_0015905 3300049579 Bacteria 5897
1015 Ga0501043_0041568 3300049579 Bacteria 3612
1016 Ga0501043_0098163 3300049579 Bacteria 2302
1017 Ga0501043_0205760 3300049579 Bacteria 1526
1018 Ga0501043_0380517 3300049579 Bacteria 1068
1019 Ga0501043_0435708 3300049579 Bacteria 987
1020 Ga0501043_0557610 3300049579 Bacteria 850
1021 Ga0501046_0002360 3300049580 Bacteria 17765
1022 Ga0501046_0009801 3300049580 Bacteria 8258
1023 Ga0501046_0013463 3300049580 Bacteria 6924
1024 Ga0501046_0177341 3300049580 Bacteria 1595
1025 Ga0501046_0313528 3300049580 Bacteria 1144
1026 Ga0501046_0324275 3300049580 Bacteria 1122
1027 Ga0501047_0008984 3300049581 Bacteria 9433
1028 Ga0501047_0013356 3300049581 Bacteria 7783
1029 Ga0501047_0026217 3300049581 Bacteria 5606
1030 Ga0501047_0029718 3300049581 Bacteria 5268
1031 Ga0501047_0094669 3300049581 Bacteria 2865
1032 Ga0501047_0131310 3300049581 Bacteria 2385
1033 Ga0501047_0412811 3300049581 Bacteria 1182
1034 Ga0501047_0415990 3300049581 Bacteria 1176
1035 Ga0501047_0739424 3300049581 Bacteria 800
1036 Ga0501048_0010289 3300049582 Bacteria 6993
1037 Ga0501067_0018462 3300049583 Bacteria 3863
1038 Ga0501067_0229444 3300049583 Bacteria 1033
1039 Ga0501068_0056200 3300049584 Bacteria 2386
1040 Ga0501070_0035901 3300049586 Bacteria 4139
1041 Ga0501070_0074312 3300049586 Bacteria 2813
1042 Ga0501070_0229304 3300049586 Bacteria 1522
1043 Ga0501070_0623334 3300049586 Bacteria 858
1044 Ga0501070_0914254 3300049586 Bacteria 684
1045 Ga0501070_0975467 3300049586 Bacteria 658
1046 Ga0501072_0014997 3300049588 Bacteria 5941
1047 Ga0501073_0001933 3300049589 Bacteria 15427
1048 Ga0501073_0009203 3300049589 Bacteria 7284
1049 Ga0501073_0026096 3300049589 Bacteria 4186
1050 Ga0501073_0029163 3300049589 Bacteria 3943
1051 Ga0501073_0119783 3300049589 Bacteria 1824
1052 Ga0501073_0466966 3300049589 Bacteria 872
1053 Ga0501074_0045492 3300049590 Bacteria 3175
1054 Ga0501076_0181296 3300049592 Bacteria 1717
1055 Ga0501076_1243458 3300049592 Bacteria 613
1056 Ga0501079_0010337 3300049741 Bacteria 7090
1057 Ga0501079_0048326 3300049741 Bacteria 3283
1058 Ga0501079_0175710 3300049741 Bacteria 1670
1059 Ga0501080_0000785 3300049742 Bacteria 25866
1060 Ga0501080_0186116 3300049742 Bacteria 1909
1061 Ga0501080_0368913 3300049742 Bacteria 1294
1062 Ga0501080_0399062 3300049742 Bacteria 1237
1063 Ga0501080_0466253 3300049742 Bacteria 1131
1064 Ga0501080_0640451 3300049742 Bacteria 941
1065 Ga0501083_0007095 3300049744 Bacteria 7954
1066 Ga0501083_0052890 3300049744 Bacteria 2727
1067 Ga0501083_0109979 3300049744 Bacteria 1812
1068 Ga0501083_0271469 3300049744 Bacteria 1103
1069 Ga0501035_0031827 3300049822 Bacteria 4804
1070 Ga0501035_0044322 3300049822 Bacteria 4006
1071 Ga0501035_0050284 3300049822 Bacteria 3735
1072 Ga0501035_0077343 3300049822 Bacteria 2941
1073 Ga0501035_0085117 3300049822 Bacteria 2787
1074 Ga0501035_0208674 3300049822 Bacteria 1672
1075 Ga0501035_0354116 3300049822 Bacteria 1228
1076 Ga0501035_0828611 3300049822 Bacteria 737
1077 Ga0501044_0009102 3300049823 Bacteria 10844
1078 Ga0501044_0019879 3300049823 Bacteria 7173
1079 Ga0501044_0045752 3300049823 Bacteria 4533
1080 Ga0501044_0045858 3300049823 Bacteria 4527
1081 Ga0501044_0047110 3300049823 Bacteria 4460
1082 Ga0501044_0204400 3300049823 Bacteria 1932
1083 Ga0501044_0236932 3300049823 Bacteria 1770
1084 Ga0501044_0374448 3300049823 Bacteria 1340
1085 Ga0501044_0729731 3300049823 Bacteria 874
1086 Ga0501045_0038538 3300049824 Bacteria 3476
1087 Ga0501045_0500083 3300049824 Bacteria 903
1088 nmdc:mga00v17_276525_c1 3300050491 Bacteria 1090
1089 nmdc:mga00v17_88_c1 3300050491 Bacteria 56091
1090 nmdc:mga00v17_93329_c1 3300050491 Bacteria 1893
1091 nmdc:mga0sz30_174271_c1 3300050516 Bacteria 954
1092 Ga0500610_0000202 3300053079 Bacteria 18159
1093 Ga0500643_000223 3300053087 Bacteria 52940
1094 Ga0500646_0023205 3300053090 Bacteria 1663
1095 Ga0500651_0000741 3300053093 Bacteria 15938
1096 Ga0500651_0001816 3300053093 Bacteria 10936
1097 Ga0500555_000290 3300053103 Bacteria 21695
1098 Ga0500559_0084368 3300053136 Bacteria 1448
1099 Ga0500568_0000862 3300053139 Bacteria 21293
1100 Ga0500573_0400393 3300053140 Bacteria 650
1101 Ga0500633_0013909 3300053160 Bacteria 2269
1102 Ga0500634_0000301 3300053161 Bacteria 15686
1103 Ga0500645_000648 3300053730 Bacteria 22062
1104 Ga0501084_0037802 3300054114 Bacteria 4034
1105 Ga0501084_0072971 3300054114 Bacteria 2874
1106 Ga0501084_0102424 3300054114 Bacteria 2404
1107 Ga0501082_0001206 3300060353 Bacteria 22712
1108 Ga0501082_0035877 3300060353 Bacteria 4273
1109 Ga0501082_0193088 3300060353 Bacteria 1771
1110 Ga0466962_0006363 3300061719 Bacteria 5670
1111 Ga0466962_0018166 3300061719 Bacteria 3382
1112 Ga0466962_0267497 3300061719 Bacteria 842
1113 Ga0530510_1380689 3300061734 Bacteria 540

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0975467 Ga0501070_0975467_265_648 127
2 3300041486 Ga0451807_0964614 Ga0451807_0964614_16_402 128
3 3300041494 Ga0451837_0656892 Ga0451837_0656892_10_396 128
4 3300048927 Ga0496124_0722157 Ga0496124_0722157_11_397 128
5 3300041441 Ga0451787_732297 Ga0451787_732297_112_507 131
6 3300041498 Ga0451841_0485890 Ga0451841_0485890_101_502 133
7 3300005340 Ga0070689_100069640 Ga0070689_1000696403 136
8 3300005330 Ga0070690_100309231 Ga0070690_1003092312 141
9 3300005365 Ga0070688_101301865 Ga0070688_1013018651 141
10 iso_pu_bacteria 2547132130 2547500474 142
11 iso_pu_bacteria 2576861471 2578456976 142
12 iso_pu_bacteria 2643221579 2643908592 142
13 iso_pu_bacteria 2643221581 2643916391 142
14 iso_pu_bacteria 2747842428 2747949934 142
15 iso_pu_bacteria 2747842501 2748019666 142
16 iso_pu_bacteria 2765235840 2765580530 142
17 iso_pu_bacteria 2816332141 2816518446 142
18 iso_pu_bacteria 2818991457 2819661308 142
19 iso_pu_bacteria 2842391507 2842394445 142
20 iso_pu_bacteria 2852649853 2852652129 142
21 iso_pu_bacteria 2852684882 2852687179 142
22 iso_pu_bacteria 2857442823 2857446858 142
23 iso_pu_bacteria 2874220319 2874223193 142
24 iso_pu_bacteria 2894414249 2894414341 142
25 iso_pu_bacteria 2895498888 2895504039 142
26 iso_pu_bacteria 2895511927 2895515393 142
27 iso_pu_bacteria 2895522137 2895525096 142
28 iso_pu_bacteria 2895525241 2895527832 142
29 iso_pu_bacteria 2919089067 2919092449 142
30 iso_pu_bacteria 2919130084 2919131064 142
31 iso_pu_bacteria 2919134579 2919138743 142
32 iso_pu_bacteria 2919513703 2919514279 142
33 iso_pu_bacteria 2919675420 2919675945 142
34 iso_pu_bacteria 2923516293 2923518173 142
35 iso_pu_bacteria 2928496128 2928500224 142
36 iso_pu_bacteria 2929195423 2929196304 142
37 iso_pu_bacteria 2931380184 2931383370 142
38 iso_pu_bacteria 2937610967 2937614344 142
39 iso_pu_bacteria 2939589442 2939589831 142
40 iso_pu_bacteria 2939622612 2939624944 142
41 iso_pu_bacteria 2939626828 2939630933 142
42 iso_pu_bacteria 2941475908 2941478751 142
43 iso_pu_bacteria 2961047084 2961049957 142
44 iso_pu_bacteria 2961064222 2961064880 142
45 iso_pu_bacteria 2974307012 2974307624 142
46 iso_pu_bacteria 2977247770 2977248335 142
47 iso_pu_bacteria 2984514374 2984517172 142
48 iso_pu_bacteria 2987605356 2987608820 142
49 iso_pu_bacteria 8021622325 8021625572 142
50 iso_pu_bacteria 8021626552 8021630559 142
51 iso_pu_bacteria 8021648035 8021649731 142
52 3300001979 JGI24740J21852_10003541 JGI24740J21852_100035412 143
53 3300001989 JGI24739J22299_10007421 JGI24739J22299_100074212 143
54 3300001990 JGI24737J22298_10001144 JGI24737J22298_100011445 143
55 3300002067 JGI24735J21928_10005023 JGI24735J21928_100050232 143
56 3300002705 JGI25156J39149_1010277 JGI25156J39149_10102772 143
57 3300002741 JGI25157J39369_1000433 JGI25157J39369_10004335 143
58 3300003215 JGI25153J46596_10013331 JGI25153J46596_100133313 143
59 3300003316 rootH1_10006990 rootH1_100069902 143
60 3300003316 rootH1_10039356 rootH1_100393562 143
61 3300003323 rootH1_10043860 rootH1_100438602 143
62 3300003578 Ga0006562J51391_1153636 Ga0006562J51391_11536365 143
63 3300003578 Ga0006562J51391_1153637 Ga0006562J51391_11536372 143
64 3300005262 Ga0065165_1001785 Ga0065165_100178514 143
65 3300005347 Ga0070668_100339444 Ga0070668_1003394442 143
66 3300005355 Ga0070671_100496493 Ga0070671_1004964932 143
67 3300005366 Ga0070659_100312204 Ga0070659_1003122042 143
68 3300005455 Ga0070663_100061578 Ga0070663_1000615783 143
69 3300005548 Ga0070665_100055239 Ga0070665_1000552392 143
70 3300005563 Ga0068855_100189913 Ga0068855_1001899132 143
71 3300005563 Ga0068855_100405053 Ga0068855_1004050532 143
72 3300005577 Ga0068857_100003481 Ga0068857_1000034819 143
73 3300005578 Ga0068854_100000387 Ga0068854_1000003872 143
74 3300005578 Ga0068854_100001064 Ga0068854_10000106410 143
75 3300005578 Ga0068854_100515834 Ga0068854_1005158342 143
76 3300005616 Ga0068852_100130482 Ga0068852_1001304822 143
77 3300005834 Ga0068851_10000919 Ga0068851_100009193 143
78 3300005842 Ga0068858_100608595 Ga0068858_1006085952 143
79 3300009093 Ga0105240_10035764 Ga0105240_100357643 143
80 3300009093 Ga0105240_10163465 Ga0105240_101634652 143
81 3300009545 Ga0105237_10001725 Ga0105237_100017252 143
82 3300010375 Ga0105239_10059926 Ga0105239_100599262 143
83 3300012500 Ga0157314_1000162 Ga0157314_10001624 143
84 3300012502 Ga0157347_1008522 Ga0157347_10085222 143
85 3300013105 Ga0157369_10094432 Ga0157369_100944323 143
86 3300025250 Ga0209026_1000055 Ga0209026_1000055157 143
87 3300025250 Ga0209026_1013500 Ga0209026_10135002 143
88 3300025256 Ga0209759_1000191 Ga0209759_100019112 143
89 3300025258 Ga0209129_1005899 Ga0209129_10058992 143
90 3300025297 Ga0209758_1001258 Ga0209758_10012585 143
91 3300025321 Ga0207656_10004342 Ga0207656_100043422 143
92 3300025903 Ga0207680_10234913 Ga0207680_102349132 143
93 3300025904 Ga0207647_10022789 Ga0207647_100227892 143
94 3300025913 Ga0207695_10000901 Ga0207695_100009012 143
95 3300025913 Ga0207695_10019904 Ga0207695_100199044 143
96 3300025913 Ga0207695_10115413 Ga0207695_101154132 143
97 3300025914 Ga0207671_10000011 Ga0207671_10000011295 143
98 3300025925 Ga0207650_10192154 Ga0207650_101921542 143
99 3300025932 Ga0207690_10338562 Ga0207690_103385622 143
100 3300025933 Ga0207706_10012279 Ga0207706_100122798 143
101 3300025945 Ga0207679_10102422 Ga0207679_101024222 143
102 3300025949 Ga0207667_10000249 Ga0207667_1000024946 143
103 3300025949 Ga0207667_10001682 Ga0207667_100016825 143
104 3300025949 Ga0207667_10172788 Ga0207667_101727882 143
105 3300025981 Ga0207640_10000414 Ga0207640_1000041420 143
106 3300025981 Ga0207640_10048509 Ga0207640_100485092 143
107 3300025981 Ga0207640_10134967 Ga0207640_101349672 143
108 3300025986 Ga0207658_10131841 Ga0207658_101318412 143
109 3300026035 Ga0207703_10018736 Ga0207703_100187362 143
110 3300026067 Ga0207678_10083087 Ga0207678_100830872 143
111 3300026078 Ga0207702_10128711 Ga0207702_101287112 143
112 3300026116 Ga0207674_10055044 Ga0207674_100550442 143
113 3300026142 Ga0207698_10109762 Ga0207698_101097622 143
114 3300028379 Ga0268266_10059223 Ga0268266_100592232 143
115 3300037312 Ga0395899_0000076 Ga0395899_0000076_50020_50460 143
116 3300037418 Ga0395900_0000024 Ga0395900_0000024_226089_226529 143
117 3300037466 Ga0395898_0000044 Ga0395898_0000044_63426_63866 143
118 3300038443 Ga0395901_0317824 Ga0395901_0317824_504_944 143
119 3300044656 Ga0466969_0009238 Ga0466969_0009238_4413_4853 143
120 3300044656 Ga0466969_0046501 Ga0466969_0046501_188_628 143
121 3300044661 Ga0466975_0209358 Ga0466975_0209358_501_941 143
122 3300044672 Ga0466982_0000012 Ga0466982_0000012_38984_39424 143
123 3300044683 Ga0466965_0341632 Ga0466965_0341632_68_508 143
124 3300044684 Ga0466966_0003482 Ga0466966_0003482_5514_5954 143
125 3300044693 Ga0466961_0069665 Ga0466961_0069665_1441_1881 143
126 3300044693 Ga0466961_0373165 Ga0466961_0373165_196_636 143
127 3300044694 Ga0466963_0193925 Ga0466963_0193925_598_1038 143
128 3300044706 Ga0466964_0000743 Ga0466964_0000743_9174_9614 143
129 3300044719 Ga0466971_0001267 Ga0466971_0001267_4629_5069 143
130 3300044719 Ga0466971_0117432 Ga0466971_0117432_61_501 143
131 3300044735 Ga0466968_0008972 Ga0466968_0008972_646_1086 143
132 3300044735 Ga0466968_0163193 Ga0466968_0163193_542_982 143
133 3300044765 Ga0466970_0007120 Ga0466970_0007120_1616_2056 143
134 3300044765 Ga0466970_0021126 Ga0466970_0021126_261_701 143
135 3300044842 Ga0466957_0011352 Ga0466957_0011352_4595_5035 143
136 3300044901 Ga0466960_0001585 Ga0466960_0001585_2474_2914 143
137 3300045049 Ga0466959_0000112 Ga0466959_0000112_28254_28694 143
138 3300045049 Ga0466959_0044047 Ga0466959_0044047_304_744 143
139 3300045836 Ga0466958_0074932 Ga0466958_0074932_1465_1905 143
140 3300045836 Ga0466958_0104766 Ga0466958_0104766_891_1331 143
141 3300048924 Ga0496121_0025804 Ga0496121_0025804_4372_4842 143
142 3300048928 Ga0496125_0000239 Ga0496125_0000239_25408_25878 143
143 3300049570 Ga0501033_0087536 Ga0501033_0087536_1516_1953 143
144 3300049580 Ga0501046_0013463 Ga0501046_0013463_3631_4068 143
145 3300049742 Ga0501080_0399062 Ga0501080_0399062_368_805 143
146 3300049823 Ga0501044_0729731 Ga0501044_0729731_22_459 143
147 3300053139 Ga0500568_0000862 Ga0500568_0000862_3765_4202 143
148 3300060353 Ga0501082_0001206 Ga0501082_0001206_17136_17573 143
149 3300061719 Ga0466962_0006363 Ga0466962_0006363_1805_2245 143
150 3300061719 Ga0466962_0267497 Ga0466962_0267497_236_676 143
151 iso_pu_bacteria 2537561836 2538834225 143
152 iso_pu_bacteria 2593339238 2595447839 143
153 iso_pu_bacteria 2593339239 2595451145 143
154 iso_pu_bacteria 2643221562 2643831247 143
155 iso_pu_bacteria 2687453130 2687584358 143
156 iso_pu_bacteria 2718218334 2721025982 143
157 iso_pu_bacteria 2734482264 2735834057 143
158 iso_pu_bacteria 2738543009 2739225467 143
159 iso_pu_bacteria 2739367700 2739732464 143
160 iso_pu_bacteria 2818991440 2819565992 143
161 iso_pu_bacteria 2842914999 2842917793 143
162 iso_pu_bacteria 2842918807 2842922035 143
163 iso_pu_bacteria 2884338543 2884342038 143
164 iso_pu_bacteria 2884411467 2884412530 143
165 iso_pu_bacteria 2904463128 2904466263 143
166 iso_pu_bacteria 2919085039 2919085997 143
167 iso_pu_bacteria 2919404418 2919408030 143
168 iso_pu_bacteria 2928963466 2928965151 143
169 iso_pu_bacteria 2941471342 2941474042 143
170 iso_pu_bacteria 2953994433 2953997141 143
171 3300003320 rootH2_10007042 rootH2_1000704215 144
172 3300005335 Ga0070666_10011462 Ga0070666_100114623 144
173 3300005367 Ga0070667_100108061 Ga0070667_1001080612 144
174 3300005367 Ga0070667_100123401 Ga0070667_1001234012 144
175 3300005539 Ga0068853_100559743 Ga0068853_1005597432 144
176 3300005548 Ga0070665_100242097 Ga0070665_1002420972 144
177 3300005577 Ga0068857_100022677 Ga0068857_1000226775 144
178 3300006048 Ga0075363_100865561 Ga0075363_1008655611 144
179 3300006237 Ga0097621_100333831 Ga0097621_1003338312 144
180 3300006358 Ga0068871_100071471 Ga0068871_1000714712 144
181 3300009093 Ga0105240_10005042 Ga0105240_100050424 144
182 3300009093 Ga0105240_10005178 Ga0105240_100051782 144
183 3300009176 Ga0105242_10619287 Ga0105242_106192872 144
184 3300010375 Ga0105239_10000174 Ga0105239_100001742 144
185 3300010375 Ga0105239_12060874 Ga0105239_120608741 144
186 3300014969 Ga0157376_10000993 Ga0157376_1000099315 144
187 3300025913 Ga0207695_10000791 Ga0207695_1000079110 144
188 3300025913 Ga0207695_10004123 Ga0207695_100041239 144
189 3300025923 Ga0207681_10959497 Ga0207681_109594971 144
190 3300025972 Ga0207668_10130870 Ga0207668_101308701 144
191 3300025986 Ga0207658_10227377 Ga0207658_102273772 144
192 3300026041 Ga0207639_11334923 Ga0207639_113349232 144
193 3300026067 Ga0207678_10007157 Ga0207678_1000715711 144
194 3300026116 Ga0207674_10153798 Ga0207674_101537982 144
195 3300026121 Ga0207683_10563558 Ga0207683_105635582 144
196 3300028379 Ga0268266_10303900 Ga0268266_103039002 144
197 3300041458 Ga0451798_0726673 Ga0451798_0726673_29_469 144
198 3300041460 Ga0451802_0377263 Ga0451802_0377263_821_1261 144
199 3300041494 Ga0451837_0849547 Ga0451837_0849547_3697_4137 144
200 3300041509 Ga0451843_0493485 Ga0451843_0493485_95_535 144
201 3300048904 Ga0496101_0047885 Ga0496101_0047885_2086_2529 144
202 3300048905 Ga0496102_0287330 Ga0496102_0287330_1046_1489 144
203 3300048908 Ga0496105_0002445 Ga0496105_0002445_11428_11871 144
204 3300048909 Ga0496106_0208989 Ga0496106_0208989_930_1373 144
205 3300048910 Ga0496107_0071021 Ga0496107_0071021_2025_2468 144
206 3300048918 Ga0496115_0010601 Ga0496115_0010601_6420_6863 144
207 3300048920 Ga0496117_0012390 Ga0496117_0012390_2023_2466 144
208 3300048921 Ga0496118_0003996 Ga0496118_0003996_2087_2530 144
209 3300048921 Ga0496118_0007465 Ga0496118_0007465_6556_6999 144
210 3300048922 Ga0496119_0000248 Ga0496119_0000248_61054_61497 144
211 3300048923 Ga0496120_0000143 Ga0496120_0000143_104794_105237 144
212 3300048923 Ga0496120_0000145 Ga0496120_0000145_48453_48896 144
213 3300048924 Ga0496121_0000593 Ga0496121_0000593_62641_63084 144
214 3300048924 Ga0496121_0131867 Ga0496121_0131867_698_1141 144
215 3300048929 Ga0496126_0000712 Ga0496126_0000712_20114_20557 144
216 3300048929 Ga0496126_0006533 Ga0496126_0006533_5096_5539 144
217 3300049575 Ga0501039_0406673 Ga0501039_0406673_421_861 144
218 3300049579 Ga0501043_0205760 Ga0501043_0205760_102_542 144
219 3300049579 Ga0501043_0557610 Ga0501043_0557610_52_492 144
220 3300049581 Ga0501047_0131310 Ga0501047_0131310_763_1203 144
221 3300049581 Ga0501047_0415990 Ga0501047_0415990_368_808 144
222 3300049586 Ga0501070_0229304 Ga0501070_0229304_744_1184 144
223 3300049589 Ga0501073_0026096 Ga0501073_0026096_2954_3394 144
224 3300049589 Ga0501073_0119783 Ga0501073_0119783_1115_1555 144
225 3300049742 Ga0501080_0466253 Ga0501080_0466253_327_767 144
226 3300049744 Ga0501083_0052890 Ga0501083_0052890_1231_1671 144
227 3300049744 Ga0501083_0271469 Ga0501083_0271469_339_779 144
228 3300049822 Ga0501035_0828611 Ga0501035_0828611_272_712 144
229 3300049823 Ga0501044_0204400 Ga0501044_0204400_252_692 144
230 3300053093 Ga0500651_0000741 Ga0500651_0000741_11229_11669 144
231 3300054114 Ga0501084_0072971 Ga0501084_0072971_2108_2548 144
232 3300001904 JGI24736J21556_1002244 JGI24736J21556_10022443 145
233 3300002067 JGI24735J21928_10086322 JGI24735J21928_100863222 145
234 3300002075 JGI24738J21930_10000044 JGI24738J21930_1000004413 145
235 3300002737 JGI25162J39368_1000811 JGI25162J39368_10008118 145
236 3300002737 JGI25162J39368_1001308 JGI25162J39368_10013087 145
237 3300002737 JGI25162J39368_1002798 JGI25162J39368_10027982 145
238 3300002738 JGI25154J39366_1006559 JGI25154J39366_10065592 145
239 3300002741 JGI25157J39369_1000709 JGI25157J39369_10007097 145
240 3300002741 JGI25157J39369_1001069 JGI25157J39369_10010692 145
241 3300002771 JGI25163J39215_1000461 JGI25163J39215_10004618 145
242 3300002772 JGI25164J39214_1000030 JGI25164J39214_100003020 145
243 3300002772 JGI25164J39214_1000638 JGI25164J39214_10006385 145
244 3300002772 JGI25164J39214_1000720 JGI25164J39214_10007203 145
245 3300002772 JGI25164J39214_1000728 JGI25164J39214_10007282 145
246 3300002773 JGI25152J39213_1010967 JGI25152J39213_10109672 145
247 3300003214 JGI25165J46597_1000057 JGI25165J46597_1000057107 145
248 3300003214 JGI25165J46597_1001248 JGI25165J46597_10012486 145
249 3300003214 JGI25165J46597_1001463 JGI25165J46597_10014632 145
250 3300003214 JGI25165J46597_1005256 JGI25165J46597_10052562 145
251 3300003320 rootH2_10083186 rootH2_100831862 145
252 3300003322 rootL2_10117941 rootL2_101179412 145
253 3300003323 rootH1_10191640 rootH1_101916402 145
254 3300003479 Ga0006556J51387_1038975 Ga0006556J51387_10389752 145
255 3300003565 Ga0006560J51390_1045036 Ga0006560J51390_10450362 145
256 3300003567 Ga0006554J51385_1038764 Ga0006554J51385_10387642 145
257 3300003578 Ga0006562J51391_1121937 Ga0006562J51391_11219372 145
258 3300003578 Ga0006562J51391_1121938 Ga0006562J51391_11219381 145
259 3300003751 Ga0055538_1002435 Ga0055538_10024352 145
260 3300003752 Ga0055539_1001976 Ga0055539_10019761 145
261 3300003756 Ga0055533_1001436 Ga0055533_10014363 145
262 3300003759 Ga0055525_1000124 Ga0055525_100012472 145
263 3300003760 Ga0055527_1000111 Ga0055527_100011128 145
264 3300003760 Ga0055527_1000244 Ga0055527_100024423 145
265 3300003760 Ga0055527_1000337 Ga0055527_100033712 145
266 3300003760 Ga0055527_1010654 Ga0055527_10106542 145
267 3300003761 Ga0055535_1000238 Ga0055535_100023828 145
268 3300003761 Ga0055535_1000885 Ga0055535_10008853 145
269 3300003761 Ga0055535_1001411 Ga0055535_10014112 145
270 3300003761 Ga0055535_1002396 Ga0055535_10023964 145
271 3300003761 Ga0055535_1028867 Ga0055535_10288671 145
272 3300003762 Ga0055542_1000170 Ga0055542_10001702 145
273 3300003762 Ga0055542_1000243 Ga0055542_100024328 145
274 3300003762 Ga0055542_1000272 Ga0055542_100027216 145
275 3300003762 Ga0055542_1000278 Ga0055542_100027825 145
276 3300003762 Ga0055542_1000359 Ga0055542_100035923 145
277 3300003762 Ga0055542_1001383 Ga0055542_10013832 145
278 3300003763 Ga0055529_1000137 Ga0055529_100013713 145
279 3300003763 Ga0055529_1000299 Ga0055529_100029925 145
280 3300003763 Ga0055529_1000446 Ga0055529_100044614 145
281 3300003763 Ga0055529_1001090 Ga0055529_10010902 145
282 3300003763 Ga0055529_1003065 Ga0055529_10030652 145
283 3300005262 Ga0065165_1000201 Ga0065165_100020145 145
284 3300005327 Ga0070658_10318007 Ga0070658_103180072 145
285 3300005327 Ga0070658_11567879 Ga0070658_115678791 145
286 3300005329 Ga0070683_100815547 Ga0070683_1008155472 145
287 3300005333 Ga0070677_10241607 Ga0070677_102416072 145
288 3300005334 Ga0068869_100126402 Ga0068869_1001264022 145
289 3300005334 Ga0068869_101643331 Ga0068869_1016433311 145
290 3300005335 Ga0070666_10000037 Ga0070666_1000003779 145
291 3300005335 Ga0070666_10119514 Ga0070666_101195142 145
292 3300005335 Ga0070666_10229203 Ga0070666_102292032 145
293 3300005336 Ga0070680_100816224 Ga0070680_1008162242 145
294 3300005337 Ga0070682_100006165 Ga0070682_1000061653 145
295 3300005337 Ga0070682_100022545 Ga0070682_1000225453 145
296 3300005337 Ga0070682_100450977 Ga0070682_1004509772 145
297 3300005337 Ga0070682_101003122 Ga0070682_1010031221 145
298 3300005339 Ga0070660_100148118 Ga0070660_1001481182 145
299 3300005344 Ga0070661_100014450 Ga0070661_1000144503 145
300 3300005344 Ga0070661_100084409 Ga0070661_1000844092 145
301 3300005344 Ga0070661_100109909 Ga0070661_1001099092 145
302 3300005344 Ga0070661_100179497 Ga0070661_1001794972 145
303 3300005344 Ga0070661_100263888 Ga0070661_1002638882 145
304 3300005344 Ga0070661_100270257 Ga0070661_1002702572 145
305 3300005344 Ga0070661_100406888 Ga0070661_1004068882 145
306 3300005345 Ga0070692_10251142 Ga0070692_102511422 145
307 3300005347 Ga0070668_100008971 Ga0070668_1000089713 145
308 3300005347 Ga0070668_100082447 Ga0070668_1000824472 145
309 3300005347 Ga0070668_100174478 Ga0070668_1001744781 145
310 3300005364 Ga0070673_100401624 Ga0070673_1004016241 145
311 3300005366 Ga0070659_100005082 Ga0070659_1000050824 145
312 3300005366 Ga0070659_100113653 Ga0070659_1001136532 145
313 3300005366 Ga0070659_100157535 Ga0070659_1001575352 145
314 3300005367 Ga0070667_100007927 Ga0070667_1000079273 145
315 3300005367 Ga0070667_100068192 Ga0070667_1000681923 145
316 3300005367 Ga0070667_100079319 Ga0070667_1000793192 145
317 3300005367 Ga0070667_100104525 Ga0070667_1001045252 145
318 3300005367 Ga0070667_100731860 Ga0070667_1007318602 145
319 3300005435 Ga0070714_100001712 Ga0070714_1000017128 145
320 3300005435 Ga0070714_100007367 Ga0070714_1000073675 145
321 3300005435 Ga0070714_100755902 Ga0070714_1007559022 145
322 3300005436 Ga0070713_100000361 Ga0070713_10000036111 145
323 3300005436 Ga0070713_100493298 Ga0070713_1004932982 145
324 3300005437 Ga0070710_10078812 Ga0070710_100788122 145
325 3300005437 Ga0070710_10294604 Ga0070710_102946042 145
326 3300005439 Ga0070711_100328453 Ga0070711_1003284532 145
327 3300005455 Ga0070663_100022897 Ga0070663_1000228972 145
328 3300005455 Ga0070663_100142296 Ga0070663_1001422962 145
329 3300005455 Ga0070663_100206250 Ga0070663_1002062502 145
330 3300005455 Ga0070663_100286973 Ga0070663_1002869732 145
331 3300005455 Ga0070663_100318687 Ga0070663_1003186872 145
332 3300005456 Ga0070678_100410621 Ga0070678_1004106211 145
333 3300005456 Ga0070678_101238262 Ga0070678_1012382621 145
334 3300005458 Ga0070681_10035249 Ga0070681_100352492 145
335 3300005458 Ga0070681_10050179 Ga0070681_100501794 145
336 3300005458 Ga0070681_10118761 Ga0070681_101187612 145
337 3300005458 Ga0070681_11306510 Ga0070681_113065101 145
338 3300005459 Ga0068867_100398752 Ga0068867_1003987522 145
339 3300005466 Ga0070685_10016651 Ga0070685_100166512 145
340 3300005466 Ga0070685_10525917 Ga0070685_105259172 145
341 3300005530 Ga0070679_100107093 Ga0070679_1001070933 145
342 3300005530 Ga0070679_100111320 Ga0070679_1001113202 145
343 3300005530 Ga0070679_101408950 Ga0070679_1014089501 145
344 3300005530 Ga0070679_101475235 Ga0070679_1014752351 145
345 3300005535 Ga0070684_100039361 Ga0070684_1000393615 145
346 3300005535 Ga0070684_101472516 Ga0070684_1014725161 145
347 3300005539 Ga0068853_100002888 Ga0068853_1000028883 145
348 3300005539 Ga0068853_100006082 Ga0068853_1000060827 145
349 3300005539 Ga0068853_100052408 Ga0068853_1000524083 145
350 3300005539 Ga0068853_100058878 Ga0068853_1000588783 145
351 3300005539 Ga0068853_100219542 Ga0068853_1002195422 145
352 3300005539 Ga0068853_100355277 Ga0068853_1003552772 145
353 3300005543 Ga0070672_100146162 Ga0070672_1001461622 145
354 3300005546 Ga0070696_100013156 Ga0070696_1000131564 145
355 3300005546 Ga0070696_100029285 Ga0070696_1000292853 145
356 3300005547 Ga0070693_100014292 Ga0070693_1000142922 145
357 3300005547 Ga0070693_100021962 Ga0070693_1000219622 145
358 3300005547 Ga0070693_100266050 Ga0070693_1002660502 145
359 3300005548 Ga0070665_100027941 Ga0070665_1000279413 145
360 3300005548 Ga0070665_100159999 Ga0070665_1001599992 145
361 3300005548 Ga0070665_100521598 Ga0070665_1005215982 145
362 3300005563 Ga0068855_100009589 Ga0068855_1000095892 145
363 3300005563 Ga0068855_100032401 Ga0068855_1000324013 145
364 3300005563 Ga0068855_100119218 Ga0068855_1001192182 145
365 3300005563 Ga0068855_100193394 Ga0068855_1001933942 145
366 3300005563 Ga0068855_100455328 Ga0068855_1004553281 145
367 3300005564 Ga0070664_100045909 Ga0070664_1000459092 145
368 3300005577 Ga0068857_100022263 Ga0068857_1000222633 145
369 3300005577 Ga0068857_100213600 Ga0068857_1002136002 145
370 3300005577 Ga0068857_100248172 Ga0068857_1002481722 145
371 3300005577 Ga0068857_100348155 Ga0068857_1003481552 145
372 3300005577 Ga0068857_101127950 Ga0068857_1011279502 145
373 3300005578 Ga0068854_100015721 Ga0068854_1000157215 145
374 3300005578 Ga0068854_100020609 Ga0068854_1000206092 145
375 3300005614 Ga0068856_100000074 Ga0068856_10000007414 145
376 3300005614 Ga0068856_100002874 Ga0068856_1000028748 145
377 3300005614 Ga0068856_100163284 Ga0068856_1001632842 145
378 3300005614 Ga0068856_100728181 Ga0068856_1007281812 145
379 3300005616 Ga0068852_100169120 Ga0068852_1001691202 145
380 3300005617 Ga0068859_100000414 Ga0068859_10000041430 145
381 3300005618 Ga0068864_100050317 Ga0068864_1000503175 145
382 3300005719 Ga0068861_100156731 Ga0068861_1001567312 145
383 3300005834 Ga0068851_10057100 Ga0068851_100571002 145
384 3300005834 Ga0068851_10326926 Ga0068851_103269262 145
385 3300005841 Ga0068863_100218541 Ga0068863_1002185411 145
386 3300005842 Ga0068858_100439287 Ga0068858_1004392872 145
387 3300005842 Ga0068858_101180759 Ga0068858_1011807591 145
388 3300005843 Ga0068860_100032336 Ga0068860_1000323363 145
389 3300005843 Ga0068860_100101544 Ga0068860_1001015442 145
390 3300005843 Ga0068860_100561495 Ga0068860_1005614952 145
391 3300005844 Ga0068862_100000047 Ga0068862_10000004726 145
392 3300005844 Ga0068862_100676586 Ga0068862_1006765862 145
393 3300006175 Ga0070712_100386046 Ga0070712_1003860462 145
394 3300006186 Ga0075369_10019233 Ga0075369_100192334 145
395 3300006186 Ga0075369_10084571 Ga0075369_100845712 145
396 3300006237 Ga0097621_100098567 Ga0097621_1000985672 145
397 3300006237 Ga0097621_100218754 Ga0097621_1002187541 145
398 3300006881 Ga0068865_100079664 Ga0068865_1000796642 145
399 3300006931 Ga0097620_100000414 Ga0097620_10000041430 145
400 3300009093 Ga0105240_10013068 Ga0105240_100130686 145
401 3300009093 Ga0105240_10520885 Ga0105240_105208852 145
402 3300009093 Ga0105240_10558200 Ga0105240_105582002 145
403 3300009093 Ga0105240_11511655 Ga0105240_115116551 145
404 3300009098 Ga0105245_10888416 Ga0105245_108884162 145
405 3300009101 Ga0105247_10001840 Ga0105247_100018408 145
406 3300009101 Ga0105247_10014538 Ga0105247_100145382 145
407 3300009101 Ga0105247_10111910 Ga0105247_101119102 145
408 3300009174 Ga0105241_10067467 Ga0105241_100674673 145
409 3300009176 Ga0105242_12589625 Ga0105242_125896252 145
410 3300009177 Ga0105248_10089766 Ga0105248_100897665 145
411 3300009177 Ga0105248_10150212 Ga0105248_101502122 145
412 3300009177 Ga0105248_10172774 Ga0105248_101727742 145
413 3300009177 Ga0105248_10787185 Ga0105248_107871852 145
414 3300009545 Ga0105237_10002067 Ga0105237_100020672 145
415 3300009545 Ga0105237_10097369 Ga0105237_100973692 145
416 3300009545 Ga0105237_10590238 Ga0105237_105902382 145
417 3300009545 Ga0105237_10780722 Ga0105237_107807222 145
418 3300009545 Ga0105237_11058689 Ga0105237_110586891 145
419 3300009551 Ga0105238_10000154 Ga0105238_1000015453 145
420 3300009551 Ga0105238_10010377 Ga0105238_100103773 145
421 3300009551 Ga0105238_10047250 Ga0105238_100472502 145
422 3300009551 Ga0105238_10124083 Ga0105238_101240832 145
423 3300009551 Ga0105238_10202153 Ga0105238_102021532 145
424 3300009551 Ga0105238_10276459 Ga0105238_102764592 145
425 3300009553 Ga0105249_10955365 Ga0105249_109553652 145
426 3300010375 Ga0105239_10024693 Ga0105239_100246936 145
427 3300010375 Ga0105239_10080628 Ga0105239_100806284 145
428 3300010375 Ga0105239_10219743 Ga0105239_102197432 145
429 3300011119 Ga0105246_10790792 Ga0105246_107907922 145
430 3300013100 Ga0157373_10016438 Ga0157373_100164383 145
431 3300013100 Ga0157373_10477457 Ga0157373_104774572 145
432 3300013102 Ga0157371_10016074 Ga0157371_100160743 145
433 3300013102 Ga0157371_10185359 Ga0157371_101853592 145
434 3300013102 Ga0157371_10245966 Ga0157371_102459662 145
435 3300013102 Ga0157371_10319021 Ga0157371_103190212 145
436 3300013104 Ga0157370_10000645 Ga0157370_1000064517 145
437 3300013104 Ga0157370_10006625 Ga0157370_100066255 145
438 3300013104 Ga0157370_10009235 Ga0157370_100092352 145
439 3300013104 Ga0157370_10087580 Ga0157370_100875803 145
440 3300013104 Ga0157370_10134541 Ga0157370_101345412 145
441 3300013104 Ga0157370_10149621 Ga0157370_101496212 145
442 3300013104 Ga0157370_10228220 Ga0157370_102282202 145
443 3300013104 Ga0157370_10339408 Ga0157370_103394082 145
444 3300013104 Ga0157370_10489753 Ga0157370_104897531 145
445 3300013104 Ga0157370_10735098 Ga0157370_107350981 145
446 3300013104 Ga0157370_11825855 Ga0157370_118258551 145
447 3300013105 Ga0157369_10001935 Ga0157369_100019356 145
448 3300013105 Ga0157369_10812057 Ga0157369_108120572 145
449 3300013296 Ga0157374_10502706 Ga0157374_105027062 145
450 3300013296 Ga0157374_11118948 Ga0157374_111189482 145
451 3300013296 Ga0157374_11368832 Ga0157374_113688322 145
452 3300013306 Ga0163162_10000647 Ga0163162_1000064718 145
453 3300013306 Ga0163162_10274869 Ga0163162_102748692 145
454 3300013306 Ga0163162_10935415 Ga0163162_109354152 145
455 3300013307 Ga0157372_10047869 Ga0157372_100478693 145
456 3300013307 Ga0157372_10057975 Ga0157372_100579753 145
457 3300013307 Ga0157372_10067201 Ga0157372_100672013 145
458 3300013307 Ga0157372_10097567 Ga0157372_100975672 145
459 3300013307 Ga0157372_10230959 Ga0157372_102309592 145
460 3300013307 Ga0157372_10357196 Ga0157372_103571962 145
461 3300013307 Ga0157372_10953889 Ga0157372_109538892 145
462 3300013307 Ga0157372_11224815 Ga0157372_112248152 145
463 3300013308 Ga0157375_10099128 Ga0157375_100991283 145
464 3300013308 Ga0157375_10498860 Ga0157375_104988602 145
465 3300014325 Ga0163163_10017040 Ga0163163_1001704010 145
466 3300014497 Ga0182008_10007959 Ga0182008_100079596 145
467 3300014497 Ga0182008_10035211 Ga0182008_100352112 145
468 3300014497 Ga0182008_10088988 Ga0182008_100889882 145
469 3300014497 Ga0182008_10122433 Ga0182008_101224331 145
470 3300014968 Ga0157379_10120836 Ga0157379_101208362 145
471 3300014968 Ga0157379_11630904 Ga0157379_116309041 145
472 3300014969 Ga0157376_10024509 Ga0157376_100245092 145
473 3300014969 Ga0157376_10263789 Ga0157376_102637892 145
474 3300014969 Ga0157376_10475438 Ga0157376_104754382 145
475 3300015261 Ga0182006_1000061 Ga0182006_100006119 145
476 3300015261 Ga0182006_1001722 Ga0182006_10017225 145
477 3300015262 Ga0182007_10009518 Ga0182007_100095183 145
478 3300015262 Ga0182007_10077784 Ga0182007_100777842 145
479 3300015262 Ga0182007_10372347 Ga0182007_103723471 145
480 3300015265 Ga0182005_1000143 Ga0182005_100014337 145
481 3300015265 Ga0182005_1001697 Ga0182005_10016975 145
482 3300015265 Ga0182005_1010129 Ga0182005_10101291 145
483 3300015265 Ga0182005_1034793 Ga0182005_10347932 145
484 3300015265 Ga0182005_1051916 Ga0182005_10519162 145
485 3300015685 Ga0183369_1013 Ga0183369_101320 145
486 3300017792 Ga0163161_10005121 Ga0163161_100051212 145
487 3300020070 Ga0206356_10642219 Ga0206356_106422192 145
488 3300020081 Ga0206354_10186273 Ga0206354_101862732 145
489 3300020082 Ga0206353_10447291 Ga0206353_104472913 145
490 3300020082 Ga0206353_11756222 Ga0206353_117562222 145
491 3300020610 Ga0154015_1335098 Ga0154015_13350981 145
492 3300025206 Ga0209435_105590 Ga0209435_1055902 145
493 3300025207 Ga0209760_100356 Ga0209760_1003562 145
494 3300025224 Ga0209784_100011 Ga0209784_100011463 145
495 3300025225 Ga0209566_101229 Ga0209566_1012293 145
496 3300025226 Ga0209674_100309 Ga0209674_10030913 145
497 3300025226 Ga0209674_100464 Ga0209674_1004649 145
498 3300025226 Ga0209674_100792 Ga0209674_1007923 145
499 3300025226 Ga0209674_101920 Ga0209674_1019203 145
500 3300025228 Ga0209672_100005 Ga0209672_100005168 145
501 3300025228 Ga0209672_100055 Ga0209672_10005595 145
502 3300025228 Ga0209672_100227 Ga0209672_10022713 145
503 3300025228 Ga0209672_100698 Ga0209672_1006987 145
504 3300025228 Ga0209672_101151 Ga0209672_1011514 145
505 3300025228 Ga0209672_115445 Ga0209672_1154452 145
506 3300025230 Ga0209563_100045 Ga0209563_100045140 145
507 3300025231 Ga0207427_100053 Ga0207427_10005379 145
508 3300025231 Ga0207427_100134 Ga0207427_10013426 145
509 3300025231 Ga0207427_100150 Ga0207427_10015032 145
510 3300025231 Ga0207427_100872 Ga0207427_1008722 145
511 3300025231 Ga0207427_103431 Ga0207427_1034313 145
512 3300025231 Ga0207427_108763 Ga0207427_1087631 145
513 3300025233 Ga0209437_100005 Ga0209437_100005716 145
514 3300025233 Ga0209437_100108 Ga0209437_100108104 145
515 3300025233 Ga0209437_100200 Ga0209437_10020032 145
516 3300025233 Ga0209437_100403 Ga0209437_1004035 145
517 3300025233 Ga0209437_100620 Ga0209437_1006204 145
518 3300025233 Ga0209437_100841 Ga0209437_1008412 145
519 3300025233 Ga0209437_117459 Ga0209437_1174592 145
520 3300025242 Ga0209258_100006 Ga0209258_100006168 145
521 3300025242 Ga0209258_100012 Ga0209258_10001242 145
522 3300025242 Ga0209258_100027 Ga0209258_10002784 145
523 3300025242 Ga0209258_100055 Ga0209258_10005586 145
524 3300025242 Ga0209258_100255 Ga0209258_10025531 145
525 3300025242 Ga0209258_102796 Ga0209258_1027962 145
526 3300025246 Ga0209646_1000696 Ga0209646_10006967 145
527 3300025246 Ga0209646_1006720 Ga0209646_10067202 145
528 3300025246 Ga0209646_1019714 Ga0209646_10197141 145
529 3300025250 Ga0209026_1000017 Ga0209026_1000017279 145
530 3300025250 Ga0209026_1000084 Ga0209026_1000084104 145
531 3300025250 Ga0209026_1000324 Ga0209026_100032432 145
532 3300025250 Ga0209026_1001063 Ga0209026_10010632 145
533 3300025250 Ga0209026_1005157 Ga0209026_10051572 145
534 3300025250 Ga0209026_1022893 Ga0209026_10228932 145
535 3300025253 Ga0209677_100818 Ga0209677_1008182 145
536 3300025254 Ga0209148_1000001 Ga0209148_1000001822 145
537 3300025254 Ga0209148_1000002 Ga0209148_1000002928 145
538 3300025254 Ga0209148_1000012 Ga0209148_1000012168 145
539 3300025254 Ga0209148_1000014 Ga0209148_1000014613 145
540 3300025254 Ga0209148_1000058 Ga0209148_1000058185 145
541 3300025254 Ga0209148_1000221 Ga0209148_100022131 145
542 3300025256 Ga0209759_1000159 Ga0209759_100015977 145
543 3300025256 Ga0209759_1001529 Ga0209759_10015297 145
544 3300025256 Ga0209759_1004295 Ga0209759_10042952 145
545 3300025256 Ga0209759_1010707 Ga0209759_10107072 145
546 3300025256 Ga0209759_1027478 Ga0209759_10274782 145
547 3300025256 Ga0209759_1027483 Ga0209759_10274832 145
548 3300025258 Ga0209129_1000678 Ga0209129_10006782 145
549 3300025261 Ga0209233_1000002 Ga0209233_10000021408 145
550 3300025261 Ga0209233_1000011 Ga0209233_1000011226 145
551 3300025261 Ga0209233_1000125 Ga0209233_100012579 145
552 3300025261 Ga0209233_1000193 Ga0209233_100019332 145
553 3300025272 Ga0209455_1000008 Ga0209455_1000008168 145
554 3300025272 Ga0209455_1000014 Ga0209455_1000014501 145
555 3300025272 Ga0209455_1000018 Ga0209455_1000018185 145
556 3300025272 Ga0209455_1000019 Ga0209455_1000019151 145
557 3300025272 Ga0209455_1000186 Ga0209455_10001869 145
558 3300025272 Ga0209455_1004299 Ga0209455_10042993 145
559 3300025297 Ga0209758_1012699 Ga0209758_10126993 145
560 3300025297 Ga0209758_1025441 Ga0209758_10254412 145
561 3300025299 Ga0209256_1006480 Ga0209256_10064803 145
562 3300025302 Ga0207426_1056760 Ga0207426_10567601 145
563 3300025303 Ga0209051_1011209 Ga0209051_10112092 145
564 3300025303 Ga0209051_1011461 Ga0209051_10114613 145
565 3300025303 Ga0209051_1046903 Ga0209051_10469032 145
566 3300025304 Ga0209257_1078020 Ga0209257_10780202 145
567 3300025321 Ga0207656_10023360 Ga0207656_100233602 145
568 3300025321 Ga0207656_10047956 Ga0207656_100479561 145
569 3300025898 Ga0207692_10095106 Ga0207692_100951062 145
570 3300025900 Ga0207710_10012235 Ga0207710_100122352 145
571 3300025900 Ga0207710_10223264 Ga0207710_102232642 145
572 3300025903 Ga0207680_10000001 Ga0207680_10000001383 145
573 3300025903 Ga0207680_10029596 Ga0207680_100295962 145
574 3300025904 Ga0207647_10000016 Ga0207647_1000001622 145
575 3300025904 Ga0207647_10299762 Ga0207647_102997622 145
576 3300025907 Ga0207645_10019766 Ga0207645_100197663 145
577 3300025909 Ga0207705_10310846 Ga0207705_103108462 145
578 3300025912 Ga0207707_10026156 Ga0207707_100261563 145
579 3300025912 Ga0207707_10067580 Ga0207707_100675802 145
580 3300025912 Ga0207707_10133133 Ga0207707_101331332 145
581 3300025912 Ga0207707_11064395 Ga0207707_110643952 145
582 3300025913 Ga0207695_10008570 Ga0207695_100085706 145
583 3300025913 Ga0207695_10640935 Ga0207695_106409351 145
584 3300025913 Ga0207695_10930165 Ga0207695_109301652 145
585 3300025914 Ga0207671_10000507 Ga0207671_1000050714 145
586 3300025914 Ga0207671_10075974 Ga0207671_100759742 145
587 3300025914 Ga0207671_10503509 Ga0207671_105035092 145
588 3300025915 Ga0207693_10159686 Ga0207693_101596862 145
589 3300025917 Ga0207660_10966478 Ga0207660_109664782 145
590 3300025919 Ga0207657_10042402 Ga0207657_100424023 145
591 3300025919 Ga0207657_10230034 Ga0207657_102300342 145
592 3300025920 Ga0207649_10009846 Ga0207649_100098463 145
593 3300025920 Ga0207649_10012842 Ga0207649_100128422 145
594 3300025920 Ga0207649_10113683 Ga0207649_101136832 145
595 3300025920 Ga0207649_10140194 Ga0207649_101401942 145
596 3300025920 Ga0207649_10205853 Ga0207649_102058532 145
597 3300025921 Ga0207652_10085853 Ga0207652_100858532 145
598 3300025921 Ga0207652_10089120 Ga0207652_100891202 145
599 3300025921 Ga0207652_11246511 Ga0207652_112465112 145
600 3300025921 Ga0207652_11264938 Ga0207652_112649382 145
601 3300025924 Ga0207694_10002221 Ga0207694_1000222113 145
602 3300025924 Ga0207694_10045353 Ga0207694_100453533 145
603 3300025924 Ga0207694_10052153 Ga0207694_100521532 145
604 3300025924 Ga0207694_10100065 Ga0207694_101000652 145
605 3300025924 Ga0207694_10854173 Ga0207694_108541731 145
606 3300025925 Ga0207650_10108992 Ga0207650_101089922 145
607 3300025927 Ga0207687_10517427 Ga0207687_105174272 145
608 3300025928 Ga0207700_10001555 Ga0207700_1000155510 145
609 3300025928 Ga0207700_10346377 Ga0207700_103463772 145
610 3300025929 Ga0207664_10001955 Ga0207664_100019558 145
611 3300025929 Ga0207664_10102215 Ga0207664_101022152 145
612 3300025932 Ga0207690_10005078 Ga0207690_100050782 145
613 3300025932 Ga0207690_10011474 Ga0207690_100114744 145
614 3300025932 Ga0207690_10012246 Ga0207690_100122462 145
615 3300025932 Ga0207690_10017735 Ga0207690_100177353 145
616 3300025932 Ga0207690_10149135 Ga0207690_101491352 145
617 3300025936 Ga0207670_10002199 Ga0207670_100021992 145
618 3300025938 Ga0207704_10798197 Ga0207704_107981971 145
619 3300025940 Ga0207691_10029808 Ga0207691_100298082 145
620 3300025941 Ga0207711_10377098 Ga0207711_103770982 145
621 3300025941 Ga0207711_10749946 Ga0207711_107499461 145
622 3300025942 Ga0207689_10136910 Ga0207689_101369102 145
623 3300025942 Ga0207689_10776219 Ga0207689_107762191 145
624 3300025945 Ga0207679_10120281 Ga0207679_101202812 145
625 3300025949 Ga0207667_10071449 Ga0207667_100714491 145
626 3300025949 Ga0207667_10090192 Ga0207667_100901922 145
627 3300025949 Ga0207667_10153833 Ga0207667_101538333 145
628 3300025949 Ga0207667_10741052 Ga0207667_107410522 145
629 3300025960 Ga0207651_10441385 Ga0207651_104413852 145
630 3300025961 Ga0207712_11535398 Ga0207712_115353981 145
631 3300025972 Ga0207668_10018545 Ga0207668_100185457 145
632 3300025972 Ga0207668_10030206 Ga0207668_100302065 145
633 3300025972 Ga0207668_10050353 Ga0207668_100503533 145
634 3300025981 Ga0207640_10053809 Ga0207640_100538092 145
635 3300025981 Ga0207640_10067226 Ga0207640_100672261 145
636 3300025981 Ga0207640_10315350 Ga0207640_103153502 145
637 3300025986 Ga0207658_10090529 Ga0207658_100905292 145
638 3300025986 Ga0207658_10300245 Ga0207658_103002452 145
639 3300026023 Ga0207677_10539889 Ga0207677_105398892 145
640 3300026035 Ga0207703_10059957 Ga0207703_100599572 145
641 3300026035 Ga0207703_10683229 Ga0207703_106832292 145
642 3300026041 Ga0207639_10006833 Ga0207639_100068336 145
643 3300026041 Ga0207639_10012777 Ga0207639_100127774 145
644 3300026041 Ga0207639_10050273 Ga0207639_100502732 145
645 3300026041 Ga0207639_10223020 Ga0207639_102230202 145
646 3300026041 Ga0207639_10336281 Ga0207639_103362812 145
647 3300026041 Ga0207639_10349456 Ga0207639_103494562 145
648 3300026041 Ga0207639_10906137 Ga0207639_109061372 145
649 3300026067 Ga0207678_10024651 Ga0207678_100246512 145
650 3300026067 Ga0207678_10050974 Ga0207678_100509744 145
651 3300026067 Ga0207678_10058436 Ga0207678_100584362 145
652 3300026067 Ga0207678_10063926 Ga0207678_100639262 145
653 3300026067 Ga0207678_10328971 Ga0207678_103289712 145
654 3300026067 Ga0207678_10415398 Ga0207678_104153982 145
655 3300026067 Ga0207678_10652866 Ga0207678_106528662 145
656 3300026078 Ga0207702_10000146 Ga0207702_1000014622 145
657 3300026078 Ga0207702_10001245 Ga0207702_1000124511 145
658 3300026078 Ga0207702_10616825 Ga0207702_106168252 145
659 3300026088 Ga0207641_10066474 Ga0207641_100664742 145
660 3300026088 Ga0207641_10115199 Ga0207641_101151992 145
661 3300026088 Ga0207641_10306945 Ga0207641_103069452 145
662 3300026089 Ga0207648_10078265 Ga0207648_100782652 145
663 3300026116 Ga0207674_10021203 Ga0207674_100212038 145
664 3300026116 Ga0207674_10026552 Ga0207674_100265526 145
665 3300026116 Ga0207674_10042211 Ga0207674_100422114 145
666 3300026116 Ga0207674_10331733 Ga0207674_103317332 145
667 3300026116 Ga0207674_10402813 Ga0207674_104028132 145
668 3300026116 Ga0207674_11093899 Ga0207674_110938991 145
669 3300026118 Ga0207675_100035110 Ga0207675_1000351102 145
670 3300026118 Ga0207675_100800508 Ga0207675_1008005081 145
671 3300026121 Ga0207683_10261286 Ga0207683_102612862 145
672 3300026121 Ga0207683_11081420 Ga0207683_110814201 145
673 3300026142 Ga0207698_10257466 Ga0207698_102574662 145
674 3300028379 Ga0268266_10000075 Ga0268266_10000075127 145
675 3300028379 Ga0268266_10248684 Ga0268266_102486841 145
676 3300028380 Ga0268265_10003524 Ga0268265_100035246 145
677 3300028380 Ga0268265_10207763 Ga0268265_102077631 145
678 3300028380 Ga0268265_10573600 Ga0268265_105736002 145
679 3300028381 Ga0268264_10007592 Ga0268264_1000759211 145
680 3300028381 Ga0268264_10051940 Ga0268264_100519402 145
681 3300028381 Ga0268264_10502894 Ga0268264_105028942 145
682 3300031238 Ga0265332_10065294 Ga0265332_100652942 145
683 3300031731 Ga0307405_10092256 Ga0307405_100922562 145
684 3300031731 Ga0307405_10558131 Ga0307405_105581312 145
685 3300031824 Ga0307413_11120500 Ga0307413_111205002 145
686 3300031911 Ga0307412_10000964 Ga0307412_100009644 145
687 3300031911 Ga0307412_10063471 Ga0307412_100634712 145
688 3300032002 Ga0307416_100015400 Ga0307416_1000154005 145
689 3300033180 Ga0307510_10000590 Ga0307510_1000059012 145
690 3300033180 Ga0307510_10106053 Ga0307510_101060532 145
691 3300037312 Ga0395899_0010288 Ga0395899_0010288_1481_1927 145
692 3300037312 Ga0395899_0032873 Ga0395899_0032873_3143_3589 145
693 3300037312 Ga0395899_0237204 Ga0395899_0237204_505_951 145
694 3300037418 Ga0395900_0012140 Ga0395900_0012140_3216_3662 145
695 3300037418 Ga0395900_0022584 Ga0395900_0022584_3242_3688 145
696 3300037418 Ga0395900_0152011 Ga0395900_0152011_635_1081 145
697 3300037466 Ga0395898_0000311 Ga0395898_0000311_93796_94245 145
698 3300037466 Ga0395898_0003642 Ga0395898_0003642_8355_8801 145
699 3300037466 Ga0395898_0044009 Ga0395898_0044009_1682_2128 145
700 3300037466 Ga0395898_0061745 Ga0395898_0061745_3093_3539 145
701 3300038443 Ga0395901_0005506 Ga0395901_0005506_5726_6172 145
702 3300038443 Ga0395901_0028241 Ga0395901_0028241_3143_3589 145
703 3300038443 Ga0395901_0065763 Ga0395901_0065763_2060_2506 145
704 3300038443 Ga0395901_0087865 Ga0395901_0087865_2369_2815 145
705 3300041404 Ga0439436_0000039 Ga0439436_0000039_14717_15163 145
706 3300041413 Ga0439465_0001017 Ga0439465_0001017_7030_7476 145
707 3300041452 Ga0451793_1363426 Ga0451793_1363426_385_828 145
708 3300041456 Ga0451795_1197460 Ga0451795_1197460_820_1266 145
709 3300041486 Ga0451807_0056970 Ga0451807_0056970_1320_1763 145
710 3300041509 Ga0451843_0242899 Ga0451843_0242899_102_545 145
711 3300041509 Ga0451843_0878023 Ga0451843_0878023_143_586 145
712 3300041512 Ga0451853_1720595 Ga0451853_1720595_101_550 145
713 3300042004 Ga0439445_0016947 Ga0439445_0016947_1006_1452 145
714 3300042011 Ga0439454_013215 Ga0439454_013215_632_1078 145
715 3300042134 Ga0450898_027898 Ga0450898_027898_205_651 145
716 3300042184 Ga0450908_000089 Ga0450908_000089_10743_11189 145
717 3300044672 Ga0466982_0000069 Ga0466982_0000069_14979_15425 145
718 3300044683 Ga0466965_0025175 Ga0466965_0025175_17_463 145
719 3300044693 Ga0466961_0000828 Ga0466961_0000828_8463_8912 145
720 3300044693 Ga0466961_0026637 Ga0466961_0026637_407_853 145
721 3300044694 Ga0466963_0195888 Ga0466963_0195888_61_510 145
722 3300044719 Ga0466971_0071350 Ga0466971_0071350_509_955 145
723 3300044735 Ga0466968_0004576 Ga0466968_0004576_2748_3194 145
724 3300044842 Ga0466957_0006148 Ga0466957_0006148_3363_3809 145
725 3300044842 Ga0466957_0049587 Ga0466957_0049587_573_1022 145
726 3300044842 Ga0466957_0102849 Ga0466957_0102849_1172_1618 145
727 3300045836 Ga0466958_0009449 Ga0466958_0009449_4168_4614 145
728 3300045836 Ga0466958_0015748 Ga0466958_0015748_1549_1998 145
729 3300045976 Ga0466967_0078856 Ga0466967_0078856_1911_2357 145
730 3300045976 Ga0466967_0459289 Ga0466967_0459289_13_462 145
731 3300045976 Ga0466967_0470359 Ga0466967_0470359_425_871 145
732 3300046452 Ga0495617_000544 Ga0495617_000544_10150_10596 145
733 3300046452 Ga0495617_000892 Ga0495617_000892_7060_7506 145
734 3300046460 Ga0495638_0000248 Ga0495638_0000248_19106_19552 145
735 3300046460 Ga0495638_0000272 Ga0495638_0000272_67538_67981 145
736 3300046460 Ga0495638_0001001 Ga0495638_0001001_594_1040 145
737 3300046460 Ga0495638_0024024 Ga0495638_0024024_1249_1695 145
738 3300046460 Ga0495638_0222925 Ga0495638_0222925_35_505 145
739 3300046471 Ga0495650_0000430 Ga0495650_0000430_65360_65806 145
740 3300046471 Ga0495650_0001768 Ga0495650_0001768_11493_11939 145
741 3300046471 Ga0495650_0023427 Ga0495650_0023427_1411_1857 145
742 3300046471 Ga0495650_0268587 Ga0495650_0268587_57_503 145
743 3300046491 Ga0495584_0000619 Ga0495584_0000619_2932_3378 145
744 3300046492 Ga0495585_0001031 Ga0495585_0001031_9790_10236 145
745 3300046501 Ga0495607_0000174 Ga0495607_0000174_61259_61705 145
746 3300046501 Ga0495607_0000363 Ga0495607_0000363_5160_5606 145
747 3300046501 Ga0495607_0013625 Ga0495607_0013625_1952_2398 145
748 3300046506 Ga0495583_0052863 Ga0495583_0052863_599_1045 145
749 3300046507 Ga0495606_0003641 Ga0495606_0003641_30_476 145
750 3300046507 Ga0495606_0005439 Ga0495606_0005439_9711_10154 145
751 3300046507 Ga0495606_0005452 Ga0495606_0005452_4685_5131 145
752 3300046507 Ga0495606_0017085 Ga0495606_0017085_2656_3102 145
753 3300046507 Ga0495606_0027933 Ga0495606_0027933_187_633 145
754 3300046512 Ga0495610_0000298 Ga0495610_0000298_73_519 145
755 3300046512 Ga0495610_0008074 Ga0495610_0008074_27_473 145
756 3300046513 Ga0495616_0000138 Ga0495616_0000138_56178_56624 145
757 3300046513 Ga0495616_0010777 Ga0495616_0010777_4025_4471 145
758 3300046515 Ga0495620_0000366 Ga0495620_0000366_7033_7479 145
759 3300046515 Ga0495620_0039587 Ga0495620_0039587_439_885 145
760 3300046518 Ga0495631_0000282 Ga0495631_0000282_8606_9052 145
761 3300046518 Ga0495631_0000825 Ga0495631_0000825_12459_12905 145
762 3300046519 Ga0495632_0000010 Ga0495632_0000010_103513_103959 145
763 3300046519 Ga0495632_0006748 Ga0495632_0006748_169_615 145
764 3300046519 Ga0495632_0012628 Ga0495632_0012628_2320_2766 145
765 3300046519 Ga0495632_0062029 Ga0495632_0062029_160_606 145
766 3300046520 Ga0495637_0011078 Ga0495637_0011078_3847_4293 145
767 3300046524 Ga0495648_0001511 Ga0495648_0001511_12480_12926 145
768 3300046524 Ga0495648_0003781 Ga0495648_0003781_11736_12182 145
769 3300046538 Ga0495609_0003368 Ga0495609_0003368_8134_8580 145
770 3300046616 Ga0495668_0010274 Ga0495668_0010274_1012_1458 145
771 3300046642 Ga0495634_0229496 Ga0495634_0229496_137_580 145
772 3300046648 Ga0495611_0000003 Ga0495611_0000003_253675_254121 145
773 3300046648 Ga0495611_0000857 Ga0495611_0000857_7063_7509 145
774 3300046660 Ga0495625_0000019 Ga0495625_0000019_52535_52981 145
775 3300046660 Ga0495625_0029482 Ga0495625_0029482_45_488 145
776 3300046660 Ga0495625_0044270 Ga0495625_0044270_534_980 145
777 3300046660 Ga0495625_0053218 Ga0495625_0053218_1556_2002 145
778 3300046665 Ga0495661_0001440 Ga0495661_0001440_6864_7310 145
779 3300046691 Ga0495670_0000500 Ga0495670_0000500_6083_6529 145
780 3300046691 Ga0495670_0006799 Ga0495670_0006799_720_1166 145
781 3300046691 Ga0495670_0024353 Ga0495670_0024353_1492_1938 145
782 3300046692 Ga0495671_0001785 Ga0495671_0001785_9741_10187 145
783 3300046694 Ga0495649_0001469 Ga0495649_0001469_1969_2412 145
784 3300046694 Ga0495649_0032839 Ga0495649_0032839_1814_2257 145
785 3300046694 Ga0495649_0042529 Ga0495649_0042529_439_885 145
786 3300046794 Ga0495589_0000516 Ga0495589_0000516_9112_9558 145
787 3300046810 Ga0495660_0000125 Ga0495660_0000125_42909_43355 145
788 3300046810 Ga0495660_0000251 Ga0495660_0000251_43755_44201 145
789 3300047323 Ga0495683_0002304 Ga0495683_0002304_9071_9517 145
790 3300047446 Ga0495679_000017 Ga0495679_000017_9113_9559 145
791 3300047469 Ga0495673_0000004 Ga0495673_0000004_705908_706354 145
792 3300047469 Ga0495673_0000133 Ga0495673_0000133_132161_132607 145
793 3300047469 Ga0495673_0003063 Ga0495673_0003063_3963_4409 145
794 3300047472 Ga0495686_0001096 Ga0495686_0001096_6305_6751 145
795 3300047472 Ga0495686_0001191 Ga0495686_0001191_24464_24910 145
796 3300047472 Ga0495686_0019484 Ga0495686_0019484_1155_1601 145
797 3300047472 Ga0495686_0025043 Ga0495686_0025043_2382_2828 145
798 3300047472 Ga0495686_0036584 Ga0495686_0036584_1410_1856 145
799 3300048903 Ga0496100_0014402 Ga0496100_0014402_2288_2734 145
800 3300048903 Ga0496100_0704745 Ga0496100_0704745_224_661 145
801 3300048904 Ga0496101_0002766 Ga0496101_0002766_1350_1796 145
802 3300048904 Ga0496101_1238904 Ga0496101_1238904_26_463 145
803 3300048905 Ga0496102_0075090 Ga0496102_0075090_2565_3011 145
804 3300048905 Ga0496102_0364253 Ga0496102_0364253_123_569 145
805 3300048907 Ga0496104_0559216 Ga0496104_0559216_556_1002 145
806 3300048909 Ga0496106_0003606 Ga0496106_0003606_10453_10899 145
807 3300048909 Ga0496106_0967342 Ga0496106_0967342_30_476 145
808 3300048910 Ga0496107_0233178 Ga0496107_0233178_825_1268 145
809 3300048912 Ga0496109_0111352 Ga0496109_0111352_462_905 145
810 3300048917 Ga0496114_0091752 Ga0496114_0091752_959_1405 145
811 3300048917 Ga0496114_0102534 Ga0496114_0102534_481_924 145
812 3300048918 Ga0496115_0004754 Ga0496115_0004754_7299_7742 145
813 3300048918 Ga0496115_0118390 Ga0496115_0118390_189_635 145
814 3300048918 Ga0496115_0192535 Ga0496115_0192535_365_808 145
815 3300048919 Ga0496116_0227244 Ga0496116_0227244_15_461 145
816 3300048919 Ga0496116_0302541 Ga0496116_0302541_50_496 145
817 3300048920 Ga0496117_0003181 Ga0496117_0003181_4140_4586 145
818 3300048920 Ga0496117_0043387 Ga0496117_0043387_732_1178 145
819 3300048920 Ga0496117_0122362 Ga0496117_0122362_213_659 145
820 3300048921 Ga0496118_0005088 Ga0496118_0005088_7428_7874 145
821 3300048921 Ga0496118_0007784 Ga0496118_0007784_7338_7784 145
822 3300048922 Ga0496119_0014890 Ga0496119_0014890_761_1207 145
823 3300048924 Ga0496121_0000251 Ga0496121_0000251_41045_41491 145
824 3300048924 Ga0496121_0000898 Ga0496121_0000898_44843_45289 145
825 3300048924 Ga0496121_0001047 Ga0496121_0001047_43721_44167 145
826 3300048924 Ga0496121_0056739 Ga0496121_0056739_2152_2598 145
827 3300048924 Ga0496121_0065955 Ga0496121_0065955_2324_2770 145
828 3300048924 Ga0496121_0081242 Ga0496121_0081242_2005_2451 145
829 3300048924 Ga0496121_0098277 Ga0496121_0098277_1209_1655 145
830 3300048925 Ga0496122_0011466 Ga0496122_0011466_6161_6607 145
831 3300048925 Ga0496122_0071461 Ga0496122_0071461_672_1118 145
832 3300048926 Ga0496123_0007239 Ga0496123_0007239_2471_2917 145
833 3300048926 Ga0496123_0029768 Ga0496123_0029768_1358_1804 145
834 3300048926 Ga0496123_0045635 Ga0496123_0045635_1665_2111 145
835 3300048926 Ga0496123_0072642 Ga0496123_0072642_953_1399 145
836 3300048927 Ga0496124_0090357 Ga0496124_0090357_1078_1524 145
837 3300048928 Ga0496125_0007774 Ga0496125_0007774_1333_1779 145
838 3300048928 Ga0496125_0081010 Ga0496125_0081010_1147_1593 145
839 3300048929 Ga0496126_0007552 Ga0496126_0007552_6843_7289 145
840 3300048929 Ga0496126_0013487 Ga0496126_0013487_4587_5033 145
841 3300048929 Ga0496126_0093279 Ga0496126_0093279_582_1028 145
842 3300048929 Ga0496126_0271707 Ga0496126_0271707_896_1339 145
843 3300048929 Ga0496126_0640184 Ga0496126_0640184_32_478 145
844 3300048929 Ga0496126_1093662 Ga0496126_1093662_85_528 145
845 3300049459 Ga0495678_001135 Ga0495678_001135_9056_9502 145
846 3300049459 Ga0495678_036975 Ga0495678_036975_621_1064 145
847 3300049460 Ga0495682_0001686 Ga0495682_0001686_4504_4950 145
848 3300049460 Ga0495682_0003436 Ga0495682_0003436_905_1351 145
849 3300049568 Ga0501031_0001635 Ga0501031_0001635_1575_2027 145
850 3300049568 Ga0501031_0010135 Ga0501031_0010135_374_817 145
851 3300049569 Ga0501032_0005139 Ga0501032_0005139_7818_8261 145
852 3300049569 Ga0501032_0007934 Ga0501032_0007934_5635_6087 145
853 3300049569 Ga0501032_0020747 Ga0501032_0020747_1444_1887 145
854 3300049569 Ga0501032_0055978 Ga0501032_0055978_76_522 145
855 3300049570 Ga0501033_0000413 Ga0501033_0000413_38040_38483 145
856 3300049570 Ga0501033_0001888 Ga0501033_0001888_12221_12667 145
857 3300049570 Ga0501033_0013037 Ga0501033_0013037_1107_1553 145
858 3300049570 Ga0501033_0019606 Ga0501033_0019606_2176_2619 145
859 3300049570 Ga0501033_0189607 Ga0501033_0189607_840_1292 145
860 3300049570 Ga0501033_0645283 Ga0501033_0645283_155_601 145
861 3300049571 Ga0501034_0004833 Ga0501034_0004833_6825_7277 145
862 3300049571 Ga0501034_0010658 Ga0501034_0010658_7981_8424 145
863 3300049571 Ga0501034_0015587 Ga0501034_0015587_983_1426 145
864 3300049571 Ga0501034_0025803 Ga0501034_0025803_4504_4950 145
865 3300049571 Ga0501034_0209216 Ga0501034_0209216_63_509 145
866 3300049572 Ga0501036_0003345 Ga0501036_0003345_4732_5175 145
867 3300049572 Ga0501036_0019655 Ga0501036_0019655_2798_3250 145
868 3300049572 Ga0501036_0079456 Ga0501036_0079456_1617_2063 145
869 3300049573 Ga0501037_0013746 Ga0501037_0013746_1875_2327 145
870 3300049573 Ga0501037_0013910 Ga0501037_0013910_1578_2021 145
871 3300049573 Ga0501037_0029943 Ga0501037_0029943_1676_2122 145
872 3300049573 Ga0501037_0033163 Ga0501037_0033163_1447_1893 145
873 3300049573 Ga0501037_0397141 Ga0501037_0397141_33_482 145
874 3300049574 Ga0501038_0001260 Ga0501038_0001260_21119_21562 145
875 3300049574 Ga0501038_0004540 Ga0501038_0004540_5668_6120 145
876 3300049574 Ga0501038_0034079 Ga0501038_0034079_2134_2580 145
877 3300049574 Ga0501038_0147873 Ga0501038_0147873_702_1145 145
878 3300049574 Ga0501038_0151585 Ga0501038_0151585_157_600 145
879 3300049575 Ga0501039_0008284 Ga0501039_0008284_1431_1874 145
880 3300049575 Ga0501039_0223887 Ga0501039_0223887_772_1224 145
881 3300049576 Ga0501040_0003903 Ga0501040_0003903_1394_1837 145
882 3300049576 Ga0501040_0131260 Ga0501040_0131260_725_1177 145
883 3300049578 Ga0501042_0003512 Ga0501042_0003512_7747_8190 145
884 3300049578 Ga0501042_0127461 Ga0501042_0127461_1143_1586 145
885 3300049579 Ga0501043_0006834 Ga0501043_0006834_2321_2773 145
886 3300049579 Ga0501043_0015905 Ga0501043_0015905_4628_5071 145
887 3300049579 Ga0501043_0041568 Ga0501043_0041568_713_1159 145
888 3300049579 Ga0501043_0098163 Ga0501043_0098163_198_641 145
889 3300049579 Ga0501043_0380517 Ga0501043_0380517_469_912 145
890 3300049579 Ga0501043_0435708 Ga0501043_0435708_92_538 145
891 3300049580 Ga0501046_0002360 Ga0501046_0002360_4327_4779 145
892 3300049580 Ga0501046_0009801 Ga0501046_0009801_147_590 145
893 3300049580 Ga0501046_0177341 Ga0501046_0177341_369_812 145
894 3300049580 Ga0501046_0313528 Ga0501046_0313528_208_651 145
895 3300049580 Ga0501046_0324275 Ga0501046_0324275_638_1084 145
896 3300049581 Ga0501047_0008984 Ga0501047_0008984_8752_9195 145
897 3300049581 Ga0501047_0013356 Ga0501047_0013356_5928_6374 145
898 3300049581 Ga0501047_0026217 Ga0501047_0026217_3493_3945 145
899 3300049581 Ga0501047_0029718 Ga0501047_0029718_2503_2949 145
900 3300049581 Ga0501047_0094669 Ga0501047_0094669_285_728 145
901 3300049581 Ga0501047_0412811 Ga0501047_0412811_380_829 145
902 3300049581 Ga0501047_0739424 Ga0501047_0739424_284_730 145
903 3300049582 Ga0501048_0010289 Ga0501048_0010289_2842_3285 145
904 3300049583 Ga0501067_0018462 Ga0501067_0018462_2816_3259 145
905 3300049583 Ga0501067_0229444 Ga0501067_0229444_129_581 145
906 3300049584 Ga0501068_0056200 Ga0501068_0056200_595_1047 145
907 3300049586 Ga0501070_0035901 Ga0501070_0035901_305_748 145
908 3300049586 Ga0501070_0074312 Ga0501070_0074312_1290_1733 145
909 3300049586 Ga0501070_0623334 Ga0501070_0623334_356_802 145
910 3300049586 Ga0501070_0914254 Ga0501070_0914254_158_604 145
911 3300049588 Ga0501072_0014997 Ga0501072_0014997_2492_2935 145
912 3300049589 Ga0501073_0001933 Ga0501073_0001933_777_1220 145
913 3300049589 Ga0501073_0009203 Ga0501073_0009203_2341_2793 145
914 3300049589 Ga0501073_0029163 Ga0501073_0029163_499_948 145
915 3300049589 Ga0501073_0466966 Ga0501073_0466966_216_659 145
916 3300049590 Ga0501074_0045492 Ga0501074_0045492_1315_1758 145
917 3300049592 Ga0501076_0181296 Ga0501076_0181296_1013_1456 145
918 3300049592 Ga0501076_1243458 Ga0501076_1243458_52_495 145
919 3300049741 Ga0501079_0010337 Ga0501079_0010337_3513_3956 145
920 3300049741 Ga0501079_0048326 Ga0501079_0048326_881_1324 145
921 3300049741 Ga0501079_0175710 Ga0501079_0175710_1213_1656 145
922 3300049742 Ga0501080_0000785 Ga0501080_0000785_14953_15396 145
923 3300049742 Ga0501080_0186116 Ga0501080_0186116_49_501 145
924 3300049742 Ga0501080_0368913 Ga0501080_0368913_228_671 145
925 3300049742 Ga0501080_0640451 Ga0501080_0640451_209_652 145
926 3300049744 Ga0501083_0007095 Ga0501083_0007095_2085_2528 145
927 3300049744 Ga0501083_0109979 Ga0501083_0109979_955_1398 145
928 3300049822 Ga0501035_0031827 Ga0501035_0031827_1561_2004 145
929 3300049822 Ga0501035_0044322 Ga0501035_0044322_980_1423 145
930 3300049822 Ga0501035_0050284 Ga0501035_0050284_1410_1856 145
931 3300049822 Ga0501035_0077343 Ga0501035_0077343_1952_2398 145
932 3300049822 Ga0501035_0085117 Ga0501035_0085117_672_1124 145
933 3300049822 Ga0501035_0208674 Ga0501035_0208674_232_678 145
934 3300049822 Ga0501035_0354116 Ga0501035_0354116_421_864 145
935 3300049823 Ga0501044_0009102 Ga0501044_0009102_9542_9985 145
936 3300049823 Ga0501044_0019879 Ga0501044_0019879_4399_4851 145
937 3300049823 Ga0501044_0045752 Ga0501044_0045752_3835_4278 145
938 3300049823 Ga0501044_0045858 Ga0501044_0045858_2202_2648 145
939 3300049823 Ga0501044_0047110 Ga0501044_0047110_1714_2160 145
940 3300049823 Ga0501044_0236932 Ga0501044_0236932_474_920 145
941 3300049823 Ga0501044_0374448 Ga0501044_0374448_338_784 145
942 3300049824 Ga0501045_0038538 Ga0501045_0038538_2492_2935 145
943 3300049824 Ga0501045_0500083 Ga0501045_0500083_217_663 145
944 3300050516 nmdc:mga0sz30_174271_c1 nmdc:mga0sz30_174271_c1_340_786 145
945 3300053079 Ga0500610_0000202 Ga0500610_0000202_11553_11996 145
946 3300053087 Ga0500643_000223 Ga0500643_000223_9397_9843 145
947 3300053090 Ga0500646_0023205 Ga0500646_0023205_1005_1451 145
948 3300053093 Ga0500651_0001816 Ga0500651_0001816_7962_8405 145
949 3300053103 Ga0500555_000290 Ga0500555_000290_8999_9445 145
950 3300053136 Ga0500559_0084368 Ga0500559_0084368_34_477 145
951 3300053140 Ga0500573_0400393 Ga0500573_0400393_145_591 145
952 3300053160 Ga0500633_0013909 Ga0500633_0013909_1625_2071 145
953 3300053730 Ga0500645_000648 Ga0500645_000648_12569_13015 145
954 3300054114 Ga0501084_0037802 Ga0501084_0037802_2702_3145 145
955 3300054114 Ga0501084_0102424 Ga0501084_0102424_1405_1848 145
956 3300060353 Ga0501082_0035877 Ga0501082_0035877_607_1050 145
957 3300060353 Ga0501082_0193088 Ga0501082_0193088_1240_1683 145
958 3300061719 Ga0466962_0018166 Ga0466962_0018166_854_1300 145
959 3300061734 Ga0530510_1380689 Ga0530510_1380689_74_517 145
960 2162886007 SwRhRL2b_contig_2618757 SwRhRL2b_0590.00007140 146
961 2162886007 SwRhRL2b_contig_3114300 SwRhRL2b_0077.00006190 146
962 2162886007 SwRhRL2b_contig_3331867 SwRhRL2b_0321.00003900 146
963 3300002774 JGI25150J39212_1000183 JGI25150J39212_100018313 146
964 3300003187 JGI25151J46595_10000271 JGI25151J46595_1000027132 146
965 3300003215 JGI25153J46596_10000190 JGI25153J46596_1000019032 146
966 3300003771 Ga0055526_1000298 Ga0055526_10002988 146
967 3300003773 Ga0055537_1001342 Ga0055537_10013428 146
968 3300003773 Ga0055537_1001615 Ga0055537_10016155 146
969 3300003781 Ga0055536_1007759 Ga0055536_10077596 146
970 3300003781 Ga0055536_1008889 Ga0055536_10088894 146
971 3300003784 Ga0055534_1000145 Ga0055534_10001459 146
972 3300003790 Ga0055528_1002402 Ga0055528_10024028 146
973 3300003794 Ga0055531_10004333 Ga0055531_100043334 146
974 3300003794 Ga0055531_10036266 Ga0055531_100362662 146
975 3300003856 Ga0058692_1000053 Ga0058692_100005381 146
976 3300003856 Ga0058692_1000065 Ga0058692_100006546 146
977 3300005289 Ga0065704_10071470 Ga0065704_100714707 146
978 3300005289 Ga0065704_10071727 Ga0065704_100717274 146
979 3300005289 Ga0065704_10114879 Ga0065704_101148792 146
980 3300005331 Ga0070670_100001269 Ga0070670_10000126914 146
981 3300005347 Ga0070668_100002627 Ga0070668_1000026278 146
982 3300005347 Ga0070668_100405656 Ga0070668_1004056562 146
983 3300005353 Ga0070669_101213156 Ga0070669_1012131561 146
984 3300005456 Ga0070678_100037145 Ga0070678_1000371452 146
985 3300005548 Ga0070665_100084360 Ga0070665_1000843602 146
986 3300006038 Ga0075365_10249900 Ga0075365_102499002 146
987 3300006051 Ga0075364_10000527 Ga0075364_1000052711 146
988 3300006051 Ga0075364_10223826 Ga0075364_102238262 146
989 3300006051 Ga0075364_10440672 Ga0075364_104406722 146
990 3300006051 Ga0075364_10507193 Ga0075364_105071931 146
991 3300006186 Ga0075369_10104761 Ga0075369_101047611 146
992 3300009011 Ga0105251_10000205 Ga0105251_1000020526 146
993 3300009036 Ga0105244_10049736 Ga0105244_100497362 146
994 3300009036 Ga0105244_10099875 Ga0105244_100998752 146
995 3300009036 Ga0105244_10268482 Ga0105244_102684822 146
996 3300009148 Ga0105243_10004757 Ga0105243_100047572 146
997 3300009148 Ga0105243_10006955 Ga0105243_1000695510 146
998 3300009174 Ga0105241_10959446 Ga0105241_109594462 146
999 3300010375 Ga0105239_10046999 Ga0105239_100469992 146
1000 3300013100 Ga0157373_10055151 Ga0157373_100551513 146
1001 3300013100 Ga0157373_10115095 Ga0157373_101150952 146
1002 3300013100 Ga0157373_10948008 Ga0157373_109480081 146
1003 3300013102 Ga0157371_10000397 Ga0157371_1000039722 146
1004 3300013102 Ga0157371_10043256 Ga0157371_100432562 146
1005 3300013102 Ga0157371_10057626 Ga0157371_100576263 146
1006 3300013102 Ga0157371_10057704 Ga0157371_100577043 146
1007 3300013102 Ga0157371_10068392 Ga0157371_100683922 146
1008 3300013104 Ga0157370_10000918 Ga0157370_1000091812 146
1009 3300013104 Ga0157370_10081287 Ga0157370_100812873 146
1010 3300013104 Ga0157370_10224821 Ga0157370_102248212 146
1011 3300013105 Ga0157369_10025085 Ga0157369_100250857 146
1012 3300013306 Ga0163162_10290633 Ga0163162_102906332 146
1013 3300013307 Ga0157372_10678881 Ga0157372_106788812 146
1014 3300014497 Ga0182008_10000076 Ga0182008_1000007652 146
1015 3300014497 Ga0182008_10005245 Ga0182008_100052458 146
1016 3300015262 Ga0182007_10000079 Ga0182007_1000007921 146
1017 3300015265 Ga0182005_1000166 Ga0182005_100016613 146
1018 3300015265 Ga0182005_1002148 Ga0182005_10021485 146
1019 3300016635 Ga0183361_10384 Ga0183361_103842 146
1020 3300017792 Ga0163161_10004941 Ga0163161_100049419 146
1021 3300017792 Ga0163161_10025799 Ga0163161_100257993 146
1022 3300017792 Ga0163161_10555247 Ga0163161_105552472 146
1023 3300025245 Ga0207425_1000148 Ga0207425_100014819 146
1024 3300025258 Ga0209129_1000239 Ga0209129_100023919 146
1025 3300025263 Ga0209565_1000060 Ga0209565_1000060111 146
1026 3300025273 Ga0209673_1000047 Ga0209673_100004751 146
1027 3300025273 Ga0209673_1022642 Ga0209673_10226422 146
1028 3300025291 Ga0209675_1000007 Ga0209675_1000007569 146
1029 3300025291 Ga0209675_1036976 Ga0209675_10369762 146
1030 3300025292 Ga0209676_1000024 Ga0209676_100002426 146
1031 3300025292 Ga0209676_1000411 Ga0209676_100041137 146
1032 3300025292 Ga0209676_1011809 Ga0209676_10118093 146
1033 3300025294 Ga0209025_1000048 Ga0209025_1000048264 146
1034 3300025294 Ga0209025_1124282 Ga0209025_11242822 146
1035 3300025295 Ga0209564_1000252 Ga0209564_100025228 146
1036 3300025295 Ga0209564_1037410 Ga0209564_10374102 146
1037 3300025297 Ga0209758_1000056 Ga0209758_1000056264 146
1038 3300025298 Ga0209050_1005908 Ga0209050_10059083 146
1039 3300025298 Ga0209050_1016485 Ga0209050_10164852 146
1040 3300025298 Ga0209050_1052538 Ga0209050_10525381 146
1041 3300025299 Ga0209256_1006105 Ga0209256_10061053 146
1042 3300025304 Ga0209257_1002415 Ga0209257_10024157 146
1043 3300025304 Ga0209257_1006792 Ga0209257_10067925 146
1044 3300025304 Ga0209257_1013734 Ga0209257_10137342 146
1045 3300025735 Ga0207713_1000196 Ga0207713_100019645 146
1046 3300025925 Ga0207650_10018392 Ga0207650_100183922 146
1047 3300025925 Ga0207650_10097225 Ga0207650_100972252 146
1048 3300025935 Ga0207709_10000527 Ga0207709_1000052723 146
1049 3300025935 Ga0207709_10031190 Ga0207709_100311902 146
1050 3300025972 Ga0207668_10646204 Ga0207668_106462042 146
1051 3300025981 Ga0207640_10466475 Ga0207640_104664752 146
1052 3300026078 Ga0207702_11802916 Ga0207702_118029161 146
1053 3300026121 Ga0207683_10041028 Ga0207683_100410282 146
1054 3300027312 Ga0209371_1000018 Ga0209371_1000018543 146
1055 3300027312 Ga0209371_1000025 Ga0209371_100002523 146
1056 3300028379 Ga0268266_10083058 Ga0268266_100830582 146
1057 3300028379 Ga0268266_10848664 Ga0268266_108486642 146
1058 3300030500 Ga0268256_1000016 Ga0268256_1000016543 146
1059 3300030500 Ga0268256_1000027 Ga0268256_100002723 146
1060 3300030742 Ga0316183_1005705 Ga0316183_10057058 146
1061 3300031824 Ga0307413_10062116 Ga0307413_100621163 146
1062 3300031852 Ga0307410_10728679 Ga0307410_107286792 146
1063 3300031911 Ga0307412_10001490 Ga0307412_100014905 146
1064 3300032004 Ga0307414_10002908 Ga0307414_100029087 146
1065 3300032004 Ga0307414_11575943 Ga0307414_115759431 146
1066 3300038705 Ga0237819_00212 Ga0237819_00212_5685_6125 146
1067 3300038705 Ga0237819_05893 Ga0237819_05893_1186_1626 146
1068 3300041413 Ga0439465_0011754 Ga0439465_0011754_2010_2450 146
1069 3300041441 Ga0451787_012880 Ga0451787_012880_547_987 146
1070 3300041443 Ga0451789_0557839 Ga0451789_0557839_35_475 146
1071 3300041451 Ga0451791_0334252 Ga0451791_0334252_213_653 146
1072 3300041451 Ga0451791_1081702 Ga0451791_1081702_585_1025 146
1073 3300041451 Ga0451791_1511621 Ga0451791_1511621_66_506 146
1074 3300041452 Ga0451793_1103512 Ga0451793_1103512_243_683 146
1075 3300041452 Ga0451793_1717557 Ga0451793_1717557_369_809 146
1076 3300041453 Ga0451797_0312273 Ga0451797_0312273_277_717 146
1077 3300041456 Ga0451795_0526614 Ga0451795_0526614_97_537 146
1078 3300041456 Ga0451795_1129675 Ga0451795_1129675_442_882 146
1079 3300041458 Ga0451798_1163213 Ga0451798_1163213_66_506 146
1080 3300041459 Ga0451800_0088931 Ga0451800_0088931_5233_5673 146
1081 3300041460 Ga0451802_1987837 Ga0451802_1987837_59_499 146
1082 3300041462 Ga0451806_049713 Ga0451806_049713_3501_3941 146
1083 3300041463 Ga0451804_0181637 Ga0451804_0181637_956_1396 146
1084 3300041486 Ga0451807_0135972 Ga0451807_0135972_642_1082 146
1085 3300041486 Ga0451807_0525217 Ga0451807_0525217_3834_4274 146
1086 3300041486 Ga0451807_0552649 Ga0451807_0552649_511_951 146
1087 3300041492 Ga0451835_0349548 Ga0451835_0349548_97_537 146
1088 3300041494 Ga0451837_1853924 Ga0451837_1853924_900_1340 146
1089 3300041498 Ga0451841_0885665 Ga0451841_0885665_253_693 146
1090 3300041507 Ga0451851_1026372 Ga0451851_1026372_107_547 146
1091 3300041509 Ga0451843_0356603 Ga0451843_0356603_166_606 146
1092 3300041509 Ga0451843_0587814 Ga0451843_0587814_633_1073 146
1093 3300041512 Ga0451853_1123701 Ga0451853_1123701_151_591 146
1094 3300041512 Ga0451853_3798902 Ga0451853_3798902_64_507 146
1095 3300042006 Ga0439432_003692 Ga0439432_003692_3955_4395 146
1096 3300042006 Ga0439432_012481 Ga0439432_012481_55_495 146
1097 3300042007 Ga0439449_0022177 Ga0439449_0022177_1777_2217 146
1098 3300046460 Ga0495638_0000526 Ga0495638_0000526_14316_14756 146
1099 3300046512 Ga0495610_0004372 Ga0495610_0004372_7128_7568 146
1100 3300046518 Ga0495631_0002447 Ga0495631_0002447_2921_3361 146
1101 3300046522 Ga0495643_0001815 Ga0495643_0001815_7447_7887 146
1102 3300046525 Ga0495663_0001114 Ga0495663_0001114_2256_2696 146
1103 3300046558 Ga0495633_0005215 Ga0495633_0005215_2448_2888 146
1104 3300046558 Ga0495633_0006376 Ga0495633_0006376_5878_6318 146
1105 3300046660 Ga0495625_0013061 Ga0495625_0013061_2197_2637 146
1106 3300046810 Ga0495660_0007665 Ga0495660_0007665_4274_4714 146
1107 3300047320 Ga0495672_0000087 Ga0495672_0000087_21934_22374 146
1108 3300047470 Ga0495681_0014016 Ga0495681_0014016_2256_2696 146
1109 3300047472 Ga0495686_0004003 Ga0495686_0004003_9688_10128 146
1110 3300047472 Ga0495686_0015934 Ga0495686_0015934_3726_4166 146
1111 3300048917 Ga0496114_0031279 Ga0496114_0031279_107_547 146
1112 3300048917 Ga0496114_0332549 Ga0496114_0332549_329_769 146
1113 3300048919 Ga0496116_0002572 Ga0496116_0002572_9890_10330 146
1114 3300048919 Ga0496116_0028282 Ga0496116_0028282_64_504 146
1115 3300048919 Ga0496116_0029042 Ga0496116_0029042_926_1366 146
1116 3300048920 Ga0496117_0000826 Ga0496117_0000826_8215_8655 146
1117 3300048920 Ga0496117_0001430 Ga0496117_0001430_13743_14183 146
1118 3300048920 Ga0496117_0006061 Ga0496117_0006061_2316_2756 146
1119 3300048920 Ga0496117_0006643 Ga0496117_0006643_6987_7427 146
1120 3300048921 Ga0496118_0001349 Ga0496118_0001349_13744_14184 146
1121 3300048921 Ga0496118_0002050 Ga0496118_0002050_25155_25595 146
1122 3300048921 Ga0496118_0006019 Ga0496118_0006019_2790_3230 146
1123 3300048921 Ga0496118_0007889 Ga0496118_0007889_7475_7915 146
1124 3300048921 Ga0496118_0008964 Ga0496118_0008964_722_1162 146
1125 3300048921 Ga0496118_0013651 Ga0496118_0013651_6376_6816 146
1126 3300048921 Ga0496118_0020067 Ga0496118_0020067_3688_4128 146
1127 3300048921 Ga0496118_0038408 Ga0496118_0038408_197_637 146
1128 3300048921 Ga0496118_0051257 Ga0496118_0051257_560_1000 146
1129 3300048921 Ga0496118_0286888 Ga0496118_0286888_355_795 146
1130 3300048922 Ga0496119_0000711 Ga0496119_0000711_21178_21618 146
1131 3300048922 Ga0496119_0002773 Ga0496119_0002773_10763_11203 146
1132 3300048923 Ga0496120_0000273 Ga0496120_0000273_42425_42865 146
1133 3300048923 Ga0496120_0000727 Ga0496120_0000727_24586_25026 146
1134 3300048924 Ga0496121_0004863 Ga0496121_0004863_8160_8600 146
1135 3300048924 Ga0496121_0023766 Ga0496121_0023766_3856_4296 146
1136 3300048924 Ga0496121_0089821 Ga0496121_0089821_1094_1534 146
1137 3300048925 Ga0496122_0000417 Ga0496122_0000417_52408_52848 146
1138 3300048925 Ga0496122_0001140 Ga0496122_0001140_37343_37783 146
1139 3300048925 Ga0496122_0008583 Ga0496122_0008583_8060_8500 146
1140 3300048925 Ga0496122_0020608 Ga0496122_0020608_3685_4137 146
1141 3300048925 Ga0496122_0036471 Ga0496122_0036471_2812_3252 146
1142 3300048926 Ga0496123_0000137 Ga0496123_0000137_107799_108239 146
1143 3300048926 Ga0496123_0000942 Ga0496123_0000942_37185_37625 146
1144 3300048926 Ga0496123_0010892 Ga0496123_0010892_65_505 146
1145 3300048926 Ga0496123_0021928 Ga0496123_0021928_2239_2679 146
1146 3300048926 Ga0496123_0031779 Ga0496123_0031779_507_947 146
1147 3300048926 Ga0496123_0063311 Ga0496123_0063311_1612_2052 146
1148 3300048926 Ga0496123_0116758 Ga0496123_0116758_249_701 146
1149 3300048927 Ga0496124_0000872 Ga0496124_0000872_36539_36979 146
1150 3300048927 Ga0496124_0001043 Ga0496124_0001043_35808_36260 146
1151 3300048927 Ga0496124_0001144 Ga0496124_0001144_35683_36135 146
1152 3300048927 Ga0496124_0003834 Ga0496124_0003834_10211_10651 146
1153 3300048927 Ga0496124_0006153 Ga0496124_0006153_9191_9631 146
1154 3300048927 Ga0496124_0010529 Ga0496124_0010529_6764_7204 146
1155 3300048927 Ga0496124_0026523 Ga0496124_0026523_618_1058 146
1156 3300048927 Ga0496124_0042811 Ga0496124_0042811_3397_3837 146
1157 3300048927 Ga0496124_0162760 Ga0496124_0162760_497_937 146
1158 3300048927 Ga0496124_0199412 Ga0496124_0199412_151_591 146
1159 3300048928 Ga0496125_0000722 Ga0496125_0000722_7256_7696 146
1160 3300048928 Ga0496125_0010929 Ga0496125_0010929_4315_4755 146
1161 3300048928 Ga0496125_0013105 Ga0496125_0013105_564_1004 146
1162 3300048928 Ga0496125_0013534 Ga0496125_0013534_5848_6288 146
1163 3300048928 Ga0496125_0015985 Ga0496125_0015985_2994_3434 146
1164 3300048928 Ga0496125_0018451 Ga0496125_0018451_2209_2649 146
1165 3300048928 Ga0496125_0030132 Ga0496125_0030132_1616_2056 146
1166 3300048928 Ga0496125_0033626 Ga0496125_0033626_1786_2226 146
1167 3300048929 Ga0496126_0003861 Ga0496126_0003861_7993_8433 146
1168 3300048929 Ga0496126_0019684 Ga0496126_0019684_3669_4109 146
1169 3300048929 Ga0496126_0281232 Ga0496126_0281232_483_923 146
1170 3300049571 Ga0501034_0002433 Ga0501034_0002433_15012_15452 146
1171 3300050491 nmdc:mga00v17_276525_c1 nmdc:mga00v17_276525_c1_325_765 146
1172 3300050491 nmdc:mga00v17_88_c1 nmdc:mga00v17_88_c1_26059_26502 146
1173 3300050491 nmdc:mga00v17_93329_c1 nmdc:mga00v17_93329_c1_728_1168 146
1174 3300053161 Ga0500634_0000301 Ga0500634_0000301_11362_11802 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

9

134

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k68-assembly1.cif.gz_B crystal structure of the phosphorylated cyanobacterial phytochrome response regulator rcpa 0.8644 3 144
1jlk-assembly1.cif.gz_B crystal structure of the mn(2+)-bound form of response regulator rcp1 0.8566 5 144
1k68-assembly1.cif.gz_B crystal structure of the phosphorylated cyanobacterial phytochrome response regulator rcpa 0.8531 3 144
1k66-assembly1.cif.gz_B crystal structure of the cyanobacterial phytochrome response regulator, rcpb 0.8509 3 145
1jlk-assembly1.cif.gz_B crystal structure of the mn(2+)-bound form of response regulator rcp1 0.8399 5 144
ID Description Score Start End Superfamily
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9035 3 94 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9013 5 94 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9002 3 94 3.40.50.2300
af_P08368_2_83_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8942 3 94 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.893 5 100 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2G4E2G8-F1-model_v4 Chemotaxis protein CheY 0.9621 3 108 GO:0000160
AF-J8V183-F1-model_v4 deleted 0.948 3 100
AF-A0A2G4E2G8-F1-model_v4 Chemotaxis protein CheY 0.9448 3 108 GO:0000160
AF-K9V6C3-F1-model_v4 Response regulator receiver protein 0.9103 2 144 GO:0000160
AF-A0A4Q3GW16-F1-model_v4 Response regulator 0.9093 5 137 GO:0000160

Feature Viewer

pLDDT pTM Quality
88.54 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map