F491182

General Info

Members Datasets Scaffolds Average Seq Length
1172 255 1171 333

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10132833|Ga0070692_101328332
Length 355
Sequence MRMNMHSFAFLCNRLHSAPLMIRTAILGASGYVGGELLRLLNAHPQLAAVRLFGESKAGQPLGAVHPHLAASYPDAVVEKFGDGALDGVDLIFAALPHGHSQRVAPAILDSGIPFVDLGADFRLDDAETYERWYGHAHQAPELLAAFVYGIPELNRERIRGAKAVAAAGCYATAAILALKPLVDAGMVDADGLIVDAASGVSGAGREAKEQTGFCTVTESFSAYGLLNHRHTAEMEMALGGTVLFTPHLAPMSRGILATCYGQAAGAGDPLEALRAAYANQPFVHVTDDPPATKWVAGSNGVQLTARRDERTGRILAISAIDNLGKGAAGQMIQCANLMLGFDEVAGLTSIGVTP

Samples

Sample ID Description Type Environment
1 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
189 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
190 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
191 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
244 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
245 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
248 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
249 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.09
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.09
Nodule 0
Rhizoplane 4.01
Rhizosphere 95.56
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000562 3300001904 Bacteria 6844
2 JGI24752J21851_1003533 3300001976 Bacteria 2059
3 JGI24740J21852_10014226 3300001979 Bacteria 2942
4 JGI24739J22299_10010928 3300001989 Bacteria 3356
5 JGI24739J22299_10011690 3300001989 Bacteria 3236
6 JGI24739J22299_10012866 3300001989 Bacteria 3065
7 JGI24737J22298_10000416 3300001990 Bacteria 14577
8 JGI24737J22298_10000516 3300001990 Bacteria 13557
9 JGI24738J21930_10000779 3300002075 Bacteria 9116
10 JGI24738J21930_10012364 3300002075 Bacteria 1865
11 JGI24744J21845_10000205 3300002077 Bacteria 9156
12 Ga0065712_10073460 3300005290 Bacteria 4371
13 Ga0065715_10094225 3300005293 Bacteria 4402
14 Ga0070658_10000220 3300005327 Bacteria 50700
15 Ga0070658_10003471 3300005327 Bacteria 12948
16 Ga0070658_10004728 3300005327 Bacteria 11071
17 Ga0070658_10042820 3300005327 Bacteria 3657
18 Ga0070658_10058090 3300005327 Bacteria 3148
19 Ga0070658_10147149 3300005327 Bacteria 1970
20 Ga0070658_10169393 3300005327 Bacteria 1834
21 Ga0070658_10212757 3300005327 Bacteria 1633
22 Ga0070658_10246709 3300005327 Bacteria 1514
23 Ga0070676_10012417 3300005328 Bacteria 4649
24 Ga0070676_10017607 3300005328 Bacteria 3954
25 Ga0070676_10018617 3300005328 Bacteria 3851
26 Ga0070676_10020704 3300005328 Bacteria 3676
27 Ga0070676_10050604 3300005328 Bacteria 2436
28 Ga0070676_10079726 3300005328 Bacteria 1983
29 Ga0070676_10255573 3300005328 Bacteria 1171
30 Ga0070683_100002165 3300005329 Bacteria 15542
31 Ga0070683_100002170 3300005329 Bacteria 15519
32 Ga0070683_100040805 3300005329 Bacteria 4267
33 Ga0070683_100058398 3300005329 Bacteria 3584
34 Ga0070683_100098027 3300005329 Bacteria 2758
35 Ga0070690_100012760 3300005330 Bacteria 4948
36 Ga0070670_100015333 3300005331 Bacteria 6582
37 Ga0070670_100028368 3300005331 Bacteria 4817
38 Ga0070670_100028510 3300005331 Bacteria 4805
39 Ga0070670_100029781 3300005331 Bacteria 4702
40 Ga0070670_100037665 3300005331 Bacteria 4160
41 Ga0070670_100041871 3300005331 Bacteria 3936
42 Ga0070670_100216240 3300005331 Bacteria 1667
43 Ga0070670_100226775 3300005331 Bacteria 1626
44 Ga0070670_100297622 3300005331 Bacteria 1411
45 Ga0070677_10000298 3300005333 Bacteria 17460
46 Ga0070677_10028236 3300005333 Bacteria 2118
47 Ga0068869_100065165 3300005334 Bacteria 2681
48 Ga0070666_10000522 3300005335 Bacteria 23280
49 Ga0070666_10000747 3300005335 Bacteria 19688
50 Ga0070666_10005747 3300005335 Bacteria 7619
51 Ga0070666_10011414 3300005335 Bacteria 5573
52 Ga0070666_10021810 3300005335 Bacteria 4152
53 Ga0070666_10026281 3300005335 Bacteria 3801
54 Ga0070666_10033705 3300005335 Bacteria 3390
55 Ga0070666_10090399 3300005335 Bacteria 2103
56 Ga0070680_100000414 3300005336 Bacteria 29107
57 Ga0070680_100003672 3300005336 Bacteria 11461
58 Ga0070680_100010477 3300005336 Bacteria 7148
59 Ga0070680_100058607 3300005336 Bacteria 3149
60 Ga0070680_100081990 3300005336 Bacteria 2661
61 Ga0070680_100347532 3300005336 Bacteria 1261
62 Ga0070682_100040301 3300005337 Bacteria 2873
63 Ga0068868_100001739 3300005338 Bacteria 14921
64 Ga0068868_100058325 3300005338 Bacteria 3051
65 Ga0068868_100059352 3300005338 Bacteria 3026
66 Ga0068868_100074493 3300005338 Bacteria 2711
67 Ga0068868_100198246 3300005338 Bacteria 1672
68 Ga0070660_100000627 3300005339 Bacteria 23539
69 Ga0070660_100009134 3300005339 Bacteria 6958
70 Ga0070660_100022269 3300005339 Bacteria 4683
71 Ga0070660_100026958 3300005339 Bacteria 4283
72 Ga0070660_100027246 3300005339 Bacteria 4263
73 Ga0070660_100032672 3300005339 Bacteria 3918
74 Ga0070660_100046622 3300005339 Bacteria 3322
75 Ga0070660_100057148 3300005339 Bacteria 3021
76 Ga0070660_100060009 3300005339 Bacteria 2951
77 Ga0070660_100108208 3300005339 Bacteria 2209
78 Ga0070660_100165614 3300005339 Bacteria 1783
79 Ga0070660_100236591 3300005339 Bacteria 1487
80 Ga0070660_100331388 3300005339 Bacteria 1251
81 Ga0070661_100000181 3300005344 Bacteria 52052
82 Ga0070661_100014880 3300005344 Bacteria 5489
83 Ga0070661_100025576 3300005344 Bacteria 4243
84 Ga0070661_100034023 3300005344 Bacteria 3695
85 Ga0070661_100036538 3300005344 Bacteria 3571
86 Ga0070661_100046361 3300005344 Bacteria 3180
87 Ga0070661_100050711 3300005344 Bacteria 3037
88 Ga0070661_100051636 3300005344 Bacteria 3009
89 Ga0070661_100103891 3300005344 Bacteria 2116
90 Ga0070661_100105046 3300005344 Bacteria 2105
91 Ga0070661_100114465 3300005344 Bacteria 2016
92 Ga0070661_100135859 3300005344 Bacteria 1850
93 Ga0070661_100299491 3300005344 Bacteria 1251
94 Ga0070692_10043649 3300005345 Bacteria 2307
95 Ga0070692_10132833 3300005345 Bacteria 1401
96 Ga0070668_100022403 3300005347 Bacteria 4775
97 Ga0070668_100046222 3300005347 Bacteria 3342
98 Ga0070668_100058142 3300005347 Bacteria 2991
99 Ga0070668_100119781 3300005347 Bacteria 2103
100 Ga0070669_100004811 3300005353 Bacteria 9745
101 Ga0070669_100028120 3300005353 Bacteria 4047
102 Ga0070675_100001645 3300005354 Bacteria 16513
103 Ga0070675_100003785 3300005354 Bacteria 11491
104 Ga0070675_100011464 3300005354 Bacteria 6940
105 Ga0070675_100018886 3300005354 Bacteria 5489
106 Ga0070675_100020121 3300005354 Bacteria 5325
107 Ga0070675_100049614 3300005354 Bacteria 3445
108 Ga0070671_100001210 3300005355 Bacteria 19318
109 Ga0070671_100002741 3300005355 Bacteria 13682
110 Ga0070671_100004740 3300005355 Bacteria 10804
111 Ga0070671_100005881 3300005355 Bacteria 9775
112 Ga0070671_100007951 3300005355 Bacteria 8482
113 Ga0070671_100008369 3300005355 Bacteria 8287
114 Ga0070671_100014448 3300005355 Bacteria 6380
115 Ga0070671_100014614 3300005355 Bacteria 6347
116 Ga0070671_100017298 3300005355 Bacteria 5838
117 Ga0070671_100020238 3300005355 Bacteria 5425
118 Ga0070671_100053546 3300005355 Bacteria 3355
119 Ga0070671_100094999 3300005355 Bacteria 2499
120 Ga0070674_100000834 3300005356 Bacteria 15941
121 Ga0070674_100011186 3300005356 Bacteria 5452
122 Ga0070674_100032370 3300005356 Bacteria 3472
123 Ga0070674_100081702 3300005356 Bacteria 2310
124 Ga0070674_100096405 3300005356 Bacteria 2146
125 Ga0070673_100000882 3300005364 Bacteria 16922
126 Ga0070673_100001392 3300005364 Bacteria 14139
127 Ga0070673_100002586 3300005364 Bacteria 11053
128 Ga0070673_100005382 3300005364 Bacteria 8182
129 Ga0070673_100039550 3300005364 Bacteria 3610
130 Ga0070673_100040796 3300005364 Bacteria 3563
131 Ga0070673_100064893 3300005364 Bacteria 2910
132 Ga0070673_100086819 3300005364 Bacteria 2550
133 Ga0070673_100113318 3300005364 Bacteria 2252
134 Ga0070673_100204708 3300005364 Bacteria 1701
135 Ga0070673_100390177 3300005364 Bacteria 1243
136 Ga0070659_100003560 3300005366 Bacteria 11090
137 Ga0070659_100027868 3300005366 Bacteria 4356
138 Ga0070659_100035208 3300005366 Bacteria 3898
139 Ga0070659_100037123 3300005366 Bacteria 3798
140 Ga0070659_100052490 3300005366 Bacteria 3207
141 Ga0070659_100076828 3300005366 Bacteria 2662
142 Ga0070659_100182217 3300005366 Bacteria 1724
143 Ga0070659_100279114 3300005366 Bacteria 1390
144 Ga0070667_100000890 3300005367 Bacteria 27625
145 Ga0070667_100005930 3300005367 Bacteria 10170
146 Ga0070667_100014866 3300005367 Bacteria 6430
147 Ga0070667_100019880 3300005367 Bacteria 5572
148 Ga0070667_100021796 3300005367 Bacteria 5317
149 Ga0070667_100026825 3300005367 Bacteria 4794
150 Ga0070667_100170553 3300005367 Bacteria 1921
151 Ga0070667_100231480 3300005367 Bacteria 1648
152 Ga0070709_10098453 3300005434 Bacteria 1943
153 Ga0070714_100019298 3300005435 Bacteria 5550
154 Ga0070714_100062414 3300005435 Bacteria 3203
155 Ga0070714_100128257 3300005435 Bacteria 2264
156 Ga0070713_100130507 3300005436 Bacteria 2215
157 Ga0070713_100433081 3300005436 Bacteria 1232
158 Ga0070694_100014810 3300005444 Bacteria 4885
159 Ga0070663_100002581 3300005455 Bacteria 10226
160 Ga0070663_100057847 3300005455 Bacteria 2783
161 Ga0070663_100063111 3300005455 Bacteria 2674
162 Ga0070663_100098704 3300005455 Bacteria 2176
163 Ga0070663_100165277 3300005455 Bacteria 1706
164 Ga0070663_100298642 3300005455 Bacteria 1288
165 Ga0070678_100002614 3300005456 Bacteria 9905
166 Ga0070678_100003037 3300005456 Bacteria 9300
167 Ga0070678_100019171 3300005456 Bacteria 4453
168 Ga0070678_100023968 3300005456 Bacteria 4076
169 Ga0070678_100035376 3300005456 Bacteria 3486
170 Ga0070678_100050850 3300005456 Bacteria 3000
171 Ga0070678_100050905 3300005456 Bacteria 2999
172 Ga0070678_100180599 3300005456 Bacteria 1727
173 Ga0070662_100000080 3300005457 Bacteria 53280
174 Ga0070662_100000256 3300005457 Bacteria 31436
175 Ga0070662_100008293 3300005457 Bacteria 6768
176 Ga0070662_100013344 3300005457 Bacteria 5466
177 Ga0070662_100019462 3300005457 Bacteria 4608
178 Ga0070662_100020341 3300005457 Bacteria 4519
179 Ga0070662_100057108 3300005457 Bacteria 2835
180 Ga0070662_100067601 3300005457 Bacteria 2624
181 Ga0070662_100074182 3300005457 Bacteria 2516
182 Ga0070662_100078397 3300005457 Bacteria 2454
183 Ga0070681_10036381 3300005458 Bacteria 4943
184 Ga0070681_10229538 3300005458 Bacteria 1770
185 Ga0068867_100018557 3300005459 Bacteria 4944
186 Ga0068867_100040809 3300005459 Bacteria 3390
187 Ga0070679_100017863 3300005530 Bacteria 6870
188 Ga0070679_100140170 3300005530 Bacteria 2398
189 Ga0070679_100238166 3300005530 Unclassified 1778
190 Ga0070684_100006623 3300005535 Bacteria 8973
191 Ga0070684_100038517 3300005535 Bacteria 4107
192 Ga0070684_100088835 3300005535 Bacteria 2746
193 Ga0070684_100176248 3300005535 Bacteria 1943
194 Ga0068853_100000134 3300005539 Bacteria 50184
195 Ga0068853_100001369 3300005539 Bacteria 17582
196 Ga0068853_100114982 3300005539 Bacteria 2394
197 Ga0068853_100192355 3300005539 Bacteria 1854
198 Ga0068853_100242470 3300005539 Bacteria 1652
199 Ga0068853_100266121 3300005539 Bacteria 1577
200 Ga0070672_100000917 3300005543 Bacteria 17678
201 Ga0070672_100001894 3300005543 Bacteria 13105
202 Ga0070672_100007544 3300005543 Bacteria 7390
203 Ga0070672_100013224 3300005543 Bacteria 5821
204 Ga0070672_100030501 3300005543 Bacteria 4051
205 Ga0070672_100048768 3300005543 Bacteria 3292
206 Ga0070672_100057442 3300005543 Bacteria 3054
207 Ga0070672_100101392 3300005543 Bacteria 2335
208 Ga0070686_100294047 3300005544 Bacteria 1202
209 Ga0070696_100007696 3300005546 Bacteria 7196
210 Ga0070696_100114955 3300005546 Bacteria 1941
211 Ga0070693_100005630 3300005547 Bacteria 6041
212 Ga0070693_100060746 3300005547 Bacteria 2195
213 Ga0070693_100137796 3300005547 Bacteria 1532
214 Ga0070693_100165820 3300005547 Bacteria 1411
215 Ga0070665_100000263 3300005548 Bacteria 86603
216 Ga0070665_100006205 3300005548 Bacteria 12230
217 Ga0070665_100020880 3300005548 Bacteria 6582
218 Ga0070665_100048519 3300005548 Bacteria 4262
219 Ga0070665_100062976 3300005548 Bacteria 3719
220 Ga0070665_100114210 3300005548 Bacteria 2703
221 Ga0070665_100314445 3300005548 Bacteria 1570
222 Ga0068855_100001243 3300005563 Bacteria 31626
223 Ga0068855_100002468 3300005563 Bacteria 22828
224 Ga0068855_100044405 3300005563 Bacteria 5259
225 Ga0068855_100044650 3300005563 Bacteria 5244
226 Ga0068855_100046631 3300005563 Bacteria 5122
227 Ga0068855_100055407 3300005563 Bacteria 4657
228 Ga0068855_100167784 3300005563 Bacteria 2487
229 Ga0068855_100176298 3300005563 Bacteria 2419
230 Ga0068855_100319315 3300005563 Bacteria 1717
231 Ga0068855_100425933 3300005563 Bacteria 1451
232 Ga0070664_100000047 3300005564 Bacteria 73560
233 Ga0070664_100008560 3300005564 Bacteria 8276
234 Ga0070664_100010639 3300005564 Bacteria 7454
235 Ga0070664_100014090 3300005564 Bacteria 6521
236 Ga0070664_100027717 3300005564 Bacteria 4708
237 Ga0070664_100044539 3300005564 Bacteria 3747
238 Ga0070664_100060199 3300005564 Bacteria 3233
239 Ga0068857_100003128 3300005577 Bacteria 13693
240 Ga0068857_100013069 3300005577 Bacteria 7233
241 Ga0068857_100020336 3300005577 Bacteria 5837
242 Ga0068857_100030339 3300005577 Bacteria 4774
243 Ga0068857_100181159 3300005577 Bacteria 1917
244 Ga0068854_100006180 3300005578 Bacteria 7603
245 Ga0068854_100034284 3300005578 Bacteria 3545
246 Ga0068854_100056884 3300005578 Bacteria 2820
247 Ga0068854_100164848 3300005578 Bacteria 1719
248 Ga0068854_100169159 3300005578 Bacteria 1699
249 Ga0068856_100001328 3300005614 Bacteria 26042
250 Ga0068856_100030993 3300005614 Bacteria 5231
251 Ga0068856_100157351 3300005614 Bacteria 2282
252 Ga0068856_100179749 3300005614 Bacteria 2128
253 Ga0068856_100333557 3300005614 Bacteria 1534
254 Ga0068856_100423610 3300005614 Bacteria 1351
255 Ga0068852_100005476 3300005616 Bacteria 9086
256 Ga0068852_100006103 3300005616 Bacteria 8685
257 Ga0068852_100010004 3300005616 Bacteria 7058
258 Ga0068852_100016684 3300005616 Bacteria 5737
259 Ga0068852_100017227 3300005616 Bacteria 5664
260 Ga0068852_100020061 3300005616 Bacteria 5308
261 Ga0068852_100152188 3300005616 Bacteria 2152
262 Ga0068852_100275081 3300005616 Bacteria 1621
263 Ga0068859_100000965 3300005617 Bacteria 29425
264 Ga0068859_100006426 3300005617 Bacteria 11926
265 Ga0068859_100014644 3300005617 Bacteria 7880
266 Ga0068859_100052440 3300005617 Bacteria 4101
267 Ga0068859_100069448 3300005617 Bacteria 3558
268 Ga0068859_100134369 3300005617 Bacteria 2545
269 Ga0068859_100205672 3300005617 Bacteria 2054
270 Ga0068859_100248661 3300005617 Bacteria 1868
271 Ga0068864_100005190 3300005618 Bacteria 10669
272 Ga0068864_100013836 3300005618 Bacteria 6686
273 Ga0068864_100016487 3300005618 Bacteria 6150
274 Ga0068864_100018079 3300005618 Bacteria 5884
275 Ga0068864_100021439 3300005618 Bacteria 5414
276 Ga0068864_100028043 3300005618 Bacteria 4758
277 Ga0068864_100096727 3300005618 Bacteria 2613
278 Ga0068864_100193285 3300005618 Bacteria 1866
279 Ga0068864_100389866 3300005618 Bacteria 1322
280 Ga0068866_10146315 3300005718 Bacteria 1363
281 Ga0068861_100003405 3300005719 Bacteria 10551
282 Ga0068851_10013545 3300005834 Bacteria 3858
283 Ga0068851_10034986 3300005834 Bacteria 2509
284 Ga0068851_10036290 3300005834 Bacteria 2468
285 Ga0068870_10054760 3300005840 Bacteria 2123
286 Ga0068863_100003063 3300005841 Bacteria 16526
287 Ga0068863_100009309 3300005841 Bacteria 9584
288 Ga0068863_100017895 3300005841 Bacteria 6781
289 Ga0068863_100018870 3300005841 Bacteria 6600
290 Ga0068863_100027343 3300005841 Bacteria 5440
291 Ga0068863_100035480 3300005841 Bacteria 4750
292 Ga0068863_100065720 3300005841 Bacteria 3431
293 Ga0068863_100095042 3300005841 Bacteria 2829
294 Ga0068863_100121267 3300005841 Bacteria 2493
295 Ga0068863_100148569 3300005841 Bacteria 2242
296 Ga0068858_100002589 3300005842 Bacteria 18214
297 Ga0068858_100004176 3300005842 Bacteria 14215
298 Ga0068858_100006611 3300005842 Bacteria 11281
299 Ga0068858_100023020 3300005842 Bacteria 5810
300 Ga0068858_100023321 3300005842 Bacteria 5766
301 Ga0068858_100098083 3300005842 Bacteria 2732
302 Ga0068858_100181176 3300005842 Bacteria 1989
303 Ga0068860_100006380 3300005843 Bacteria 11838
304 Ga0068860_100006884 3300005843 Bacteria 11399
305 Ga0068860_100009482 3300005843 Bacteria 9667
306 Ga0068860_100034446 3300005843 Bacteria 4857
307 Ga0068860_100092874 3300005843 Bacteria 2876
308 Ga0068860_100205417 3300005843 Bacteria 1910
309 Ga0068860_100301044 3300005843 Bacteria 1571
310 Ga0068860_100468381 3300005843 Bacteria 1254
311 Ga0068862_100021749 3300005844 Bacteria 5364
312 Ga0068862_100023629 3300005844 Bacteria 5152
313 Ga0068862_100023676 3300005844 Bacteria 5147
314 Ga0068862_100073059 3300005844 Bacteria 2964
315 Ga0068862_100196152 3300005844 Bacteria 1819
316 Ga0068862_100262033 3300005844 Bacteria 1578
317 Ga0068862_100310703 3300005844 Bacteria 1453
318 Ga0068862_100375446 3300005844 Bacteria 1325
319 Ga0081539_10010379 3300005985 Bacteria 7574
320 Ga0081539_10029738 3300005985 Bacteria 3406
321 Ga0070717_10000436 3300006028 Bacteria 26575
322 Ga0097621_100005316 3300006237 Bacteria 9069
323 Ga0097621_100051644 3300006237 Bacteria 3346
324 Ga0097621_100333469 3300006237 Bacteria 1346
325 Ga0068871_100002294 3300006358 Bacteria 13025
326 Ga0068871_100018114 3300006358 Bacteria 5346
327 Ga0068871_100036659 3300006358 Bacteria 3906
328 Ga0075433_10044276 3300006852 Bacteria 3866
329 Ga0075433_10349387 3300006852 Bacteria 1307
330 Ga0068865_100031905 3300006881 Bacteria 3515
331 Ga0068865_100172129 3300006881 Bacteria 1661
332 Ga0097620_100000965 3300006931 Bacteria 29425
333 Ga0097620_100006426 3300006931 Bacteria 11926
334 Ga0097620_100014644 3300006931 Bacteria 7880
335 Ga0097620_100052441 3300006931 Bacteria 4101
336 Ga0097620_100069448 3300006931 Bacteria 3558
337 Ga0097620_100134375 3300006931 Bacteria 2545
338 Ga0097620_100205679 3300006931 Bacteria 2054
339 Ga0097620_100248649 3300006931 Bacteria 1868
340 Ga0105250_10022388 3300009092 Bacteria 2549
341 Ga0105240_10043075 3300009093 Bacteria 5747
342 Ga0105240_10354610 3300009093 Bacteria 1663
343 Ga0105240_10609276 3300009093 Bacteria 1201
344 Ga0111539_10044238 3300009094 Bacteria 5335
345 Ga0105245_10021990 3300009098 Bacteria 5596
346 Ga0105245_10104787 3300009098 Bacteria 2622
347 Ga0105243_10126651 3300009148 Bacteria 2162
348 Ga0105241_10080229 3300009174 Bacteria 2553
349 Ga0105242_10049903 3300009176 Bacteria 3406
350 Ga0105248_10000276 3300009177 Bacteria 60451
351 Ga0105248_10000747 3300009177 Bacteria 36526
352 Ga0105248_10018946 3300009177 Bacteria 7610
353 Ga0105248_10021773 3300009177 Bacteria 7103
354 Ga0105248_10028459 3300009177 Bacteria 6225
355 Ga0105248_10030243 3300009177 Bacteria 6046
356 Ga0105248_10041093 3300009177 Bacteria 5184
357 Ga0105248_10045901 3300009177 Bacteria 4898
358 Ga0105248_10048508 3300009177 Bacteria 4764
359 Ga0105248_10098659 3300009177 Bacteria 3291
360 Ga0105248_10260229 3300009177 Bacteria 1953
361 Ga0105248_10283211 3300009177 Bacteria 1866
362 Ga0105248_10412395 3300009177 Bacteria 1521
363 Ga0105248_10530075 3300009177 Bacteria 1328
364 Ga0105248_10546571 3300009177 Unclassified 1306
365 Ga0105237_10079171 3300009545 Bacteria 3276
366 Ga0105238_10056632 3300009551 Bacteria 3932
367 Ga0105238_10128213 3300009551 Bacteria 2515
368 Ga0105238_10283466 3300009551 Bacteria 1638
369 Ga0105238_10428970 3300009551 Bacteria 1317
370 Ga0105249_10031412 3300009553 Bacteria 4803
371 Ga0105246_10072834 3300011119 Bacteria 2423
372 Ga0157373_10014941 3300013100 Bacteria 5683
373 Ga0157373_10066087 3300013100 Bacteria 2559
374 Ga0157373_10097674 3300013100 Bacteria 2067
375 Ga0157373_10219144 3300013100 Bacteria 1342
376 Ga0157371_10001460 3300013102 Bacteria 24505
377 Ga0157371_10004455 3300013102 Bacteria 12212
378 Ga0157371_10007858 3300013102 Bacteria 8562
379 Ga0157371_10007932 3300013102 Bacteria 8518
380 Ga0157371_10018108 3300013102 Bacteria 5215
381 Ga0157371_10025834 3300013102 Bacteria 4275
382 Ga0157371_10037920 3300013102 Bacteria 3449
383 Ga0157371_10048878 3300013102 Bacteria 3006
384 Ga0157370_10000534 3300013104 Bacteria 47653
385 Ga0157370_10088918 3300013104 Bacteria 2901
386 Ga0157370_10100465 3300013104 Bacteria 2710
387 Ga0157370_10120017 3300013104 Bacteria 2455
388 Ga0157370_10268096 3300013104 Bacteria 1578
389 Ga0157369_10005054 3300013105 Bacteria 15446
390 Ga0157369_10008575 3300013105 Bacteria 11724
391 Ga0157369_10048390 3300013105 Bacteria 4614
392 Ga0157369_10060439 3300013105 Bacteria 4086
393 Ga0157369_10500970 3300013105 Bacteria 1256
394 Ga0157374_10107974 3300013296 Bacteria 2675
395 Ga0157374_10118854 3300013296 Bacteria 2549
396 Ga0157374_10166140 3300013296 Bacteria 2150
397 Ga0157378_10161711 3300013297 Bacteria 2094
398 Ga0157378_10400455 3300013297 Bacteria 1352
399 Ga0163162_10015055 3300013306 Bacteria 7556
400 Ga0163162_10018552 3300013306 Bacteria 6818
401 Ga0163162_10062560 3300013306 Bacteria 3762
402 Ga0163162_10420905 3300013306 Bacteria 1468
403 Ga0157372_10010120 3300013307 Bacteria 10018
404 Ga0157372_10126532 3300013307 Bacteria 2938
405 Ga0157372_10337075 3300013307 Bacteria 1757
406 Ga0157372_10526816 3300013307 Bacteria 1377
407 Ga0157375_10015725 3300013308 Bacteria 6780
408 Ga0157375_10025913 3300013308 Bacteria 5456
409 Ga0157375_10046650 3300013308 Bacteria 4227
410 Ga0157375_10132837 3300013308 Bacteria 2610
411 Ga0157375_10174664 3300013308 Bacteria 2297
412 Ga0163163_10001248 3300014325 Bacteria 21440
413 Ga0163163_10012850 3300014325 Bacteria 7641
414 Ga0163163_10046317 3300014325 Bacteria 4272
415 Ga0163163_10071796 3300014325 Bacteria 3450
416 Ga0163163_10208332 3300014325 Bacteria 2004
417 Ga0163163_10382194 3300014325 Bacteria 1466
418 Ga0163163_10390267 3300014325 Bacteria 1450
419 Ga0157380_10001273 3300014326 Bacteria 16384
420 Ga0157380_10003250 3300014326 Bacteria 11126
421 Ga0157380_10209880 3300014326 Bacteria 1734
422 Ga0157380_10371281 3300014326 Bacteria 1346
423 Ga0157377_10204573 3300014745 Bacteria 1255
424 Ga0157379_10006683 3300014968 Bacteria 9959
425 Ga0157379_10008994 3300014968 Bacteria 8706
426 Ga0157379_10042102 3300014968 Bacteria 4076
427 Ga0157379_10103939 3300014968 Bacteria 2549
428 Ga0163161_10005360 3300017792 Bacteria 8915
429 Ga0163161_10034882 3300017792 Bacteria 3599
430 Ga0163161_10321670 3300017792 Bacteria 1223
431 Ga0206353_10715458 3300020082 Bacteria 3679
432 Ga0213876_10120364 3300021384 Bacteria 1393
433 Ga0207673_1012131 3300025290 Bacteria 1121
434 Ga0207697_10000510 3300025315 Bacteria 21916
435 Ga0207697_10001956 3300025315 Bacteria 10946
436 Ga0207697_10023189 3300025315 Bacteria 2541
437 Ga0207656_10028212 3300025321 Bacteria 2302
438 Ga0207656_10035674 3300025321 Bacteria 2084
439 Ga0207682_10005796 3300025893 Bacteria 5009
440 Ga0207642_10126855 3300025899 Bacteria 1325
441 Ga0207688_10006175 3300025901 Bacteria 6517
442 Ga0207688_10013605 3300025901 Bacteria 4423
443 Ga0207688_10017535 3300025901 Bacteria 3892
444 Ga0207688_10038819 3300025901 Bacteria 2644
445 Ga0207688_10133399 3300025901 Bacteria 1457
446 Ga0207680_10005049 3300025903 Bacteria 6287
447 Ga0207680_10021002 3300025903 Bacteria 3526
448 Ga0207680_10044740 3300025903 Bacteria 2606
449 Ga0207680_10127257 3300025903 Bacteria 1674
450 Ga0207647_10004345 3300025904 Bacteria 10509
451 Ga0207647_10004501 3300025904 Bacteria 10325
452 Ga0207647_10008836 3300025904 Bacteria 7190
453 Ga0207647_10029990 3300025904 Bacteria 3513
454 Ga0207647_10040243 3300025904 Bacteria 2945
455 Ga0207647_10061207 3300025904 Bacteria 2298
456 Ga0207647_10077032 3300025904 Bacteria 2005
457 Ga0207645_10010661 3300025907 Bacteria 6306
458 Ga0207645_10021295 3300025907 Bacteria 4229
459 Ga0207645_10026094 3300025907 Bacteria 3777
460 Ga0207645_10129099 3300025907 Bacteria 1645
461 Ga0207645_10250267 3300025907 Bacteria 1172
462 Ga0207643_10016508 3300025908 Bacteria 4028
463 Ga0207643_10062341 3300025908 Bacteria 2131
464 Ga0207643_10185857 3300025908 Bacteria 1259
465 Ga0207705_10000091 3300025909 Bacteria 110768
466 Ga0207705_10000101 3300025909 Bacteria 98231
467 Ga0207705_10000164 3300025909 Bacteria 71606
468 Ga0207705_10000997 3300025909 Bacteria 23105
469 Ga0207705_10003327 3300025909 Bacteria 12220
470 Ga0207705_10004509 3300025909 Bacteria 10525
471 Ga0207705_10008140 3300025909 Bacteria 7677
472 Ga0207705_10015423 3300025909 Bacteria 5483
473 Ga0207705_10019104 3300025909 Bacteria 4901
474 Ga0207705_10020148 3300025909 Bacteria 4771
475 Ga0207705_10046209 3300025909 Bacteria 3128
476 Ga0207705_10066304 3300025909 Bacteria 2611
477 Ga0207705_10066548 3300025909 Bacteria 2606
478 Ga0207705_10070853 3300025909 Bacteria 2527
479 Ga0207705_10099384 3300025909 Bacteria 2139
480 Ga0207705_10131203 3300025909 Bacteria 1865
481 Ga0207705_10149971 3300025909 Bacteria 1747
482 Ga0207705_10229851 3300025909 Bacteria 1411
483 Ga0207705_10252438 3300025909 Bacteria 1345
484 Ga0207695_10002104 3300025913 Bacteria 30252
485 Ga0207695_10333287 3300025913 Unclassified 1406
486 Ga0207671_10243102 3300025914 Bacteria 1414
487 Ga0207693_10008871 3300025915 Bacteria 8213
488 Ga0207660_10003728 3300025917 Bacteria 9931
489 Ga0207657_10000090 3300025919 Bacteria 86852
490 Ga0207657_10000742 3300025919 Bacteria 34615
491 Ga0207657_10001215 3300025919 Bacteria 27430
492 Ga0207657_10001561 3300025919 Bacteria 24588
493 Ga0207657_10002240 3300025919 Bacteria 20961
494 Ga0207657_10002718 3300025919 Bacteria 19043
495 Ga0207657_10004234 3300025919 Bacteria 15204
496 Ga0207657_10006559 3300025919 Bacteria 12050
497 Ga0207657_10008545 3300025919 Bacteria 10381
498 Ga0207657_10015066 3300025919 Bacteria 7510
499 Ga0207657_10050867 3300025919 Bacteria 3603
500 Ga0207657_10054212 3300025919 Bacteria 3468
501 Ga0207657_10062140 3300025919 Bacteria 3199
502 Ga0207657_10063327 3300025919 Bacteria 3162
503 Ga0207657_10067666 3300025919 Bacteria 3036
504 Ga0207657_10083366 3300025919 Bacteria 2682
505 Ga0207657_10103194 3300025919 Bacteria 2364
506 Ga0207649_10000563 3300025920 Bacteria 25553
507 Ga0207649_10000720 3300025920 Bacteria 21786
508 Ga0207649_10013079 3300025920 Bacteria 4628
509 Ga0207649_10014400 3300025920 Bacteria 4427
510 Ga0207649_10021846 3300025920 Bacteria 3692
511 Ga0207649_10038244 3300025920 Bacteria 2904
512 Ga0207649_10050017 3300025920 Bacteria 2584
513 Ga0207649_10117206 3300025920 Bacteria 1790
514 Ga0207649_10144063 3300025920 Bacteria 1634
515 Ga0207649_10178072 3300025920 Bacteria 1486
516 Ga0207649_10202204 3300025920 Bacteria 1404
517 Ga0207649_10287010 3300025920 Bacteria 1198
518 Ga0207652_10013204 3300025921 Bacteria 6688
519 Ga0207652_10335326 3300025921 Unclassified 1365
520 Ga0207681_10001451 3300025923 Bacteria 15255
521 Ga0207681_10019932 3300025923 Bacteria 4247
522 Ga0207681_10041905 3300025923 Bacteria 3055
523 Ga0207681_10045621 3300025923 Bacteria 2944
524 Ga0207681_10107498 3300025923 Bacteria 2023
525 Ga0207681_10116716 3300025923 Bacteria 1951
526 Ga0207681_10133720 3300025923 Bacteria 1837
527 Ga0207694_10013383 3300025924 Bacteria 6179
528 Ga0207694_10083294 3300025924 Bacteria 2515
529 Ga0207694_10119444 3300025924 Bacteria 2104
530 Ga0207694_10209878 3300025924 Bacteria 1586
531 Ga0207694_10340750 3300025924 Bacteria 1240
532 Ga0207650_10003083 3300025925 Bacteria 11479
533 Ga0207650_10011727 3300025925 Bacteria 6042
534 Ga0207650_10014173 3300025925 Bacteria 5537
535 Ga0207650_10020694 3300025925 Bacteria 4643
536 Ga0207650_10030095 3300025925 Bacteria 3908
537 Ga0207650_10039703 3300025925 Bacteria 3440
538 Ga0207650_10078272 3300025925 Bacteria 2501
539 Ga0207650_10080682 3300025925 Bacteria 2467
540 Ga0207650_10110688 3300025925 Bacteria 2125
541 Ga0207650_10121161 3300025925 Bacteria 2037
542 Ga0207650_10221770 3300025925 Bacteria 1522
543 Ga0207650_10313204 3300025925 Bacteria 1284
544 Ga0207650_10417651 3300025925 Bacteria 1112
545 Ga0207659_10003513 3300025926 Bacteria 9420
546 Ga0207659_10009722 3300025926 Bacteria 6015
547 Ga0207659_10146801 3300025926 Bacteria 1837
548 Ga0207687_10230506 3300025927 Bacteria 1463
549 Ga0207700_10075882 3300025928 Bacteria 2606
550 Ga0207700_10079372 3300025928 Bacteria 2556
551 Ga0207664_10128022 3300025929 Bacteria 2134
552 Ga0207664_10130510 3300025929 Bacteria 2115
553 Ga0207664_10161029 3300025929 Bacteria 1914
554 Ga0207664_10193050 3300025929 Bacteria 1754
555 Ga0207644_10000337 3300025931 Bacteria 30381
556 Ga0207644_10001551 3300025931 Bacteria 14827
557 Ga0207644_10003876 3300025931 Bacteria 9697
558 Ga0207644_10004611 3300025931 Bacteria 8965
559 Ga0207644_10005737 3300025931 Bacteria 8078
560 Ga0207644_10009601 3300025931 Bacteria 6354
561 Ga0207644_10015884 3300025931 Bacteria 5062
562 Ga0207644_10028693 3300025931 Bacteria 3855
563 Ga0207644_10112050 3300025931 Bacteria 2064
564 Ga0207644_10142135 3300025931 Bacteria 1849
565 Ga0207644_10275164 3300025931 Bacteria 1350
566 Ga0207690_10000184 3300025932 Bacteria 48035
567 Ga0207690_10002872 3300025932 Bacteria 10374
568 Ga0207690_10024467 3300025932 Bacteria 3783
569 Ga0207690_10042858 3300025932 Bacteria 2975
570 Ga0207690_10053154 3300025932 Bacteria 2716
571 Ga0207690_10060529 3300025932 Bacteria 2570
572 Ga0207690_10083515 3300025932 Bacteria 2236
573 Ga0207690_10085658 3300025932 Bacteria 2212
574 Ga0207690_10093585 3300025932 Bacteria 2130
575 Ga0207690_10232132 3300025932 Bacteria 1417
576 Ga0207706_10000110 3300025933 Bacteria 87522
577 Ga0207706_10000890 3300025933 Bacteria 30672
578 Ga0207706_10006778 3300025933 Bacteria 10592
579 Ga0207706_10008041 3300025933 Bacteria 9734
580 Ga0207706_10029723 3300025933 Bacteria 4877
581 Ga0207706_10035908 3300025933 Bacteria 4404
582 Ga0207706_10050476 3300025933 Bacteria 3676
583 Ga0207706_10054361 3300025933 Bacteria 3534
584 Ga0207706_10056856 3300025933 Bacteria 3448
585 Ga0207706_10088117 3300025933 Bacteria 2729
586 Ga0207706_10149374 3300025933 Bacteria 2055
587 Ga0207706_10304357 3300025933 Bacteria 1389
588 Ga0207669_10000764 3300025937 Bacteria 13811
589 Ga0207669_10072553 3300025937 Bacteria 2168
590 Ga0207669_10094293 3300025937 Bacteria 1958
591 Ga0207704_10178120 3300025938 Bacteria 1533
592 Ga0207704_10225830 3300025938 Bacteria 1389
593 Ga0207691_10000364 3300025940 Bacteria 45561
594 Ga0207691_10002549 3300025940 Bacteria 17802
595 Ga0207691_10029927 3300025940 Bacteria 5092
596 Ga0207691_10030480 3300025940 Bacteria 5040
597 Ga0207691_10044326 3300025940 Bacteria 4095
598 Ga0207691_10060482 3300025940 Bacteria 3442
599 Ga0207691_10064337 3300025940 Bacteria 3323
600 Ga0207691_10088060 3300025940 Bacteria 2785
601 Ga0207691_10172779 3300025940 Bacteria 1892
602 Ga0207711_10001952 3300025941 Bacteria 18719
603 Ga0207711_10004112 3300025941 Bacteria 12473
604 Ga0207711_10009801 3300025941 Bacteria 7968
605 Ga0207711_10013563 3300025941 Bacteria 6767
606 Ga0207711_10018793 3300025941 Bacteria 5746
607 Ga0207711_10033325 3300025941 Bacteria 4358
608 Ga0207711_10034408 3300025941 Bacteria 4291
609 Ga0207711_10128464 3300025941 Bacteria 2269
610 Ga0207711_10444982 3300025941 Bacteria 1206
611 Ga0207689_10000984 3300025942 Bacteria 27302
612 Ga0207689_10059348 3300025942 Bacteria 3146
613 Ga0207689_10123694 3300025942 Bacteria 2128
614 Ga0207661_10000179 3300025944 Bacteria 40861
615 Ga0207661_10001586 3300025944 Bacteria 15478
616 Ga0207661_10211581 3300025944 Bacteria 1709
617 Ga0207679_10000329 3300025945 Bacteria 35247
618 Ga0207679_10012900 3300025945 Bacteria 5466
619 Ga0207679_10026910 3300025945 Bacteria 3971
620 Ga0207679_10030123 3300025945 Bacteria 3786
621 Ga0207679_10043129 3300025945 Bacteria 3246
622 Ga0207679_10052433 3300025945 Bacteria 2992
623 Ga0207679_10054510 3300025945 Bacteria 2944
624 Ga0207679_10136555 3300025945 Bacteria 1975
625 Ga0207679_10139420 3300025945 Bacteria 1958
626 Ga0207679_10145362 3300025945 Bacteria 1922
627 Ga0207679_10158316 3300025945 Bacteria 1851
628 Ga0207679_10245440 3300025945 Bacteria 1519
629 Ga0207667_10000122 3300025949 Bacteria 121588
630 Ga0207667_10002214 3300025949 Bacteria 24404
631 Ga0207667_10024808 3300025949 Bacteria 6575
632 Ga0207667_10043094 3300025949 Bacteria 4790
633 Ga0207667_10181138 3300025949 Bacteria 2164
634 Ga0207667_10244301 3300025949 Bacteria 1837
635 Ga0207667_10294652 3300025949 Bacteria 1657
636 Ga0207667_10462666 3300025949 Bacteria 1288
637 Ga0207651_10000808 3300025960 Bacteria 13486
638 Ga0207651_10001158 3300025960 Bacteria 11783
639 Ga0207651_10003210 3300025960 Bacteria 7993
640 Ga0207651_10008937 3300025960 Bacteria 5442
641 Ga0207651_10009792 3300025960 Bacteria 5271
642 Ga0207651_10010367 3300025960 Bacteria 5162
643 Ga0207651_10031745 3300025960 Bacteria 3381
644 Ga0207651_10038159 3300025960 Bacteria 3154
645 Ga0207651_10088564 3300025960 Bacteria 2257
646 Ga0207651_10110219 3300025960 Bacteria 2064
647 Ga0207651_10119596 3300025960 Bacteria 1995
648 Ga0207651_10340852 3300025960 Bacteria 1259
649 Ga0207651_10353133 3300025960 Bacteria 1239
650 Ga0207712_10004041 3300025961 Bacteria 9266
651 Ga0207712_10007327 3300025961 Bacteria 6964
652 Ga0207668_10000725 3300025972 Bacteria 20192
653 Ga0207668_10019430 3300025972 Bacteria 4296
654 Ga0207668_10104724 3300025972 Bacteria 2110
655 Ga0207668_10108454 3300025972 Bacteria 2078
656 Ga0207668_10228659 3300025972 Bacteria 1498
657 Ga0207640_10001958 3300025981 Bacteria 11089
658 Ga0207640_10025485 3300025981 Bacteria 3581
659 Ga0207640_10032063 3300025981 Bacteria 3255
660 Ga0207640_10047829 3300025981 Bacteria 2762
661 Ga0207640_10093359 3300025981 Bacteria 2090
662 Ga0207640_10168221 3300025981 Bacteria 1630
663 Ga0207640_10247111 3300025981 Bacteria 1382
664 Ga0207658_10012935 3300025986 Bacteria 5700
665 Ga0207658_10014720 3300025986 Bacteria 5360
666 Ga0207658_10016848 3300025986 Bacteria 5028
667 Ga0207658_10027251 3300025986 Bacteria 4012
668 Ga0207658_10032330 3300025986 Bacteria 3723
669 Ga0207658_10083149 3300025986 Bacteria 2460
670 Ga0207658_10112305 3300025986 Bacteria 2156
671 Ga0207658_10333505 3300025986 Bacteria 1316
672 Ga0207677_10003208 3300026023 Bacteria 8624
673 Ga0207677_10022265 3300026023 Bacteria 3892
674 Ga0207677_10088280 3300026023 Bacteria 2247
675 Ga0207677_10207589 3300026023 Bacteria 1562
676 Ga0207703_10002189 3300026035 Bacteria 17150
677 Ga0207703_10003519 3300026035 Bacteria 13097
678 Ga0207703_10008490 3300026035 Bacteria 8116
679 Ga0207703_10016593 3300026035 Bacteria 5743
680 Ga0207703_10155284 3300026035 Bacteria 1999
681 Ga0207703_10285581 3300026035 Bacteria 1500
682 Ga0207639_10002619 3300026041 Bacteria 12072
683 Ga0207639_10026546 3300026041 Bacteria 4209
684 Ga0207639_10078074 3300026041 Bacteria 2612
685 Ga0207639_10294809 3300026041 Bacteria 1431
686 Ga0207639_10353163 3300026041 Bacteria 1313
687 Ga0207678_10004239 3300026067 Bacteria 12862
688 Ga0207678_10004845 3300026067 Bacteria 12088
689 Ga0207678_10005822 3300026067 Bacteria 10987
690 Ga0207678_10007192 3300026067 Bacteria 9868
691 Ga0207678_10009417 3300026067 Bacteria 8593
692 Ga0207678_10019092 3300026067 Bacteria 6018
693 Ga0207678_10020047 3300026067 Bacteria 5874
694 Ga0207678_10037023 3300026067 Bacteria 4247
695 Ga0207678_10053677 3300026067 Bacteria 3473
696 Ga0207678_10062229 3300026067 Bacteria 3209
697 Ga0207678_10064588 3300026067 Bacteria 3145
698 Ga0207678_10073432 3300026067 Bacteria 2931
699 Ga0207678_10074238 3300026067 Bacteria 2914
700 Ga0207678_10093858 3300026067 Bacteria 2563
701 Ga0207678_10420112 3300026067 Bacteria 1159
702 Ga0207702_10000391 3300026078 Bacteria 49957
703 Ga0207702_10004582 3300026078 Bacteria 12253
704 Ga0207702_10006769 3300026078 Bacteria 9831
705 Ga0207702_10020619 3300026078 Bacteria 5455
706 Ga0207702_10037234 3300026078 Bacteria 4071
707 Ga0207702_10116389 3300026078 Bacteria 2385
708 Ga0207702_10183386 3300026078 Bacteria 1929
709 Ga0207702_10237909 3300026078 Bacteria 1705
710 Ga0207702_10483151 3300026078 Bacteria 1206
711 Ga0207641_10000761 3300026088 Bacteria 34699
712 Ga0207641_10018256 3300026088 Bacteria 5749
713 Ga0207641_10037617 3300026088 Bacteria 4042
714 Ga0207641_10043648 3300026088 Bacteria 3766
715 Ga0207641_10046527 3300026088 Bacteria 3657
716 Ga0207641_10076295 3300026088 Bacteria 2897
717 Ga0207641_10148679 3300026088 Bacteria 2120
718 Ga0207641_10225883 3300026088 Bacteria 1738
719 Ga0207648_10000781 3300026089 Bacteria 35889
720 Ga0207648_10019564 3300026089 Bacteria 6110
721 Ga0207648_10028079 3300026089 Bacteria 4991
722 Ga0207648_10039403 3300026089 Bacteria 4155
723 Ga0207676_10000731 3300026095 Bacteria 25737
724 Ga0207676_10006257 3300026095 Bacteria 8402
725 Ga0207676_10006357 3300026095 Bacteria 8346
726 Ga0207676_10008298 3300026095 Bacteria 7382
727 Ga0207676_10038306 3300026095 Bacteria 3658
728 Ga0207676_10039178 3300026095 Bacteria 3623
729 Ga0207676_10060203 3300026095 Bacteria 3002
730 Ga0207676_10065793 3300026095 Bacteria 2888
731 Ga0207676_10193341 3300026095 Bacteria 1792
732 Ga0207674_10000308 3300026116 Bacteria 62120
733 Ga0207674_10000780 3300026116 Bacteria 41514
734 Ga0207674_10003828 3300026116 Bacteria 18342
735 Ga0207674_10010013 3300026116 Bacteria 10788
736 Ga0207674_10030184 3300026116 Bacteria 5702
737 Ga0207674_10031006 3300026116 Bacteria 5619
738 Ga0207674_10060359 3300026116 Bacteria 3835
739 Ga0207674_10420019 3300026116 Bacteria 1292
740 Ga0207675_100003414 3300026118 Bacteria 15508
741 Ga0207683_10004684 3300026121 Bacteria 11787
742 Ga0207683_10015674 3300026121 Bacteria 6451
743 Ga0207683_10022732 3300026121 Bacteria 5385
744 Ga0207683_10024336 3300026121 Bacteria 5214
745 Ga0207683_10058935 3300026121 Bacteria 3372
746 Ga0207683_10063981 3300026121 Bacteria 3241
747 Ga0207683_10086633 3300026121 Bacteria 2785
748 Ga0207683_10101089 3300026121 Bacteria 2574
749 Ga0207683_10115186 3300026121 Bacteria 2410
750 Ga0207698_10002766 3300026142 Bacteria 10464
751 Ga0207698_10004211 3300026142 Bacteria 8749
752 Ga0207698_10011025 3300026142 Bacteria 5843
753 Ga0207698_10014618 3300026142 Bacteria 5226
754 Ga0207698_10017547 3300026142 Bacteria 4859
755 Ga0207698_10020613 3300026142 Bacteria 4541
756 Ga0207698_10023527 3300026142 Bacteria 4305
757 Ga0207698_10158059 3300026142 Bacteria 1978
758 Ga0207698_10284649 3300026142 Bacteria 1531
759 Ga0209974_10035198 3300027876 Bacteria 1663
760 Ga0209974_10043482 3300027876 Bacteria 1497
761 Ga0207428_10074456 3300027907 Bacteria 2663
762 Ga0268266_10000135 3300028379 Bacteria 141959
763 Ga0268266_10004437 3300028379 Bacteria 13433
764 Ga0268266_10012798 3300028379 Bacteria 7247
765 Ga0268266_10015812 3300028379 Bacteria 6462
766 Ga0268266_10034869 3300028379 Bacteria 4280
767 Ga0268266_10042780 3300028379 Bacteria 3870
768 Ga0268266_10143684 3300028379 Bacteria 2143
769 Ga0268266_10270540 3300028379 Bacteria 1577
770 Ga0268265_10007223 3300028380 Bacteria 7505
771 Ga0268265_10015789 3300028380 Bacteria 5176
772 Ga0268265_10021412 3300028380 Bacteria 4529
773 Ga0268265_10047457 3300028380 Bacteria 3218
774 Ga0268265_10063211 3300028380 Bacteria 2847
775 Ga0268265_10070179 3300028380 Bacteria 2723
776 Ga0268265_10118696 3300028380 Bacteria 2175
777 Ga0268265_10135737 3300028380 Bacteria 2052
778 Ga0268265_10178745 3300028380 Bacteria 1821
779 Ga0268264_10000379 3300028381 Bacteria 64925
780 Ga0268264_10000755 3300028381 Bacteria 36243
781 Ga0268264_10020182 3300028381 Bacteria 5446
782 Ga0268264_10023994 3300028381 Bacteria 4977
783 Ga0268264_10071077 3300028381 Bacteria 2948
784 Ga0268264_10095705 3300028381 Bacteria 2570
785 Ga0307408_100009107 3300031548 Bacteria 6549
786 Ga0307408_100020482 3300031548 Bacteria 4466
787 Ga0307408_100033459 3300031548 Bacteria 3591
788 Ga0307408_100050888 3300031548 Bacteria 2981
789 Ga0307408_100258412 3300031548 Bacteria 1440
790 Ga0307516_10057064 3300031730 Bacteria 3805
791 Ga0307405_10011197 3300031731 Bacteria 4685
792 Ga0307405_10016832 3300031731 Bacteria 3996
793 Ga0307405_10037966 3300031731 Bacteria 2899
794 Ga0307405_10043202 3300031731 Bacteria 2748
795 Ga0307405_10056914 3300031731 Bacteria 2454
796 Ga0307405_10128908 3300031731 Bacteria 1744
797 Ga0307405_10202671 3300031731 Bacteria 1442
798 Ga0307413_10017532 3300031824 Bacteria 3732
799 Ga0307413_10019334 3300031824 Bacteria 3596
800 Ga0307413_10019401 3300031824 Bacteria 3592
801 Ga0307413_10073603 3300031824 Bacteria 2160
802 Ga0307413_10075350 3300031824 Bacteria 2141
803 Ga0307413_10080787 3300031824 Bacteria 2082
804 Ga0307413_10338514 3300031824 Bacteria 1156
805 Ga0307410_10014740 3300031852 Bacteria 4612
806 Ga0307410_10023220 3300031852 Bacteria 3851
807 Ga0307410_10044058 3300031852 Bacteria 2961
808 Ga0307410_10046567 3300031852 Bacteria 2894
809 Ga0307410_10053169 3300031852 Bacteria 2739
810 Ga0307410_10070920 3300031852 Bacteria 2415
811 Ga0307410_10085939 3300031852 Bacteria 2221
812 Ga0307410_10094286 3300031852 Bacteria 2132
813 Ga0307410_10146396 3300031852 Bacteria 1753
814 Ga0307410_10187243 3300031852 Bacteria 1571
815 Ga0307406_10024256 3300031901 Bacteria 3620
816 Ga0307406_10024571 3300031901 Bacteria 3600
817 Ga0307406_10106665 3300031901 Bacteria 1919
818 Ga0307407_10002391 3300031903 Bacteria 7327
819 Ga0307407_10016894 3300031903 Bacteria 3645
820 Ga0307407_10045519 3300031903 Bacteria 2480
821 Ga0307407_10085504 3300031903 Bacteria 1919
822 Ga0307407_10089461 3300031903 Bacteria 1883
823 Ga0307407_10104804 3300031903 Bacteria 1763
824 Ga0307412_10001871 3300031911 Bacteria 11643
825 Ga0307412_10005917 3300031911 Bacteria 6892
826 Ga0307412_10019110 3300031911 Bacteria 4140
827 Ga0307412_10019896 3300031911 Bacteria 4075
828 Ga0307412_10126219 3300031911 Bacteria 1851
829 Ga0307412_10298084 3300031911 Bacteria 1273
830 Ga0307409_100004448 3300031995 Bacteria 7874
831 Ga0307409_100012008 3300031995 Bacteria 5496
832 Ga0307409_100031038 3300031995 Bacteria 3849
833 Ga0307409_100036008 3300031995 Bacteria 3632
834 Ga0307409_100039099 3300031995 Bacteria 3517
835 Ga0307409_100048110 3300031995 Bacteria 3242
836 Ga0307409_100056183 3300031995 Bacteria 3043
837 Ga0307409_100184813 3300031995 Bacteria 1849
838 Ga0307409_100216497 3300031995 Bacteria 1726
839 Ga0307409_100219547 3300031995 Bacteria 1715
840 Ga0307409_100238643 3300031995 Bacteria 1653
841 Ga0307416_100002535 3300032002 Bacteria 10513
842 Ga0307416_100025091 3300032002 Bacteria 4364
843 Ga0307416_100088434 3300032002 Bacteria 2648
844 Ga0307416_100135626 3300032002 Bacteria 2226
845 Ga0307416_100172955 3300032002 Bacteria 2013
846 Ga0307416_100174555 3300032002 Bacteria 2006
847 Ga0307416_100394411 3300032002 Bacteria 1419
848 Ga0307416_100456895 3300032002 Bacteria 1331
849 Ga0307416_100482925 3300032002 Bacteria 1299
850 Ga0307414_10009460 3300032004 Bacteria 5599
851 Ga0307414_10033895 3300032004 Bacteria 3379
852 Ga0307414_10039302 3300032004 Bacteria 3186
853 Ga0307414_10074202 3300032004 Bacteria 2463
854 Ga0307414_10131833 3300032004 Bacteria 1941
855 Ga0307414_10158365 3300032004 Bacteria 1795
856 Ga0307414_10225826 3300032004 Bacteria 1540
857 Ga0307414_10293920 3300032004 Bacteria 1371
858 Ga0307411_10001121 3300032005 Bacteria 10456
859 Ga0307411_10013427 3300032005 Bacteria 4519
860 Ga0307411_10014373 3300032005 Bacteria 4401
861 Ga0307411_10017942 3300032005 Bacteria 4048
862 Ga0307411_10024359 3300032005 Bacteria 3606
863 Ga0307411_10034331 3300032005 Bacteria 3156
864 Ga0307411_10038575 3300032005 Bacteria 3014
865 Ga0307411_10099266 3300032005 Bacteria 2054
866 Ga0307411_10120429 3300032005 Bacteria 1897
867 Ga0307411_10205677 3300032005 Bacteria 1515
868 Ga0307415_100007657 3300032126 Bacteria 5926
869 Ga0307415_100013064 3300032126 Bacteria 4831
870 Ga0307415_100039821 3300032126 Bacteria 3109
871 Ga0307415_100053258 3300032126 Bacteria 2756
872 Ga0307415_100059200 3300032126 Bacteria 2640
873 Ga0307415_100073507 3300032126 Bacteria 2412
874 Ga0307415_100073770 3300032126 Bacteria 2409
875 Ga0307415_100113534 3300032126 Bacteria 2015
876 Ga0307415_100247462 3300032126 Bacteria 1446
877 Ga0307415_100250648 3300032126 Bacteria 1438
878 Ga0307415_100310145 3300032126 Bacteria 1311
879 Ga0373943_0001240 3300035170 Bacteria 11421
880 Ga0373946_0027962 3300035171 Bacteria 2234
881 Ga0373955_0004354 3300035172 Bacteria 6261
882 Ga0373931_0025427 3300035691 Bacteria 3007
883 Ga0373931_0031800 3300035691 Bacteria 2727
884 Ga0373935_0060767 3300035692 Bacteria 2418
885 Ga0373927_0111058 3300035695 Bacteria 1786
886 Ga0373933_0062123 3300035724 Bacteria 2255
887 Ga0373937_0156812 3300036401 Bacteria 2134
888 Ga0395899_0000103 3300037312 Bacteria 147274
889 Ga0395899_0000112 3300037312 Bacteria 138389
890 Ga0395899_0000756 3300037312 Bacteria 32002
891 Ga0395899_0001656 3300037312 Bacteria 18573
892 Ga0395899_0004112 3300037312 Bacteria 11459
893 Ga0395899_0008155 3300037312 Bacteria 8070
894 Ga0395899_0008760 3300037312 Bacteria 7786
895 Ga0395899_0023916 3300037312 Bacteria 4622
896 Ga0395899_0030716 3300037312 Bacteria 4039
897 Ga0395899_0041416 3300037312 Bacteria 3441
898 Ga0395899_0097730 3300037312 Bacteria 2122
899 Ga0395899_0118454 3300037312 Bacteria 1899
900 Ga0395899_0126671 3300037312 Bacteria 1826
901 Ga0395899_0150873 3300037312 Bacteria 1647
902 Ga0395900_0000093 3300037418 Bacteria 166505
903 Ga0395900_0000336 3300037418 Bacteria 69212
904 Ga0395900_0001132 3300037418 Bacteria 33674
905 Ga0395900_0001210 3300037418 Bacteria 31949
906 Ga0395900_0001912 3300037418 Bacteria 23668
907 Ga0395900_0002089 3300037418 Bacteria 22389
908 Ga0395900_0003177 3300037418 Bacteria 17797
909 Ga0395900_0006132 3300037418 Bacteria 12540
910 Ga0395900_0018731 3300037418 Bacteria 7060
911 Ga0395900_0030348 3300037418 Bacteria 5551
912 Ga0395900_0030911 3300037418 Bacteria 5499
913 Ga0395900_0033828 3300037418 Bacteria 5260
914 Ga0395900_0035542 3300037418 Bacteria 5132
915 Ga0395900_0040549 3300037418 Bacteria 4798
916 Ga0395900_0041598 3300037418 Bacteria 4737
917 Ga0395900_0058225 3300037418 Bacteria 3978
918 Ga0395900_0059137 3300037418 Bacteria 3945
919 Ga0395900_0059819 3300037418 Bacteria 3921
920 Ga0395900_0068802 3300037418 Bacteria 3638
921 Ga0395900_0073325 3300037418 Bacteria 3519
922 Ga0395900_0074568 3300037418 Bacteria 3488
923 Ga0395900_0076414 3300037418 Bacteria 3442
924 Ga0395900_0085374 3300037418 Bacteria 3244
925 Ga0395900_0121919 3300037418 Bacteria 2675
926 Ga0395900_0152625 3300037418 Bacteria 2359
927 Ga0395900_0176977 3300037418 Bacteria 2169
928 Ga0395900_0195762 3300037418 Bacteria 2048
929 Ga0395900_0258632 3300037418 Bacteria 1739
930 Ga0395900_0302200 3300037418 Bacteria 1586
931 Ga0395900_0376660 3300037418 Bacteria 1388
932 Ga0395900_0509170 3300037418 Bacteria 1153
933 Ga0395898_0000053 3300037466 Bacteria 279600
934 Ga0395898_0001084 3300037466 Bacteria 42107
935 Ga0395898_0001500 3300037466 Bacteria 32350
936 Ga0395898_0002211 3300037466 Bacteria 23748
937 Ga0395898_0007849 3300037466 Bacteria 11327
938 Ga0395898_0013704 3300037466 Bacteria 8339
939 Ga0395898_0018403 3300037466 Bacteria 7122
940 Ga0395898_0027836 3300037466 Bacteria 5668
941 Ga0395898_0037617 3300037466 Bacteria 4799
942 Ga0395898_0038107 3300037466 Bacteria 4766
943 Ga0395898_0050627 3300037466 Bacteria 4065
944 Ga0395898_0067520 3300037466 Bacteria 3461
945 Ga0395898_0076019 3300037466 Bacteria 3243
946 Ga0395898_0080283 3300037466 Bacteria 3146
947 Ga0395898_0116763 3300037466 Bacteria 2557
948 Ga0395898_0119955 3300037466 Bacteria 2519
949 Ga0395898_0126804 3300037466 Bacteria 2445
950 Ga0395898_0251678 3300037466 Bacteria 1685
951 Ga0395898_0350104 3300037466 Bacteria 1409
952 Ga0395898_0369756 3300037466 Bacteria 1367
953 Ga0395905_0000031 3300037471 Bacteria 286757
954 Ga0395905_0000083 3300037471 Bacteria 158407
955 Ga0395905_0000092 3300037471 Bacteria 149300
956 Ga0395905_0001268 3300037471 Bacteria 31200
957 Ga0395905_0001353 3300037471 Bacteria 29855
958 Ga0395905_0003461 3300037471 Bacteria 16880
959 Ga0395905_0004474 3300037471 Bacteria 14499
960 Ga0395905_0005930 3300037471 Bacteria 12382
961 Ga0395905_0006356 3300037471 Bacteria 11909
962 Ga0395905_0009470 3300037471 Bacteria 9516
963 Ga0395905_0009689 3300037471 Bacteria 9402
964 Ga0395905_0011208 3300037471 Bacteria 8668
965 Ga0395905_0012107 3300037471 Bacteria 8310
966 Ga0395905_0015993 3300037471 Bacteria 7131
967 Ga0395905_0017791 3300037471 Bacteria 6751
968 Ga0395905_0017849 3300037471 Bacteria 6741
969 Ga0395905_0020327 3300037471 Bacteria 6289
970 Ga0395905_0021776 3300037471 Bacteria 6062
971 Ga0395905_0025864 3300037471 Bacteria 5532
972 Ga0395905_0026056 3300037471 Bacteria 5514
973 Ga0395905_0035085 3300037471 Bacteria 4709
974 Ga0395905_0044675 3300037471 Bacteria 4157
975 Ga0395905_0045018 3300037471 Bacteria 4139
976 Ga0395905_0045019 3300037471 Bacteria 4139
977 Ga0395905_0053109 3300037471 Bacteria 3793
978 Ga0395905_0053598 3300037471 Bacteria 3774
979 Ga0395905_0062854 3300037471 Bacteria 3473
980 Ga0395905_0062943 3300037471 Bacteria 3470
981 Ga0395905_0071683 3300037471 Bacteria 3248
982 Ga0395905_0072179 3300037471 Bacteria 3236
983 Ga0395905_0105301 3300037471 Bacteria 2648
984 Ga0395905_0113485 3300037471 Bacteria 2546
985 Ga0395905_0138301 3300037471 Bacteria 2291
986 Ga0395905_0160564 3300037471 Bacteria 2112
987 Ga0395905_0203550 3300037471 Bacteria 1855
988 Ga0395905_0215426 3300037471 Bacteria 1798
989 Ga0395905_0224576 3300037471 Bacteria 1757
990 Ga0395905_0253235 3300037471 Bacteria 1645
991 Ga0395905_0271198 3300037471 Bacteria 1583
992 Ga0395905_0435964 3300037471 Bacteria 1207
993 Ga0436364_0911980 3300037853 Bacteria 1853
994 Ga0395901_0000047 3300038443 Bacteria 175221
995 Ga0395901_0000339 3300038443 Bacteria 56917
996 Ga0395901_0000369 3300038443 Bacteria 54034
997 Ga0395901_0000770 3300038443 Bacteria 35923
998 Ga0395901_0000850 3300038443 Bacteria 33604
999 Ga0395901_0001609 3300038443 Bacteria 23383
1000 Ga0395901_0010343 3300038443 Bacteria 9450
1001 Ga0395901_0011751 3300038443 Bacteria 8875
1002 Ga0395901_0017737 3300038443 Bacteria 7266
1003 Ga0395901_0017953 3300038443 Bacteria 7222
1004 Ga0395901_0018138 3300038443 Bacteria 7182
1005 Ga0395901_0022253 3300038443 Bacteria 6494
1006 Ga0395901_0022632 3300038443 Bacteria 6442
1007 Ga0395901_0025057 3300038443 Bacteria 6123
1008 Ga0395901_0034014 3300038443 Bacteria 5262
1009 Ga0395901_0044332 3300038443 Bacteria 4613
1010 Ga0395901_0049348 3300038443 Bacteria 4372
1011 Ga0395901_0054203 3300038443 Bacteria 4167
1012 Ga0395901_0061819 3300038443 Bacteria 3897
1013 Ga0395901_0073354 3300038443 Bacteria 3569
1014 Ga0395901_0086397 3300038443 Bacteria 3279
1015 Ga0395901_0100034 3300038443 Bacteria 3041
1016 Ga0395901_0105228 3300038443 Bacteria 2961
1017 Ga0395901_0119228 3300038443 Bacteria 2772
1018 Ga0395901_0144671 3300038443 Bacteria 2499
1019 Ga0395901_0198330 3300038443 Bacteria 2104
1020 Ga0395901_0209980 3300038443 Bacteria 2038
1021 Ga0395901_0221385 3300038443 Bacteria 1978
1022 Ga0395901_0239083 3300038443 Bacteria 1894
1023 Ga0395901_0312590 3300038443 Bacteria 1627
1024 Ga0395901_0314971 3300038443 Bacteria 1620
1025 Ga0436365_0031645 3300039437 Bacteria 4865
1026 Ga0439448_0001036 3300042005 Bacteria 6948
1027 Ga0439455_0010566 3300042012 Bacteria 2033
1028 Ga0450905_000655 3300042142 Bacteria 4272
1029 Ga0450889_000066 3300042144 Bacteria 9358
1030 Ga0439458_0000005 3300042157 Bacteria 32418
1031 Ga0439458_0002203 3300042157 Bacteria 4813
1032 Ga0439464_0000114 3300042439 Bacteria 12425
1033 Ga0466969_0006382 3300044656 Bacteria 6274
1034 Ga0466969_0101721 3300044656 Bacteria 1352
1035 Ga0466972_0067536 3300044658 Bacteria 1708
1036 Ga0466966_0000004 3300044684 Bacteria 223594
1037 Ga0466966_0048296 3300044684 Bacteria 2711
1038 Ga0466966_0053939 3300044684 Bacteria 2549
1039 Ga0466966_0063939 3300044684 Bacteria 2318
1040 Ga0466966_0185154 3300044684 Bacteria 1262
1041 Ga0466961_0001622 3300044693 Bacteria 13949
1042 Ga0466961_0017191 3300044693 Bacteria 4646
1043 Ga0466961_0106360 3300044693 Bacteria 1766
1044 Ga0466963_0000727 3300044694 Bacteria 16151
1045 Ga0466963_0002355 3300044694 Bacteria 10547
1046 Ga0466963_0037609 3300044694 Bacteria 3161
1047 Ga0466963_0046442 3300044694 Bacteria 2863
1048 Ga0466963_0103702 3300044694 Bacteria 1948
1049 Ga0466963_0108478 3300044694 Bacteria 1904
1050 Ga0466963_0129172 3300044694 Bacteria 1744
1051 Ga0466963_0136608 3300044694 Bacteria 1697
1052 Ga0466963_0136657 3300044694 Bacteria 1696
1053 Ga0466964_0006111 3300044706 Bacteria 4489
1054 Ga0466971_0007159 3300044719 Bacteria 4854
1055 Ga0466968_0027315 3300044735 Bacteria 2348
1056 Ga0466970_0031542 3300044765 Bacteria 2799
1057 Ga0466970_0195100 3300044765 Bacteria 1126
1058 Ga0466957_0003105 3300044842 Bacteria 9038
1059 Ga0466957_0004220 3300044842 Bacteria 7970
1060 Ga0466957_0029216 3300044842 Bacteria 3286
1061 Ga0466957_0041412 3300044842 Bacteria 2786
1062 Ga0466960_0150024 3300044901 Bacteria 1245
1063 Ga0466959_0073281 3300045049 Bacteria 2477
1064 Ga0466958_0000180 3300045836 Bacteria 22832
1065 Ga0466958_0033341 3300045836 Bacteria 3068
1066 Ga0466958_0062367 3300045836 Bacteria 2272
1067 Ga0466958_0102679 3300045836 Bacteria 1779
1068 Ga0466958_0119877 3300045836 Bacteria 1646
1069 Ga0466958_0239545 3300045836 Bacteria 1159
1070 Ga0466967_0000409 3300045976 Bacteria 20274
1071 Ga0466967_0006519 3300045976 Bacteria 8274
1072 Ga0466967_0013939 3300045976 Bacteria 6237
1073 Ga0466967_0274702 3300045976 Bacteria 1616
1074 Ga0466967_0332469 3300045976 Bacteria 1467
1075 Ga0495603_0132730 3300046455 Bacteria 1450
1076 Ga0495629_0152390 3300046459 Bacteria 1607
1077 Ga0495620_0086162 3300046515 Bacteria 1265
1078 Ga0495628_0008816 3300046516 Bacteria 8632
1079 Ga0495628_0099862 3300046516 Bacteria 2241
1080 Ga0495630_0083571 3300046517 Bacteria 2410
1081 Ga0495663_0003515 3300046525 Bacteria 4515
1082 Ga0495663_0004247 3300046525 Bacteria 4043
1083 Ga0495642_0016856 3300046528 Bacteria 2850
1084 Ga0495621_0000099 3300046539 Bacteria 17912
1085 Ga0495621_0000378 3300046539 Bacteria 10888
1086 Ga0495621_0001818 3300046539 Bacteria 5607
1087 Ga0495621_0003888 3300046539 Bacteria 4148
1088 Ga0495621_0034445 3300046539 Bacteria 1749
1089 Ga0495633_0012585 3300046558 Bacteria 4490
1090 Ga0495668_0054918 3300046616 Bacteria 2200
1091 Ga0495634_0013645 3300046642 Bacteria 5869
1092 Ga0495634_0183148 3300046642 Bacteria 1310
1093 Ga0495659_0047677 3300046664 Unclassified 1550
1094 Ga0495647_0035309 3300046681 Bacteria 1877
1095 Ga0495658_0021826 3300046683 Bacteria 3380
1096 Ga0495658_0045472 3300046683 Bacteria 2464
1097 Ga0495669_0015277 3300046684 Bacteria 3287
1098 Ga0495669_0016643 3300046684 Bacteria 3150
1099 Ga0495669_0030368 3300046684 Bacteria 2372
1100 Ga0495669_0087027 3300046684 Bacteria 1439
1101 Ga0495670_0003499 3300046691 Bacteria 7709
1102 Ga0495670_0022489 3300046691 Bacteria 3113
1103 Ga0495670_0041731 3300046691 Bacteria 2289
1104 Ga0495680_0003146 3300047322 Bacteria 16448
1105 Ga0495677_0021740 3300047445 Bacteria 2325
1106 Ga0495684_0184780 3300047471 Bacteria 1544
1107 Ga0496100_0001078 3300048903 Bacteria 13164
1108 Ga0496100_0191579 3300048903 Bacteria 1485
1109 Ga0496101_0001752 3300048904 Bacteria 13008
1110 Ga0496101_0008634 3300048904 Bacteria 6662
1111 Ga0496101_0018211 3300048904 Bacteria 4773
1112 Ga0496101_0085686 3300048904 Bacteria 2335
1113 Ga0496102_0079632 3300048905 Bacteria 3017
1114 Ga0496102_0081051 3300048905 Bacteria 2991
1115 Ga0496102_0218517 3300048905 Bacteria 1796
1116 Ga0496103_0003471 3300048906 Bacteria 9633
1117 Ga0496105_0061873 3300048908 Bacteria 3089
1118 Ga0496106_0001618 3300048909 Bacteria 16932
1119 Ga0496106_0136635 3300048909 Bacteria 1926
1120 Ga0496107_0014521 3300048910 Bacteria 5512
1121 Ga0496107_0042791 3300048910 Bacteria 3253
1122 Ga0496107_0051009 3300048910 Bacteria 2983
1123 Ga0496108_0005548 3300048911 Bacteria 10211
1124 Ga0496108_0012730 3300048911 Bacteria 6850
1125 Ga0496108_0019144 3300048911 Bacteria 5618
1126 Ga0496108_0029306 3300048911 Bacteria 4556
1127 Ga0496109_0008214 3300048912 Bacteria 8857
1128 Ga0496109_0011136 3300048912 Bacteria 7712
1129 Ga0496109_0017718 3300048912 Bacteria 6248
1130 Ga0496109_0019804 3300048912 Bacteria 5936
1131 Ga0496109_0050714 3300048912 Bacteria 3778
1132 Ga0496109_0218070 3300048912 Bacteria 1794
1133 Ga0496110_0000819 3300048913 Bacteria 21801
1134 Ga0496110_0012140 3300048913 Bacteria 7078
1135 Ga0496110_0051173 3300048913 Bacteria 3630
1136 Ga0496110_0085482 3300048913 Bacteria 2815
1137 Ga0496111_0000373 3300048914 Bacteria 22307
1138 Ga0496111_0008161 3300048914 Bacteria 6920
1139 Ga0496111_0106504 3300048914 Bacteria 2064
1140 Ga0496111_0113580 3300048914 Bacteria 1996
1141 Ga0496112_0006544 3300048915 Bacteria 10249
1142 Ga0496112_0034465 3300048915 Bacteria 4926
1143 Ga0496112_0034642 3300048915 Bacteria 4914
1144 Ga0496112_0086875 3300048915 Bacteria 3094
1145 Ga0496112_0645311 3300048915 Bacteria 988
1146 Ga0496113_0002966 3300048916 Bacteria 10035
1147 Ga0496113_0008017 3300048916 Bacteria 6849
1148 Ga0496113_0009447 3300048916 Bacteria 6398
1149 Ga0496113_0010652 3300048916 Bacteria 6089
1150 Ga0496113_0083257 3300048916 Bacteria 2454
1151 Ga0496114_0000019 3300048917 Bacteria 244365
1152 Ga0496114_0059129 3300048917 Bacteria 3202
1153 Ga0496114_0118272 3300048917 Bacteria 2277
1154 Ga0501042_0324358 3300049578 Bacteria 1113
1155 Ga0501068_0012439 3300049584 Bacteria 4827
1156 Ga0501069_0056082 3300049585 Bacteria 2195
1157 Ga0501223_009667 3300049663 Bacteria 1949
1158 Ga0501224_009595 3300049664 Bacteria 1417
1159 Ga0501225_0012730 3300049705 Bacteria 2361
1160 Ga0501080_0160564 3300049742 Bacteria 2076
1161 Ga0501268_017390 3300049765 Bacteria 1200
1162 Ga0501268_033776 3300049765 Bacteria 937
1163 Ga0501273_002366 3300049770 Bacteria 1912
1164 Ga0501212_002735 3300049851 Bacteria 2154
1165 nmdc:mga06r32_2867_c1 3300050510 Bacteria 15468
1166 nmdc:mga08y16_24694_c1 3300050511 Bacteria 6342
1167 nmdc:mga08y16_86060_c1 3300050511 Bacteria 3276
1168 nmdc:mga0a205_52373_c1 3300050515 Bacteria 3939
1169 Ga0495612_0017087 3300053078 Bacteria 2906
1170 Ga0500568_0000124 3300053139 Bacteria 68924
1171 Ga0466962_0002267 3300061719 Bacteria 9118

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10097674 Ga0157373_100976742 264
2 3300046455 Ga0495603_0132730 Ga0495603_0132730_12_824 268
3 3300044694 Ga0466963_0046442 Ga0466963_0046442_23_883 286
4 3300049765 Ga0501268_033776 Ga0501268_033776_55_927 290
5 3300048915 Ga0496112_0645311 Ga0496112_0645311_57_968 303
6 3300037418 Ga0395900_0068802 Ga0395900_0068802_1430_2434 304
7 3300037466 Ga0395898_0119955 Ga0395898_0119955_1430_2434 304
8 3300037466 Ga0395898_0350104 Ga0395898_0350104_14_937 304
9 3300038443 Ga0395901_0086397 Ga0395901_0086397_430_1434 304
10 3300026067 Ga0207678_10064588 Ga0207678_100645883 305
11 3300049663 Ga0501223_009667 Ga0501223_009667_927_1844 305
12 3300001989 JGI24739J22299_10011690 JGI24739J22299_100116902 307
13 3300001990 JGI24737J22298_10000416 JGI24737J22298_100004164 307
14 3300002075 JGI24738J21930_10000779 JGI24738J21930_100007796 307
15 3300005327 Ga0070658_10000220 Ga0070658_1000022042 307
16 3300005329 Ga0070683_100002170 Ga0070683_1000021702 307
17 3300005331 Ga0070670_100216240 Ga0070670_1002162402 307
18 3300005335 Ga0070666_10000522 Ga0070666_1000052217 307
19 3300005344 Ga0070661_100000181 Ga0070661_10000018142 307
20 3300005367 Ga0070667_100014866 Ga0070667_1000148662 307
21 3300005455 Ga0070663_100002581 Ga0070663_1000025815 307
22 3300005456 Ga0070678_100180599 Ga0070678_1001805992 307
23 3300005457 Ga0070662_100000080 Ga0070662_10000008043 307
24 3300005535 Ga0070684_100088835 Ga0070684_1000888352 307
25 3300005539 Ga0068853_100000134 Ga0068853_10000013442 307
26 3300005546 Ga0070696_100114955 Ga0070696_1001149552 307
27 3300005547 Ga0070693_100005630 Ga0070693_1000056302 307
28 3300005548 Ga0070665_100114210 Ga0070665_1001142102 307
29 3300005563 Ga0068855_100002468 Ga0068855_10000246813 307
30 3300005564 Ga0070664_100000047 Ga0070664_10000004762 307
31 3300005578 Ga0068854_100034284 Ga0068854_1000342842 307
32 3300005614 Ga0068856_100001328 Ga0068856_10000132815 307
33 3300005616 Ga0068852_100005476 Ga0068852_1000054768 307
34 3300005618 Ga0068864_100021439 Ga0068864_1000214392 307
35 3300005834 Ga0068851_10034986 Ga0068851_100349863 307
36 3300005842 Ga0068858_100098083 Ga0068858_1000980833 307
37 3300006358 Ga0068871_100036659 Ga0068871_1000366592 307
38 3300009174 Ga0105241_10080229 Ga0105241_100802293 307
39 3300009177 Ga0105248_10000276 Ga0105248_1000027643 307
40 3300009551 Ga0105238_10128213 Ga0105238_101282131 307
41 3300013102 Ga0157371_10001460 Ga0157371_100014604 307
42 3300014325 Ga0163163_10001248 Ga0163163_100012489 307
43 3300014968 Ga0157379_10042102 Ga0157379_100421023 307
44 3300025909 Ga0207705_10000164 Ga0207705_1000016442 307
45 3300025919 Ga0207657_10000090 Ga0207657_1000009033 307
46 3300025920 Ga0207649_10000563 Ga0207649_100005636 307
47 3300025924 Ga0207694_10083294 Ga0207694_100832941 307
48 3300025925 Ga0207650_10080682 Ga0207650_100806821 307
49 3300025932 Ga0207690_10000184 Ga0207690_1000018411 307
50 3300025933 Ga0207706_10000110 Ga0207706_1000011063 307
51 3300025941 Ga0207711_10018793 Ga0207711_100187933 307
52 3300025944 Ga0207661_10000179 Ga0207661_1000017934 307
53 3300025945 Ga0207679_10000329 Ga0207679_1000032913 307
54 3300025949 Ga0207667_10002214 Ga0207667_1000221414 307
55 3300025981 Ga0207640_10025485 Ga0207640_100254853 307
56 3300025986 Ga0207658_10012935 Ga0207658_100129352 307
57 3300026035 Ga0207703_10003519 Ga0207703_1000351911 307
58 3300026041 Ga0207639_10002619 Ga0207639_100026198 307
59 3300026067 Ga0207678_10004239 Ga0207678_100042399 307
60 3300026078 Ga0207702_10000391 Ga0207702_1000039142 307
61 3300026142 Ga0207698_10004211 Ga0207698_100042112 307
62 3300028379 Ga0268266_10015812 Ga0268266_100158126 307
63 3300035691 Ga0373931_0025427 Ga0373931_0025427_1504_2511 307
64 3300025901 Ga0207688_10013605 Ga0207688_100136055 314
65 3300005327 Ga0070658_10042820 Ga0070658_100428203 316
66 3300006852 Ga0075433_10349387 Ga0075433_103493871 320
67 3300021384 Ga0213876_10120364 Ga0213876_101203642 320
68 3300035172 Ga0373955_0004354 Ga0373955_0004354_1556_2539 320
69 3300036401 Ga0373937_0156812 Ga0373937_0156812_12_995 320
70 3300039437 Ga0436365_0031645 Ga0436365_0031645_142_1125 320
71 3300046516 Ga0495628_0008816 Ga0495628_0008816_4314_5297 320
72 3300046516 Ga0495628_0099862 Ga0495628_0099862_167_1153 320
73 3300046517 Ga0495630_0083571 Ga0495630_0083571_1398_2381 320
74 3300046642 Ga0495634_0013645 Ga0495634_0013645_3382_4365 320
75 3300046683 Ga0495658_0021826 Ga0495658_0021826_939_1922 320
76 3300050511 nmdc:mga08y16_86060_c1 nmdc:mga08y16_86060_c1_1944_2927 320
77 3300053078 Ga0495612_0017087 Ga0495612_0017087_1546_2532 320
78 3300025923 Ga0207681_10107498 Ga0207681_101074982 321
79 3300031852 Ga0307410_10070920 Ga0307410_100709202 321
80 3300031852 Ga0307410_10146396 Ga0307410_101463962 322
81 3300005335 Ga0070666_10021810 Ga0070666_100218105 323
82 3300037418 Ga0395900_0176977 Ga0395900_0176977_459_1430 323
83 3300037471 Ga0395905_0000092 Ga0395905_0000092_19373_20377 323
84 3300038443 Ga0395901_0025057 Ga0395901_0025057_4399_5370 323
85 3300038443 Ga0395901_0312590 Ga0395901_0312590_146_1153 323
86 3300038443 Ga0395901_0314971 Ga0395901_0314971_29_1033 323
87 3300025908 Ga0207643_10185857 Ga0207643_101858572 324
88 3300025929 Ga0207664_10130510 Ga0207664_101305102 324
89 3300031730 Ga0307516_10057064 Ga0307516_100570642 324
90 3300037471 Ga0395905_0053598 Ga0395905_0053598_1549_2556 324
91 3300044694 Ga0466963_0000727 Ga0466963_0000727_9192_10199 324
92 3300044706 Ga0466964_0006111 Ga0466964_0006111_32_1039 324
93 3300044842 Ga0466957_0004220 Ga0466957_0004220_5455_6462 324
94 3300045976 Ga0466967_0000409 Ga0466967_0000409_12976_13983 324
95 3300047471 Ga0495684_0184780 Ga0495684_0184780_231_1211 324
96 3300005328 Ga0070676_10017607 Ga0070676_100176073 325
97 3300005367 Ga0070667_100170553 Ga0070667_1001705532 325
98 3300025907 Ga0207645_10250267 Ga0207645_102502671 325
99 3300025924 Ga0207694_10340750 Ga0207694_103407502 325
100 3300025981 Ga0207640_10247111 Ga0207640_102471112 325
101 3300025986 Ga0207658_10333505 Ga0207658_103335052 325
102 3300026023 Ga0207677_10003208 Ga0207677_100032085 325
103 3300038443 Ga0395901_0119228 Ga0395901_0119228_49_1053 325
104 3300048910 Ga0496107_0042791 Ga0496107_0042791_1606_2610 325
105 3300001989 JGI24739J22299_10012866 JGI24739J22299_100128663 326
106 3300005328 Ga0070676_10018617 Ga0070676_100186173 326
107 3300005334 Ga0068869_100065165 Ga0068869_1000651653 326
108 3300005335 Ga0070666_10090399 Ga0070666_100903992 326
109 3300005339 Ga0070660_100046622 Ga0070660_1000466222 326
110 3300005347 Ga0070668_100046222 Ga0070668_1000462223 326
111 3300005364 Ga0070673_100000882 Ga0070673_10000088210 326
112 3300005366 Ga0070659_100035208 Ga0070659_1000352083 326
113 3300005539 Ga0068853_100001369 Ga0068853_1000013697 326
114 3300005543 Ga0070672_100007544 Ga0070672_1000075444 326
115 3300005577 Ga0068857_100030339 Ga0068857_1000303394 326
116 3300005618 Ga0068864_100028043 Ga0068864_1000280434 326
117 3300005844 Ga0068862_100023629 Ga0068862_1000236294 326
118 3300009098 Ga0105245_10021990 Ga0105245_100219903 326
119 3300009176 Ga0105242_10049903 Ga0105242_100499033 326
120 3300013102 Ga0157371_10007932 Ga0157371_100079328 326
121 3300013306 Ga0163162_10062560 Ga0163162_100625603 326
122 3300013307 Ga0157372_10010120 Ga0157372_100101204 326
123 3300025290 Ga0207673_1012131 Ga0207673_10121311 326
124 3300025901 Ga0207688_10006175 Ga0207688_100061755 326
125 3300025907 Ga0207645_10021295 Ga0207645_100212953 326
126 3300025919 Ga0207657_10000742 Ga0207657_1000074219 326
127 3300025931 Ga0207644_10275164 Ga0207644_102751642 326
128 3300025940 Ga0207691_10000364 Ga0207691_100003648 326
129 3300025942 Ga0207689_10000984 Ga0207689_1000098417 326
130 3300025960 Ga0207651_10000808 Ga0207651_100008088 326
131 3300025972 Ga0207668_10019430 Ga0207668_100194303 326
132 3300026089 Ga0207648_10000781 Ga0207648_100007818 326
133 3300026095 Ga0207676_10060203 Ga0207676_100602033 326
134 3300026116 Ga0207674_10003828 Ga0207674_100038289 326
135 3300026121 Ga0207683_10058935 Ga0207683_100589351 326
136 3300037312 Ga0395899_0004112 Ga0395899_0004112_7388_8395 326
137 3300037418 Ga0395900_0001912 Ga0395900_0001912_13441_14448 326
138 3300037466 Ga0395898_0001084 Ga0395898_0001084_38606_39613 326
139 3300037471 Ga0395905_0004474 Ga0395905_0004474_867_1874 326
140 3300038443 Ga0395901_0001609 Ga0395901_0001609_10554_11561 326
141 3300046642 Ga0495634_0183148 Ga0495634_0183148_212_1198 326
142 3300047322 Ga0495680_0003146 Ga0495680_0003146_15254_16240 326
143 3300048903 Ga0496100_0191579 Ga0496100_0191579_342_1328 326
144 3300048912 Ga0496109_0218070 Ga0496109_0218070_653_1639 326
145 3300048917 Ga0496114_0118272 Ga0496114_0118272_666_1652 326
146 3300005339 Ga0070660_100032672 Ga0070660_1000326724 328
147 3300005344 Ga0070661_100103891 Ga0070661_1001038912 328
148 3300005458 Ga0070681_10036381 Ga0070681_100363815 328
149 3300005547 Ga0070693_100165820 Ga0070693_1001658202 328
150 3300006852 Ga0075433_10044276 Ga0075433_100442762 328
151 3300025919 Ga0207657_10002240 Ga0207657_100022402 328
152 3300025920 Ga0207649_10117206 Ga0207649_101172062 328
153 3300025921 Ga0207652_10013204 Ga0207652_100132042 328
154 3300026142 Ga0207698_10023527 Ga0207698_100235275 328
155 3300035724 Ga0373933_0062123 Ga0373933_0062123_469_1476 328
156 3300042005 Ga0439448_0001036 Ga0439448_0001036_2555_3562 328
157 3300042012 Ga0439455_0010566 Ga0439455_0010566_849_1856 328
158 3300042157 Ga0439458_0002203 Ga0439458_0002203_3132_4139 328
159 3300050515 nmdc:mga0a205_52373_c1 nmdc:mga0a205_52373_c1_2287_3291 328
160 3300005434 Ga0070709_10098453 Ga0070709_100984531 329
161 3300005435 Ga0070714_100128257 Ga0070714_1001282573 329
162 3300005436 Ga0070713_100130507 Ga0070713_1001305072 329
163 3300005844 Ga0068862_100310703 Ga0068862_1003107032 329
164 3300025915 Ga0207693_10008871 Ga0207693_100088716 329
165 3300025928 Ga0207700_10075882 Ga0207700_100758822 329
166 3300025933 Ga0207706_10008041 Ga0207706_100080415 329
167 3300028380 Ga0268265_10021412 Ga0268265_100214122 329
168 3300031548 Ga0307408_100050888 Ga0307408_1000508882 329
169 3300031903 Ga0307407_10085504 Ga0307407_100855042 329
170 3300032002 Ga0307416_100135626 Ga0307416_1001356262 329
171 iso_pu_bacteria 2896429255 2896432000 331
172 3300005355 Ga0070671_100008369 Ga0070671_1000083697 332
173 3300005367 Ga0070667_100026825 Ga0070667_1000268253 332
174 3300005563 Ga0068855_100425933 Ga0068855_1004259332 332
175 3300005841 Ga0068863_100018870 Ga0068863_1000188706 332
176 3300005843 Ga0068860_100092874 Ga0068860_1000928743 332
177 3300009545 Ga0105237_10079171 Ga0105237_100791714 332
178 3300014968 Ga0157379_10008994 Ga0157379_100089945 332
179 3300025914 Ga0207671_10243102 Ga0207671_102431022 332
180 3300025945 Ga0207679_10158316 Ga0207679_101583162 332
181 3300026035 Ga0207703_10285581 Ga0207703_102855811 332
182 3300026078 Ga0207702_10020619 Ga0207702_100206195 332
183 3300026116 Ga0207674_10000780 Ga0207674_100007807 332
184 3300037471 Ga0395905_0026056 Ga0395905_0026056_539_1537 332
185 3300046459 Ga0495629_0152390 Ga0495629_0152390_537_1565 332
186 3300046683 Ga0495658_0045472 Ga0495658_0045472_784_1812 332
187 3300048906 Ga0496103_0003471 Ga0496103_0003471_3669_4667 332
188 3300048909 Ga0496106_0136635 Ga0496106_0136635_38_1036 332
189 3300048910 Ga0496107_0051009 Ga0496107_0051009_828_1826 332
190 3300048911 Ga0496108_0019144 Ga0496108_0019144_3592_4590 332
191 3300048912 Ga0496109_0008214 Ga0496109_0008214_2723_3721 332
192 3300048913 Ga0496110_0085482 Ga0496110_0085482_828_1826 332
193 3300048914 Ga0496111_0008161 Ga0496111_0008161_1123_2121 332
194 3300049578 Ga0501042_0324358 Ga0501042_0324358_40_1047 332
195 3300005364 Ga0070673_100002586 Ga0070673_1000025862 333
196 3300005367 Ga0070667_100231480 Ga0070667_1002314802 333
197 3300005617 Ga0068859_100006426 Ga0068859_1000064265 333
198 3300005618 Ga0068864_100005190 Ga0068864_1000051905 333
199 3300005841 Ga0068863_100009309 Ga0068863_1000093097 333
200 3300005842 Ga0068858_100002589 Ga0068858_1000025892 333
201 3300005843 Ga0068860_100006884 Ga0068860_1000068845 333
202 3300006931 Ga0097620_100006426 Ga0097620_1000064265 333
203 3300009092 Ga0105250_10022388 Ga0105250_100223882 333
204 3300009177 Ga0105248_10018946 Ga0105248_100189463 333
205 3300009177 Ga0105248_10098659 Ga0105248_100986594 333
206 3300013308 Ga0157375_10046650 Ga0157375_100466504 333
207 3300014325 Ga0163163_10071796 Ga0163163_100717964 333
208 3300014968 Ga0157379_10006683 Ga0157379_100066831 333
209 3300017792 Ga0163161_10005360 Ga0163161_1000536011 333
210 3300025923 Ga0207681_10045621 Ga0207681_100456214 333
211 3300025941 Ga0207711_10013563 Ga0207711_100135632 333
212 3300025941 Ga0207711_10128464 Ga0207711_101284642 333
213 3300025960 Ga0207651_10010367 Ga0207651_100103672 333
214 3300026035 Ga0207703_10002189 Ga0207703_100021894 333
215 3300026088 Ga0207641_10000761 Ga0207641_1000076134 333
216 3300026095 Ga0207676_10000731 Ga0207676_1000073112 333
217 3300028380 Ga0268265_10047457 Ga0268265_100474572 333
218 3300028381 Ga0268264_10000755 Ga0268264_1000075520 333
219 3300031548 Ga0307408_100009107 Ga0307408_1000091072 333
220 3300031731 Ga0307405_10016832 Ga0307405_100168323 333
221 3300031852 Ga0307410_10014740 Ga0307410_100147403 333
222 3300031911 Ga0307412_10001871 Ga0307412_100018715 333
223 3300031995 Ga0307409_100012008 Ga0307409_1000120082 333
224 3300031995 Ga0307409_100036008 Ga0307409_1000360082 333
225 3300032002 Ga0307416_100002535 Ga0307416_1000025355 333
226 3300032002 Ga0307416_100174555 Ga0307416_1001745552 333
227 3300032004 Ga0307414_10293920 Ga0307414_102939202 333
228 3300032005 Ga0307411_10120429 Ga0307411_101204292 333
229 3300032126 Ga0307415_100013064 Ga0307415_1000130642 333
230 3300032126 Ga0307415_100053258 Ga0307415_1000532582 333
231 3300049765 Ga0501268_017390 Ga0501268_017390_59_1060 333
232 3300001989 JGI24739J22299_10010928 JGI24739J22299_100109282 334
233 3300002075 JGI24738J21930_10012364 JGI24738J21930_100123642 334
234 3300002077 JGI24744J21845_10000205 JGI24744J21845_100002056 334
235 3300005290 Ga0065712_10073460 Ga0065712_100734604 334
236 3300005293 Ga0065715_10094225 Ga0065715_100942253 334
237 3300005327 Ga0070658_10169393 Ga0070658_101693932 334
238 3300005328 Ga0070676_10020704 Ga0070676_100207043 334
239 3300005328 Ga0070676_10050604 Ga0070676_100506042 334
240 3300005328 Ga0070676_10079726 Ga0070676_100797262 334
241 3300005329 Ga0070683_100040805 Ga0070683_1000408053 334
242 3300005330 Ga0070690_100012760 Ga0070690_1000127603 334
243 3300005331 Ga0070670_100028368 Ga0070670_1000283684 334
244 3300005331 Ga0070670_100029781 Ga0070670_1000297813 334
245 3300005331 Ga0070670_100041871 Ga0070670_1000418714 334
246 3300005331 Ga0070670_100226775 Ga0070670_1002267752 334
247 3300005333 Ga0070677_10028236 Ga0070677_100282363 334
248 3300005335 Ga0070666_10000747 Ga0070666_100007473 334
249 3300005335 Ga0070666_10005747 Ga0070666_100057475 334
250 3300005335 Ga0070666_10026281 Ga0070666_100262813 334
251 3300005335 Ga0070666_10033705 Ga0070666_100337053 334
252 3300005336 Ga0070680_100347532 Ga0070680_1003475321 334
253 3300005338 Ga0068868_100001739 Ga0068868_1000017398 334
254 3300005338 Ga0068868_100059352 Ga0068868_1000593523 334
255 3300005338 Ga0068868_100074493 Ga0068868_1000744931 334
256 3300005338 Ga0068868_100198246 Ga0068868_1001982462 334
257 3300005339 Ga0070660_100027246 Ga0070660_1000272464 334
258 3300005339 Ga0070660_100057148 Ga0070660_1000571481 334
259 3300005339 Ga0070660_100108208 Ga0070660_1001082081 334
260 3300005344 Ga0070661_100014880 Ga0070661_1000148804 334
261 3300005344 Ga0070661_100034023 Ga0070661_1000340232 334
262 3300005344 Ga0070661_100036538 Ga0070661_1000365382 334
263 3300005344 Ga0070661_100135859 Ga0070661_1001358592 334
264 3300005344 Ga0070661_100299491 Ga0070661_1002994911 334
265 3300005347 Ga0070668_100119781 Ga0070668_1001197812 334
266 3300005354 Ga0070675_100003785 Ga0070675_10000378510 334
267 3300005354 Ga0070675_100011464 Ga0070675_1000114645 334
268 3300005354 Ga0070675_100020121 Ga0070675_1000201213 334
269 3300005354 Ga0070675_100049614 Ga0070675_1000496144 334
270 3300005355 Ga0070671_100001210 Ga0070671_10000121018 334
271 3300005355 Ga0070671_100002741 Ga0070671_1000027412 334
272 3300005355 Ga0070671_100014448 Ga0070671_1000144489 334
273 3300005355 Ga0070671_100014614 Ga0070671_1000146144 334
274 3300005355 Ga0070671_100017298 Ga0070671_1000172984 334
275 3300005355 Ga0070671_100053546 Ga0070671_1000535464 334
276 3300005356 Ga0070674_100011186 Ga0070674_1000111864 334
277 3300005356 Ga0070674_100081702 Ga0070674_1000817022 334
278 3300005356 Ga0070674_100096405 Ga0070674_1000964052 334
279 3300005364 Ga0070673_100001392 Ga0070673_10000139210 334
280 3300005364 Ga0070673_100039550 Ga0070673_1000395503 334
281 3300005364 Ga0070673_100040796 Ga0070673_1000407963 334
282 3300005364 Ga0070673_100064893 Ga0070673_1000648933 334
283 3300005364 Ga0070673_100086819 Ga0070673_1000868193 334
284 3300005366 Ga0070659_100003560 Ga0070659_1000035607 334
285 3300005366 Ga0070659_100027868 Ga0070659_1000278684 334
286 3300005366 Ga0070659_100076828 Ga0070659_1000768281 334
287 3300005366 Ga0070659_100182217 Ga0070659_1001822172 334
288 3300005367 Ga0070667_100000890 Ga0070667_10000089035 334
289 3300005367 Ga0070667_100005930 Ga0070667_1000059303 334
290 3300005367 Ga0070667_100019880 Ga0070667_1000198805 334
291 3300005367 Ga0070667_100021796 Ga0070667_1000217965 334
292 3300005436 Ga0070713_100433081 Ga0070713_1004330811 334
293 3300005444 Ga0070694_100014810 Ga0070694_1000148102 334
294 3300005455 Ga0070663_100063111 Ga0070663_1000631114 334
295 3300005455 Ga0070663_100165277 Ga0070663_1001652772 334
296 3300005456 Ga0070678_100023968 Ga0070678_1000239682 334
297 3300005456 Ga0070678_100050850 Ga0070678_1000508505 334
298 3300005456 Ga0070678_100050905 Ga0070678_1000509052 334
299 3300005457 Ga0070662_100008293 Ga0070662_1000082933 334
300 3300005457 Ga0070662_100057108 Ga0070662_1000571082 334
301 3300005457 Ga0070662_100067601 Ga0070662_1000676013 334
302 3300005457 Ga0070662_100074182 Ga0070662_1000741821 334
303 3300005457 Ga0070662_100078397 Ga0070662_1000783972 334
304 3300005459 Ga0068867_100018557 Ga0068867_1000185572 334
305 3300005530 Ga0070679_100238166 Ga0070679_1002381662 334
306 3300005539 Ga0068853_100192355 Ga0068853_1001923552 334
307 3300005539 Ga0068853_100266121 Ga0068853_1002661212 334
308 3300005543 Ga0070672_100000917 Ga0070672_1000009173 334
309 3300005543 Ga0070672_100030501 Ga0070672_1000305012 334
310 3300005543 Ga0070672_100048768 Ga0070672_1000487682 334
311 3300005543 Ga0070672_100101392 Ga0070672_1001013922 334
312 3300005546 Ga0070696_100007696 Ga0070696_1000076969 334
313 3300005547 Ga0070693_100060746 Ga0070693_1000607462 334
314 3300005547 Ga0070693_100137796 Ga0070693_1001377962 334
315 3300005548 Ga0070665_100000263 Ga0070665_10000026356 334
316 3300005548 Ga0070665_100006205 Ga0070665_1000062057 334
317 3300005548 Ga0070665_100020880 Ga0070665_1000208806 334
318 3300005548 Ga0070665_100048519 Ga0070665_1000485194 334
319 3300005548 Ga0070665_100314445 Ga0070665_1003144452 334
320 3300005563 Ga0068855_100046631 Ga0068855_1000466315 334
321 3300005563 Ga0068855_100167784 Ga0068855_1001677842 334
322 3300005563 Ga0068855_100319315 Ga0068855_1003193151 334
323 3300005564 Ga0070664_100008560 Ga0070664_1000085607 334
324 3300005564 Ga0070664_100010639 Ga0070664_1000106396 334
325 3300005564 Ga0070664_100014090 Ga0070664_1000140903 334
326 3300005564 Ga0070664_100044539 Ga0070664_1000445393 334
327 3300005564 Ga0070664_100060199 Ga0070664_1000601993 334
328 3300005577 Ga0068857_100013069 Ga0068857_1000130697 334
329 3300005577 Ga0068857_100020336 Ga0068857_1000203365 334
330 3300005578 Ga0068854_100006180 Ga0068854_1000061802 334
331 3300005578 Ga0068854_100169159 Ga0068854_1001691592 334
332 3300005614 Ga0068856_100030993 Ga0068856_1000309932 334
333 3300005614 Ga0068856_100423610 Ga0068856_1004236102 334
334 3300005616 Ga0068852_100017227 Ga0068852_1000172276 334
335 3300005616 Ga0068852_100152188 Ga0068852_1001521882 334
336 3300005617 Ga0068859_100014644 Ga0068859_1000146448 334
337 3300005617 Ga0068859_100052440 Ga0068859_1000524403 334
338 3300005617 Ga0068859_100069448 Ga0068859_1000694483 334
339 3300005617 Ga0068859_100134369 Ga0068859_1001343692 334
340 3300005617 Ga0068859_100205672 Ga0068859_1002056722 334
341 3300005617 Ga0068859_100248661 Ga0068859_1002486611 334
342 3300005618 Ga0068864_100013836 Ga0068864_1000138363 334
343 3300005618 Ga0068864_100016487 Ga0068864_1000164873 334
344 3300005718 Ga0068866_10146315 Ga0068866_101463152 334
345 3300005834 Ga0068851_10013545 Ga0068851_100135452 334
346 3300005834 Ga0068851_10036290 Ga0068851_100362902 334
347 3300005841 Ga0068863_100035480 Ga0068863_1000354803 334
348 3300005841 Ga0068863_100065720 Ga0068863_1000657203 334
349 3300005841 Ga0068863_100095042 Ga0068863_1000950423 334
350 3300005841 Ga0068863_100121267 Ga0068863_1001212673 334
351 3300005841 Ga0068863_100148569 Ga0068863_1001485692 334
352 3300005842 Ga0068858_100004176 Ga0068858_10000417610 334
353 3300005842 Ga0068858_100006611 Ga0068858_1000066114 334
354 3300005842 Ga0068858_100023321 Ga0068858_1000233212 334
355 3300005842 Ga0068858_100181176 Ga0068858_1001811761 334
356 3300005843 Ga0068860_100006380 Ga0068860_10000638013 334
357 3300005843 Ga0068860_100009482 Ga0068860_1000094825 334
358 3300005843 Ga0068860_100468381 Ga0068860_1004683811 334
359 3300005844 Ga0068862_100021749 Ga0068862_1000217494 334
360 3300005844 Ga0068862_100023676 Ga0068862_1000236765 334
361 3300005844 Ga0068862_100262033 Ga0068862_1002620332 334
362 3300005844 Ga0068862_100375446 Ga0068862_1003754462 334
363 3300005985 Ga0081539_10029738 Ga0081539_100297383 334
364 3300006237 Ga0097621_100051644 Ga0097621_1000516442 334
365 3300006358 Ga0068871_100002294 Ga0068871_10000229412 334
366 3300006931 Ga0097620_100014644 Ga0097620_1000146448 334
367 3300006931 Ga0097620_100052441 Ga0097620_1000524413 334
368 3300006931 Ga0097620_100069448 Ga0097620_1000694483 334
369 3300006931 Ga0097620_100134375 Ga0097620_1001343752 334
370 3300006931 Ga0097620_100205679 Ga0097620_1002056792 334
371 3300006931 Ga0097620_100248649 Ga0097620_1002486491 334
372 3300009093 Ga0105240_10609276 Ga0105240_106092761 334
373 3300009094 Ga0111539_10044238 Ga0111539_100442383 334
374 3300009098 Ga0105245_10104787 Ga0105245_101047873 334
375 3300009148 Ga0105243_10126651 Ga0105243_101266512 334
376 3300009177 Ga0105248_10045901 Ga0105248_100459016 334
377 3300009177 Ga0105248_10260229 Ga0105248_102602293 334
378 3300009177 Ga0105248_10283211 Ga0105248_102832112 334
379 3300009177 Ga0105248_10412395 Ga0105248_104123952 334
380 3300009177 Ga0105248_10530075 Ga0105248_105300751 334
381 3300009177 Ga0105248_10546571 Ga0105248_105465712 334
382 3300009551 Ga0105238_10056632 Ga0105238_100566322 334
383 3300009551 Ga0105238_10283466 Ga0105238_102834662 334
384 3300009551 Ga0105238_10428970 Ga0105238_104289702 334
385 3300013100 Ga0157373_10014941 Ga0157373_100149414 334
386 3300013100 Ga0157373_10066087 Ga0157373_100660873 334
387 3300013102 Ga0157371_10025834 Ga0157371_100258344 334
388 3300013102 Ga0157371_10048878 Ga0157371_100488782 334
389 3300013104 Ga0157370_10000534 Ga0157370_1000053412 334
390 3300013104 Ga0157370_10268096 Ga0157370_102680962 334
391 3300013296 Ga0157374_10118854 Ga0157374_101188543 334
392 3300013296 Ga0157374_10166140 Ga0157374_101661402 334
393 3300013297 Ga0157378_10400455 Ga0157378_104004551 334
394 3300013306 Ga0163162_10018552 Ga0163162_100185523 334
395 3300013306 Ga0163162_10420905 Ga0163162_104209052 334
396 3300013307 Ga0157372_10126532 Ga0157372_101265322 334
397 3300013308 Ga0157375_10025913 Ga0157375_100259137 334
398 3300013308 Ga0157375_10132837 Ga0157375_101328372 334
399 3300013308 Ga0157375_10174664 Ga0157375_101746641 334
400 3300014325 Ga0163163_10208332 Ga0163163_102083323 334
401 3300014325 Ga0163163_10382194 Ga0163163_103821942 334
402 3300014325 Ga0163163_10390267 Ga0163163_103902672 334
403 3300014745 Ga0157377_10204573 Ga0157377_102045731 334
404 3300014968 Ga0157379_10103939 Ga0157379_101039393 334
405 3300025315 Ga0207697_10001956 Ga0207697_100019563 334
406 3300025315 Ga0207697_10023189 Ga0207697_100231894 334
407 3300025321 Ga0207656_10028212 Ga0207656_100282122 334
408 3300025321 Ga0207656_10035674 Ga0207656_100356742 334
409 3300025893 Ga0207682_10005796 Ga0207682_100057964 334
410 3300025901 Ga0207688_10017535 Ga0207688_100175354 334
411 3300025901 Ga0207688_10133399 Ga0207688_101333992 334
412 3300025903 Ga0207680_10021002 Ga0207680_100210023 334
413 3300025903 Ga0207680_10044740 Ga0207680_100447402 334
414 3300025903 Ga0207680_10127257 Ga0207680_101272572 334
415 3300025904 Ga0207647_10004345 Ga0207647_100043454 334
416 3300025904 Ga0207647_10008836 Ga0207647_100088367 334
417 3300025904 Ga0207647_10077032 Ga0207647_100770323 334
418 3300025907 Ga0207645_10026094 Ga0207645_100260942 334
419 3300025907 Ga0207645_10129099 Ga0207645_101290992 334
420 3300025908 Ga0207643_10016508 Ga0207643_100165084 334
421 3300025909 Ga0207705_10008140 Ga0207705_100081405 334
422 3300025909 Ga0207705_10020148 Ga0207705_100201484 334
423 3300025909 Ga0207705_10066548 Ga0207705_100665482 334
424 3300025909 Ga0207705_10099384 Ga0207705_100993841 334
425 3300025919 Ga0207657_10001215 Ga0207657_1000121527 334
426 3300025919 Ga0207657_10008545 Ga0207657_100085453 334
427 3300025919 Ga0207657_10054212 Ga0207657_100542122 334
428 3300025919 Ga0207657_10062140 Ga0207657_100621403 334
429 3300025919 Ga0207657_10063327 Ga0207657_100633274 334
430 3300025919 Ga0207657_10067666 Ga0207657_100676661 334
431 3300025920 Ga0207649_10021846 Ga0207649_100218462 334
432 3300025920 Ga0207649_10050017 Ga0207649_100500173 334
433 3300025920 Ga0207649_10144063 Ga0207649_101440632 334
434 3300025920 Ga0207649_10287010 Ga0207649_102870102 334
435 3300025921 Ga0207652_10335326 Ga0207652_103353262 334
436 3300025923 Ga0207681_10019932 Ga0207681_100199323 334
437 3300025923 Ga0207681_10116716 Ga0207681_101167162 334
438 3300025924 Ga0207694_10013383 Ga0207694_100133835 334
439 3300025924 Ga0207694_10119444 Ga0207694_101194443 334
440 3300025925 Ga0207650_10014173 Ga0207650_100141734 334
441 3300025925 Ga0207650_10030095 Ga0207650_100300953 334
442 3300025925 Ga0207650_10039703 Ga0207650_100397032 334
443 3300025925 Ga0207650_10110688 Ga0207650_101106882 334
444 3300025925 Ga0207650_10313204 Ga0207650_103132041 334
445 3300025925 Ga0207650_10417651 Ga0207650_104176511 334
446 3300025926 Ga0207659_10003513 Ga0207659_100035133 334
447 3300025927 Ga0207687_10230506 Ga0207687_102305062 334
448 3300025929 Ga0207664_10193050 Ga0207664_101930502 334
449 3300025931 Ga0207644_10000337 Ga0207644_1000033710 334
450 3300025931 Ga0207644_10001551 Ga0207644_100015512 334
451 3300025931 Ga0207644_10009601 Ga0207644_100096015 334
452 3300025931 Ga0207644_10028693 Ga0207644_100286934 334
453 3300025931 Ga0207644_10112050 Ga0207644_101120501 334
454 3300025932 Ga0207690_10042858 Ga0207690_100428583 334
455 3300025932 Ga0207690_10053154 Ga0207690_100531542 334
456 3300025932 Ga0207690_10060529 Ga0207690_100605293 334
457 3300025932 Ga0207690_10093585 Ga0207690_100935853 334
458 3300025932 Ga0207690_10232132 Ga0207690_102321322 334
459 3300025933 Ga0207706_10035908 Ga0207706_100359083 334
460 3300025933 Ga0207706_10050476 Ga0207706_100504762 334
461 3300025933 Ga0207706_10056856 Ga0207706_100568563 334
462 3300025933 Ga0207706_10088117 Ga0207706_100881172 334
463 3300025933 Ga0207706_10149374 Ga0207706_101493742 334
464 3300025933 Ga0207706_10304357 Ga0207706_103043572 334
465 3300025937 Ga0207669_10072553 Ga0207669_100725532 334
466 3300025937 Ga0207669_10094293 Ga0207669_100942932 334
467 3300025938 Ga0207704_10225830 Ga0207704_102258302 334
468 3300025940 Ga0207691_10002549 Ga0207691_1000254914 334
469 3300025940 Ga0207691_10029927 Ga0207691_100299272 334
470 3300025940 Ga0207691_10060482 Ga0207691_100604823 334
471 3300025940 Ga0207691_10064337 Ga0207691_100643373 334
472 3300025941 Ga0207711_10001952 Ga0207711_1000195210 334
473 3300025941 Ga0207711_10033325 Ga0207711_100333252 334
474 3300025941 Ga0207711_10034408 Ga0207711_100344084 334
475 3300025941 Ga0207711_10444982 Ga0207711_104449822 334
476 3300025942 Ga0207689_10059348 Ga0207689_100593482 334
477 3300025942 Ga0207689_10123694 Ga0207689_101236943 334
478 3300025944 Ga0207661_10211581 Ga0207661_102115812 334
479 3300025945 Ga0207679_10012900 Ga0207679_100129002 334
480 3300025945 Ga0207679_10026910 Ga0207679_100269104 334
481 3300025945 Ga0207679_10043129 Ga0207679_100431292 334
482 3300025945 Ga0207679_10054510 Ga0207679_100545102 334
483 3300025945 Ga0207679_10136555 Ga0207679_101365552 334
484 3300025945 Ga0207679_10245440 Ga0207679_102454401 334
485 3300025949 Ga0207667_10024808 Ga0207667_100248084 334
486 3300025949 Ga0207667_10181138 Ga0207667_101811383 334
487 3300025949 Ga0207667_10244301 Ga0207667_102443011 334
488 3300025949 Ga0207667_10462666 Ga0207667_104626662 334
489 3300025960 Ga0207651_10001158 Ga0207651_100011589 334
490 3300025960 Ga0207651_10008937 Ga0207651_100089375 334
491 3300025960 Ga0207651_10009792 Ga0207651_100097923 334
492 3300025960 Ga0207651_10031745 Ga0207651_100317452 334
493 3300025960 Ga0207651_10038159 Ga0207651_100381593 334
494 3300025960 Ga0207651_10119596 Ga0207651_101195962 334
495 3300025960 Ga0207651_10353133 Ga0207651_103531332 334
496 3300025961 Ga0207712_10004041 Ga0207712_100040418 334
497 3300025972 Ga0207668_10108454 Ga0207668_101084542 334
498 3300025981 Ga0207640_10032063 Ga0207640_100320633 334
499 3300025981 Ga0207640_10047829 Ga0207640_100478292 334
500 3300025981 Ga0207640_10093359 Ga0207640_100933591 334
501 3300025986 Ga0207658_10014720 Ga0207658_100147202 334
502 3300025986 Ga0207658_10016848 Ga0207658_100168485 334
503 3300025986 Ga0207658_10032330 Ga0207658_100323302 334
504 3300025986 Ga0207658_10112305 Ga0207658_101123053 334
505 3300026023 Ga0207677_10022265 Ga0207677_100222654 334
506 3300026023 Ga0207677_10207589 Ga0207677_102075892 334
507 3300026035 Ga0207703_10008490 Ga0207703_100084902 334
508 3300026035 Ga0207703_10155284 Ga0207703_101552842 334
509 3300026041 Ga0207639_10026546 Ga0207639_100265462 334
510 3300026041 Ga0207639_10353163 Ga0207639_103531631 334
511 3300026067 Ga0207678_10004845 Ga0207678_1000484511 334
512 3300026067 Ga0207678_10005822 Ga0207678_100058228 334
513 3300026067 Ga0207678_10019092 Ga0207678_100190923 334
514 3300026067 Ga0207678_10073432 Ga0207678_100734323 334
515 3300026067 Ga0207678_10074238 Ga0207678_100742385 334
516 3300026078 Ga0207702_10116389 Ga0207702_101163892 334
517 3300026078 Ga0207702_10237909 Ga0207702_102379092 334
518 3300026088 Ga0207641_10037617 Ga0207641_100376173 334
519 3300026088 Ga0207641_10076295 Ga0207641_100762953 334
520 3300026088 Ga0207641_10148679 Ga0207641_101486792 334
521 3300026088 Ga0207641_10225883 Ga0207641_102258832 334
522 3300026089 Ga0207648_10028079 Ga0207648_100280793 334
523 3300026089 Ga0207648_10039403 Ga0207648_100394033 334
524 3300026095 Ga0207676_10008298 Ga0207676_100082988 334
525 3300026095 Ga0207676_10038306 Ga0207676_100383063 334
526 3300026095 Ga0207676_10039178 Ga0207676_100391784 334
527 3300026095 Ga0207676_10065793 Ga0207676_100657932 334
528 3300026116 Ga0207674_10031006 Ga0207674_100310066 334
529 3300026116 Ga0207674_10060359 Ga0207674_100603593 334
530 3300026121 Ga0207683_10022732 Ga0207683_100227324 334
531 3300026121 Ga0207683_10086633 Ga0207683_100866332 334
532 3300026121 Ga0207683_10101089 Ga0207683_101010893 334
533 3300026142 Ga0207698_10158059 Ga0207698_101580592 334
534 3300027876 Ga0209974_10043482 Ga0209974_100434821 334
535 3300027907 Ga0207428_10074456 Ga0207428_100744562 334
536 3300028379 Ga0268266_10000135 Ga0268266_1000013511 334
537 3300028379 Ga0268266_10004437 Ga0268266_100044377 334
538 3300028379 Ga0268266_10012798 Ga0268266_100127981 334
539 3300028379 Ga0268266_10034869 Ga0268266_100348694 334
540 3300028379 Ga0268266_10042780 Ga0268266_100427803 334
541 3300028379 Ga0268266_10270540 Ga0268266_102705402 334
542 3300028380 Ga0268265_10007223 Ga0268265_100072237 334
543 3300028380 Ga0268265_10063211 Ga0268265_100632112 334
544 3300028380 Ga0268265_10070179 Ga0268265_100701792 334
545 3300028380 Ga0268265_10178745 Ga0268265_101787452 334
546 3300028381 Ga0268264_10000379 Ga0268264_1000037948 334
547 3300028381 Ga0268264_10020182 Ga0268264_100201825 334
548 3300028381 Ga0268264_10023994 Ga0268264_100239943 334
549 3300028381 Ga0268264_10095705 Ga0268264_100957053 334
550 3300031548 Ga0307408_100020482 Ga0307408_1000204824 334
551 3300031548 Ga0307408_100033459 Ga0307408_1000334592 334
552 3300031548 Ga0307408_100258412 Ga0307408_1002584121 334
553 3300031731 Ga0307405_10011197 Ga0307405_100111975 334
554 3300031731 Ga0307405_10037966 Ga0307405_100379662 334
555 3300031731 Ga0307405_10043202 Ga0307405_100432023 334
556 3300031731 Ga0307405_10056914 Ga0307405_100569143 334
557 3300031731 Ga0307405_10128908 Ga0307405_101289083 334
558 3300031731 Ga0307405_10202671 Ga0307405_102026712 334
559 3300031824 Ga0307413_10017532 Ga0307413_100175322 334
560 3300031824 Ga0307413_10019334 Ga0307413_100193344 334
561 3300031824 Ga0307413_10019401 Ga0307413_100194013 334
562 3300031824 Ga0307413_10073603 Ga0307413_100736034 334
563 3300031852 Ga0307410_10023220 Ga0307410_100232203 334
564 3300031852 Ga0307410_10046567 Ga0307410_100465673 334
565 3300031852 Ga0307410_10187243 Ga0307410_101872432 334
566 3300031901 Ga0307406_10024256 Ga0307406_100242562 334
567 3300031901 Ga0307406_10024571 Ga0307406_100245713 334
568 3300031901 Ga0307406_10106665 Ga0307406_101066653 334
569 3300031903 Ga0307407_10002391 Ga0307407_100023913 334
570 3300031903 Ga0307407_10016894 Ga0307407_100168943 334
571 3300031903 Ga0307407_10045519 Ga0307407_100455193 334
572 3300031903 Ga0307407_10104804 Ga0307407_101048042 334
573 3300031911 Ga0307412_10005917 Ga0307412_100059176 334
574 3300031911 Ga0307412_10019110 Ga0307412_100191102 334
575 3300031911 Ga0307412_10126219 Ga0307412_101262191 334
576 3300031995 Ga0307409_100004448 Ga0307409_1000044483 334
577 3300031995 Ga0307409_100056183 Ga0307409_1000561832 334
578 3300032002 Ga0307416_100088434 Ga0307416_1000884343 334
579 3300032002 Ga0307416_100172955 Ga0307416_1001729552 334
580 3300032002 Ga0307416_100394411 Ga0307416_1003944111 334
581 3300032004 Ga0307414_10074202 Ga0307414_100742021 334
582 3300032005 Ga0307411_10001121 Ga0307411_1000112110 334
583 3300032005 Ga0307411_10014373 Ga0307411_100143734 334
584 3300032005 Ga0307411_10038575 Ga0307411_100385753 334
585 3300032005 Ga0307411_10099266 Ga0307411_100992663 334
586 3300032005 Ga0307411_10205677 Ga0307411_102056772 334
587 3300032126 Ga0307415_100039821 Ga0307415_1000398213 334
588 3300032126 Ga0307415_100059200 Ga0307415_1000592003 334
589 3300032126 Ga0307415_100073507 Ga0307415_1000735072 334
590 3300032126 Ga0307415_100073770 Ga0307415_1000737702 334
591 3300032126 Ga0307415_100250648 Ga0307415_1002506482 334
592 3300035170 Ga0373943_0001240 Ga0373943_0001240_616_1620 334
593 3300035171 Ga0373946_0027962 Ga0373946_0027962_297_1301 334
594 3300035691 Ga0373931_0031800 Ga0373931_0031800_789_1793 334
595 3300035692 Ga0373935_0060767 Ga0373935_0060767_323_1327 334
596 3300035695 Ga0373927_0111058 Ga0373927_0111058_569_1573 334
597 3300037312 Ga0395899_0000112 Ga0395899_0000112_59167_60171 334
598 3300037312 Ga0395899_0023916 Ga0395899_0023916_838_1851 334
599 3300037312 Ga0395899_0097730 Ga0395899_0097730_960_1964 334
600 3300037312 Ga0395899_0118454 Ga0395899_0118454_666_1670 334
601 3300037312 Ga0395899_0126671 Ga0395899_0126671_297_1301 334
602 3300037418 Ga0395900_0002089 Ga0395900_0002089_11043_12047 334
603 3300037418 Ga0395900_0035542 Ga0395900_0035542_82_1086 334
604 3300037418 Ga0395900_0040549 Ga0395900_0040549_553_1557 334
605 3300037418 Ga0395900_0073325 Ga0395900_0073325_1723_2736 334
606 3300037418 Ga0395900_0074568 Ga0395900_0074568_2409_3422 334
607 3300037418 Ga0395900_0076414 Ga0395900_0076414_1140_2144 334
608 3300037418 Ga0395900_0121919 Ga0395900_0121919_318_1322 334
609 3300037418 Ga0395900_0152625 Ga0395900_0152625_18_1022 334
610 3300037418 Ga0395900_0195762 Ga0395900_0195762_555_1559 334
611 3300037466 Ga0395898_0002211 Ga0395898_0002211_6256_7260 334
612 3300037466 Ga0395898_0037617 Ga0395898_0037617_3208_4221 334
613 3300037466 Ga0395898_0251678 Ga0395898_0251678_114_1118 334
614 3300037471 Ga0395905_0009689 Ga0395905_0009689_7978_8991 334
615 3300037471 Ga0395905_0011208 Ga0395905_0011208_5692_6705 334
616 3300037471 Ga0395905_0012107 Ga0395905_0012107_4649_5653 334
617 3300037471 Ga0395905_0015993 Ga0395905_0015993_5381_6385 334
618 3300037471 Ga0395905_0017791 Ga0395905_0017791_5177_6181 334
619 3300037471 Ga0395905_0025864 Ga0395905_0025864_2056_3060 334
620 3300037471 Ga0395905_0035085 Ga0395905_0035085_498_1502 334
621 3300037471 Ga0395905_0044675 Ga0395905_0044675_2749_3753 334
622 3300037471 Ga0395905_0062854 Ga0395905_0062854_414_1418 334
623 3300037471 Ga0395905_0072179 Ga0395905_0072179_540_1544 334
624 3300037471 Ga0395905_0113485 Ga0395905_0113485_586_1590 334
625 3300037471 Ga0395905_0160564 Ga0395905_0160564_1014_2018 334
626 3300037471 Ga0395905_0435964 Ga0395905_0435964_91_1095 334
627 3300038443 Ga0395901_0000047 Ga0395901_0000047_23969_24973 334
628 3300038443 Ga0395901_0011751 Ga0395901_0011751_5137_6150 334
629 3300038443 Ga0395901_0022632 Ga0395901_0022632_2788_3792 334
630 3300038443 Ga0395901_0239083 Ga0395901_0239083_396_1400 334
631 3300042142 Ga0450905_000655 Ga0450905_000655_1090_2094 334
632 3300042144 Ga0450889_000066 Ga0450889_000066_7136_8140 334
633 3300042439 Ga0439464_0000114 Ga0439464_0000114_2887_3891 334
634 3300044658 Ga0466972_0067536 Ga0466972_0067536_230_1234 334
635 3300044684 Ga0466966_0048296 Ga0466966_0048296_18_1022 334
636 3300044693 Ga0466961_0106360 Ga0466961_0106360_100_1104 334
637 3300044735 Ga0466968_0027315 Ga0466968_0027315_688_1692 334
638 3300044765 Ga0466970_0195100 Ga0466970_0195100_34_1038 334
639 3300044842 Ga0466957_0029216 Ga0466957_0029216_49_1053 334
640 3300044901 Ga0466960_0150024 Ga0466960_0150024_102_1106 334
641 3300045836 Ga0466958_0033341 Ga0466958_0033341_617_1621 334
642 3300045836 Ga0466958_0119877 Ga0466958_0119877_607_1611 334
643 3300045836 Ga0466958_0239545 Ga0466958_0239545_11_1015 334
644 3300045976 Ga0466967_0274702 Ga0466967_0274702_117_1121 334
645 3300046539 Ga0495621_0034445 Ga0495621_0034445_568_1572 334
646 3300046684 Ga0495669_0030368 Ga0495669_0030368_537_1541 334
647 3300046684 Ga0495669_0087027 Ga0495669_0087027_155_1159 334
648 3300048903 Ga0496100_0001078 Ga0496100_0001078_12111_13115 334
649 3300048904 Ga0496101_0001752 Ga0496101_0001752_3178_4182 334
650 3300048904 Ga0496101_0085686 Ga0496101_0085686_229_1233 334
651 3300048905 Ga0496102_0079632 Ga0496102_0079632_1661_2665 334
652 3300048908 Ga0496105_0061873 Ga0496105_0061873_1494_2498 334
653 3300048909 Ga0496106_0001618 Ga0496106_0001618_12123_13127 334
654 3300048911 Ga0496108_0005548 Ga0496108_0005548_580_1584 334
655 3300048912 Ga0496109_0011136 Ga0496109_0011136_920_1924 334
656 3300048912 Ga0496109_0019804 Ga0496109_0019804_2335_3339 334
657 3300048913 Ga0496110_0000819 Ga0496110_0000819_7401_8405 334
658 3300048914 Ga0496111_0000373 Ga0496111_0000373_11790_12794 334
659 3300048914 Ga0496111_0113580 Ga0496111_0113580_341_1345 334
660 3300048915 Ga0496112_0006544 Ga0496112_0006544_1479_2483 334
661 3300048915 Ga0496112_0034465 Ga0496112_0034465_2649_3653 334
662 3300048915 Ga0496112_0086875 Ga0496112_0086875_456_1460 334
663 3300048916 Ga0496113_0002966 Ga0496113_0002966_7685_8689 334
664 3300048916 Ga0496113_0008017 Ga0496113_0008017_393_1397 334
665 3300048917 Ga0496114_0000019 Ga0496114_0000019_39116_40120 334
666 3300048917 Ga0496114_0059129 Ga0496114_0059129_53_1057 334
667 3300049584 Ga0501068_0012439 Ga0501068_0012439_1985_2989 334
668 3300049664 Ga0501224_009595 Ga0501224_009595_381_1385 334
669 3300049705 Ga0501225_0012730 Ga0501225_0012730_47_1051 334
670 3300049742 Ga0501080_0160564 Ga0501080_0160564_351_1355 334
671 3300049770 Ga0501273_002366 Ga0501273_002366_836_1840 334
672 3300049851 Ga0501212_002735 Ga0501212_002735_874_1878 334
673 3300050511 nmdc:mga08y16_24694_c1 nmdc:mga08y16_24694_c1_4463_5467 334
674 3300001904 JGI24736J21556_1000562 JGI24736J21556_10005624 335
675 3300001976 JGI24752J21851_1003533 JGI24752J21851_10035332 335
676 3300001979 JGI24740J21852_10014226 JGI24740J21852_100142263 335
677 3300001990 JGI24737J22298_10000516 JGI24737J22298_100005163 335
678 3300005327 Ga0070658_10003471 Ga0070658_100034715 335
679 3300005327 Ga0070658_10004728 Ga0070658_1000472812 335
680 3300005327 Ga0070658_10058090 Ga0070658_100580903 335
681 3300005327 Ga0070658_10147149 Ga0070658_101471492 335
682 3300005327 Ga0070658_10212757 Ga0070658_102127572 335
683 3300005327 Ga0070658_10246709 Ga0070658_102467091 335
684 3300005328 Ga0070676_10012417 Ga0070676_100124175 335
685 3300005328 Ga0070676_10255573 Ga0070676_102555731 335
686 3300005329 Ga0070683_100002165 Ga0070683_1000021655 335
687 3300005329 Ga0070683_100058398 Ga0070683_1000583984 335
688 3300005329 Ga0070683_100098027 Ga0070683_1000980273 335
689 3300005331 Ga0070670_100015333 Ga0070670_1000153334 335
690 3300005331 Ga0070670_100028510 Ga0070670_1000285103 335
691 3300005331 Ga0070670_100037665 Ga0070670_1000376652 335
692 3300005331 Ga0070670_100297622 Ga0070670_1002976222 335
693 3300005333 Ga0070677_10000298 Ga0070677_1000029815 335
694 3300005335 Ga0070666_10011414 Ga0070666_100114144 335
695 3300005336 Ga0070680_100000414 Ga0070680_10000041418 335
696 3300005336 Ga0070680_100003672 Ga0070680_1000036724 335
697 3300005336 Ga0070680_100010477 Ga0070680_1000104775 335
698 3300005336 Ga0070680_100058607 Ga0070680_1000586073 335
699 3300005336 Ga0070680_100081990 Ga0070680_1000819902 335
700 3300005337 Ga0070682_100040301 Ga0070682_1000403012 335
701 3300005338 Ga0068868_100058325 Ga0068868_1000583254 335
702 3300005339 Ga0070660_100000627 Ga0070660_1000006272 335
703 3300005339 Ga0070660_100009134 Ga0070660_1000091343 335
704 3300005339 Ga0070660_100022269 Ga0070660_1000222695 335
705 3300005339 Ga0070660_100026958 Ga0070660_1000269583 335
706 3300005339 Ga0070660_100060009 Ga0070660_1000600093 335
707 3300005339 Ga0070660_100165614 Ga0070660_1001656142 335
708 3300005339 Ga0070660_100236591 Ga0070660_1002365912 335
709 3300005339 Ga0070660_100331388 Ga0070660_1003313882 335
710 3300005344 Ga0070661_100025576 Ga0070661_1000255763 335
711 3300005344 Ga0070661_100046361 Ga0070661_1000463611 335
712 3300005344 Ga0070661_100050711 Ga0070661_1000507113 335
713 3300005344 Ga0070661_100051636 Ga0070661_1000516363 335
714 3300005344 Ga0070661_100105046 Ga0070661_1001050463 335
715 3300005344 Ga0070661_100114465 Ga0070661_1001144652 335
716 3300005345 Ga0070692_10043649 Ga0070692_100436494 335
717 3300005345 Ga0070692_10132833 Ga0070692_101328332 335
718 3300005347 Ga0070668_100022403 Ga0070668_1000224032 335
719 3300005347 Ga0070668_100058142 Ga0070668_1000581422 335
720 3300005353 Ga0070669_100004811 Ga0070669_1000048116 335
721 3300005353 Ga0070669_100028120 Ga0070669_1000281203 335
722 3300005354 Ga0070675_100001645 Ga0070675_1000016452 335
723 3300005354 Ga0070675_100018886 Ga0070675_1000188863 335
724 3300005355 Ga0070671_100004740 Ga0070671_1000047409 335
725 3300005355 Ga0070671_100005881 Ga0070671_1000058813 335
726 3300005355 Ga0070671_100007951 Ga0070671_1000079512 335
727 3300005355 Ga0070671_100020238 Ga0070671_1000202384 335
728 3300005355 Ga0070671_100094999 Ga0070671_1000949993 335
729 3300005356 Ga0070674_100000834 Ga0070674_10000083413 335
730 3300005356 Ga0070674_100032370 Ga0070674_1000323702 335
731 3300005364 Ga0070673_100005382 Ga0070673_1000053824 335
732 3300005364 Ga0070673_100113318 Ga0070673_1001133182 335
733 3300005364 Ga0070673_100204708 Ga0070673_1002047082 335
734 3300005364 Ga0070673_100390177 Ga0070673_1003901771 335
735 3300005366 Ga0070659_100037123 Ga0070659_1000371232 335
736 3300005366 Ga0070659_100052490 Ga0070659_1000524902 335
737 3300005366 Ga0070659_100279114 Ga0070659_1002791142 335
738 3300005435 Ga0070714_100019298 Ga0070714_1000192985 335
739 3300005435 Ga0070714_100062414 Ga0070714_1000624142 335
740 3300005455 Ga0070663_100057847 Ga0070663_1000578472 335
741 3300005455 Ga0070663_100098704 Ga0070663_1000987042 335
742 3300005455 Ga0070663_100298642 Ga0070663_1002986421 335
743 3300005456 Ga0070678_100002614 Ga0070678_1000026141 335
744 3300005456 Ga0070678_100003037 Ga0070678_1000030371 335
745 3300005456 Ga0070678_100019171 Ga0070678_1000191712 335
746 3300005456 Ga0070678_100035376 Ga0070678_1000353762 335
747 3300005457 Ga0070662_100000256 Ga0070662_10000025615 335
748 3300005457 Ga0070662_100013344 Ga0070662_1000133443 335
749 3300005457 Ga0070662_100019462 Ga0070662_1000194625 335
750 3300005457 Ga0070662_100020341 Ga0070662_1000203415 335
751 3300005458 Ga0070681_10229538 Ga0070681_102295382 335
752 3300005459 Ga0068867_100040809 Ga0068867_1000408092 335
753 3300005530 Ga0070679_100017863 Ga0070679_1000178635 335
754 3300005530 Ga0070679_100140170 Ga0070679_1001401703 335
755 3300005535 Ga0070684_100006623 Ga0070684_1000066235 335
756 3300005535 Ga0070684_100038517 Ga0070684_1000385172 335
757 3300005535 Ga0070684_100176248 Ga0070684_1001762483 335
758 3300005539 Ga0068853_100114982 Ga0068853_1001149822 335
759 3300005539 Ga0068853_100242470 Ga0068853_1002424701 335
760 3300005543 Ga0070672_100001894 Ga0070672_1000018942 335
761 3300005543 Ga0070672_100013224 Ga0070672_1000132244 335
762 3300005543 Ga0070672_100057442 Ga0070672_1000574423 335
763 3300005544 Ga0070686_100294047 Ga0070686_1002940471 335
764 3300005548 Ga0070665_100062976 Ga0070665_1000629762 335
765 3300005563 Ga0068855_100001243 Ga0068855_10000124315 335
766 3300005563 Ga0068855_100044405 Ga0068855_1000444054 335
767 3300005563 Ga0068855_100044650 Ga0068855_1000446505 335
768 3300005563 Ga0068855_100055407 Ga0068855_1000554074 335
769 3300005563 Ga0068855_100176298 Ga0068855_1001762984 335
770 3300005564 Ga0070664_100027717 Ga0070664_1000277174 335
771 3300005577 Ga0068857_100003128 Ga0068857_1000031286 335
772 3300005577 Ga0068857_100181159 Ga0068857_1001811592 335
773 3300005578 Ga0068854_100056884 Ga0068854_1000568842 335
774 3300005578 Ga0068854_100164848 Ga0068854_1001648482 335
775 3300005614 Ga0068856_100157351 Ga0068856_1001573513 335
776 3300005614 Ga0068856_100179749 Ga0068856_1001797492 335
777 3300005614 Ga0068856_100333557 Ga0068856_1003335572 335
778 3300005616 Ga0068852_100006103 Ga0068852_10000610310 335
779 3300005616 Ga0068852_100010004 Ga0068852_1000100042 335
780 3300005616 Ga0068852_100016684 Ga0068852_1000166843 335
781 3300005616 Ga0068852_100020061 Ga0068852_1000200613 335
782 3300005616 Ga0068852_100275081 Ga0068852_1002750812 335
783 3300005617 Ga0068859_100000965 Ga0068859_10000096520 335
784 3300005618 Ga0068864_100018079 Ga0068864_1000180794 335
785 3300005618 Ga0068864_100096727 Ga0068864_1000967272 335
786 3300005618 Ga0068864_100193285 Ga0068864_1001932852 335
787 3300005618 Ga0068864_100389866 Ga0068864_1003898662 335
788 3300005719 Ga0068861_100003405 Ga0068861_1000034058 335
789 3300005840 Ga0068870_10054760 Ga0068870_100547602 335
790 3300005841 Ga0068863_100003063 Ga0068863_1000030637 335
791 3300005841 Ga0068863_100017895 Ga0068863_1000178956 335
792 3300005841 Ga0068863_100027343 Ga0068863_1000273432 335
793 3300005842 Ga0068858_100023020 Ga0068858_1000230204 335
794 3300005843 Ga0068860_100034446 Ga0068860_1000344462 335
795 3300005843 Ga0068860_100205417 Ga0068860_1002054172 335
796 3300005843 Ga0068860_100301044 Ga0068860_1003010442 335
797 3300005844 Ga0068862_100073059 Ga0068862_1000730592 335
798 3300005844 Ga0068862_100196152 Ga0068862_1001961522 335
799 3300005985 Ga0081539_10010379 Ga0081539_100103794 335
800 3300006028 Ga0070717_10000436 Ga0070717_100004363 335
801 3300006237 Ga0097621_100005316 Ga0097621_1000053165 335
802 3300006237 Ga0097621_100333469 Ga0097621_1003334692 335
803 3300006358 Ga0068871_100018114 Ga0068871_1000181145 335
804 3300006881 Ga0068865_100031905 Ga0068865_1000319054 335
805 3300006881 Ga0068865_100172129 Ga0068865_1001721292 335
806 3300006931 Ga0097620_100000965 Ga0097620_10000096520 335
807 3300009093 Ga0105240_10043075 Ga0105240_100430756 335
808 3300009093 Ga0105240_10354610 Ga0105240_103546102 335
809 3300009177 Ga0105248_10000747 Ga0105248_1000074710 335
810 3300009177 Ga0105248_10021773 Ga0105248_100217734 335
811 3300009177 Ga0105248_10028459 Ga0105248_100284592 335
812 3300009177 Ga0105248_10030243 Ga0105248_100302432 335
813 3300009177 Ga0105248_10041093 Ga0105248_100410935 335
814 3300009177 Ga0105248_10048508 Ga0105248_100485084 335
815 3300009553 Ga0105249_10031412 Ga0105249_100314122 335
816 3300011119 Ga0105246_10072834 Ga0105246_100728343 335
817 3300013100 Ga0157373_10219144 Ga0157373_102191442 335
818 3300013102 Ga0157371_10004455 Ga0157371_100044555 335
819 3300013102 Ga0157371_10007858 Ga0157371_100078582 335
820 3300013102 Ga0157371_10018108 Ga0157371_100181086 335
821 3300013102 Ga0157371_10037920 Ga0157371_100379203 335
822 3300013104 Ga0157370_10088918 Ga0157370_100889182 335
823 3300013104 Ga0157370_10100465 Ga0157370_101004653 335
824 3300013104 Ga0157370_10120017 Ga0157370_101200171 335
825 3300013105 Ga0157369_10005054 Ga0157369_100050545 335
826 3300013105 Ga0157369_10008575 Ga0157369_100085755 335
827 3300013105 Ga0157369_10048390 Ga0157369_100483905 335
828 3300013105 Ga0157369_10060439 Ga0157369_100604395 335
829 3300013105 Ga0157369_10500970 Ga0157369_105009702 335
830 3300013296 Ga0157374_10107974 Ga0157374_101079742 335
831 3300013297 Ga0157378_10161711 Ga0157378_101617111 335
832 3300013306 Ga0163162_10015055 Ga0163162_100150554 335
833 3300013307 Ga0157372_10337075 Ga0157372_103370752 335
834 3300013307 Ga0157372_10526816 Ga0157372_105268162 335
835 3300013308 Ga0157375_10015725 Ga0157375_100157254 335
836 3300014325 Ga0163163_10012850 Ga0163163_100128504 335
837 3300014325 Ga0163163_10046317 Ga0163163_100463173 335
838 3300014326 Ga0157380_10001273 Ga0157380_100012739 335
839 3300014326 Ga0157380_10003250 Ga0157380_1000325014 335
840 3300014326 Ga0157380_10209880 Ga0157380_102098802 335
841 3300014326 Ga0157380_10371281 Ga0157380_103712812 335
842 3300017792 Ga0163161_10034882 Ga0163161_100348823 335
843 3300017792 Ga0163161_10321670 Ga0163161_103216701 335
844 3300020082 Ga0206353_10715458 Ga0206353_107154583 335
845 3300025315 Ga0207697_10000510 Ga0207697_1000051023 335
846 3300025899 Ga0207642_10126855 Ga0207642_101268552 335
847 3300025901 Ga0207688_10038819 Ga0207688_100388193 335
848 3300025903 Ga0207680_10005049 Ga0207680_100050494 335
849 3300025904 Ga0207647_10004501 Ga0207647_100045018 335
850 3300025904 Ga0207647_10029990 Ga0207647_100299902 335
851 3300025904 Ga0207647_10040243 Ga0207647_100402433 335
852 3300025904 Ga0207647_10061207 Ga0207647_100612072 335
853 3300025907 Ga0207645_10010661 Ga0207645_100106614 335
854 3300025908 Ga0207643_10062341 Ga0207643_100623412 335
855 3300025909 Ga0207705_10000091 Ga0207705_1000009126 335
856 3300025909 Ga0207705_10000101 Ga0207705_1000010169 335
857 3300025909 Ga0207705_10000997 Ga0207705_1000099719 335
858 3300025909 Ga0207705_10003327 Ga0207705_1000332710 335
859 3300025909 Ga0207705_10004509 Ga0207705_100045092 335
860 3300025909 Ga0207705_10015423 Ga0207705_100154237 335
861 3300025909 Ga0207705_10019104 Ga0207705_100191046 335
862 3300025909 Ga0207705_10046209 Ga0207705_100462093 335
863 3300025909 Ga0207705_10066304 Ga0207705_100663043 335
864 3300025909 Ga0207705_10070853 Ga0207705_100708531 335
865 3300025909 Ga0207705_10131203 Ga0207705_101312032 335
866 3300025909 Ga0207705_10149971 Ga0207705_101499713 335
867 3300025909 Ga0207705_10229851 Ga0207705_102298512 335
868 3300025909 Ga0207705_10252438 Ga0207705_102524381 335
869 3300025913 Ga0207695_10002104 Ga0207695_1000210412 335
870 3300025913 Ga0207695_10333287 Ga0207695_103332872 335
871 3300025917 Ga0207660_10003728 Ga0207660_100037286 335
872 3300025919 Ga0207657_10001561 Ga0207657_1000156126 335
873 3300025919 Ga0207657_10002718 Ga0207657_100027184 335
874 3300025919 Ga0207657_10004234 Ga0207657_1000423410 335
875 3300025919 Ga0207657_10006559 Ga0207657_1000655913 335
876 3300025919 Ga0207657_10015066 Ga0207657_100150666 335
877 3300025919 Ga0207657_10050867 Ga0207657_100508674 335
878 3300025919 Ga0207657_10083366 Ga0207657_100833664 335
879 3300025919 Ga0207657_10103194 Ga0207657_101031941 335
880 3300025920 Ga0207649_10000720 Ga0207649_1000072013 335
881 3300025920 Ga0207649_10013079 Ga0207649_100130793 335
882 3300025920 Ga0207649_10014400 Ga0207649_100144003 335
883 3300025920 Ga0207649_10038244 Ga0207649_100382442 335
884 3300025920 Ga0207649_10178072 Ga0207649_101780722 335
885 3300025920 Ga0207649_10202204 Ga0207649_102022042 335
886 3300025923 Ga0207681_10001451 Ga0207681_1000145115 335
887 3300025923 Ga0207681_10041905 Ga0207681_100419052 335
888 3300025923 Ga0207681_10133720 Ga0207681_101337202 335
889 3300025924 Ga0207694_10209878 Ga0207694_102098781 335
890 3300025925 Ga0207650_10003083 Ga0207650_100030832 335
891 3300025925 Ga0207650_10011727 Ga0207650_100117274 335
892 3300025925 Ga0207650_10020694 Ga0207650_100206942 335
893 3300025925 Ga0207650_10078272 Ga0207650_100782723 335
894 3300025925 Ga0207650_10121161 Ga0207650_101211612 335
895 3300025925 Ga0207650_10221770 Ga0207650_102217702 335
896 3300025926 Ga0207659_10009722 Ga0207659_100097225 335
897 3300025926 Ga0207659_10146801 Ga0207659_101468012 335
898 3300025928 Ga0207700_10079372 Ga0207700_100793723 335
899 3300025929 Ga0207664_10128022 Ga0207664_101280222 335
900 3300025929 Ga0207664_10161029 Ga0207664_101610292 335
901 3300025931 Ga0207644_10003876 Ga0207644_100038766 335
902 3300025931 Ga0207644_10004611 Ga0207644_100046115 335
903 3300025931 Ga0207644_10005737 Ga0207644_100057374 335
904 3300025931 Ga0207644_10015884 Ga0207644_100158844 335
905 3300025931 Ga0207644_10142135 Ga0207644_101421352 335
906 3300025932 Ga0207690_10002872 Ga0207690_100028727 335
907 3300025932 Ga0207690_10024467 Ga0207690_100244671 335
908 3300025932 Ga0207690_10083515 Ga0207690_100835153 335
909 3300025932 Ga0207690_10085658 Ga0207690_100856582 335
910 3300025933 Ga0207706_10000890 Ga0207706_1000089016 335
911 3300025933 Ga0207706_10006778 Ga0207706_100067785 335
912 3300025933 Ga0207706_10029723 Ga0207706_100297233 335
913 3300025933 Ga0207706_10054361 Ga0207706_100543613 335
914 3300025937 Ga0207669_10000764 Ga0207669_1000076413 335
915 3300025938 Ga0207704_10178120 Ga0207704_101781202 335
916 3300025940 Ga0207691_10030480 Ga0207691_100304803 335
917 3300025940 Ga0207691_10044326 Ga0207691_100443264 335
918 3300025940 Ga0207691_10088060 Ga0207691_100880603 335
919 3300025940 Ga0207691_10172779 Ga0207691_101727793 335
920 3300025941 Ga0207711_10004112 Ga0207711_100041126 335
921 3300025941 Ga0207711_10009801 Ga0207711_100098012 335
922 3300025944 Ga0207661_10001586 Ga0207661_100015866 335
923 3300025945 Ga0207679_10030123 Ga0207679_100301233 335
924 3300025945 Ga0207679_10052433 Ga0207679_100524333 335
925 3300025945 Ga0207679_10139420 Ga0207679_101394202 335
926 3300025945 Ga0207679_10145362 Ga0207679_101453623 335
927 3300025949 Ga0207667_10000122 Ga0207667_1000012211 335
928 3300025949 Ga0207667_10043094 Ga0207667_100430941 335
929 3300025949 Ga0207667_10294652 Ga0207667_102946522 335
930 3300025960 Ga0207651_10003210 Ga0207651_100032104 335
931 3300025960 Ga0207651_10088564 Ga0207651_100885642 335
932 3300025960 Ga0207651_10110219 Ga0207651_101102192 335
933 3300025960 Ga0207651_10340852 Ga0207651_103408522 335
934 3300025961 Ga0207712_10007327 Ga0207712_100073275 335
935 3300025972 Ga0207668_10000725 Ga0207668_1000072511 335
936 3300025972 Ga0207668_10104724 Ga0207668_101047242 335
937 3300025972 Ga0207668_10228659 Ga0207668_102286592 335
938 3300025981 Ga0207640_10001958 Ga0207640_100019585 335
939 3300025981 Ga0207640_10168221 Ga0207640_101682212 335
940 3300025986 Ga0207658_10027251 Ga0207658_100272514 335
941 3300025986 Ga0207658_10083149 Ga0207658_100831492 335
942 3300026023 Ga0207677_10088280 Ga0207677_100882802 335
943 3300026035 Ga0207703_10016593 Ga0207703_100165934 335
944 3300026041 Ga0207639_10078074 Ga0207639_100780742 335
945 3300026041 Ga0207639_10294809 Ga0207639_102948092 335
946 3300026067 Ga0207678_10007192 Ga0207678_100071923 335
947 3300026067 Ga0207678_10009417 Ga0207678_100094179 335
948 3300026067 Ga0207678_10020047 Ga0207678_100200475 335
949 3300026067 Ga0207678_10037023 Ga0207678_100370233 335
950 3300026067 Ga0207678_10053677 Ga0207678_100536772 335
951 3300026067 Ga0207678_10062229 Ga0207678_100622293 335
952 3300026067 Ga0207678_10093858 Ga0207678_100938581 335
953 3300026067 Ga0207678_10420112 Ga0207678_104201122 335
954 3300026078 Ga0207702_10004582 Ga0207702_100045828 335
955 3300026078 Ga0207702_10006769 Ga0207702_100067694 335
956 3300026078 Ga0207702_10037234 Ga0207702_100372342 335
957 3300026078 Ga0207702_10183386 Ga0207702_101833863 335
958 3300026078 Ga0207702_10483151 Ga0207702_104831512 335
959 3300026088 Ga0207641_10018256 Ga0207641_100182563 335
960 3300026088 Ga0207641_10043648 Ga0207641_100436484 335
961 3300026088 Ga0207641_10046527 Ga0207641_100465274 335
962 3300026089 Ga0207648_10019564 Ga0207648_100195648 335
963 3300026095 Ga0207676_10006257 Ga0207676_100062574 335
964 3300026095 Ga0207676_10006357 Ga0207676_100063573 335
965 3300026095 Ga0207676_10193341 Ga0207676_101933412 335
966 3300026116 Ga0207674_10000308 Ga0207674_1000030851 335
967 3300026116 Ga0207674_10010013 Ga0207674_100100132 335
968 3300026116 Ga0207674_10030184 Ga0207674_100301844 335
969 3300026116 Ga0207674_10420019 Ga0207674_104200191 335
970 3300026118 Ga0207675_100003414 Ga0207675_10000341413 335
971 3300026121 Ga0207683_10004684 Ga0207683_1000468411 335
972 3300026121 Ga0207683_10015674 Ga0207683_100156745 335
973 3300026121 Ga0207683_10024336 Ga0207683_100243362 335
974 3300026121 Ga0207683_10063981 Ga0207683_100639813 335
975 3300026121 Ga0207683_10115186 Ga0207683_101151862 335
976 3300026142 Ga0207698_10002766 Ga0207698_100027662 335
977 3300026142 Ga0207698_10011025 Ga0207698_100110255 335
978 3300026142 Ga0207698_10014618 Ga0207698_100146184 335
979 3300026142 Ga0207698_10017547 Ga0207698_100175473 335
980 3300026142 Ga0207698_10020613 Ga0207698_100206135 335
981 3300026142 Ga0207698_10284649 Ga0207698_102846492 335
982 3300027876 Ga0209974_10035198 Ga0209974_100351981 335
983 3300028379 Ga0268266_10143684 Ga0268266_101436842 335
984 3300028380 Ga0268265_10015789 Ga0268265_100157893 335
985 3300028380 Ga0268265_10118696 Ga0268265_101186961 335
986 3300028380 Ga0268265_10135737 Ga0268265_101357372 335
987 3300028381 Ga0268264_10071077 Ga0268264_100710772 335
988 3300031824 Ga0307413_10075350 Ga0307413_100753502 335
989 3300031824 Ga0307413_10080787 Ga0307413_100807872 335
990 3300031824 Ga0307413_10338514 Ga0307413_103385142 335
991 3300031852 Ga0307410_10044058 Ga0307410_100440582 335
992 3300031852 Ga0307410_10053169 Ga0307410_100531692 335
993 3300031852 Ga0307410_10085939 Ga0307410_100859392 335
994 3300031852 Ga0307410_10094286 Ga0307410_100942862 335
995 3300031903 Ga0307407_10089461 Ga0307407_100894612 335
996 3300031911 Ga0307412_10019896 Ga0307412_100198962 335
997 3300031911 Ga0307412_10298084 Ga0307412_102980841 335
998 3300031995 Ga0307409_100031038 Ga0307409_1000310383 335
999 3300031995 Ga0307409_100039099 Ga0307409_1000390992 335
1000 3300031995 Ga0307409_100048110 Ga0307409_1000481102 335
1001 3300031995 Ga0307409_100184813 Ga0307409_1001848132 335
1002 3300031995 Ga0307409_100216497 Ga0307409_1002164972 335
1003 3300031995 Ga0307409_100219547 Ga0307409_1002195472 335
1004 3300031995 Ga0307409_100238643 Ga0307409_1002386432 335
1005 3300032002 Ga0307416_100025091 Ga0307416_1000250913 335
1006 3300032002 Ga0307416_100456895 Ga0307416_1004568951 335
1007 3300032002 Ga0307416_100482925 Ga0307416_1004829252 335
1008 3300032004 Ga0307414_10009460 Ga0307414_100094603 335
1009 3300032004 Ga0307414_10033895 Ga0307414_100338952 335
1010 3300032004 Ga0307414_10039302 Ga0307414_100393023 335
1011 3300032004 Ga0307414_10131833 Ga0307414_101318332 335
1012 3300032004 Ga0307414_10158365 Ga0307414_101583652 335
1013 3300032004 Ga0307414_10225826 Ga0307414_102258262 335
1014 3300032005 Ga0307411_10013427 Ga0307411_100134272 335
1015 3300032005 Ga0307411_10017942 Ga0307411_100179424 335
1016 3300032005 Ga0307411_10024359 Ga0307411_100243592 335
1017 3300032005 Ga0307411_10034331 Ga0307411_100343312 335
1018 3300032126 Ga0307415_100007657 Ga0307415_1000076574 335
1019 3300032126 Ga0307415_100113534 Ga0307415_1001135342 335
1020 3300032126 Ga0307415_100247462 Ga0307415_1002474622 335
1021 3300032126 Ga0307415_100310145 Ga0307415_1003101452 335
1022 3300037312 Ga0395899_0000103 Ga0395899_0000103_21611_22618 335
1023 3300037312 Ga0395899_0000756 Ga0395899_0000756_14619_15626 335
1024 3300037312 Ga0395899_0001656 Ga0395899_0001656_10293_11300 335
1025 3300037312 Ga0395899_0008155 Ga0395899_0008155_3977_4993 335
1026 3300037312 Ga0395899_0008760 Ga0395899_0008760_6119_7147 335
1027 3300037312 Ga0395899_0030716 Ga0395899_0030716_2723_3730 335
1028 3300037312 Ga0395899_0041416 Ga0395899_0041416_2087_3094 335
1029 3300037312 Ga0395899_0150873 Ga0395899_0150873_90_1097 335
1030 3300037418 Ga0395900_0000093 Ga0395900_0000093_76212_77219 335
1031 3300037418 Ga0395900_0000336 Ga0395900_0000336_30449_31456 335
1032 3300037418 Ga0395900_0001132 Ga0395900_0001132_26799_27827 335
1033 3300037418 Ga0395900_0001210 Ga0395900_0001210_20909_21916 335
1034 3300037418 Ga0395900_0003177 Ga0395900_0003177_14658_15665 335
1035 3300037418 Ga0395900_0006132 Ga0395900_0006132_1624_2631 335
1036 3300037418 Ga0395900_0018731 Ga0395900_0018731_4930_5937 335
1037 3300037418 Ga0395900_0030348 Ga0395900_0030348_3186_4193 335
1038 3300037418 Ga0395900_0030911 Ga0395900_0030911_2555_3562 335
1039 3300037418 Ga0395900_0033828 Ga0395900_0033828_4127_5134 335
1040 3300037418 Ga0395900_0041598 Ga0395900_0041598_3023_4030 335
1041 3300037418 Ga0395900_0058225 Ga0395900_0058225_816_1832 335
1042 3300037418 Ga0395900_0059137 Ga0395900_0059137_2244_3251 335
1043 3300037418 Ga0395900_0059819 Ga0395900_0059819_999_2006 335
1044 3300037418 Ga0395900_0085374 Ga0395900_0085374_731_1738 335
1045 3300037418 Ga0395900_0258632 Ga0395900_0258632_561_1577 335
1046 3300037418 Ga0395900_0302200 Ga0395900_0302200_323_1330 335
1047 3300037418 Ga0395900_0376660 Ga0395900_0376660_330_1337 335
1048 3300037418 Ga0395900_0509170 Ga0395900_0509170_52_1059 335
1049 3300037466 Ga0395898_0000053 Ga0395898_0000053_76212_77219 335
1050 3300037466 Ga0395898_0001500 Ga0395898_0001500_20209_21216 335
1051 3300037466 Ga0395898_0007849 Ga0395898_0007849_10115_11122 335
1052 3300037466 Ga0395898_0013704 Ga0395898_0013704_5875_6882 335
1053 3300037466 Ga0395898_0018403 Ga0395898_0018403_3892_4899 335
1054 3300037466 Ga0395898_0027836 Ga0395898_0027836_3764_4771 335
1055 3300037466 Ga0395898_0038107 Ga0395898_0038107_692_1699 335
1056 3300037466 Ga0395898_0050627 Ga0395898_0050627_2694_3701 335
1057 3300037466 Ga0395898_0067520 Ga0395898_0067520_1784_2791 335
1058 3300037466 Ga0395898_0076019 Ga0395898_0076019_80_1096 335
1059 3300037466 Ga0395898_0080283 Ga0395898_0080283_53_1060 335
1060 3300037466 Ga0395898_0116763 Ga0395898_0116763_703_1710 335
1061 3300037466 Ga0395898_0126804 Ga0395898_0126804_27_1034 335
1062 3300037466 Ga0395898_0369756 Ga0395898_0369756_55_1071 335
1063 3300037471 Ga0395905_0000031 Ga0395905_0000031_209539_210546 335
1064 3300037471 Ga0395905_0000083 Ga0395905_0000083_32514_33542 335
1065 3300037471 Ga0395905_0001268 Ga0395905_0001268_4022_5029 335
1066 3300037471 Ga0395905_0001353 Ga0395905_0001353_27889_28896 335
1067 3300037471 Ga0395905_0003461 Ga0395905_0003461_9005_10012 335
1068 3300037471 Ga0395905_0005930 Ga0395905_0005930_7274_8281 335
1069 3300037471 Ga0395905_0006356 Ga0395905_0006356_10187_11194 335
1070 3300037471 Ga0395905_0009470 Ga0395905_0009470_3160_4167 335
1071 3300037471 Ga0395905_0017849 Ga0395905_0017849_133_1149 335
1072 3300037471 Ga0395905_0020327 Ga0395905_0020327_3302_4309 335
1073 3300037471 Ga0395905_0021776 Ga0395905_0021776_3871_4878 335
1074 3300037471 Ga0395905_0045018 Ga0395905_0045018_53_1060 335
1075 3300037471 Ga0395905_0045019 Ga0395905_0045019_53_1060 335
1076 3300037471 Ga0395905_0053109 Ga0395905_0053109_589_1596 335
1077 3300037471 Ga0395905_0062943 Ga0395905_0062943_218_1234 335
1078 3300037471 Ga0395905_0071683 Ga0395905_0071683_253_1260 335
1079 3300037471 Ga0395905_0105301 Ga0395905_0105301_172_1179 335
1080 3300037471 Ga0395905_0138301 Ga0395905_0138301_489_1496 335
1081 3300037471 Ga0395905_0203550 Ga0395905_0203550_748_1755 335
1082 3300037471 Ga0395905_0215426 Ga0395905_0215426_741_1748 335
1083 3300037471 Ga0395905_0224576 Ga0395905_0224576_397_1404 335
1084 3300037471 Ga0395905_0253235 Ga0395905_0253235_330_1337 335
1085 3300037471 Ga0395905_0271198 Ga0395905_0271198_124_1131 335
1086 3300037853 Ga0436364_0911980 Ga0436364_0911980_249_1274 335
1087 3300038443 Ga0395901_0000339 Ga0395901_0000339_35794_36801 335
1088 3300038443 Ga0395901_0000369 Ga0395901_0000369_9606_10634 335
1089 3300038443 Ga0395901_0000770 Ga0395901_0000770_24197_25204 335
1090 3300038443 Ga0395901_0000850 Ga0395901_0000850_26257_27264 335
1091 3300038443 Ga0395901_0010343 Ga0395901_0010343_7261_8268 335
1092 3300038443 Ga0395901_0017737 Ga0395901_0017737_5506_6513 335
1093 3300038443 Ga0395901_0017953 Ga0395901_0017953_2167_3174 335
1094 3300038443 Ga0395901_0018138 Ga0395901_0018138_2143_3150 335
1095 3300038443 Ga0395901_0022253 Ga0395901_0022253_254_1270 335
1096 3300038443 Ga0395901_0034014 Ga0395901_0034014_3667_4674 335
1097 3300038443 Ga0395901_0044332 Ga0395901_0044332_692_1699 335
1098 3300038443 Ga0395901_0049348 Ga0395901_0049348_390_1397 335
1099 3300038443 Ga0395901_0054203 Ga0395901_0054203_1078_2085 335
1100 3300038443 Ga0395901_0061819 Ga0395901_0061819_24_1031 335
1101 3300038443 Ga0395901_0073354 Ga0395901_0073354_476_1483 335
1102 3300038443 Ga0395901_0100034 Ga0395901_0100034_861_1868 335
1103 3300038443 Ga0395901_0105228 Ga0395901_0105228_1788_2795 335
1104 3300038443 Ga0395901_0144671 Ga0395901_0144671_634_1641 335
1105 3300038443 Ga0395901_0198330 Ga0395901_0198330_974_1990 335
1106 3300038443 Ga0395901_0209980 Ga0395901_0209980_422_1438 335
1107 3300038443 Ga0395901_0221385 Ga0395901_0221385_640_1647 335
1108 3300042157 Ga0439458_0000005 Ga0439458_0000005_2114_3121 335
1109 3300044656 Ga0466969_0006382 Ga0466969_0006382_5252_6259 335
1110 3300044656 Ga0466969_0101721 Ga0466969_0101721_250_1257 335
1111 3300044684 Ga0466966_0000004 Ga0466966_0000004_191692_192699 335
1112 3300044684 Ga0466966_0053939 Ga0466966_0053939_242_1249 335
1113 3300044684 Ga0466966_0063939 Ga0466966_0063939_563_1570 335
1114 3300044684 Ga0466966_0185154 Ga0466966_0185154_159_1166 335
1115 3300044693 Ga0466961_0001622 Ga0466961_0001622_5772_6779 335
1116 3300044693 Ga0466961_0017191 Ga0466961_0017191_1491_2498 335
1117 3300044694 Ga0466963_0002355 Ga0466963_0002355_3748_4755 335
1118 3300044694 Ga0466963_0037609 Ga0466963_0037609_1465_2472 335
1119 3300044694 Ga0466963_0103702 Ga0466963_0103702_665_1711 335
1120 3300044694 Ga0466963_0108478 Ga0466963_0108478_788_1795 335
1121 3300044694 Ga0466963_0129172 Ga0466963_0129172_189_1196 335
1122 3300044694 Ga0466963_0136608 Ga0466963_0136608_465_1472 335
1123 3300044694 Ga0466963_0136657 Ga0466963_0136657_18_1025 335
1124 3300044719 Ga0466971_0007159 Ga0466971_0007159_1884_2891 335
1125 3300044765 Ga0466970_0031542 Ga0466970_0031542_196_1203 335
1126 3300044842 Ga0466957_0003105 Ga0466957_0003105_1250_2257 335
1127 3300044842 Ga0466957_0041412 Ga0466957_0041412_1561_2595 335
1128 3300045049 Ga0466959_0073281 Ga0466959_0073281_1326_2333 335
1129 3300045836 Ga0466958_0000180 Ga0466958_0000180_12603_13610 335
1130 3300045836 Ga0466958_0062367 Ga0466958_0062367_77_1084 335
1131 3300045836 Ga0466958_0102679 Ga0466958_0102679_711_1718 335
1132 3300045976 Ga0466967_0006519 Ga0466967_0006519_2885_3931 335
1133 3300045976 Ga0466967_0013939 Ga0466967_0013939_1640_2647 335
1134 3300045976 Ga0466967_0332469 Ga0466967_0332469_152_1159 335
1135 3300046515 Ga0495620_0086162 Ga0495620_0086162_18_1025 335
1136 3300046525 Ga0495663_0003515 Ga0495663_0003515_2340_3347 335
1137 3300046525 Ga0495663_0004247 Ga0495663_0004247_329_1336 335
1138 3300046528 Ga0495642_0016856 Ga0495642_0016856_1728_2744 335
1139 3300046539 Ga0495621_0000099 Ga0495621_0000099_12460_13467 335
1140 3300046539 Ga0495621_0000378 Ga0495621_0000378_1516_2523 335
1141 3300046539 Ga0495621_0001818 Ga0495621_0001818_3663_4679 335
1142 3300046539 Ga0495621_0003888 Ga0495621_0003888_2374_3381 335
1143 3300046558 Ga0495633_0012585 Ga0495633_0012585_2654_3661 335
1144 3300046616 Ga0495668_0054918 Ga0495668_0054918_112_1119 335
1145 3300046664 Ga0495659_0047677 Ga0495659_0047677_70_1086 335
1146 3300046681 Ga0495647_0035309 Ga0495647_0035309_139_1146 335
1147 3300046684 Ga0495669_0015277 Ga0495669_0015277_173_1180 335
1148 3300046684 Ga0495669_0016643 Ga0495669_0016643_1610_2617 335
1149 3300046691 Ga0495670_0003499 Ga0495670_0003499_66_1073 335
1150 3300046691 Ga0495670_0022489 Ga0495670_0022489_634_1641 335
1151 3300046691 Ga0495670_0041731 Ga0495670_0041731_1246_2253 335
1152 3300047445 Ga0495677_0021740 Ga0495677_0021740_299_1306 335
1153 3300048904 Ga0496101_0008634 Ga0496101_0008634_5608_6615 335
1154 3300048904 Ga0496101_0018211 Ga0496101_0018211_3608_4615 335
1155 3300048905 Ga0496102_0081051 Ga0496102_0081051_494_1516 335
1156 3300048905 Ga0496102_0218517 Ga0496102_0218517_141_1148 335
1157 3300048910 Ga0496107_0014521 Ga0496107_0014521_2496_3503 335
1158 3300048911 Ga0496108_0012730 Ga0496108_0012730_766_1773 335
1159 3300048911 Ga0496108_0029306 Ga0496108_0029306_1445_2452 335
1160 3300048912 Ga0496109_0017718 Ga0496109_0017718_4362_5369 335
1161 3300048912 Ga0496109_0050714 Ga0496109_0050714_1327_2334 335
1162 3300048913 Ga0496110_0012140 Ga0496110_0012140_1341_2348 335
1163 3300048913 Ga0496110_0051173 Ga0496110_0051173_1477_2484 335
1164 3300048914 Ga0496111_0106504 Ga0496111_0106504_325_1332 335
1165 3300048915 Ga0496112_0034642 Ga0496112_0034642_1028_2035 335
1166 3300048916 Ga0496113_0009447 Ga0496113_0009447_5276_6283 335
1167 3300048916 Ga0496113_0010652 Ga0496113_0010652_1871_2878 335
1168 3300048916 Ga0496113_0083257 Ga0496113_0083257_1137_2144 335
1169 3300049585 Ga0501069_0056082 Ga0501069_0056082_595_1602 335
1170 3300050510 nmdc:mga06r32_2867_c1 nmdc:mga06r32_2867_c1_438_1454 335
1171 3300053139 Ga0500568_0000124 Ga0500568_0000124_50904_51950 335
1172 3300061719 Ga0466962_0002267 Ga0466962_0002267_4274_5281 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

170

323

0.99

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

23

162

0.97

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

179

326

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8afv-assembly1.cif.gz_A daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.9463 3 329
3dr3-assembly1.cif.gz_A structure of idp00107, a potential n-acetyl-gamma-glutamylphosphate reductase from shigella flexneri 0.9426 1 329
8afu-assembly2.cif.gz_A-2 daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.942 1 329
1vkn-assembly1.cif.gz_B crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution 0.9392 1 335
1xyg-assembly1.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at2g19940 0.9378 2 335
ID Description Score Start End Superfamily
2i3gB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9463 149 303 3.30.360.10
af_I1KL32_193_359_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9457 149 303 3.30.360.10
af_Q2G1H4_169_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9336 172 303 3.30.360.10
af_Q2G1H4_146_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.928 149 303 3.30.360.10
1vknA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9254 1 147 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A832ZEX5-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9766 1 169 GO:0003942
GO:0006526
GO:0051287
GO:0070401
AF-A0A2E9LB62-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (AGPR) (EC 1.2.1.38) (N-acetyl-glutamate semialdehyde dehydrogenase) (NAGSA dehydrogenase) 0.9756 1 335 GO:0003942
GO:0005737
GO:0006526
GO:0051287
GO:0070401
AF-A0A7X7D8W6-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9733 209 335
AF-A0A2E9LB62-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (AGPR) (EC 1.2.1.38) (N-acetyl-glutamate semialdehyde dehydrogenase) (NAGSA dehydrogenase) 0.9728 1 335 GO:0003942
GO:0005737
GO:0006526
GO:0051287
GO:0070401
AF-A0A7C5LLG7-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (AGPR) (EC 1.2.1.38) (N-acetyl-glutamate semialdehyde dehydrogenase) (NAGSA dehydrogenase) 0.9715 3 329 GO:0003942
GO:0005737
GO:0006526
GO:0051287
GO:0070401

Feature Viewer

pLDDT pTM Quality
93.47 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map