F491139
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1170 | 415 | 2340 | 442 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100113515|Ga0070706_1001135152 |
| Length | 476 |
| Sequence | MADHDVNSAPRAFGFDTRAVHAGQRPDPYTGARAVPIFQTTSYVFEDAESAAAYFNLQEYGNTYSRIMNPTVATFEERVASLEGGAGGVAFASGLAAQAAAFFTMLEPGDHIVASGALYGGSVTQLKHLSRKLGLELTFVDPDNIDAWRQALRDTTKLLYGETIGNPGGNVLDIRAVADVAHGIGAPLMIDNTFATPYLCRPIEFGADIVVHSATKFIGGHGTSIGGVVVDSGTFDWSNGRYPVVADPSPAYHGLAFHDTFGMYGYLMKLRAESLRDLGGCLSPFNAFLFLLGLETLPLRMERHVANAVGVARFLQQHPAATGVRYAGLPDSPYRPLVERYLPKGAGAVFAFDVRGGREAGQRLIASLRLWSHLANVGDAKSLVIHPASTTHRQLSEQELVAAGISGGTIRLSVGLETLEDLLWDLERGLVASQVSDGTAQVNGRAAAGEQRAAGERPPTTADTRRPAAGEGEVVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 121 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 202 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 206 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 211 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 220 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 226 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 227 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 230 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 231 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 232 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 237 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 245 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 252 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 255 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 256 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 261 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 262 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 263 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 264 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 265 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 266 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 267 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 268 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 269 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 270 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 271 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 272 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 273 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 274 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 275 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 276 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 277 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 278 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 279 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 280 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 281 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 282 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 283 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 284 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 285 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 336 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 344 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 345 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 346 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 349 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 350 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 351 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 352 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 353 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 379 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 380 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 392 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 395 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 396 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 397 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 398 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 400 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 401 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 402 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 403 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 405 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 406 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 407 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 408 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 409 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 410 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 411 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 412 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 413 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 414 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 415 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.46 |
| Metatranscriptomes | 0.6 |
| Isolates | 0.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.91 |
| Nodule | 0.17 |
| Rhizoplane | 7.86 |
| Rhizosphere | 85.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070706_100113515 | 3300005467 | Bacteria | 2523 |
| 2 | JGI25406J46586_10003119 | 3300003203 | Bacteria | 7790 |
| 3 | JGI25404J52841_10000325 | 3300003659 | Bacteria | 6323 |
| 4 | Ga0065712_10010069 | 3300005290 | Bacteria | 3485 |
| 5 | Ga0065712_10068279 | 3300005290 | Bacteria | 12220 |
| 6 | Ga0065715_10003259 | 3300005293 | Bacteria | 4501 |
| 7 | Ga0065715_10105385 | 3300005293 | Bacteria | 2896 |
| 8 | Ga0070658_10013525 | 3300005327 | Bacteria | 6547 |
| 9 | Ga0070683_100000708 | 3300005329 | Bacteria | 24261 |
| 10 | Ga0070683_100006137 | 3300005329 | Bacteria | 10075 |
| 11 | Ga0070683_100051377 | 3300005329 | Bacteria | 3817 |
| 12 | Ga0070683_100065521 | 3300005329 | Bacteria | 3382 |
| 13 | Ga0070683_100188061 | 3300005329 | Bacteria | 1960 |
| 14 | Ga0070690_100041283 | 3300005330 | Bacteria | 2921 |
| 15 | Ga0070670_100002490 | 3300005331 | Bacteria | 15185 |
| 16 | Ga0070670_100015382 | 3300005331 | Bacteria | 6571 |
| 17 | Ga0070670_100023077 | 3300005331 | Bacteria | 5354 |
| 18 | Ga0070670_100065146 | 3300005331 | Bacteria | 3126 |
| 19 | Ga0070670_100091590 | 3300005331 | Bacteria | 2614 |
| 20 | Ga0068869_100000875 | 3300005334 | Bacteria | 17321 |
| 21 | Ga0070680_100249339 | 3300005336 | Bacteria | 1501 |
| 22 | Ga0068868_100005552 | 3300005338 | Bacteria | 8870 |
| 23 | Ga0068868_100127395 | 3300005338 | Bacteria | 2081 |
| 24 | Ga0070660_100004570 | 3300005339 | Bacteria | 9567 |
| 25 | Ga0070689_100152071 | 3300005340 | Bacteria | 1867 |
| 26 | Ga0070691_10047059 | 3300005341 | Bacteria | 2050 |
| 27 | Ga0070691_10049594 | 3300005341 | Bacteria | 2001 |
| 28 | Ga0070687_100016969 | 3300005343 | Bacteria | 3337 |
| 29 | Ga0070687_100048841 | 3300005343 | Bacteria | 2177 |
| 30 | Ga0070661_100064226 | 3300005344 | Bacteria | 2698 |
| 31 | Ga0070661_100076735 | 3300005344 | Bacteria | 2463 |
| 32 | Ga0070661_100112017 | 3300005344 | Bacteria | 2038 |
| 33 | Ga0070692_10018668 | 3300005345 | Bacteria | 3338 |
| 34 | Ga0070668_100023554 | 3300005347 | Bacteria | 4658 |
| 35 | Ga0070669_100014255 | 3300005353 | Bacteria | 5656 |
| 36 | Ga0070669_100043091 | 3300005353 | Bacteria | 3286 |
| 37 | Ga0070669_100061772 | 3300005353 | Bacteria | 2754 |
| 38 | Ga0070669_100171484 | 3300005353 | Bacteria | 1692 |
| 39 | Ga0070675_100001453 | 3300005354 | Bacteria | 17447 |
| 40 | Ga0070675_100007466 | 3300005354 | Bacteria | 8446 |
| 41 | Ga0070675_100025889 | 3300005354 | Bacteria | 4704 |
| 42 | Ga0070675_100068451 | 3300005354 | Bacteria | 2939 |
| 43 | Ga0070675_100149650 | 3300005354 | Bacteria | 2001 |
| 44 | Ga0070675_100189851 | 3300005354 | Bacteria | 1780 |
| 45 | Ga0070671_100001323 | 3300005355 | Bacteria | 18625 |
| 46 | Ga0070671_100042971 | 3300005355 | Bacteria | 3758 |
| 47 | Ga0070671_100048299 | 3300005355 | Bacteria | 3539 |
| 48 | Ga0070674_100055631 | 3300005356 | Bacteria | 2741 |
| 49 | Ga0070674_100214333 | 3300005356 | Bacteria | 1494 |
| 50 | Ga0070673_100064706 | 3300005364 | Bacteria | 2914 |
| 51 | Ga0070673_100110972 | 3300005364 | Bacteria | 2274 |
| 52 | Ga0070673_100133337 | 3300005364 | Bacteria | 2088 |
| 53 | Ga0070688_100080498 | 3300005365 | Bacteria | 2107 |
| 54 | Ga0070667_100008751 | 3300005367 | Bacteria | 8390 |
| 55 | Ga0070667_100012141 | 3300005367 | Bacteria | 7130 |
| 56 | Ga0070667_100059792 | 3300005367 | Bacteria | 3224 |
| 57 | Ga0070667_100177627 | 3300005367 | Bacteria | 1882 |
| 58 | Ga0070703_10004964 | 3300005406 | Bacteria | 3712 |
| 59 | Ga0070709_10001895 | 3300005434 | Bacteria | 11350 |
| 60 | Ga0070709_10020242 | 3300005434 | Bacteria | 3858 |
| 61 | Ga0070709_10077535 | 3300005434 | Bacteria | 2160 |
| 62 | Ga0070709_10097629 | 3300005434 | Bacteria | 1951 |
| 63 | Ga0070709_10103591 | 3300005434 | Bacteria | 1900 |
| 64 | Ga0070709_10112470 | 3300005434 | Bacteria | 1832 |
| 65 | Ga0070714_100005591 | 3300005435 | Bacteria | 9606 |
| 66 | Ga0070714_100008018 | 3300005435 | Bacteria | 8232 |
| 67 | Ga0070714_100009569 | 3300005435 | Bacteria | 7627 |
| 68 | Ga0070714_100069571 | 3300005435 | Bacteria | 3040 |
| 69 | Ga0070714_100111738 | 3300005435 | Bacteria | 2420 |
| 70 | Ga0070714_100216976 | 3300005435 | Bacteria | 1756 |
| 71 | Ga0070713_100005039 | 3300005436 | Bacteria | 8982 |
| 72 | Ga0070713_100017150 | 3300005436 | Bacteria | 5468 |
| 73 | Ga0070713_100026182 | 3300005436 | Bacteria | 4574 |
| 74 | Ga0070710_10001607 | 3300005437 | Bacteria | 10667 |
| 75 | Ga0070710_10010036 | 3300005437 | Bacteria | 4642 |
| 76 | Ga0070710_10029772 | 3300005437 | Bacteria | 2932 |
| 77 | Ga0070710_10105831 | 3300005437 | Bacteria | 1682 |
| 78 | Ga0070711_100001313 | 3300005439 | Bacteria | 13531 |
| 79 | Ga0070711_100015396 | 3300005439 | Bacteria | 4841 |
| 80 | Ga0070711_100035012 | 3300005439 | Bacteria | 3353 |
| 81 | Ga0070711_100110193 | 3300005439 | Bacteria | 2019 |
| 82 | Ga0070700_100005059 | 3300005441 | Bacteria | 6953 |
| 83 | Ga0070708_100016213 | 3300005445 | Bacteria | 6177 |
| 84 | Ga0070708_100029697 | 3300005445 | Bacteria | 4717 |
| 85 | Ga0070663_100020660 | 3300005455 | Bacteria | 4363 |
| 86 | Ga0070663_100094442 | 3300005455 | Bacteria | 2221 |
| 87 | Ga0070678_100016237 | 3300005456 | Bacteria | 4756 |
| 88 | Ga0070678_100091375 | 3300005456 | Bacteria | 2336 |
| 89 | Ga0070678_100203182 | 3300005456 | Bacteria | 1637 |
| 90 | Ga0070662_100050182 | 3300005457 | Bacteria | 3010 |
| 91 | Ga0070681_10005432 | 3300005458 | Bacteria | 12313 |
| 92 | Ga0070681_10022748 | 3300005458 | Bacteria | 6299 |
| 93 | Ga0070681_10178023 | 3300005458 | Bacteria | 2048 |
| 94 | Ga0068867_100039296 | 3300005459 | Bacteria | 3449 |
| 95 | Ga0068867_100072162 | 3300005459 | Bacteria | 2584 |
| 96 | Ga0068867_100185443 | 3300005459 | Bacteria | 1657 |
| 97 | Ga0070706_100000298 | 3300005467 | Bacteria | 60360 |
| 98 | Ga0070706_100003182 | 3300005467 | Bacteria | 16210 |
| 99 | Ga0070706_100003183 | 3300005467 | Bacteria | 16208 |
| 100 | Ga0070706_100003446 | 3300005467 | Bacteria | 15578 |
| 101 | Ga0070706_100037326 | 3300005467 | Bacteria | 4488 |
| 102 | Ga0070706_100095645 | 3300005467 | Bacteria | 2757 |
| 103 | Ga0070707_100000066 | 3300005468 | Bacteria | 94334 |
| 104 | Ga0070707_100028239 | 3300005468 | Bacteria | 5338 |
| 105 | Ga0070707_100031345 | 3300005468 | Bacteria | 5064 |
| 106 | Ga0070707_100044696 | 3300005468 | Bacteria | 4240 |
| 107 | Ga0070707_100049611 | 3300005468 | Bacteria | 4024 |
| 108 | Ga0070707_100064740 | 3300005468 | Bacteria | 3510 |
| 109 | Ga0070707_100077439 | 3300005468 | Bacteria | 3209 |
| 110 | Ga0070707_100098952 | 3300005468 | Bacteria | 2825 |
| 111 | Ga0070707_100127596 | 3300005468 | Bacteria | 2472 |
| 112 | Ga0070707_100303393 | 3300005468 | Bacteria | 1552 |
| 113 | Ga0070698_100000154 | 3300005471 | Bacteria | 62325 |
| 114 | Ga0070698_100004935 | 3300005471 | Bacteria | 14634 |
| 115 | Ga0070698_100005953 | 3300005471 | Bacteria | 13301 |
| 116 | Ga0070698_100010079 | 3300005471 | Bacteria | 10092 |
| 117 | Ga0070698_100011383 | 3300005471 | Bacteria | 9440 |
| 118 | Ga0070698_100011937 | 3300005471 | Bacteria | 9218 |
| 119 | Ga0070698_100017565 | 3300005471 | Bacteria | 7539 |
| 120 | Ga0070698_100038471 | 3300005471 | Bacteria | 4928 |
| 121 | Ga0070698_100040100 | 3300005471 | Bacteria | 4815 |
| 122 | Ga0070698_100044493 | 3300005471 | Bacteria | 4546 |
| 123 | Ga0070698_100059464 | 3300005471 | Bacteria | 3860 |
| 124 | Ga0070698_100062237 | 3300005471 | Bacteria | 3765 |
| 125 | Ga0070698_100063401 | 3300005471 | Bacteria | 3727 |
| 126 | Ga0070698_100080818 | 3300005471 | Bacteria | 3245 |
| 127 | Ga0070698_100087245 | 3300005471 | Bacteria | 3107 |
| 128 | Ga0070698_100107569 | 3300005471 | Bacteria | 2756 |
| 129 | Ga0070698_100196328 | 3300005471 | Bacteria | 1955 |
| 130 | Ga0070699_100000758 | 3300005518 | Bacteria | 29797 |
| 131 | Ga0070699_100001345 | 3300005518 | Bacteria | 22648 |
| 132 | Ga0070699_100013989 | 3300005518 | Bacteria | 6903 |
| 133 | Ga0070699_100014705 | 3300005518 | Bacteria | 6730 |
| 134 | Ga0070699_100035871 | 3300005518 | Bacteria | 4288 |
| 135 | Ga0070699_100060708 | 3300005518 | Bacteria | 3276 |
| 136 | Ga0070699_100087847 | 3300005518 | Bacteria | 2714 |
| 137 | Ga0070679_100044237 | 3300005530 | Bacteria | 4436 |
| 138 | Ga0070679_100048223 | 3300005530 | Bacteria | 4244 |
| 139 | Ga0070679_100141624 | 3300005530 | Bacteria | 2384 |
| 140 | Ga0070684_100010970 | 3300005535 | Bacteria | 7205 |
| 141 | Ga0070684_100013271 | 3300005535 | Bacteria | 6638 |
| 142 | Ga0070684_100032607 | 3300005535 | Bacteria | 4441 |
| 143 | Ga0070684_100046984 | 3300005535 | Bacteria | 3741 |
| 144 | Ga0070684_100077920 | 3300005535 | Bacteria | 2928 |
| 145 | Ga0070684_100146361 | 3300005535 | Bacteria | 2138 |
| 146 | Ga0070684_100213834 | 3300005535 | Bacteria | 1758 |
| 147 | Ga0070697_100012007 | 3300005536 | Bacteria | 6779 |
| 148 | Ga0070697_100014435 | 3300005536 | Bacteria | 6203 |
| 149 | Ga0070697_100022679 | 3300005536 | Bacteria | 4987 |
| 150 | Ga0070697_100032532 | 3300005536 | Bacteria | 4198 |
| 151 | Ga0070697_100057202 | 3300005536 | Bacteria | 3173 |
| 152 | Ga0070697_100136145 | 3300005536 | Bacteria | 2063 |
| 153 | Ga0070686_100017300 | 3300005544 | Bacteria | 4211 |
| 154 | Ga0070695_100005289 | 3300005545 | Bacteria | 7599 |
| 155 | Ga0070695_100106781 | 3300005545 | Bacteria | 1894 |
| 156 | Ga0070695_100153034 | 3300005545 | Bacteria | 1611 |
| 157 | Ga0070665_100004294 | 3300005548 | Bacteria | 14979 |
| 158 | Ga0070665_100004460 | 3300005548 | Bacteria | 14709 |
| 159 | Ga0070665_100048196 | 3300005548 | Bacteria | 4278 |
| 160 | Ga0070665_100054831 | 3300005548 | Bacteria | 3998 |
| 161 | Ga0070665_100093009 | 3300005548 | Bacteria | 3020 |
| 162 | Ga0070665_100179722 | 3300005548 | Bacteria | 2117 |
| 163 | Ga0070704_100055511 | 3300005549 | Bacteria | 2809 |
| 164 | Ga0068855_100012336 | 3300005563 | Bacteria | 10323 |
| 165 | Ga0068855_100130631 | 3300005563 | Bacteria | 2869 |
| 166 | Ga0070664_100001862 | 3300005564 | Bacteria | 16909 |
| 167 | Ga0070664_100024777 | 3300005564 | Bacteria | 4968 |
| 168 | Ga0070664_100050318 | 3300005564 | Bacteria | 3526 |
| 169 | Ga0070664_100309218 | 3300005564 | Bacteria | 1430 |
| 170 | Ga0068857_100018463 | 3300005577 | Bacteria | 6118 |
| 171 | Ga0068857_100036109 | 3300005577 | Bacteria | 4379 |
| 172 | Ga0068854_100002000 | 3300005578 | Bacteria | 12485 |
| 173 | Ga0068856_100023164 | 3300005614 | Bacteria | 6040 |
| 174 | Ga0068856_100044400 | 3300005614 | Bacteria | 4374 |
| 175 | Ga0068856_100057750 | 3300005614 | Bacteria | 3831 |
| 176 | Ga0068856_100066150 | 3300005614 | Bacteria | 3571 |
| 177 | Ga0068856_100082825 | 3300005614 | Bacteria | 3184 |
| 178 | Ga0068856_100355543 | 3300005614 | Bacteria | 1483 |
| 179 | Ga0070702_100022881 | 3300005615 | Bacteria | 3312 |
| 180 | Ga0070702_100025067 | 3300005615 | Bacteria | 3191 |
| 181 | Ga0068852_100006521 | 3300005616 | Bacteria | 8438 |
| 182 | Ga0068859_100068345 | 3300005617 | Bacteria | 3587 |
| 183 | Ga0068864_100004684 | 3300005618 | Bacteria | 11222 |
| 184 | Ga0068864_100024062 | 3300005618 | Bacteria | 5120 |
| 185 | Ga0068864_100025084 | 3300005618 | Bacteria | 5019 |
| 186 | Ga0068864_100045919 | 3300005618 | Bacteria | 3747 |
| 187 | Ga0068861_100036073 | 3300005719 | Bacteria | 3667 |
| 188 | Ga0068851_10048950 | 3300005834 | Bacteria | 2143 |
| 189 | Ga0068863_100004960 | 3300005841 | Bacteria | 13117 |
| 190 | Ga0068863_100008257 | 3300005841 | Bacteria | 10173 |
| 191 | Ga0068863_100016047 | 3300005841 | Bacteria | 7182 |
| 192 | Ga0068863_100042759 | 3300005841 | Bacteria | 4304 |
| 193 | Ga0068863_100102710 | 3300005841 | Bacteria | 2718 |
| 194 | Ga0068858_100011661 | 3300005842 | Bacteria | 8289 |
| 195 | Ga0068858_100013571 | 3300005842 | Bacteria | 7687 |
| 196 | Ga0068860_100044713 | 3300005843 | Bacteria | 4220 |
| 197 | Ga0068860_100153508 | 3300005843 | Bacteria | 2218 |
| 198 | Ga0068860_100263187 | 3300005843 | Bacteria | 1681 |
| 199 | Ga0068862_100000037 | 3300005844 | Bacteria | 172796 |
| 200 | Ga0068862_100016247 | 3300005844 | Bacteria | 6194 |
| 201 | Ga0068862_100114737 | 3300005844 | Bacteria | 2368 |
| 202 | Ga0081455_10000070 | 3300005937 | Bacteria | 110926 |
| 203 | Ga0081455_10008133 | 3300005937 | Bacteria | 10941 |
| 204 | Ga0081455_10013953 | 3300005937 | Bacteria | 7898 |
| 205 | Ga0081540_1000244 | 3300005983 | Bacteria | 57049 |
| 206 | Ga0081540_1000792 | 3300005983 | Bacteria | 29032 |
| 207 | Ga0081539_10000285 | 3300005985 | Bacteria | 114370 |
| 208 | Ga0081539_10001662 | 3300005985 | Bacteria | 36045 |
| 209 | Ga0070717_10064553 | 3300006028 | Bacteria | 3041 |
| 210 | Ga0070717_10128019 | 3300006028 | Bacteria | 2181 |
| 211 | Ga0075365_10016041 | 3300006038 | Bacteria | 4545 |
| 212 | Ga0075365_10120158 | 3300006038 | Bacteria | 1812 |
| 213 | Ga0075368_10006288 | 3300006042 | Bacteria | 4142 |
| 214 | Ga0075368_10032957 | 3300006042 | Bacteria | 2014 |
| 215 | Ga0075364_10031327 | 3300006051 | Bacteria | 3417 |
| 216 | Ga0075364_10045733 | 3300006051 | Bacteria | 2848 |
| 217 | Ga0075364_10082186 | 3300006051 | Bacteria | 2131 |
| 218 | Ga0070715_10022021 | 3300006163 | Bacteria | 2480 |
| 219 | Ga0070716_100003571 | 3300006173 | Bacteria | 7343 |
| 220 | Ga0070716_100005543 | 3300006173 | Bacteria | 6122 |
| 221 | Ga0070716_100021375 | 3300006173 | Bacteria | 3409 |
| 222 | Ga0070716_100035952 | 3300006173 | Bacteria | 2727 |
| 223 | Ga0070712_100005064 | 3300006175 | Bacteria | 8161 |
| 224 | Ga0070712_100015738 | 3300006175 | Bacteria | 4877 |
| 225 | Ga0070712_100026606 | 3300006175 | Bacteria | 3856 |
| 226 | Ga0070712_100046224 | 3300006175 | Bacteria | 3009 |
| 227 | Ga0075367_10100019 | 3300006178 | Bacteria | 1771 |
| 228 | Ga0075366_10009894 | 3300006195 | Bacteria | 5334 |
| 229 | Ga0097621_100003602 | 3300006237 | Bacteria | 10704 |
| 230 | Ga0097621_100004239 | 3300006237 | Bacteria | 9965 |
| 231 | Ga0097621_100013902 | 3300006237 | Bacteria | 6011 |
| 232 | Ga0097621_100041573 | 3300006237 | Bacteria | 3701 |
| 233 | Ga0097621_100083519 | 3300006237 | Bacteria | 2661 |
| 234 | Ga0075370_10008520 | 3300006353 | Bacteria | 5280 |
| 235 | Ga0075370_10045086 | 3300006353 | Bacteria | 2493 |
| 236 | Ga0075370_10048354 | 3300006353 | Bacteria | 2410 |
| 237 | Ga0068871_100003038 | 3300006358 | Bacteria | 11508 |
| 238 | Ga0068871_100065475 | 3300006358 | Bacteria | 2976 |
| 239 | Ga0068871_100091197 | 3300006358 | Bacteria | 2539 |
| 240 | Ga0068871_100132418 | 3300006358 | Bacteria | 2115 |
| 241 | Ga0075428_100003422 | 3300006844 | Bacteria | 17359 |
| 242 | Ga0075428_100017655 | 3300006844 | Bacteria | 7883 |
| 243 | Ga0075428_100018271 | 3300006844 | Bacteria | 7750 |
| 244 | Ga0075428_100044900 | 3300006844 | Bacteria | 4856 |
| 245 | Ga0075428_100089481 | 3300006844 | Bacteria | 3358 |
| 246 | Ga0075428_100381306 | 3300006844 | Bacteria | 1511 |
| 247 | Ga0075430_100000790 | 3300006846 | Bacteria | 24524 |
| 248 | Ga0075430_100009424 | 3300006846 | Bacteria | 8248 |
| 249 | Ga0075430_100010903 | 3300006846 | Bacteria | 7699 |
| 250 | Ga0075430_100030699 | 3300006846 | Bacteria | 4565 |
| 251 | Ga0075431_100009459 | 3300006847 | Bacteria | 9783 |
| 252 | Ga0075431_100050191 | 3300006847 | Bacteria | 4302 |
| 253 | Ga0075431_100202892 | 3300006847 | Bacteria | 2028 |
| 254 | Ga0075433_10013697 | 3300006852 | Bacteria | 6603 |
| 255 | Ga0075433_10098951 | 3300006852 | Bacteria | 2582 |
| 256 | Ga0075434_100021887 | 3300006871 | Bacteria | 6223 |
| 257 | Ga0075434_100127113 | 3300006871 | Bacteria | 2566 |
| 258 | Ga0075434_100305014 | 3300006871 | Bacteria | 1613 |
| 259 | Ga0075429_100000790 | 3300006880 | Bacteria | 24921 |
| 260 | Ga0075429_100009195 | 3300006880 | Bacteria | 8580 |
| 261 | Ga0068865_100001353 | 3300006881 | Bacteria | 14258 |
| 262 | Ga0068865_100011565 | 3300006881 | Bacteria | 5529 |
| 263 | Ga0068865_100020263 | 3300006881 | Bacteria | 4313 |
| 264 | Ga0068865_100107429 | 3300006881 | Bacteria | 2052 |
| 265 | Ga0075436_100002528 | 3300006914 | Bacteria | 12591 |
| 266 | Ga0097620_100000043 | 3300006931 | Bacteria | 156893 |
| 267 | Ga0097620_100068349 | 3300006931 | Bacteria | 3587 |
| 268 | Ga0075435_100023263 | 3300007076 | Bacteria | 4789 |
| 269 | Ga0075435_100029278 | 3300007076 | Bacteria | 4321 |
| 270 | Ga0105240_10000016 | 3300009093 | Bacteria | 447794 |
| 271 | Ga0105240_10125826 | 3300009093 | Bacteria | 3080 |
| 272 | Ga0111539_10000009 | 3300009094 | Bacteria | 375223 |
| 273 | Ga0111539_10000159 | 3300009094 | Bacteria | 76817 |
| 274 | Ga0111539_10002299 | 3300009094 | Bacteria | 25405 |
| 275 | Ga0111539_10012961 | 3300009094 | Bacteria | 10434 |
| 276 | Ga0111539_10024596 | 3300009094 | Bacteria | 7386 |
| 277 | Ga0111539_10031724 | 3300009094 | Bacteria | 6419 |
| 278 | Ga0111539_10037027 | 3300009094 | Bacteria | 5895 |
| 279 | Ga0111539_10139425 | 3300009094 | Bacteria | 2839 |
| 280 | Ga0105245_10014308 | 3300009098 | Bacteria | 6915 |
| 281 | Ga0105245_10019618 | 3300009098 | Bacteria | 5924 |
| 282 | Ga0105245_10037070 | 3300009098 | Bacteria | 4334 |
| 283 | Ga0105245_10092259 | 3300009098 | Bacteria | 2789 |
| 284 | Ga0105245_10123004 | 3300009098 | Bacteria | 2426 |
| 285 | Ga0105247_10014927 | 3300009101 | Bacteria | 4655 |
| 286 | Ga0114129_10001448 | 3300009147 | Bacteria | 32015 |
| 287 | Ga0114129_10004686 | 3300009147 | Bacteria | 19320 |
| 288 | Ga0114129_10007559 | 3300009147 | Bacteria | 15478 |
| 289 | Ga0114129_10043612 | 3300009147 | Bacteria | 6310 |
| 290 | Ga0114129_10056209 | 3300009147 | Bacteria | 5513 |
| 291 | Ga0114129_10073340 | 3300009147 | Bacteria | 4768 |
| 292 | Ga0114129_10136565 | 3300009147 | Bacteria | 3364 |
| 293 | Ga0114129_10317984 | 3300009147 | Bacteria | 2070 |
| 294 | Ga0105243_10019454 | 3300009148 | Bacteria | 5149 |
| 295 | Ga0105243_10066229 | 3300009148 | Bacteria | 2905 |
| 296 | Ga0105243_10080068 | 3300009148 | Bacteria | 2663 |
| 297 | Ga0105241_10000239 | 3300009174 | Bacteria | 41568 |
| 298 | Ga0105241_10051062 | 3300009174 | Bacteria | 3153 |
| 299 | Ga0105242_10002512 | 3300009176 | Bacteria | 14393 |
| 300 | Ga0105242_10003883 | 3300009176 | Bacteria | 11615 |
| 301 | Ga0105242_10006730 | 3300009176 | Bacteria | 8867 |
| 302 | Ga0105242_10018291 | 3300009176 | Bacteria | 5476 |
| 303 | Ga0105242_10019508 | 3300009176 | Bacteria | 5314 |
| 304 | Ga0105242_10149031 | 3300009176 | Bacteria | 2038 |
| 305 | Ga0105248_10030409 | 3300009177 | Bacteria | 6029 |
| 306 | Ga0105248_10036049 | 3300009177 | Bacteria | 5533 |
| 307 | Ga0105248_10056218 | 3300009177 | Bacteria | 4415 |
| 308 | Ga0105248_10118679 | 3300009177 | Bacteria | 2984 |
| 309 | Ga0105237_10049907 | 3300009545 | Bacteria | 4205 |
| 310 | Ga0105237_10185162 | 3300009545 | Bacteria | 2082 |
| 311 | Ga0105238_10001393 | 3300009551 | Bacteria | 24250 |
| 312 | Ga0105238_10012498 | 3300009551 | Bacteria | 8563 |
| 313 | Ga0105238_10014392 | 3300009551 | Bacteria | 7996 |
| 314 | Ga0105238_10107940 | 3300009551 | Bacteria | 2765 |
| 315 | Ga0105238_10382569 | 3300009551 | Bacteria | 1399 |
| 316 | Ga0105249_10058877 | 3300009553 | Bacteria | 3522 |
| 317 | Ga0105249_10126645 | 3300009553 | Bacteria | 2433 |
| 318 | Ga0099796_10034784 | 3300010159 | Bacteria | 1666 |
| 319 | Ga0105239_10008916 | 3300010375 | Bacteria | 11347 |
| 320 | Ga0105239_10096091 | 3300010375 | Bacteria | 3273 |
| 321 | Ga0105246_10005086 | 3300011119 | Bacteria | 8002 |
| 322 | Ga0105246_10161556 | 3300011119 | Bacteria | 1707 |
| 323 | Ga0105246_10194607 | 3300011119 | Bacteria | 1572 |
| 324 | Ga0157370_10018418 | 3300013104 | Bacteria | 7024 |
| 325 | Ga0157369_10007550 | 3300013105 | Bacteria | 12514 |
| 326 | Ga0157369_10013183 | 3300013105 | Bacteria | 9354 |
| 327 | Ga0157369_10052297 | 3300013105 | Bacteria | 4420 |
| 328 | Ga0157374_10008702 | 3300013296 | Bacteria | 8681 |
| 329 | Ga0157374_10034589 | 3300013296 | Bacteria | 4617 |
| 330 | Ga0157374_10324990 | 3300013296 | Bacteria | 1525 |
| 331 | Ga0157378_10020339 | 3300013297 | Bacteria | 5838 |
| 332 | Ga0163162_10006773 | 3300013306 | Bacteria | 11116 |
| 333 | Ga0163162_10011988 | 3300013306 | Bacteria | 8454 |
| 334 | Ga0163162_10047356 | 3300013306 | Bacteria | 4309 |
| 335 | Ga0157375_10015152 | 3300013308 | Bacteria | 6896 |
| 336 | Ga0163163_10000001 | 3300014325 | Bacteria | 622185 |
| 337 | Ga0163163_10010746 | 3300014325 | Bacteria | 8256 |
| 338 | Ga0163163_10021478 | 3300014325 | Bacteria | 6093 |
| 339 | Ga0163163_10069765 | 3300014325 | Bacteria | 3499 |
| 340 | Ga0163163_10152288 | 3300014325 | Bacteria | 2356 |
| 341 | Ga0157380_10008049 | 3300014326 | Bacteria | 7510 |
| 342 | Ga0157380_10012276 | 3300014326 | Bacteria | 6208 |
| 343 | Ga0157380_10268367 | 3300014326 | Bacteria | 1554 |
| 344 | Ga0157377_10113436 | 3300014745 | Bacteria | 1632 |
| 345 | Ga0157379_10008806 | 3300014968 | Bacteria | 8802 |
| 346 | Ga0157379_10031188 | 3300014968 | Bacteria | 4748 |
| 347 | Ga0157379_10040353 | 3300014968 | Bacteria | 4165 |
| 348 | Ga0157379_10040667 | 3300014968 | Bacteria | 4150 |
| 349 | Ga0157376_10006796 | 3300014969 | Bacteria | 8100 |
| 350 | Ga0157376_10020783 | 3300014969 | Bacteria | 5088 |
| 351 | Ga0157376_10115804 | 3300014969 | Bacteria | 2367 |
| 352 | Ga0157376_10176414 | 3300014969 | Bacteria | 1950 |
| 353 | Ga0206354_11100292 | 3300020081 | Bacteria | 3951 |
| 354 | Ga0206353_10082891 | 3300020082 | Bacteria | 2806 |
| 355 | Ga0206353_10163986 | 3300020082 | Bacteria | 3885 |
| 356 | Ga0206353_10639952 | 3300020082 | Bacteria | 1727 |
| 357 | Ga0213876_10001259 | 3300021384 | Bacteria | 15987 |
| 358 | Ga0213876_10029200 | 3300021384 | Bacteria | 2907 |
| 359 | Ga0213876_10054597 | 3300021384 | Bacteria | 2109 |
| 360 | Ga0213875_10002658 | 3300021388 | Bacteria | 10561 |
| 361 | Ga0213875_10012568 | 3300021388 | Bacteria | 4175 |
| 362 | Ga0213871_10010903 | 3300021441 | Bacteria | 2073 |
| 363 | Ga0224712_10005976 | 3300022467 | Bacteria | 3437 |
| 364 | Ga0224712_10020911 | 3300022467 | Bacteria | 2231 |
| 365 | Ga0224572_1001028 | 3300024225 | Bacteria | 3876 |
| 366 | Ga0207697_10014580 | 3300025315 | Bacteria | 3259 |
| 367 | Ga0207653_10000676 | 3300025885 | Bacteria | 11711 |
| 368 | Ga0207653_10005871 | 3300025885 | Bacteria | 3831 |
| 369 | Ga0207682_10048807 | 3300025893 | Bacteria | 1746 |
| 370 | Ga0207692_10000949 | 3300025898 | Bacteria | 10525 |
| 371 | Ga0207692_10001973 | 3300025898 | Bacteria | 7834 |
| 372 | Ga0207692_10014211 | 3300025898 | Bacteria | 3473 |
| 373 | Ga0207692_10025813 | 3300025898 | Bacteria | 2750 |
| 374 | Ga0207710_10024355 | 3300025900 | Bacteria | 2606 |
| 375 | Ga0207688_10011027 | 3300025901 | Bacteria | 4916 |
| 376 | Ga0207680_10005600 | 3300025903 | Bacteria | 6009 |
| 377 | Ga0207680_10069803 | 3300025903 | Bacteria | 2172 |
| 378 | Ga0207647_10015041 | 3300025904 | Bacteria | 5318 |
| 379 | Ga0207647_10027622 | 3300025904 | Bacteria | 3697 |
| 380 | Ga0207685_10014519 | 3300025905 | Bacteria | 2468 |
| 381 | Ga0207685_10016422 | 3300025905 | Bacteria | 2370 |
| 382 | Ga0207699_10000382 | 3300025906 | Bacteria | 23317 |
| 383 | Ga0207699_10001451 | 3300025906 | Bacteria | 11256 |
| 384 | Ga0207699_10002657 | 3300025906 | Bacteria | 8439 |
| 385 | Ga0207699_10005384 | 3300025906 | Bacteria | 6134 |
| 386 | Ga0207699_10041257 | 3300025906 | Bacteria | 2664 |
| 387 | Ga0207699_10125302 | 3300025906 | Bacteria | 1667 |
| 388 | Ga0207645_10017636 | 3300025907 | Bacteria | 4708 |
| 389 | Ga0207645_10102178 | 3300025907 | Bacteria | 1850 |
| 390 | Ga0207643_10052827 | 3300025908 | Bacteria | 2308 |
| 391 | Ga0207705_10005831 | 3300025909 | Bacteria | 9175 |
| 392 | Ga0207684_10000482 | 3300025910 | Bacteria | 51648 |
| 393 | Ga0207684_10000539 | 3300025910 | Bacteria | 46762 |
| 394 | Ga0207684_10000558 | 3300025910 | Bacteria | 45698 |
| 395 | Ga0207684_10003396 | 3300025910 | Bacteria | 15591 |
| 396 | Ga0207684_10006546 | 3300025910 | Bacteria | 10610 |
| 397 | Ga0207684_10031896 | 3300025910 | Bacteria | 4483 |
| 398 | Ga0207684_10048492 | 3300025910 | Bacteria | 3602 |
| 399 | Ga0207684_10121310 | 3300025910 | Bacteria | 2241 |
| 400 | Ga0207654_10132780 | 3300025911 | Bacteria | 1578 |
| 401 | Ga0207707_10051384 | 3300025912 | Bacteria | 3589 |
| 402 | Ga0207695_10000042 | 3300025913 | Bacteria | 447793 |
| 403 | Ga0207695_10202127 | 3300025913 | Bacteria | 1901 |
| 404 | Ga0207695_10210618 | 3300025913 | Bacteria | 1854 |
| 405 | Ga0207671_10000794 | 3300025914 | Bacteria | 40010 |
| 406 | Ga0207671_10150173 | 3300025914 | Bacteria | 1800 |
| 407 | Ga0207693_10000504 | 3300025915 | Bacteria | 35283 |
| 408 | Ga0207693_10041010 | 3300025915 | Bacteria | 3646 |
| 409 | Ga0207693_10079420 | 3300025915 | Bacteria | 2568 |
| 410 | Ga0207693_10104306 | 3300025915 | Bacteria | 2224 |
| 411 | Ga0207693_10117597 | 3300025915 | Bacteria | 2087 |
| 412 | Ga0207693_10151798 | 3300025915 | Bacteria | 1822 |
| 413 | Ga0207663_10075573 | 3300025916 | Bacteria | 2187 |
| 414 | Ga0207662_10021653 | 3300025918 | Bacteria | 3678 |
| 415 | Ga0207657_10000773 | 3300025919 | Bacteria | 33955 |
| 416 | Ga0207657_10024423 | 3300025919 | Bacteria | 5594 |
| 417 | Ga0207649_10062392 | 3300025920 | Bacteria | 2350 |
| 418 | Ga0207649_10073461 | 3300025920 | Bacteria | 2191 |
| 419 | Ga0207652_10060831 | 3300025921 | Bacteria | 3260 |
| 420 | Ga0207652_10068911 | 3300025921 | Bacteria | 3070 |
| 421 | Ga0207646_10000065 | 3300025922 | Bacteria | 149387 |
| 422 | Ga0207646_10000078 | 3300025922 | Bacteria | 133416 |
| 423 | Ga0207646_10010477 | 3300025922 | Bacteria | 9054 |
| 424 | Ga0207646_10014545 | 3300025922 | Bacteria | 7468 |
| 425 | Ga0207646_10023119 | 3300025922 | Bacteria | 5713 |
| 426 | Ga0207646_10025444 | 3300025922 | Bacteria | 5414 |
| 427 | Ga0207646_10027516 | 3300025922 | Bacteria | 5186 |
| 428 | Ga0207646_10061897 | 3300025922 | Bacteria | 3341 |
| 429 | Ga0207646_10078929 | 3300025922 | Bacteria | 2943 |
| 430 | Ga0207646_10170764 | 3300025922 | Bacteria | 1964 |
| 431 | Ga0207694_10020140 | 3300025924 | Bacteria | 5044 |
| 432 | Ga0207694_10022350 | 3300025924 | Bacteria | 4797 |
| 433 | Ga0207694_10268544 | 3300025924 | Bacteria | 1399 |
| 434 | Ga0207650_10027202 | 3300025925 | Bacteria | 4091 |
| 435 | Ga0207650_10041376 | 3300025925 | Bacteria | 3376 |
| 436 | Ga0207650_10074533 | 3300025925 | Bacteria | 2558 |
| 437 | Ga0207659_10009892 | 3300025926 | Bacteria | 5969 |
| 438 | Ga0207659_10015390 | 3300025926 | Bacteria | 4955 |
| 439 | Ga0207659_10042434 | 3300025926 | Bacteria | 3189 |
| 440 | Ga0207687_10019961 | 3300025927 | Bacteria | 4444 |
| 441 | Ga0207687_10032086 | 3300025927 | Bacteria | 3555 |
| 442 | Ga0207687_10103117 | 3300025927 | Bacteria | 2103 |
| 443 | Ga0207687_10193372 | 3300025927 | Bacteria | 1585 |
| 444 | Ga0207700_10000156 | 3300025928 | Bacteria | 40692 |
| 445 | Ga0207700_10003061 | 3300025928 | Bacteria | 9651 |
| 446 | Ga0207700_10025555 | 3300025928 | Bacteria | 4103 |
| 447 | Ga0207700_10038619 | 3300025928 | Bacteria | 3467 |
| 448 | Ga0207700_10046636 | 3300025928 | Bacteria | 3206 |
| 449 | Ga0207700_10052798 | 3300025928 | Bacteria | 3041 |
| 450 | Ga0207700_10068555 | 3300025928 | Bacteria | 2720 |
| 451 | Ga0207664_10005805 | 3300025929 | Bacteria | 8440 |
| 452 | Ga0207664_10007782 | 3300025929 | Bacteria | 7441 |
| 453 | Ga0207664_10010545 | 3300025929 | Bacteria | 6528 |
| 454 | Ga0207664_10010978 | 3300025929 | Bacteria | 6415 |
| 455 | Ga0207664_10013709 | 3300025929 | Bacteria | 5829 |
| 456 | Ga0207664_10013782 | 3300025929 | Bacteria | 5817 |
| 457 | Ga0207664_10013826 | 3300025929 | Bacteria | 5811 |
| 458 | Ga0207664_10025391 | 3300025929 | Bacteria | 4463 |
| 459 | Ga0207664_10110578 | 3300025929 | Bacteria | 2285 |
| 460 | Ga0207664_10139468 | 3300025929 | Bacteria | 2049 |
| 461 | Ga0207644_10047490 | 3300025931 | Bacteria | 3064 |
| 462 | Ga0207644_10083102 | 3300025931 | Bacteria | 2370 |
| 463 | Ga0207644_10192671 | 3300025931 | Bacteria | 1603 |
| 464 | Ga0207644_10208950 | 3300025931 | Bacteria | 1542 |
| 465 | Ga0207690_10107608 | 3300025932 | Bacteria | 2003 |
| 466 | Ga0207706_10009046 | 3300025933 | Bacteria | 9163 |
| 467 | Ga0207686_10002971 | 3300025934 | Bacteria | 9140 |
| 468 | Ga0207686_10009157 | 3300025934 | Bacteria | 5369 |
| 469 | Ga0207686_10024587 | 3300025934 | Bacteria | 3493 |
| 470 | Ga0207686_10046360 | 3300025934 | Bacteria | 2680 |
| 471 | Ga0207686_10080539 | 3300025934 | Bacteria | 2123 |
| 472 | Ga0207709_10018158 | 3300025935 | Bacteria | 3935 |
| 473 | Ga0207709_10030553 | 3300025935 | Bacteria | 3135 |
| 474 | Ga0207709_10102293 | 3300025935 | Bacteria | 1897 |
| 475 | Ga0207709_10109283 | 3300025935 | Bacteria | 1846 |
| 476 | Ga0207709_10131098 | 3300025935 | Bacteria | 1709 |
| 477 | Ga0207670_10028729 | 3300025936 | Bacteria | 3535 |
| 478 | Ga0207669_10037007 | 3300025937 | Bacteria | 2795 |
| 479 | Ga0207669_10065891 | 3300025937 | Bacteria | 2249 |
| 480 | Ga0207704_10084858 | 3300025938 | Bacteria | 2060 |
| 481 | Ga0207704_10116157 | 3300025938 | Bacteria | 1820 |
| 482 | Ga0207704_10140700 | 3300025938 | Bacteria | 1687 |
| 483 | Ga0207665_10000622 | 3300025939 | Bacteria | 23695 |
| 484 | Ga0207665_10001107 | 3300025939 | Bacteria | 18131 |
| 485 | Ga0207665_10013132 | 3300025939 | Bacteria | 5444 |
| 486 | Ga0207665_10033143 | 3300025939 | Bacteria | 3422 |
| 487 | Ga0207691_10075186 | 3300025940 | Bacteria | 3046 |
| 488 | Ga0207691_10125322 | 3300025940 | Bacteria | 2273 |
| 489 | Ga0207711_10022538 | 3300025941 | Bacteria | 5267 |
| 490 | Ga0207711_10024845 | 3300025941 | Bacteria | 5027 |
| 491 | Ga0207711_10027496 | 3300025941 | Bacteria | 4778 |
| 492 | Ga0207711_10148576 | 3300025941 | Bacteria | 2113 |
| 493 | Ga0207711_10185996 | 3300025941 | Bacteria | 1891 |
| 494 | Ga0207711_10254570 | 3300025941 | Bacteria | 1613 |
| 495 | Ga0207689_10002951 | 3300025942 | Bacteria | 15710 |
| 496 | Ga0207689_10045320 | 3300025942 | Bacteria | 3637 |
| 497 | Ga0207689_10048376 | 3300025942 | Bacteria | 3507 |
| 498 | Ga0207661_10001535 | 3300025944 | Bacteria | 15689 |
| 499 | Ga0207661_10016541 | 3300025944 | Bacteria | 5444 |
| 500 | Ga0207661_10026733 | 3300025944 | Bacteria | 4401 |
| 501 | Ga0207661_10053059 | 3300025944 | Bacteria | 3242 |
| 502 | Ga0207661_10116100 | 3300025944 | Bacteria | 2272 |
| 503 | Ga0207661_10132614 | 3300025944 | Bacteria | 2136 |
| 504 | Ga0207679_10299847 | 3300025945 | Bacteria | 1385 |
| 505 | Ga0207667_10044115 | 3300025949 | Bacteria | 4727 |
| 506 | Ga0207667_10180726 | 3300025949 | Bacteria | 2167 |
| 507 | Ga0207667_10222686 | 3300025949 | Bacteria | 1933 |
| 508 | Ga0207651_10149257 | 3300025960 | Bacteria | 1817 |
| 509 | Ga0207712_10012807 | 3300025961 | Bacteria | 5363 |
| 510 | Ga0207712_10036288 | 3300025961 | Bacteria | 3356 |
| 511 | Ga0207712_10076432 | 3300025961 | Bacteria | 2424 |
| 512 | Ga0207668_10105919 | 3300025972 | Bacteria | 2100 |
| 513 | Ga0207640_10005913 | 3300025981 | Bacteria | 6680 |
| 514 | Ga0207658_10020240 | 3300025986 | Bacteria | 4607 |
| 515 | Ga0207658_10100247 | 3300025986 | Bacteria | 2267 |
| 516 | Ga0207677_10067376 | 3300026023 | Bacteria | 2508 |
| 517 | Ga0207677_10075610 | 3300026023 | Bacteria | 2394 |
| 518 | Ga0207703_10009865 | 3300026035 | Bacteria | 7491 |
| 519 | Ga0207703_10034009 | 3300026035 | Bacteria | 4043 |
| 520 | Ga0207703_10078031 | 3300026035 | Bacteria | 2751 |
| 521 | Ga0207703_10085799 | 3300026035 | Bacteria | 2636 |
| 522 | Ga0207703_10130201 | 3300026035 | Bacteria | 2172 |
| 523 | Ga0207703_10248424 | 3300026035 | Bacteria | 1602 |
| 524 | Ga0207678_10020988 | 3300026067 | Bacteria | 5724 |
| 525 | Ga0207678_10032689 | 3300026067 | Bacteria | 4535 |
| 526 | Ga0207708_10001361 | 3300026075 | Bacteria | 18375 |
| 527 | Ga0207708_10032878 | 3300026075 | Bacteria | 3938 |
| 528 | Ga0207708_10064354 | 3300026075 | Bacteria | 2801 |
| 529 | Ga0207702_10024146 | 3300026078 | Bacteria | 5044 |
| 530 | Ga0207702_10029976 | 3300026078 | Bacteria | 4531 |
| 531 | Ga0207702_10073196 | 3300026078 | Bacteria | 2954 |
| 532 | Ga0207641_10003701 | 3300026088 | Bacteria | 13462 |
| 533 | Ga0207641_10195324 | 3300026088 | Bacteria | 1862 |
| 534 | Ga0207648_10002467 | 3300026089 | Bacteria | 19870 |
| 535 | Ga0207648_10025335 | 3300026089 | Bacteria | 5286 |
| 536 | Ga0207648_10050289 | 3300026089 | Bacteria | 3645 |
| 537 | Ga0207648_10060308 | 3300026089 | Bacteria | 3309 |
| 538 | Ga0207676_10055748 | 3300026095 | Bacteria | 3105 |
| 539 | Ga0207676_10130050 | 3300026095 | Bacteria | 2139 |
| 540 | Ga0207676_10136793 | 3300026095 | Bacteria | 2091 |
| 541 | Ga0207674_10006203 | 3300026116 | Bacteria | 14086 |
| 542 | Ga0207674_10006459 | 3300026116 | Bacteria | 13782 |
| 543 | Ga0207674_10040058 | 3300026116 | Bacteria | 4855 |
| 544 | Ga0207674_10166396 | 3300026116 | Bacteria | 2159 |
| 545 | Ga0207675_100009275 | 3300026118 | Bacteria | 9228 |
| 546 | Ga0207675_100037298 | 3300026118 | Bacteria | 4534 |
| 547 | Ga0207675_100070307 | 3300026118 | Bacteria | 3271 |
| 548 | Ga0207675_100077993 | 3300026118 | Bacteria | 3103 |
| 549 | Ga0207675_100143054 | 3300026118 | Bacteria | 2273 |
| 550 | Ga0207675_100157243 | 3300026118 | Bacteria | 2166 |
| 551 | Ga0207683_10008395 | 3300026121 | Bacteria | 8837 |
| 552 | Ga0207683_10028958 | 3300026121 | Bacteria | 4793 |
| 553 | Ga0207683_10050678 | 3300026121 | Bacteria | 3637 |
| 554 | Ga0207683_10070611 | 3300026121 | Bacteria | 3086 |
| 555 | Ga0207683_10113922 | 3300026121 | Bacteria | 2422 |
| 556 | Ga0209971_1009315 | 3300027682 | Bacteria | 2327 |
| 557 | Ga0207428_10000005 | 3300027907 | Bacteria | 520045 |
| 558 | Ga0207428_10002569 | 3300027907 | Bacteria | 18144 |
| 559 | Ga0207428_10026781 | 3300027907 | Bacteria | 4806 |
| 560 | Ga0207428_10088891 | 3300027907 | Bacteria | 2402 |
| 561 | Ga0207428_10095267 | 3300027907 | Bacteria | 2306 |
| 562 | Ga0207428_10169608 | 3300027907 | Bacteria | 1653 |
| 563 | Ga0268266_10012155 | 3300028379 | Bacteria | 7450 |
| 564 | Ga0268266_10041774 | 3300028379 | Bacteria | 3914 |
| 565 | Ga0268266_10121001 | 3300028379 | Bacteria | 2330 |
| 566 | Ga0268266_10121111 | 3300028379 | Bacteria | 2329 |
| 567 | Ga0268265_10000008 | 3300028380 | Bacteria | 417328 |
| 568 | Ga0268264_10045283 | 3300028381 | Bacteria | 3652 |
| 569 | Ga0268264_10096076 | 3300028381 | Bacteria | 2566 |
| 570 | Ga0265337_1000828 | 3300028556 | Bacteria | 16243 |
| 571 | Ga0265326_10001660 | 3300028558 | Bacteria | 7711 |
| 572 | Ga0265319_1002507 | 3300028563 | Bacteria | 9959 |
| 573 | Ga0265334_10000779 | 3300028573 | Bacteria | 15932 |
| 574 | Ga0265334_10001841 | 3300028573 | Bacteria | 10093 |
| 575 | Ga0265318_10003299 | 3300028577 | Bacteria | 8191 |
| 576 | Ga0265318_10004973 | 3300028577 | Bacteria | 6330 |
| 577 | Ga0265318_10012681 | 3300028577 | Bacteria | 3578 |
| 578 | Ga0265318_10033385 | 3300028577 | Bacteria | 1987 |
| 579 | Ga0265323_10003721 | 3300028653 | Bacteria | 6668 |
| 580 | Ga0265322_10008566 | 3300028654 | Bacteria | 2978 |
| 581 | Ga0265336_10005688 | 3300028666 | Bacteria | 4572 |
| 582 | Ga0265336_10006447 | 3300028666 | Bacteria | 4227 |
| 583 | Ga0307515_10000009 | 3300028794 | Bacteria | 653206 |
| 584 | Ga0307515_10006702 | 3300028794 | Bacteria | 22934 |
| 585 | Ga0307515_10024889 | 3300028794 | Bacteria | 10392 |
| 586 | Ga0307515_10230042 | 3300028794 | Bacteria | 1649 |
| 587 | Ga0265338_10000679 | 3300028800 | Bacteria | 58618 |
| 588 | Ga0265338_10001152 | 3300028800 | Bacteria | 43720 |
| 589 | Ga0265338_10005362 | 3300028800 | Bacteria | 16768 |
| 590 | Ga0265338_10010906 | 3300028800 | Bacteria | 10573 |
| 591 | Ga0265338_10011154 | 3300028800 | Bacteria | 10416 |
| 592 | Ga0265338_10074830 | 3300028800 | Bacteria | 2877 |
| 593 | Ga0265338_10079656 | 3300028800 | Bacteria | 2756 |
| 594 | Ga0265338_10092062 | 3300028800 | Bacteria | 2502 |
| 595 | Ga0265324_10014329 | 3300029957 | Bacteria | 2936 |
| 596 | Ga0307512_10010595 | 3300030522 | Bacteria | 8781 |
| 597 | Ga0307512_10019581 | 3300030522 | Bacteria | 6153 |
| 598 | Ga0307512_10027640 | 3300030522 | Bacteria | 4987 |
| 599 | Ga0265330_10008786 | 3300031235 | Bacteria | 4839 |
| 600 | Ga0265328_10016705 | 3300031239 | Bacteria | 2851 |
| 601 | Ga0265325_10001783 | 3300031241 | Bacteria | 14905 |
| 602 | Ga0265325_10002349 | 3300031241 | Bacteria | 12807 |
| 603 | Ga0265325_10019566 | 3300031241 | Bacteria | 3740 |
| 604 | Ga0265325_10069747 | 3300031241 | Bacteria | 1767 |
| 605 | Ga0265340_10000809 | 3300031247 | Bacteria | 17760 |
| 606 | Ga0265340_10009646 | 3300031247 | Bacteria | 5174 |
| 607 | Ga0265339_10033597 | 3300031249 | Bacteria | 2887 |
| 608 | Ga0265339_10045089 | 3300031249 | Bacteria | 2428 |
| 609 | Ga0265331_10008923 | 3300031250 | Bacteria | 5670 |
| 610 | Ga0265327_10002649 | 3300031251 | Bacteria | 18424 |
| 611 | Ga0265327_10017087 | 3300031251 | Bacteria | 4569 |
| 612 | Ga0265316_10009561 | 3300031344 | Bacteria | 8915 |
| 613 | Ga0265316_10021650 | 3300031344 | Bacteria | 5439 |
| 614 | Ga0265316_10025164 | 3300031344 | Bacteria | 4970 |
| 615 | Ga0307513_10023734 | 3300031456 | Bacteria | 7158 |
| 616 | Ga0307513_10030348 | 3300031456 | Bacteria | 6142 |
| 617 | Ga0307509_10000667 | 3300031507 | Bacteria | 58333 |
| 618 | Ga0307509_10043590 | 3300031507 | Bacteria | 4854 |
| 619 | Ga0307408_100099560 | 3300031548 | Bacteria | 2212 |
| 620 | Ga0307408_100190631 | 3300031548 | Bacteria | 1651 |
| 621 | Ga0265313_10005174 | 3300031595 | Bacteria | 9685 |
| 622 | Ga0307508_10005723 | 3300031616 | Bacteria | 11764 |
| 623 | Ga0265342_10001655 | 3300031712 | Bacteria | 20486 |
| 624 | Ga0265342_10022454 | 3300031712 | Bacteria | 4010 |
| 625 | Ga0307405_10009118 | 3300031731 | Bacteria | 5073 |
| 626 | Ga0307413_10000299 | 3300031824 | Bacteria | 15325 |
| 627 | Ga0307410_10114442 | 3300031852 | Bacteria | 1957 |
| 628 | Ga0307407_10000825 | 3300031903 | Bacteria | 10285 |
| 629 | Ga0307412_10102490 | 3300031911 | Bacteria | 2027 |
| 630 | Ga0307409_100033811 | 3300031995 | Bacteria | 3726 |
| 631 | Ga0307409_100061177 | 3300031995 | Bacteria | 2941 |
| 632 | Ga0307416_100000136 | 3300032002 | Bacteria | 43072 |
| 633 | Ga0307416_100005885 | 3300032002 | Bacteria | 7611 |
| 634 | Ga0307416_100015872 | 3300032002 | Bacteria | 5217 |
| 635 | Ga0307416_100061884 | 3300032002 | Bacteria | 3057 |
| 636 | Ga0307416_100107333 | 3300032002 | Bacteria | 2450 |
| 637 | Ga0307411_10069901 | 3300032005 | Bacteria | 2373 |
| 638 | Ga0307411_10070601 | 3300032005 | Bacteria | 2364 |
| 639 | Ga0307411_10079055 | 3300032005 | Bacteria | 2257 |
| 640 | Ga0307415_100000839 | 3300032126 | Bacteria | 14036 |
| 641 | Ga0307415_100080111 | 3300032126 | Bacteria | 2329 |
| 642 | Ga0307415_100203265 | 3300032126 | Bacteria | 1574 |
| 643 | Ga0307507_10028126 | 3300033179 | Bacteria | 6000 |
| 644 | Ga0316215_1002027 | 3300033544 | Bacteria | 1916 |
| 645 | Ga0373930_0000488 | 3300034816 | Bacteria | 5375 |
| 646 | Ga0373950_0001069 | 3300034818 | Bacteria | 3499 |
| 647 | Ga0373959_0001976 | 3300034820 | Bacteria | 3263 |
| 648 | Ga0373938_0012343 | 3300034957 | Bacteria | 1601 |
| 649 | Ga0373926_0001382 | 3300035083 | Bacteria | 7341 |
| 650 | Ga0373926_0005112 | 3300035083 | Bacteria | 4309 |
| 651 | Ga0373928_0001028 | 3300035084 | Bacteria | 5489 |
| 652 | Ga0373944_0001008 | 3300035089 | Bacteria | 6975 |
| 653 | Ga0373944_0001192 | 3300035089 | Bacteria | 6499 |
| 654 | Ga0373949_0028040 | 3300035090 | Bacteria | 1327 |
| 655 | Ga0373951_0004038 | 3300035091 | Bacteria | 3514 |
| 656 | Ga0373952_0001358 | 3300035092 | Bacteria | 4477 |
| 657 | Ga0373923_0005361 | 3300035111 | Bacteria | 4352 |
| 658 | Ga0373932_0000979 | 3300035112 | Bacteria | 8274 |
| 659 | Ga0373936_0000585 | 3300035113 | Bacteria | 12566 |
| 660 | Ga0373936_0002070 | 3300035113 | Bacteria | 7441 |
| 661 | Ga0373936_0006229 | 3300035113 | Bacteria | 4498 |
| 662 | Ga0373945_0000090 | 3300035116 | Bacteria | 21258 |
| 663 | Ga0373953_0036143 | 3300035117 | Bacteria | 1944 |
| 664 | Ga0373954_0022396 | 3300035118 | Bacteria | 2865 |
| 665 | Ga0373956_0000874 | 3300035119 | Bacteria | 12520 |
| 666 | Ga0373956_0019277 | 3300035119 | Bacteria | 2891 |
| 667 | Ga0373956_0038892 | 3300035119 | Bacteria | 2106 |
| 668 | Ga0373956_0039901 | 3300035119 | Bacteria | 2082 |
| 669 | Ga0373957_0002753 | 3300035120 | Bacteria | 5056 |
| 670 | Ga0373957_0026940 | 3300035120 | Bacteria | 2084 |
| 671 | Ga0373943_0000104 | 3300035170 | Bacteria | 30769 |
| 672 | Ga0373943_0008043 | 3300035170 | Bacteria | 4729 |
| 673 | Ga0373946_0002267 | 3300035171 | Bacteria | 6790 |
| 674 | Ga0373955_0002010 | 3300035172 | Bacteria | 8764 |
| 675 | Ga0373955_0002560 | 3300035172 | Bacteria | 7953 |
| 676 | Ga0373955_0014606 | 3300035172 | Bacteria | 3824 |
| 677 | Ga0373955_0030142 | 3300035172 | Bacteria | 2829 |
| 678 | Ga0373955_0032617 | 3300035172 | Bacteria | 2735 |
| 679 | Ga0373955_0033759 | 3300035172 | Bacteria | 2697 |
| 680 | Ga0373955_0061553 | 3300035172 | Bacteria | 2073 |
| 681 | Ga0373942_0001525 | 3300035207 | Bacteria | 5964 |
| 682 | Ga0373961_0004337 | 3300035241 | Bacteria | 3429 |
| 683 | Ga0373962_0000626 | 3300035242 | Bacteria | 7996 |
| 684 | Ga0373962_0001080 | 3300035242 | Bacteria | 6345 |
| 685 | Ga0373924_0013109 | 3300035410 | Bacteria | 3110 |
| 686 | Ga0373931_0003262 | 3300035691 | Bacteria | 7257 |
| 687 | Ga0373935_0006235 | 3300035692 | Bacteria | 7098 |
| 688 | Ga0373935_0033493 | 3300035692 | Bacteria | 3197 |
| 689 | Ga0373935_0043310 | 3300035692 | Bacteria | 2832 |
| 690 | Ga0373927_0007217 | 3300035695 | Bacteria | 7541 |
| 691 | Ga0373927_0065136 | 3300035695 | Bacteria | 2357 |
| 692 | Ga0373933_0000760 | 3300035724 | Bacteria | 19740 |
| 693 | Ga0373933_0008678 | 3300035724 | Bacteria | 5542 |
| 694 | Ga0373933_0010157 | 3300035724 | Bacteria | 5154 |
| 695 | Ga0373933_0029338 | 3300035724 | Bacteria | 3180 |
| 696 | Ga0373933_0072700 | 3300035724 | Bacteria | 2094 |
| 697 | Ga0373947_0000460 | 3300035725 | Bacteria | 23241 |
| 698 | Ga0373947_0047710 | 3300035725 | Bacteria | 2567 |
| 699 | Ga0373947_0060790 | 3300035725 | Bacteria | 2294 |
| 700 | Ga0373937_0000406 | 3300036401 | Bacteria | 40149 |
| 701 | Ga0373937_0005868 | 3300036401 | Bacteria | 10563 |
| 702 | Ga0373937_0012674 | 3300036401 | Bacteria | 7419 |
| 703 | Ga0373937_0032936 | 3300036401 | Bacteria | 4702 |
| 704 | Ga0373937_0078124 | 3300036401 | Bacteria | 3059 |
| 705 | Ga0373937_0081566 | 3300036401 | Bacteria | 2992 |
| 706 | Ga0373937_0103835 | 3300036401 | Bacteria | 2640 |
| 707 | Ga0373937_0179047 | 3300036401 | Bacteria | 1990 |
| 708 | Ga0373937_0199713 | 3300036401 | Bacteria | 1880 |
| 709 | Ga0372808_003886 | 3300036459 | Bacteria | 1869 |
| 710 | Ga0373925_0000004 | 3300037068 | Bacteria | 361597 |
| 711 | Ga0373925_0001409 | 3300037068 | Bacteria | 20883 |
| 712 | Ga0373925_0002467 | 3300037068 | Bacteria | 14789 |
| 713 | Ga0373925_0019281 | 3300037068 | Bacteria | 4961 |
| 714 | Ga0373925_0037647 | 3300037068 | Bacteria | 3572 |
| 715 | Ga0395900_0106821 | 3300037418 | Bacteria | 2876 |
| 716 | Ga0395898_0001504 | 3300037466 | Bacteria | 32204 |
| 717 | Ga0395898_0146426 | 3300037466 | Bacteria | 2260 |
| 718 | Ga0436364_0139618 | 3300037853 | Bacteria | 6183 |
| 719 | Ga0436364_0159890 | 3300037853 | Bacteria | 37893 |
| 720 | Ga0436364_0186251 | 3300037853 | Bacteria | 6064 |
| 721 | Ga0436364_0345410 | 3300037853 | Bacteria | 4647 |
| 722 | Ga0436364_0451820 | 3300037853 | Bacteria | 12064 |
| 723 | Ga0436364_0664281 | 3300037853 | Bacteria | 3148 |
| 724 | Ga0436364_0676343 | 3300037853 | Bacteria | 2885 |
| 725 | Ga0436364_1274919 | 3300037853 | Bacteria | 5081 |
| 726 | Ga0395901_0008894 | 3300038443 | Bacteria | 10170 |
| 727 | Ga0395901_0133392 | 3300038443 | Bacteria | 2610 |
| 728 | Ga0436365_0370589 | 3300039437 | Bacteria | 5743 |
| 729 | Ga0436365_0557948 | 3300039437 | Bacteria | 20490 |
| 730 | Ga0436365_0639646 | 3300039437 | Bacteria | 3056 |
| 731 | Ga0436360_0030969 | 3300039438 | Bacteria | 1381 |
| 732 | Ga0436360_0154330 | 3300039438 | Bacteria | 10394 |
| 733 | Ga0436361_0276991 | 3300039447 | Bacteria | 1985 |
| 734 | Ga0451807_1684515 | 3300041486 | Bacteria | 1611 |
| 735 | Ga0450896_003549 | 3300042133 | Bacteria | 2079 |
| 736 | Ga0450896_003658 | 3300042133 | Bacteria | 2056 |
| 737 | Ga0450908_011786 | 3300042184 | Bacteria | 1595 |
| 738 | Ga0439435_0001331 | 3300042436 | Bacteria | 4510 |
| 739 | Ga0439464_0001418 | 3300042439 | Bacteria | 5634 |
| 740 | Ga0450918_004683 | 3300042531 | Bacteria | 2481 |
| 741 | Ga0450918_008445 | 3300042531 | Bacteria | 1808 |
| 742 | Ga0451577_0020955 | 3300042876 | Bacteria | 5992 |
| 743 | Ga0466969_0005774 | 3300044656 | Bacteria | 6576 |
| 744 | Ga0466966_0048210 | 3300044684 | Bacteria | 2714 |
| 745 | Ga0466966_0083597 | 3300044684 | Bacteria | 1986 |
| 746 | Ga0466961_0005895 | 3300044693 | Bacteria | 7765 |
| 747 | Ga0466963_0042053 | 3300044694 | Bacteria | 2999 |
| 748 | Ga0466963_0090470 | 3300044694 | Bacteria | 2084 |
| 749 | Ga0453684_0000001 | 3300044712 | Bacteria | 2623166 |
| 750 | Ga0453684_0004863 | 3300044712 | Bacteria | 27546 |
| 751 | Ga0466970_0002420 | 3300044765 | Bacteria | 9017 |
| 752 | Ga0466957_0029740 | 3300044842 | Bacteria | 3259 |
| 753 | Ga0466957_0095548 | 3300044842 | Bacteria | 1866 |
| 754 | Ga0466959_0163469 | 3300045049 | Bacteria | 1564 |
| 755 | Ga0451576_0004103 | 3300045051 | Bacteria | 19215 |
| 756 | Ga0451576_0029138 | 3300045051 | Bacteria | 5908 |
| 757 | Ga0451576_0145019 | 3300045051 | Bacteria | 2475 |
| 758 | Ga0466958_0023207 | 3300045836 | Bacteria | 3639 |
| 759 | Ga0466967_0042086 | 3300045976 | Bacteria | 3945 |
| 760 | Ga0466967_0065790 | 3300045976 | Bacteria | 3228 |
| 761 | Ga0466967_0066811 | 3300045976 | Bacteria | 3205 |
| 762 | Ga0495592_0018531 | 3300046454 | Bacteria | 5295 |
| 763 | Ga0495592_0039445 | 3300046454 | Bacteria | 3547 |
| 764 | Ga0495592_0062315 | 3300046454 | Bacteria | 2738 |
| 765 | Ga0495592_0184008 | 3300046454 | Bacteria | 1421 |
| 766 | Ga0495603_0013850 | 3300046455 | Bacteria | 4881 |
| 767 | Ga0495603_0071715 | 3300046455 | Bacteria | 2035 |
| 768 | Ga0495629_0002850 | 3300046459 | Bacteria | 13217 |
| 769 | Ga0495629_0007579 | 3300046459 | Bacteria | 7996 |
| 770 | Ga0495629_0048146 | 3300046459 | Bacteria | 2989 |
| 771 | Ga0495629_0135605 | 3300046459 | Bacteria | 1714 |
| 772 | Ga0495638_0009937 | 3300046460 | Bacteria | 6636 |
| 773 | Ga0495641_0007256 | 3300046461 | Bacteria | 6964 |
| 774 | Ga0495641_0010925 | 3300046461 | Bacteria | 5215 |
| 775 | Ga0495651_0000437 | 3300046462 | Bacteria | 32112 |
| 776 | Ga0495651_0001176 | 3300046462 | Bacteria | 20215 |
| 777 | Ga0495651_0003070 | 3300046462 | Bacteria | 12901 |
| 778 | Ga0495651_0005058 | 3300046462 | Bacteria | 10065 |
| 779 | Ga0495651_0007845 | 3300046462 | Bacteria | 8177 |
| 780 | Ga0495651_0014743 | 3300046462 | Bacteria | 6044 |
| 781 | Ga0495651_0030177 | 3300046462 | Bacteria | 4227 |
| 782 | Ga0495651_0032330 | 3300046462 | Bacteria | 4081 |
| 783 | Ga0495651_0033556 | 3300046462 | Bacteria | 4004 |
| 784 | Ga0495651_0068699 | 3300046462 | Bacteria | 2700 |
| 785 | Ga0495651_0081442 | 3300046462 | Bacteria | 2443 |
| 786 | Ga0495651_0110506 | 3300046462 | Bacteria | 2033 |
| 787 | Ga0495653_0000407 | 3300046463 | Bacteria | 34501 |
| 788 | Ga0495653_0002317 | 3300046463 | Bacteria | 15094 |
| 789 | Ga0495653_0009600 | 3300046463 | Bacteria | 7915 |
| 790 | Ga0495653_0013273 | 3300046463 | Bacteria | 6716 |
| 791 | Ga0495653_0053880 | 3300046463 | Bacteria | 3075 |
| 792 | Ga0495653_0077684 | 3300046463 | Bacteria | 2464 |
| 793 | Ga0495580_0006861 | 3300046472 | Bacteria | 9211 |
| 794 | Ga0495580_0023623 | 3300046472 | Bacteria | 4511 |
| 795 | Ga0495580_0023806 | 3300046472 | Bacteria | 4491 |
| 796 | Ga0495580_0061933 | 3300046472 | Bacteria | 2626 |
| 797 | Ga0495582_0006991 | 3300046473 | Bacteria | 6275 |
| 798 | Ga0495582_0009072 | 3300046473 | Bacteria | 5488 |
| 799 | Ga0495639_0002073 | 3300046475 | Bacteria | 8872 |
| 800 | Ga0495639_0031725 | 3300046475 | Bacteria | 2354 |
| 801 | Ga0495639_0053488 | 3300046475 | Bacteria | 1840 |
| 802 | Ga0495662_0004407 | 3300046476 | Bacteria | 7069 |
| 803 | Ga0495662_0013626 | 3300046476 | Bacteria | 3958 |
| 804 | Ga0495662_0015117 | 3300046476 | Bacteria | 3749 |
| 805 | Ga0495664_0000070 | 3300046477 | Bacteria | 49408 |
| 806 | Ga0495664_0010231 | 3300046477 | Bacteria | 5262 |
| 807 | Ga0495664_0011516 | 3300046477 | Bacteria | 4988 |
| 808 | Ga0495664_0013847 | 3300046477 | Bacteria | 4573 |
| 809 | Ga0495664_0020660 | 3300046477 | Bacteria | 3799 |
| 810 | Ga0495664_0138832 | 3300046477 | Bacteria | 1473 |
| 811 | Ga0495594_0003845 | 3300046499 | Bacteria | 7714 |
| 812 | Ga0495608_0004948 | 3300046511 | Bacteria | 9542 |
| 813 | Ga0495608_0035306 | 3300046511 | Bacteria | 3373 |
| 814 | Ga0495608_0038284 | 3300046511 | Bacteria | 3221 |
| 815 | Ga0495608_0039932 | 3300046511 | Bacteria | 3144 |
| 816 | Ga0495618_0008733 | 3300046514 | Bacteria | 6121 |
| 817 | Ga0495618_0040054 | 3300046514 | Bacteria | 2947 |
| 818 | Ga0495618_0051326 | 3300046514 | Bacteria | 2605 |
| 819 | Ga0495618_0064583 | 3300046514 | Bacteria | 2326 |
| 820 | Ga0495628_0016933 | 3300046516 | Bacteria | 6074 |
| 821 | Ga0495628_0037299 | 3300046516 | Bacteria | 3897 |
| 822 | Ga0495628_0104663 | 3300046516 | Bacteria | 2181 |
| 823 | Ga0495630_0006775 | 3300046517 | Bacteria | 8162 |
| 824 | Ga0495630_0032489 | 3300046517 | Bacteria | 3889 |
| 825 | Ga0495630_0058423 | 3300046517 | Bacteria | 2891 |
| 826 | Ga0495630_0072868 | 3300046517 | Bacteria | 2586 |
| 827 | Ga0495643_0002153 | 3300046522 | Bacteria | 16186 |
| 828 | Ga0495666_0004590 | 3300046526 | Bacteria | 6983 |
| 829 | Ga0495666_0037298 | 3300046526 | Bacteria | 2364 |
| 830 | Ga0495652_0001203 | 3300046529 | Bacteria | 28972 |
| 831 | Ga0495652_0001429 | 3300046529 | Bacteria | 26472 |
| 832 | Ga0495652_0012348 | 3300046529 | Bacteria | 7708 |
| 833 | Ga0495652_0014814 | 3300046529 | Bacteria | 6990 |
| 834 | Ga0495652_0050574 | 3300046529 | Bacteria | 3552 |
| 835 | Ga0495652_0071635 | 3300046529 | Bacteria | 2891 |
| 836 | Ga0495652_0109352 | 3300046529 | Bacteria | 2225 |
| 837 | Ga0495652_0118948 | 3300046529 | Bacteria | 2111 |
| 838 | Ga0495665_0003759 | 3300046531 | Bacteria | 8216 |
| 839 | Ga0495665_0007128 | 3300046531 | Bacteria | 6034 |
| 840 | Ga0495665_0015168 | 3300046531 | Bacteria | 4153 |
| 841 | Ga0495665_0064285 | 3300046531 | Bacteria | 1936 |
| 842 | Ga0495640_0009337 | 3300046533 | Bacteria | 7638 |
| 843 | Ga0495640_0015950 | 3300046533 | Bacteria | 5636 |
| 844 | Ga0495640_0135910 | 3300046533 | Bacteria | 1588 |
| 845 | Ga0495586_0003806 | 3300046535 | Bacteria | 8082 |
| 846 | Ga0495586_0007625 | 3300046535 | Bacteria | 5774 |
| 847 | Ga0495587_0002491 | 3300046536 | Bacteria | 12293 |
| 848 | Ga0495587_0004386 | 3300046536 | Bacteria | 9303 |
| 849 | Ga0495587_0005606 | 3300046536 | Bacteria | 8190 |
| 850 | Ga0495587_0014118 | 3300046536 | Bacteria | 5015 |
| 851 | Ga0495587_0018231 | 3300046536 | Bacteria | 4354 |
| 852 | Ga0495645_0010250 | 3300046543 | Bacteria | 6568 |
| 853 | Ga0495645_0015740 | 3300046543 | Bacteria | 5384 |
| 854 | Ga0495645_0038194 | 3300046543 | Bacteria | 3502 |
| 855 | Ga0495645_0079590 | 3300046543 | Bacteria | 2353 |
| 856 | Ga0495645_0079730 | 3300046543 | Bacteria | 2351 |
| 857 | Ga0495667_0001491 | 3300046559 | Bacteria | 15424 |
| 858 | Ga0495667_0005979 | 3300046559 | Bacteria | 8229 |
| 859 | Ga0495667_0009858 | 3300046559 | Bacteria | 6470 |
| 860 | Ga0495667_0011460 | 3300046559 | Bacteria | 6000 |
| 861 | Ga0495667_0011838 | 3300046559 | Bacteria | 5909 |
| 862 | Ga0495667_0038291 | 3300046559 | Bacteria | 3194 |
| 863 | Ga0495667_0049933 | 3300046559 | Bacteria | 2762 |
| 864 | Ga0495667_0121292 | 3300046559 | Bacteria | 1688 |
| 865 | Ga0495667_0155536 | 3300046559 | Bacteria | 1471 |
| 866 | Ga0495634_0006657 | 3300046642 | Bacteria | 8766 |
| 867 | Ga0495634_0009471 | 3300046642 | Bacteria | 7182 |
| 868 | Ga0495634_0031928 | 3300046642 | Bacteria | 3624 |
| 869 | Ga0495634_0040416 | 3300046642 | Bacteria | 3172 |
| 870 | Ga0495634_0127395 | 3300046642 | Bacteria | 1626 |
| 871 | Ga0495634_0162098 | 3300046642 | Bacteria | 1409 |
| 872 | Ga0495635_0000481 | 3300046663 | Bacteria | 25143 |
| 873 | Ga0495635_0002646 | 3300046663 | Bacteria | 12247 |
| 874 | Ga0495635_0030773 | 3300046663 | Bacteria | 3728 |
| 875 | Ga0495635_0056436 | 3300046663 | Bacteria | 2703 |
| 876 | Ga0495635_0067683 | 3300046663 | Bacteria | 2449 |
| 877 | Ga0495659_0062484 | 3300046664 | Bacteria | 1378 |
| 878 | Ga0495657_0000870 | 3300046675 | Bacteria | 26662 |
| 879 | Ga0495657_0004127 | 3300046675 | Bacteria | 11635 |
| 880 | Ga0495657_0010117 | 3300046675 | Bacteria | 7107 |
| 881 | Ga0495657_0022123 | 3300046675 | Bacteria | 4558 |
| 882 | Ga0495657_0087581 | 3300046675 | Bacteria | 2003 |
| 883 | Ga0495657_0114943 | 3300046675 | Bacteria | 1700 |
| 884 | Ga0495599_0007250 | 3300046678 | Bacteria | 6718 |
| 885 | Ga0495599_0013754 | 3300046678 | Bacteria | 5005 |
| 886 | Ga0495599_0026362 | 3300046678 | Bacteria | 3642 |
| 887 | Ga0495599_0052522 | 3300046678 | Bacteria | 2553 |
| 888 | Ga0495599_0107518 | 3300046678 | Bacteria | 1738 |
| 889 | Ga0495623_0032170 | 3300046679 | Bacteria | 3371 |
| 890 | Ga0495623_0037736 | 3300046679 | Bacteria | 3090 |
| 891 | Ga0495623_0052019 | 3300046679 | Bacteria | 2590 |
| 892 | Ga0495623_0065874 | 3300046679 | Bacteria | 2264 |
| 893 | Ga0495623_0081623 | 3300046679 | Bacteria | 1999 |
| 894 | Ga0495623_0096821 | 3300046679 | Bacteria | 1802 |
| 895 | Ga0495646_0008505 | 3300046680 | Bacteria | 6518 |
| 896 | Ga0495647_0032845 | 3300046681 | Bacteria | 1937 |
| 897 | Ga0495658_0002586 | 3300046683 | Bacteria | 9101 |
| 898 | Ga0495658_0021126 | 3300046683 | Bacteria | 3428 |
| 899 | Ga0495658_0046587 | 3300046683 | Bacteria | 2438 |
| 900 | Ga0495613_0002935 | 3300046689 | Bacteria | 12771 |
| 901 | Ga0495613_0042287 | 3300046689 | Bacteria | 3372 |
| 902 | Ga0495613_0178205 | 3300046689 | Bacteria | 1506 |
| 903 | Ga0495624_0000293 | 3300046690 | Bacteria | 39469 |
| 904 | Ga0495624_0006924 | 3300046690 | Bacteria | 7996 |
| 905 | Ga0495624_0011892 | 3300046690 | Bacteria | 5967 |
| 906 | Ga0495600_0000600 | 3300046809 | Bacteria | 18601 |
| 907 | Ga0495600_0012730 | 3300046809 | Bacteria | 5267 |
| 908 | Ga0495600_0033853 | 3300046809 | Bacteria | 3317 |
| 909 | Ga0495600_0068217 | 3300046809 | Bacteria | 2324 |
| 910 | Ga0495600_0070101 | 3300046809 | Bacteria | 2291 |
| 911 | Ga0495600_0082008 | 3300046809 | Bacteria | 2104 |
| 912 | Ga0495581_0014125 | 3300047315 | Bacteria | 4627 |
| 913 | Ga0495604_0003381 | 3300047317 | Bacteria | 12728 |
| 914 | Ga0495604_0006541 | 3300047317 | Bacteria | 9236 |
| 915 | Ga0495604_0015284 | 3300047317 | Bacteria | 6129 |
| 916 | Ga0495604_0039903 | 3300047317 | Bacteria | 3688 |
| 917 | Ga0495604_0080649 | 3300047317 | Bacteria | 2438 |
| 918 | Ga0495604_0111216 | 3300047317 | Bacteria | 1997 |
| 919 | Ga0495674_0000077 | 3300047319 | Bacteria | 66642 |
| 920 | Ga0495674_0000901 | 3300047319 | Bacteria | 28391 |
| 921 | Ga0495674_0007780 | 3300047319 | Bacteria | 10230 |
| 922 | Ga0495674_0030820 | 3300047319 | Bacteria | 4873 |
| 923 | Ga0495674_0035531 | 3300047319 | Bacteria | 4494 |
| 924 | Ga0495674_0052846 | 3300047319 | Bacteria | 3573 |
| 925 | Ga0495674_0065766 | 3300047319 | Bacteria | 3148 |
| 926 | Ga0495674_0131774 | 3300047319 | Bacteria | 2106 |
| 927 | Ga0495674_0273540 | 3300047319 | Bacteria | 1385 |
| 928 | Ga0495672_0007107 | 3300047320 | Bacteria | 8486 |
| 929 | Ga0495676_0004113 | 3300047321 | Bacteria | 13263 |
| 930 | Ga0495676_0013863 | 3300047321 | Bacteria | 7228 |
| 931 | Ga0495676_0056744 | 3300047321 | Bacteria | 3095 |
| 932 | Ga0495680_0001678 | 3300047322 | Bacteria | 23537 |
| 933 | Ga0495680_0001803 | 3300047322 | Bacteria | 22644 |
| 934 | Ga0495680_0003169 | 3300047322 | Bacteria | 16374 |
| 935 | Ga0495680_0008073 | 3300047322 | Bacteria | 9596 |
| 936 | Ga0495680_0012601 | 3300047322 | Bacteria | 7429 |
| 937 | Ga0495680_0014478 | 3300047322 | Bacteria | 6829 |
| 938 | Ga0495680_0023912 | 3300047322 | Bacteria | 5076 |
| 939 | Ga0495680_0053834 | 3300047322 | Bacteria | 3129 |
| 940 | Ga0495675_0009946 | 3300047444 | Bacteria | 5930 |
| 941 | Ga0495675_0047864 | 3300047444 | Bacteria | 2720 |
| 942 | Ga0495684_0001680 | 3300047471 | Bacteria | 17791 |
| 943 | Ga0495684_0012081 | 3300047471 | Bacteria | 6662 |
| 944 | Ga0495684_0027276 | 3300047471 | Bacteria | 4385 |
| 945 | Ga0495684_0035736 | 3300047471 | Bacteria | 3809 |
| 946 | Ga0495684_0042936 | 3300047471 | Bacteria | 3461 |
| 947 | Ga0495684_0084185 | 3300047471 | Bacteria | 2413 |
| 948 | Ga0495684_0090109 | 3300047471 | Bacteria | 2323 |
| 949 | Ga0495602_0011381 | 3300048088 | Bacteria | 9200 |
| 950 | Ga0495602_0037498 | 3300048088 | Bacteria | 4497 |
| 951 | Ga0495602_0047374 | 3300048088 | Bacteria | 3874 |
| 952 | Ga0495602_0086400 | 3300048088 | Bacteria | 2618 |
| 953 | Ga0495602_0112823 | 3300048088 | Bacteria | 2205 |
| 954 | Ga0495614_0017083 | 3300048089 | Bacteria | 3154 |
| 955 | Ga0495614_0022071 | 3300048089 | Bacteria | 2748 |
| 956 | Ga0496100_0023016 | 3300048903 | Bacteria | 3778 |
| 957 | Ga0496100_0044842 | 3300048903 | Bacteria | 2834 |
| 958 | Ga0496100_0077236 | 3300048903 | Bacteria | 2238 |
| 959 | Ga0496100_0176057 | 3300048903 | Bacteria | 1544 |
| 960 | Ga0496101_0036098 | 3300048904 | Bacteria | 3499 |
| 961 | Ga0496101_0040618 | 3300048904 | Bacteria | 3313 |
| 962 | Ga0496101_0107030 | 3300048904 | Bacteria | 2100 |
| 963 | Ga0496102_0062625 | 3300048905 | Bacteria | 3406 |
| 964 | Ga0496102_0075959 | 3300048905 | Bacteria | 3089 |
| 965 | Ga0496102_0102624 | 3300048905 | Bacteria | 2659 |
| 966 | Ga0496102_0203960 | 3300048905 | Bacteria | 1864 |
| 967 | Ga0496103_0015893 | 3300048906 | Bacteria | 4487 |
| 968 | Ga0496103_0017090 | 3300048906 | Bacteria | 4337 |
| 969 | Ga0496104_0001708 | 3300048907 | Bacteria | 18959 |
| 970 | Ga0496104_0016517 | 3300048907 | Bacteria | 6707 |
| 971 | Ga0496104_0017912 | 3300048907 | Bacteria | 6458 |
| 972 | Ga0496104_0034539 | 3300048907 | Bacteria | 4716 |
| 973 | Ga0496104_0045391 | 3300048907 | Bacteria | 4132 |
| 974 | Ga0496104_0078058 | 3300048907 | Bacteria | 3155 |
| 975 | Ga0496104_0129341 | 3300048907 | Bacteria | 2425 |
| 976 | Ga0496104_0165323 | 3300048907 | Bacteria | 2122 |
| 977 | Ga0496104_0175815 | 3300048907 | Bacteria | 2051 |
| 978 | Ga0496105_0000625 | 3300048908 | Bacteria | 23668 |
| 979 | Ga0496105_0000887 | 3300048908 | Bacteria | 20463 |
| 980 | Ga0496105_0029467 | 3300048908 | Bacteria | 4492 |
| 981 | Ga0496105_0037873 | 3300048908 | Bacteria | 3972 |
| 982 | Ga0496105_0052327 | 3300048908 | Bacteria | 3373 |
| 983 | Ga0496105_0253858 | 3300048908 | Bacteria | 1424 |
| 984 | Ga0496106_0012256 | 3300048909 | Bacteria | 6330 |
| 985 | Ga0496107_0019023 | 3300048910 | Bacteria | 4843 |
| 986 | Ga0496107_0035839 | 3300048910 | Bacteria | 3558 |
| 987 | Ga0496107_0232111 | 3300048910 | Bacteria | 1373 |
| 988 | Ga0496108_0042706 | 3300048911 | Bacteria | 3785 |
| 989 | Ga0496108_0087987 | 3300048911 | Bacteria | 2639 |
| 990 | Ga0496108_0102292 | 3300048911 | Bacteria | 2445 |
| 991 | Ga0496108_0105859 | 3300048911 | Bacteria | 2402 |
| 992 | Ga0496108_0135224 | 3300048911 | Bacteria | 2120 |
| 993 | Ga0496109_0001425 | 3300048912 | Bacteria | 19847 |
| 994 | Ga0496109_0005983 | 3300048912 | Bacteria | 10218 |
| 995 | Ga0496109_0020322 | 3300048912 | Bacteria | 5865 |
| 996 | Ga0496109_0020526 | 3300048912 | Bacteria | 5835 |
| 997 | Ga0496109_0029342 | 3300048912 | Bacteria | 4927 |
| 998 | Ga0496109_0039820 | 3300048912 | Bacteria | 4255 |
| 999 | Ga0496109_0069813 | 3300048912 | Bacteria | 3223 |
| 1000 | Ga0496109_0081258 | 3300048912 | Bacteria | 2986 |
| 1001 | Ga0496109_0151526 | 3300048912 | Bacteria | 2171 |
| 1002 | Ga0496109_0235224 | 3300048912 | Bacteria | 1724 |
| 1003 | Ga0496110_0005415 | 3300048913 | Bacteria | 10012 |
| 1004 | Ga0496110_0006954 | 3300048913 | Bacteria | 8999 |
| 1005 | Ga0496110_0019391 | 3300048913 | Bacteria | 5722 |
| 1006 | Ga0496110_0028459 | 3300048913 | Bacteria | 4800 |
| 1007 | Ga0496110_0036800 | 3300048913 | Bacteria | 4252 |
| 1008 | Ga0496110_0057099 | 3300048913 | Bacteria | 3436 |
| 1009 | Ga0496110_0112267 | 3300048913 | Bacteria | 2450 |
| 1010 | Ga0496110_0219280 | 3300048913 | Bacteria | 1730 |
| 1011 | Ga0496110_0222628 | 3300048913 | Bacteria | 1716 |
| 1012 | Ga0496110_0311703 | 3300048913 | Bacteria | 1433 |
| 1013 | Ga0496111_0006167 | 3300048914 | Bacteria | 7760 |
| 1014 | Ga0496111_0008568 | 3300048914 | Bacteria | 6774 |
| 1015 | Ga0496111_0009075 | 3300048914 | Bacteria | 6619 |
| 1016 | Ga0496111_0012389 | 3300048914 | Bacteria | 5772 |
| 1017 | Ga0496111_0016514 | 3300048914 | Bacteria | 5087 |
| 1018 | Ga0496111_0125802 | 3300048914 | Bacteria | 1895 |
| 1019 | Ga0496111_0135228 | 3300048914 | Bacteria | 1826 |
| 1020 | Ga0496112_0000654 | 3300048915 | Bacteria | 24049 |
| 1021 | Ga0496112_0002559 | 3300048915 | Bacteria | 14691 |
| 1022 | Ga0496112_0014517 | 3300048915 | Bacteria | 7315 |
| 1023 | Ga0496112_0020544 | 3300048915 | Bacteria | 6262 |
| 1024 | Ga0496112_0180383 | 3300048915 | Bacteria | 2075 |
| 1025 | Ga0496112_0239148 | 3300048915 | Bacteria | 1769 |
| 1026 | Ga0496112_0288560 | 3300048915 | Bacteria | 1587 |
| 1027 | Ga0496113_0008932 | 3300048916 | Bacteria | 6560 |
| 1028 | Ga0496113_0134744 | 3300048916 | Bacteria | 1940 |
| 1029 | Ga0496114_0004635 | 3300048917 | Bacteria | 10683 |
| 1030 | Ga0496114_0005458 | 3300048917 | Bacteria | 9945 |
| 1031 | Ga0496114_0010895 | 3300048917 | Bacteria | 7244 |
| 1032 | Ga0496114_0023442 | 3300048917 | Bacteria | 5037 |
| 1033 | Ga0496114_0045384 | 3300048917 | Bacteria | 3650 |
| 1034 | Ga0496114_0046621 | 3300048917 | Bacteria | 3602 |
| 1035 | Ga0496114_0070585 | 3300048917 | Bacteria | 2934 |
| 1036 | Ga0496114_0107297 | 3300048917 | Bacteria | 2389 |
| 1037 | Ga0496114_0152765 | 3300048917 | Bacteria | 2003 |
| 1038 | Ga0496114_0173904 | 3300048917 | Bacteria | 1878 |
| 1039 | Ga0496114_0235530 | 3300048917 | Bacteria | 1609 |
| 1040 | Ga0496114_0324048 | 3300048917 | Bacteria | 1362 |
| 1041 | Ga0496115_0001765 | 3300048918 | Bacteria | 15483 |
| 1042 | Ga0496115_0001917 | 3300048918 | Bacteria | 14846 |
| 1043 | Ga0496115_0002525 | 3300048918 | Bacteria | 13151 |
| 1044 | Ga0496115_0011376 | 3300048918 | Bacteria | 6669 |
| 1045 | Ga0496115_0049719 | 3300048918 | Bacteria | 3357 |
| 1046 | Ga0496115_0192278 | 3300048918 | Bacteria | 1686 |
| 1047 | Ga0496121_0105771 | 3300048924 | Bacteria | 2159 |
| 1048 | Ga0496124_0065485 | 3300048927 | Bacteria | 3030 |
| 1049 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 1050 | Ga0501291_001996 | 3300049514 | Bacteria | 2404 |
| 1051 | Ga0501034_0003291 | 3300049571 | Bacteria | 18453 |
| 1052 | Ga0501036_0005010 | 3300049572 | Bacteria | 10721 |
| 1053 | Ga0501036_0056559 | 3300049572 | Bacteria | 3324 |
| 1054 | Ga0501037_0024927 | 3300049573 | Bacteria | 4421 |
| 1055 | Ga0501038_0001599 | 3300049574 | Bacteria | 21000 |
| 1056 | Ga0501039_0063559 | 3300049575 | Bacteria | 2860 |
| 1057 | Ga0501039_0098416 | 3300049575 | Bacteria | 2282 |
| 1058 | Ga0501039_0139976 | 3300049575 | Bacteria | 1901 |
| 1059 | Ga0501041_0021851 | 3300049577 | Bacteria | 3833 |
| 1060 | Ga0501042_0011725 | 3300049578 | Bacteria | 5922 |
| 1061 | Ga0501042_0021843 | 3300049578 | Bacteria | 4466 |
| 1062 | Ga0501042_0173170 | 3300049578 | Bacteria | 1557 |
| 1063 | Ga0501043_0006372 | 3300049579 | Bacteria | 9481 |
| 1064 | Ga0501047_0005090 | 3300049581 | Bacteria | 12332 |
| 1065 | Ga0501048_0018829 | 3300049582 | Bacteria | 5075 |
| 1066 | Ga0501070_0000314 | 3300049586 | Bacteria | 43877 |
| 1067 | Ga0501071_0126062 | 3300049587 | Bacteria | 1900 |
| 1068 | Ga0501072_0066142 | 3300049588 | Bacteria | 2851 |
| 1069 | Ga0501073_0073531 | 3300049589 | Bacteria | 2380 |
| 1070 | Ga0501074_0002246 | 3300049590 | Bacteria | 13412 |
| 1071 | Ga0501074_0021828 | 3300049590 | Bacteria | 4647 |
| 1072 | Ga0501075_0029669 | 3300049591 | Bacteria | 4046 |
| 1073 | Ga0501075_0033968 | 3300049591 | Bacteria | 3796 |
| 1074 | Ga0501076_0014490 | 3300049592 | Bacteria | 5941 |
| 1075 | Ga0501076_0021386 | 3300049592 | Bacteria | 4962 |
| 1076 | Ga0501076_0068563 | 3300049592 | Bacteria | 2833 |
| 1077 | Ga0501076_0217288 | 3300049592 | Bacteria | 1562 |
| 1078 | Ga0501081_0083960 | 3300049743 | Bacteria | 2233 |
| 1079 | Ga0501044_0137006 | 3300049823 | Bacteria | 2439 |
| 1080 | Ga0501045_0010998 | 3300049824 | Bacteria | 6342 |
| 1081 | nmdc:mga03683_2035_c1 | 3300050489 | Bacteria | 6191 |
| 1082 | nmdc:mga00v17_26612_c1 | 3300050491 | Bacteria | 3373 |
| 1083 | nmdc:mga00v17_30340_c1 | 3300050491 | Bacteria | 3181 |
| 1084 | nmdc:mga00v17_49490_c1 | 3300050491 | Bacteria | 2549 |
| 1085 | nmdc:mga0yw44_9232_c1 | 3300050492 | Bacteria | 4967 |
| 1086 | nmdc:mga0k408_12317_c1 | 3300050493 | Bacteria | 4672 |
| 1087 | nmdc:mga06z11_17220_c1 | 3300050494 | Bacteria | 3274 |
| 1088 | nmdc:mga06z11_82205_c1 | 3300050494 | Bacteria | 1731 |
| 1089 | nmdc:mga04h51_32797_c1 | 3300050495 | Bacteria | 1649 |
| 1090 | nmdc:mga07m45_26584_c1 | 3300050496 | Bacteria | 3182 |
| 1091 | nmdc:mga07m45_37579_c1 | 3300050496 | Bacteria | 2700 |
| 1092 | nmdc:mga07m45_9881_c1 | 3300050496 | Bacteria | 4964 |
| 1093 | nmdc:mga05p37_117793_c1 | 3300050507 | Bacteria | 3263 |
| 1094 | nmdc:mga05p37_11943_c1 | 3300050507 | Bacteria | 10358 |
| 1095 | nmdc:mga05p37_16331_c1 | 3300050507 | Bacteria | 8938 |
| 1096 | nmdc:mga05p37_1840_c1 | 3300050507 | Bacteria | 24732 |
| 1097 | nmdc:mga05p37_196089_c1 | 3300050507 | Bacteria | 2449 |
| 1098 | nmdc:mga05p37_4567_c1 | 3300050507 | Bacteria | 16182 |
| 1099 | nmdc:mga05p37_56374_c1 | 3300050507 | Bacteria | 4838 |
| 1100 | nmdc:mga05p37_83890_c1 | 3300050507 | Bacteria | 3926 |
| 1101 | nmdc:mga09592_17930_c1 | 3300050508 | Bacteria | 5800 |
| 1102 | nmdc:mga09592_83422_c1 | 3300050508 | Bacteria | 2724 |
| 1103 | nmdc:mga0qj67_24732_c1 | 3300050509 | Bacteria | 4633 |
| 1104 | nmdc:mga0qj67_32716_c1 | 3300050509 | Bacteria | 4057 |
| 1105 | nmdc:mga0qj67_4023_c1 | 3300050509 | Bacteria | 10645 |
| 1106 | nmdc:mga06r32_106426_c1 | 3300050510 | Bacteria | 2756 |
| 1107 | nmdc:mga06r32_183620_c1 | 3300050510 | Bacteria | 2078 |
| 1108 | nmdc:mga06r32_34653_c1 | 3300050510 | Bacteria | 4762 |
| 1109 | nmdc:mga06r32_6030_c1 | 3300050510 | Bacteria | 10903 |
| 1110 | nmdc:mga06r32_8420_c1 | 3300050510 | Bacteria | 9293 |
| 1111 | nmdc:mga08y16_15584_c1 | 3300050511 | Bacteria | 7993 |
| 1112 | nmdc:mga08y16_21084_c1 | 3300050511 | Bacteria | 6880 |
| 1113 | nmdc:mga08y16_5415_c1 | 3300050511 | Bacteria | 13344 |
| 1114 | nmdc:mga08y16_5687_c1 | 3300050511 | Bacteria | 13065 |
| 1115 | nmdc:mga08y16_62648_c1 | 3300050511 | Bacteria | 3884 |
| 1116 | nmdc:mga08y16_81888_c1 | 3300050511 | Bacteria | 3365 |
| 1117 | nmdc:mga08y16_85518_c1 | 3300050511 | Bacteria | 3287 |
| 1118 | nmdc:mga08y16_90531_c1 | 3300050511 | Bacteria | 3189 |
| 1119 | nmdc:mga08y16_9_c1 | 3300050511 | Bacteria | 566088 |
| 1120 | nmdc:mga0n895_19119_c1 | 3300050512 | Bacteria | 6360 |
| 1121 | nmdc:mga0n895_3820_c1 | 3300050512 | Bacteria | 12210 |
| 1122 | nmdc:mga0n895_45936_c1 | 3300050512 | Bacteria | 4265 |
| 1123 | nmdc:mga0rr50_100550_c1 | 3300050513 | Bacteria | 2271 |
| 1124 | nmdc:mga0rr50_289831_c1 | 3300050513 | Bacteria | 1367 |
| 1125 | nmdc:mga0rr50_78383_c1 | 3300050513 | Bacteria | 2542 |
| 1126 | nmdc:mga0rr50_9061_c1 | 3300050513 | Bacteria | 6229 |
| 1127 | nmdc:mga08x19_7857_c1 | 3300050514 | Bacteria | 6336 |
| 1128 | nmdc:mga0a205_192610_c1 | 3300050515 | Bacteria | 1930 |
| 1129 | nmdc:mga0a205_2892_c2 | 3300050515 | Bacteria | 5623 |
| 1130 | nmdc:mga0a205_51890_c1 | 3300050515 | Bacteria | 3959 |
| 1131 | Ga0495601_0014020 | 3300053077 | Bacteria | 4827 |
| 1132 | Ga0495601_0020222 | 3300053077 | Bacteria | 4065 |
| 1133 | Ga0495601_0025242 | 3300053077 | Bacteria | 3663 |
| 1134 | Ga0495612_0001488 | 3300053078 | Bacteria | 9655 |
| 1135 | Ga0495612_0011812 | 3300053078 | Bacteria | 3520 |
| 1136 | Ga0495612_0038746 | 3300053078 | Bacteria | 1937 |
| 1137 | Ga0500635_0008858 | 3300053080 | Bacteria | 2773 |
| 1138 | Ga0495595_0001958 | 3300053084 | Bacteria | 7998 |
| 1139 | Ga0495595_0010954 | 3300053084 | Bacteria | 3783 |
| 1140 | Ga0495595_0011505 | 3300053084 | Bacteria | 3700 |
| 1141 | Ga0495619_0004191 | 3300053085 | Bacteria | 9201 |
| 1142 | Ga0495619_0008447 | 3300053085 | Bacteria | 6511 |
| 1143 | Ga0495619_0011816 | 3300053085 | Bacteria | 5500 |
| 1144 | Ga0495619_0031770 | 3300053085 | Bacteria | 3422 |
| 1145 | Ga0495619_0046942 | 3300053085 | Bacteria | 2842 |
| 1146 | Ga0495619_0091317 | 3300053085 | Bacteria | 2062 |
| 1147 | Ga0495619_0130575 | 3300053085 | Bacteria | 1726 |
| 1148 | Ga0500646_0000226 | 3300053090 | Bacteria | 16966 |
| 1149 | Ga0500566_0000309 | 3300053094 | Bacteria | 26262 |
| 1150 | Ga0500592_005590 | 3300053116 | Bacteria | 2002 |
| 1151 | Ga0500593_000445 | 3300053117 | Bacteria | 16318 |
| 1152 | Ga0500564_032533 | 3300053138 | Bacteria | 2406 |
| 1153 | Ga0500577_0033069 | 3300053142 | Bacteria | 1824 |
| 1154 | Ga0500588_0010585 | 3300053146 | Bacteria | 2233 |
| 1155 | Ga0500603_002800 | 3300053150 | Bacteria | 3783 |
| 1156 | Ga0500616_0000083 | 3300053153 | Bacteria | 197344 |
| 1157 | Ga0501084_0054670 | 3300054114 | Bacteria | 3340 |
| 1158 | Ga0530510_0009419 | 3300061734 | Bacteria | 6847 |
| 1159 | Ga0530510_0031818 | 3300061734 | Bacteria | 3793 |
| 1160 | 2508674807 | 2508501039 | Bacteria | 9978592 |
| 1161 | 2676488350 | 2675903060 | Bacteria | 10051191 |
| 1162 | 2791910294 | 2791354901 | Bacteria | 8322202 |
| 1163 | 2795787262 | 2795385470 | Bacteria | 8317180 |
| 1164 | 2837269927 | 2837268691 | Bacteria | 7850704 |
| 1165 | 2887479765 | 2887478801 | Bacteria | 8972725 |
| 1166 | 2895434757 | 2895427314 | Bacteria | 13147766 |
| 1167 | 8002778267 | 8002775197 | Bacteria | 10728764 |
| 1168 | 8055067781 | 8055066027 | Bacteria | 9479577 |
| 1169 | 8055179032 | 8055172936 | Bacteria | 9305943 |
| 1170 | 8057571791 | 8057568493 | Bacteria | 7221719 |
| 1171 | Ga0070706_100113515 | |||
| 1172 | JGI25406J46586_10003119 | |||
| 1173 | JGI25404J52841_10000325 | |||
| 1174 | Ga0065712_10010069 | |||
| 1175 | Ga0065712_10068279 | |||
| 1176 | Ga0065715_10003259 | |||
| 1177 | Ga0065715_10105385 | |||
| 1178 | Ga0070658_10013525 | |||
| 1179 | Ga0070683_100000708 | |||
| 1180 | Ga0070683_100006137 | |||
| 1181 | Ga0070683_100051377 | |||
| 1182 | Ga0070683_100065521 | |||
| 1183 | Ga0070683_100188061 | |||
| 1184 | Ga0070690_100041283 | |||
| 1185 | Ga0070670_100002490 | |||
| 1186 | Ga0070670_100015382 | |||
| 1187 | Ga0070670_100023077 | |||
| 1188 | Ga0070670_100065146 | |||
| 1189 | Ga0070670_100091590 | |||
| 1190 | Ga0068869_100000875 | |||
| 1191 | Ga0070680_100249339 | |||
| 1192 | Ga0068868_100005552 | |||
| 1193 | Ga0068868_100127395 | |||
| 1194 | Ga0070660_100004570 | |||
| 1195 | Ga0070689_100152071 | |||
| 1196 | Ga0070691_10047059 | |||
| 1197 | Ga0070691_10049594 | |||
| 1198 | Ga0070687_100016969 | |||
| 1199 | Ga0070687_100048841 | |||
| 1200 | Ga0070661_100064226 | |||
| 1201 | Ga0070661_100076735 | |||
| 1202 | Ga0070661_100112017 | |||
| 1203 | Ga0070692_10018668 | |||
| 1204 | Ga0070668_100023554 | |||
| 1205 | Ga0070669_100014255 | |||
| 1206 | Ga0070669_100043091 | |||
| 1207 | Ga0070669_100061772 | |||
| 1208 | Ga0070669_100171484 | |||
| 1209 | Ga0070675_100001453 | |||
| 1210 | Ga0070675_100007466 | |||
| 1211 | Ga0070675_100025889 | |||
| 1212 | Ga0070675_100068451 | |||
| 1213 | Ga0070675_100149650 | |||
| 1214 | Ga0070675_100189851 | |||
| 1215 | Ga0070671_100001323 | |||
| 1216 | Ga0070671_100042971 | |||
| 1217 | Ga0070671_100048299 | |||
| 1218 | Ga0070674_100055631 | |||
| 1219 | Ga0070674_100214333 | |||
| 1220 | Ga0070673_100064706 | |||
| 1221 | Ga0070673_100110972 | |||
| 1222 | Ga0070673_100133337 | |||
| 1223 | Ga0070688_100080498 | |||
| 1224 | Ga0070667_100008751 | |||
| 1225 | Ga0070667_100012141 | |||
| 1226 | Ga0070667_100059792 | |||
| 1227 | Ga0070667_100177627 | |||
| 1228 | Ga0070703_10004964 | |||
| 1229 | Ga0070709_10001895 | |||
| 1230 | Ga0070709_10020242 | |||
| 1231 | Ga0070709_10077535 | |||
| 1232 | Ga0070709_10097629 | |||
| 1233 | Ga0070709_10103591 | |||
| 1234 | Ga0070709_10112470 | |||
| 1235 | Ga0070714_100005591 | |||
| 1236 | Ga0070714_100008018 | |||
| 1237 | Ga0070714_100009569 | |||
| 1238 | Ga0070714_100069571 | |||
| 1239 | Ga0070714_100111738 | |||
| 1240 | Ga0070714_100216976 | |||
| 1241 | Ga0070713_100005039 | |||
| 1242 | Ga0070713_100017150 | |||
| 1243 | Ga0070713_100026182 | |||
| 1244 | Ga0070710_10001607 | |||
| 1245 | Ga0070710_10010036 | |||
| 1246 | Ga0070710_10029772 | |||
| 1247 | Ga0070710_10105831 | |||
| 1248 | Ga0070711_100001313 | |||
| 1249 | Ga0070711_100015396 | |||
| 1250 | Ga0070711_100035012 | |||
| 1251 | Ga0070711_100110193 | |||
| 1252 | Ga0070700_100005059 | |||
| 1253 | Ga0070708_100016213 | |||
| 1254 | Ga0070708_100029697 | |||
| 1255 | Ga0070663_100020660 | |||
| 1256 | Ga0070663_100094442 | |||
| 1257 | Ga0070678_100016237 | |||
| 1258 | Ga0070678_100091375 | |||
| 1259 | Ga0070678_100203182 | |||
| 1260 | Ga0070662_100050182 | |||
| 1261 | Ga0070681_10005432 | |||
| 1262 | Ga0070681_10022748 | |||
| 1263 | Ga0070681_10178023 | |||
| 1264 | Ga0068867_100039296 | |||
| 1265 | Ga0068867_100072162 | |||
| 1266 | Ga0068867_100185443 | |||
| 1267 | Ga0070706_100000298 | |||
| 1268 | Ga0070706_100003182 | |||
| 1269 | Ga0070706_100003183 | |||
| 1270 | Ga0070706_100003446 | |||
| 1271 | Ga0070706_100037326 | |||
| 1272 | Ga0070706_100095645 | |||
| 1273 | Ga0070707_100000066 | |||
| 1274 | Ga0070707_100028239 | |||
| 1275 | Ga0070707_100031345 | |||
| 1276 | Ga0070707_100044696 | |||
| 1277 | Ga0070707_100049611 | |||
| 1278 | Ga0070707_100064740 | |||
| 1279 | Ga0070707_100077439 | |||
| 1280 | Ga0070707_100098952 | |||
| 1281 | Ga0070707_100127596 | |||
| 1282 | Ga0070707_100303393 | |||
| 1283 | Ga0070698_100000154 | |||
| 1284 | Ga0070698_100004935 | |||
| 1285 | Ga0070698_100005953 | |||
| 1286 | Ga0070698_100010079 | |||
| 1287 | Ga0070698_100011383 | |||
| 1288 | Ga0070698_100011937 | |||
| 1289 | Ga0070698_100017565 | |||
| 1290 | Ga0070698_100038471 | |||
| 1291 | Ga0070698_100040100 | |||
| 1292 | Ga0070698_100044493 | |||
| 1293 | Ga0070698_100059464 | |||
| 1294 | Ga0070698_100062237 | |||
| 1295 | Ga0070698_100063401 | |||
| 1296 | Ga0070698_100080818 | |||
| 1297 | Ga0070698_100087245 | |||
| 1298 | Ga0070698_100107569 | |||
| 1299 | Ga0070698_100196328 | |||
| 1300 | Ga0070699_100000758 | |||
| 1301 | Ga0070699_100001345 | |||
| 1302 | Ga0070699_100013989 | |||
| 1303 | Ga0070699_100014705 | |||
| 1304 | Ga0070699_100035871 | |||
| 1305 | Ga0070699_100060708 | |||
| 1306 | Ga0070699_100087847 | |||
| 1307 | Ga0070679_100044237 | |||
| 1308 | Ga0070679_100048223 | |||
| 1309 | Ga0070679_100141624 | |||
| 1310 | Ga0070684_100010970 | |||
| 1311 | Ga0070684_100013271 | |||
| 1312 | Ga0070684_100032607 | |||
| 1313 | Ga0070684_100046984 | |||
| 1314 | Ga0070684_100077920 | |||
| 1315 | Ga0070684_100146361 | |||
| 1316 | Ga0070684_100213834 | |||
| 1317 | Ga0070697_100012007 | |||
| 1318 | Ga0070697_100014435 | |||
| 1319 | Ga0070697_100022679 | |||
| 1320 | Ga0070697_100032532 | |||
| 1321 | Ga0070697_100057202 | |||
| 1322 | Ga0070697_100136145 | |||
| 1323 | Ga0070686_100017300 | |||
| 1324 | Ga0070695_100005289 | |||
| 1325 | Ga0070695_100106781 | |||
| 1326 | Ga0070695_100153034 | |||
| 1327 | Ga0070665_100004294 | |||
| 1328 | Ga0070665_100004460 | |||
| 1329 | Ga0070665_100048196 | |||
| 1330 | Ga0070665_100054831 | |||
| 1331 | Ga0070665_100093009 | |||
| 1332 | Ga0070665_100179722 | |||
| 1333 | Ga0070704_100055511 | |||
| 1334 | Ga0068855_100012336 | |||
| 1335 | Ga0068855_100130631 | |||
| 1336 | Ga0070664_100001862 | |||
| 1337 | Ga0070664_100024777 | |||
| 1338 | Ga0070664_100050318 | |||
| 1339 | Ga0070664_100309218 | |||
| 1340 | Ga0068857_100018463 | |||
| 1341 | Ga0068857_100036109 | |||
| 1342 | Ga0068854_100002000 | |||
| 1343 | Ga0068856_100023164 | |||
| 1344 | Ga0068856_100044400 | |||
| 1345 | Ga0068856_100057750 | |||
| 1346 | Ga0068856_100066150 | |||
| 1347 | Ga0068856_100082825 | |||
| 1348 | Ga0068856_100355543 | |||
| 1349 | Ga0070702_100022881 | |||
| 1350 | Ga0070702_100025067 | |||
| 1351 | Ga0068852_100006521 | |||
| 1352 | Ga0068859_100068345 | |||
| 1353 | Ga0068864_100004684 | |||
| 1354 | Ga0068864_100024062 | |||
| 1355 | Ga0068864_100025084 | |||
| 1356 | Ga0068864_100045919 | |||
| 1357 | Ga0068861_100036073 | |||
| 1358 | Ga0068851_10048950 | |||
| 1359 | Ga0068863_100004960 | |||
| 1360 | Ga0068863_100008257 | |||
| 1361 | Ga0068863_100016047 | |||
| 1362 | Ga0068863_100042759 | |||
| 1363 | Ga0068863_100102710 | |||
| 1364 | Ga0068858_100011661 | |||
| 1365 | Ga0068858_100013571 | |||
| 1366 | Ga0068860_100044713 | |||
| 1367 | Ga0068860_100153508 | |||
| 1368 | Ga0068860_100263187 | |||
| 1369 | Ga0068862_100000037 | |||
| 1370 | Ga0068862_100016247 | |||
| 1371 | Ga0068862_100114737 | |||
| 1372 | Ga0081455_10000070 | |||
| 1373 | Ga0081455_10008133 | |||
| 1374 | Ga0081455_10013953 | |||
| 1375 | Ga0081540_1000244 | |||
| 1376 | Ga0081540_1000792 | |||
| 1377 | Ga0081539_10000285 | |||
| 1378 | Ga0081539_10001662 | |||
| 1379 | Ga0070717_10064553 | |||
| 1380 | Ga0070717_10128019 | |||
| 1381 | Ga0075365_10016041 | |||
| 1382 | Ga0075365_10120158 | |||
| 1383 | Ga0075368_10006288 | |||
| 1384 | Ga0075368_10032957 | |||
| 1385 | Ga0075364_10031327 | |||
| 1386 | Ga0075364_10045733 | |||
| 1387 | Ga0075364_10082186 | |||
| 1388 | Ga0070715_10022021 | |||
| 1389 | Ga0070716_100003571 | |||
| 1390 | Ga0070716_100005543 | |||
| 1391 | Ga0070716_100021375 | |||
| 1392 | Ga0070716_100035952 | |||
| 1393 | Ga0070712_100005064 | |||
| 1394 | Ga0070712_100015738 | |||
| 1395 | Ga0070712_100026606 | |||
| 1396 | Ga0070712_100046224 | |||
| 1397 | Ga0075367_10100019 | |||
| 1398 | Ga0075366_10009894 | |||
| 1399 | Ga0097621_100003602 | |||
| 1400 | Ga0097621_100004239 | |||
| 1401 | Ga0097621_100013902 | |||
| 1402 | Ga0097621_100041573 | |||
| 1403 | Ga0097621_100083519 | |||
| 1404 | Ga0075370_10008520 | |||
| 1405 | Ga0075370_10045086 | |||
| 1406 | Ga0075370_10048354 | |||
| 1407 | Ga0068871_100003038 | |||
| 1408 | Ga0068871_100065475 | |||
| 1409 | Ga0068871_100091197 | |||
| 1410 | Ga0068871_100132418 | |||
| 1411 | Ga0075428_100003422 | |||
| 1412 | Ga0075428_100017655 | |||
| 1413 | Ga0075428_100018271 | |||
| 1414 | Ga0075428_100044900 | |||
| 1415 | Ga0075428_100089481 | |||
| 1416 | Ga0075428_100381306 | |||
| 1417 | Ga0075430_100000790 | |||
| 1418 | Ga0075430_100009424 | |||
| 1419 | Ga0075430_100010903 | |||
| 1420 | Ga0075430_100030699 | |||
| 1421 | Ga0075431_100009459 | |||
| 1422 | Ga0075431_100050191 | |||
| 1423 | Ga0075431_100202892 | |||
| 1424 | Ga0075433_10013697 | |||
| 1425 | Ga0075433_10098951 | |||
| 1426 | Ga0075434_100021887 | |||
| 1427 | Ga0075434_100127113 | |||
| 1428 | Ga0075434_100305014 | |||
| 1429 | Ga0075429_100000790 | |||
| 1430 | Ga0075429_100009195 | |||
| 1431 | Ga0068865_100001353 | |||
| 1432 | Ga0068865_100011565 | |||
| 1433 | Ga0068865_100020263 | |||
| 1434 | Ga0068865_100107429 | |||
| 1435 | Ga0075436_100002528 | |||
| 1436 | Ga0097620_100000043 | |||
| 1437 | Ga0097620_100068349 | |||
| 1438 | Ga0075435_100023263 | |||
| 1439 | Ga0075435_100029278 | |||
| 1440 | Ga0105240_10000016 | |||
| 1441 | Ga0105240_10125826 | |||
| 1442 | Ga0111539_10000009 | |||
| 1443 | Ga0111539_10000159 | |||
| 1444 | Ga0111539_10002299 | |||
| 1445 | Ga0111539_10012961 | |||
| 1446 | Ga0111539_10024596 | |||
| 1447 | Ga0111539_10031724 | |||
| 1448 | Ga0111539_10037027 | |||
| 1449 | Ga0111539_10139425 | |||
| 1450 | Ga0105245_10014308 | |||
| 1451 | Ga0105245_10019618 | |||
| 1452 | Ga0105245_10037070 | |||
| 1453 | Ga0105245_10092259 | |||
| 1454 | Ga0105245_10123004 | |||
| 1455 | Ga0105247_10014927 | |||
| 1456 | Ga0114129_10001448 | |||
| 1457 | Ga0114129_10004686 | |||
| 1458 | Ga0114129_10007559 | |||
| 1459 | Ga0114129_10043612 | |||
| 1460 | Ga0114129_10056209 | |||
| 1461 | Ga0114129_10073340 | |||
| 1462 | Ga0114129_10136565 | |||
| 1463 | Ga0114129_10317984 | |||
| 1464 | Ga0105243_10019454 | |||
| 1465 | Ga0105243_10066229 | |||
| 1466 | Ga0105243_10080068 | |||
| 1467 | Ga0105241_10000239 | |||
| 1468 | Ga0105241_10051062 | |||
| 1469 | Ga0105242_10002512 | |||
| 1470 | Ga0105242_10003883 | |||
| 1471 | Ga0105242_10006730 | |||
| 1472 | Ga0105242_10018291 | |||
| 1473 | Ga0105242_10019508 | |||
| 1474 | Ga0105242_10149031 | |||
| 1475 | Ga0105248_10030409 | |||
| 1476 | Ga0105248_10036049 | |||
| 1477 | Ga0105248_10056218 | |||
| 1478 | Ga0105248_10118679 | |||
| 1479 | Ga0105237_10049907 | |||
| 1480 | Ga0105237_10185162 | |||
| 1481 | Ga0105238_10001393 | |||
| 1482 | Ga0105238_10012498 | |||
| 1483 | Ga0105238_10014392 | |||
| 1484 | Ga0105238_10107940 | |||
| 1485 | Ga0105238_10382569 | |||
| 1486 | Ga0105249_10058877 | |||
| 1487 | Ga0105249_10126645 | |||
| 1488 | Ga0099796_10034784 | |||
| 1489 | Ga0105239_10008916 | |||
| 1490 | Ga0105239_10096091 | |||
| 1491 | Ga0105246_10005086 | |||
| 1492 | Ga0105246_10161556 | |||
| 1493 | Ga0105246_10194607 | |||
| 1494 | Ga0157370_10018418 | |||
| 1495 | Ga0157369_10007550 | |||
| 1496 | Ga0157369_10013183 | |||
| 1497 | Ga0157369_10052297 | |||
| 1498 | Ga0157374_10008702 | |||
| 1499 | Ga0157374_10034589 | |||
| 1500 | Ga0157374_10324990 | |||
| 1501 | Ga0157378_10020339 | |||
| 1502 | Ga0163162_10006773 | |||
| 1503 | Ga0163162_10011988 | |||
| 1504 | Ga0163162_10047356 | |||
| 1505 | Ga0157375_10015152 | |||
| 1506 | Ga0163163_10000001 | |||
| 1507 | Ga0163163_10010746 | |||
| 1508 | Ga0163163_10021478 | |||
| 1509 | Ga0163163_10069765 | |||
| 1510 | Ga0163163_10152288 | |||
| 1511 | Ga0157380_10008049 | |||
| 1512 | Ga0157380_10012276 | |||
| 1513 | Ga0157380_10268367 | |||
| 1514 | Ga0157377_10113436 | |||
| 1515 | Ga0157379_10008806 | |||
| 1516 | Ga0157379_10031188 | |||
| 1517 | Ga0157379_10040353 | |||
| 1518 | Ga0157379_10040667 | |||
| 1519 | Ga0157376_10006796 | |||
| 1520 | Ga0157376_10020783 | |||
| 1521 | Ga0157376_10115804 | |||
| 1522 | Ga0157376_10176414 | |||
| 1523 | Ga0206354_11100292 | |||
| 1524 | Ga0206353_10082891 | |||
| 1525 | Ga0206353_10163986 | |||
| 1526 | Ga0206353_10639952 | |||
| 1527 | Ga0213876_10001259 | |||
| 1528 | Ga0213876_10029200 | |||
| 1529 | Ga0213876_10054597 | |||
| 1530 | Ga0213875_10002658 | |||
| 1531 | Ga0213875_10012568 | |||
| 1532 | Ga0213871_10010903 | |||
| 1533 | Ga0224712_10005976 | |||
| 1534 | Ga0224712_10020911 | |||
| 1535 | Ga0224572_1001028 | |||
| 1536 | Ga0207697_10014580 | |||
| 1537 | Ga0207653_10000676 | |||
| 1538 | Ga0207653_10005871 | |||
| 1539 | Ga0207682_10048807 | |||
| 1540 | Ga0207692_10000949 | |||
| 1541 | Ga0207692_10001973 | |||
| 1542 | Ga0207692_10014211 | |||
| 1543 | Ga0207692_10025813 | |||
| 1544 | Ga0207710_10024355 | |||
| 1545 | Ga0207688_10011027 | |||
| 1546 | Ga0207680_10005600 | |||
| 1547 | Ga0207680_10069803 | |||
| 1548 | Ga0207647_10015041 | |||
| 1549 | Ga0207647_10027622 | |||
| 1550 | Ga0207685_10014519 | |||
| 1551 | Ga0207685_10016422 | |||
| 1552 | Ga0207699_10000382 | |||
| 1553 | Ga0207699_10001451 | |||
| 1554 | Ga0207699_10002657 | |||
| 1555 | Ga0207699_10005384 | |||
| 1556 | Ga0207699_10041257 | |||
| 1557 | Ga0207699_10125302 | |||
| 1558 | Ga0207645_10017636 | |||
| 1559 | Ga0207645_10102178 | |||
| 1560 | Ga0207643_10052827 | |||
| 1561 | Ga0207705_10005831 | |||
| 1562 | Ga0207684_10000482 | |||
| 1563 | Ga0207684_10000539 | |||
| 1564 | Ga0207684_10000558 | |||
| 1565 | Ga0207684_10003396 | |||
| 1566 | Ga0207684_10006546 | |||
| 1567 | Ga0207684_10031896 | |||
| 1568 | Ga0207684_10048492 | |||
| 1569 | Ga0207684_10121310 | |||
| 1570 | Ga0207654_10132780 | |||
| 1571 | Ga0207707_10051384 | |||
| 1572 | Ga0207695_10000042 | |||
| 1573 | Ga0207695_10202127 | |||
| 1574 | Ga0207695_10210618 | |||
| 1575 | Ga0207671_10000794 | |||
| 1576 | Ga0207671_10150173 | |||
| 1577 | Ga0207693_10000504 | |||
| 1578 | Ga0207693_10041010 | |||
| 1579 | Ga0207693_10079420 | |||
| 1580 | Ga0207693_10104306 | |||
| 1581 | Ga0207693_10117597 | |||
| 1582 | Ga0207693_10151798 | |||
| 1583 | Ga0207663_10075573 | |||
| 1584 | Ga0207662_10021653 | |||
| 1585 | Ga0207657_10000773 | |||
| 1586 | Ga0207657_10024423 | |||
| 1587 | Ga0207649_10062392 | |||
| 1588 | Ga0207649_10073461 | |||
| 1589 | Ga0207652_10060831 | |||
| 1590 | Ga0207652_10068911 | |||
| 1591 | Ga0207646_10000065 | |||
| 1592 | Ga0207646_10000078 | |||
| 1593 | Ga0207646_10010477 | |||
| 1594 | Ga0207646_10014545 | |||
| 1595 | Ga0207646_10023119 | |||
| 1596 | Ga0207646_10025444 | |||
| 1597 | Ga0207646_10027516 | |||
| 1598 | Ga0207646_10061897 | |||
| 1599 | Ga0207646_10078929 | |||
| 1600 | Ga0207646_10170764 | |||
| 1601 | Ga0207694_10020140 | |||
| 1602 | Ga0207694_10022350 | |||
| 1603 | Ga0207694_10268544 | |||
| 1604 | Ga0207650_10027202 | |||
| 1605 | Ga0207650_10041376 | |||
| 1606 | Ga0207650_10074533 | |||
| 1607 | Ga0207659_10009892 | |||
| 1608 | Ga0207659_10015390 | |||
| 1609 | Ga0207659_10042434 | |||
| 1610 | Ga0207687_10019961 | |||
| 1611 | Ga0207687_10032086 | |||
| 1612 | Ga0207687_10103117 | |||
| 1613 | Ga0207687_10193372 | |||
| 1614 | Ga0207700_10000156 | |||
| 1615 | Ga0207700_10003061 | |||
| 1616 | Ga0207700_10025555 | |||
| 1617 | Ga0207700_10038619 | |||
| 1618 | Ga0207700_10046636 | |||
| 1619 | Ga0207700_10052798 | |||
| 1620 | Ga0207700_10068555 | |||
| 1621 | Ga0207664_10005805 | |||
| 1622 | Ga0207664_10007782 | |||
| 1623 | Ga0207664_10010545 | |||
| 1624 | Ga0207664_10010978 | |||
| 1625 | Ga0207664_10013709 | |||
| 1626 | Ga0207664_10013782 | |||
| 1627 | Ga0207664_10013826 | |||
| 1628 | Ga0207664_10025391 | |||
| 1629 | Ga0207664_10110578 | |||
| 1630 | Ga0207664_10139468 | |||
| 1631 | Ga0207644_10047490 | |||
| 1632 | Ga0207644_10083102 | |||
| 1633 | Ga0207644_10192671 | |||
| 1634 | Ga0207644_10208950 | |||
| 1635 | Ga0207690_10107608 | |||
| 1636 | Ga0207706_10009046 | |||
| 1637 | Ga0207686_10002971 | |||
| 1638 | Ga0207686_10009157 | |||
| 1639 | Ga0207686_10024587 | |||
| 1640 | Ga0207686_10046360 | |||
| 1641 | Ga0207686_10080539 | |||
| 1642 | Ga0207709_10018158 | |||
| 1643 | Ga0207709_10030553 | |||
| 1644 | Ga0207709_10102293 | |||
| 1645 | Ga0207709_10109283 | |||
| 1646 | Ga0207709_10131098 | |||
| 1647 | Ga0207670_10028729 | |||
| 1648 | Ga0207669_10037007 | |||
| 1649 | Ga0207669_10065891 | |||
| 1650 | Ga0207704_10084858 | |||
| 1651 | Ga0207704_10116157 | |||
| 1652 | Ga0207704_10140700 | |||
| 1653 | Ga0207665_10000622 | |||
| 1654 | Ga0207665_10001107 | |||
| 1655 | Ga0207665_10013132 | |||
| 1656 | Ga0207665_10033143 | |||
| 1657 | Ga0207691_10075186 | |||
| 1658 | Ga0207691_10125322 | |||
| 1659 | Ga0207711_10022538 | |||
| 1660 | Ga0207711_10024845 | |||
| 1661 | Ga0207711_10027496 | |||
| 1662 | Ga0207711_10148576 | |||
| 1663 | Ga0207711_10185996 | |||
| 1664 | Ga0207711_10254570 | |||
| 1665 | Ga0207689_10002951 | |||
| 1666 | Ga0207689_10045320 | |||
| 1667 | Ga0207689_10048376 | |||
| 1668 | Ga0207661_10001535 | |||
| 1669 | Ga0207661_10016541 | |||
| 1670 | Ga0207661_10026733 | |||
| 1671 | Ga0207661_10053059 | |||
| 1672 | Ga0207661_10116100 | |||
| 1673 | Ga0207661_10132614 | |||
| 1674 | Ga0207679_10299847 | |||
| 1675 | Ga0207667_10044115 | |||
| 1676 | Ga0207667_10180726 | |||
| 1677 | Ga0207667_10222686 | |||
| 1678 | Ga0207651_10149257 | |||
| 1679 | Ga0207712_10012807 | |||
| 1680 | Ga0207712_10036288 | |||
| 1681 | Ga0207712_10076432 | |||
| 1682 | Ga0207668_10105919 | |||
| 1683 | Ga0207640_10005913 | |||
| 1684 | Ga0207658_10020240 | |||
| 1685 | Ga0207658_10100247 | |||
| 1686 | Ga0207677_10067376 | |||
| 1687 | Ga0207677_10075610 | |||
| 1688 | Ga0207703_10009865 | |||
| 1689 | Ga0207703_10034009 | |||
| 1690 | Ga0207703_10078031 | |||
| 1691 | Ga0207703_10085799 | |||
| 1692 | Ga0207703_10130201 | |||
| 1693 | Ga0207703_10248424 | |||
| 1694 | Ga0207678_10020988 | |||
| 1695 | Ga0207678_10032689 | |||
| 1696 | Ga0207708_10001361 | |||
| 1697 | Ga0207708_10032878 | |||
| 1698 | Ga0207708_10064354 | |||
| 1699 | Ga0207702_10024146 | |||
| 1700 | Ga0207702_10029976 | |||
| 1701 | Ga0207702_10073196 | |||
| 1702 | Ga0207641_10003701 | |||
| 1703 | Ga0207641_10195324 | |||
| 1704 | Ga0207648_10002467 | |||
| 1705 | Ga0207648_10025335 | |||
| 1706 | Ga0207648_10050289 | |||
| 1707 | Ga0207648_10060308 | |||
| 1708 | Ga0207676_10055748 | |||
| 1709 | Ga0207676_10130050 | |||
| 1710 | Ga0207676_10136793 | |||
| 1711 | Ga0207674_10006203 | |||
| 1712 | Ga0207674_10006459 | |||
| 1713 | Ga0207674_10040058 | |||
| 1714 | Ga0207674_10166396 | |||
| 1715 | Ga0207675_100009275 | |||
| 1716 | Ga0207675_100037298 | |||
| 1717 | Ga0207675_100070307 | |||
| 1718 | Ga0207675_100077993 | |||
| 1719 | Ga0207675_100143054 | |||
| 1720 | Ga0207675_100157243 | |||
| 1721 | Ga0207683_10008395 | |||
| 1722 | Ga0207683_10028958 | |||
| 1723 | Ga0207683_10050678 | |||
| 1724 | Ga0207683_10070611 | |||
| 1725 | Ga0207683_10113922 | |||
| 1726 | Ga0209971_1009315 | |||
| 1727 | Ga0207428_10000005 | |||
| 1728 | Ga0207428_10002569 | |||
| 1729 | Ga0207428_10026781 | |||
| 1730 | Ga0207428_10088891 | |||
| 1731 | Ga0207428_10095267 | |||
| 1732 | Ga0207428_10169608 | |||
| 1733 | Ga0268266_10012155 | |||
| 1734 | Ga0268266_10041774 | |||
| 1735 | Ga0268266_10121001 | |||
| 1736 | Ga0268266_10121111 | |||
| 1737 | Ga0268265_10000008 | |||
| 1738 | Ga0268264_10045283 | |||
| 1739 | Ga0268264_10096076 | |||
| 1740 | Ga0265337_1000828 | |||
| 1741 | Ga0265326_10001660 | |||
| 1742 | Ga0265319_1002507 | |||
| 1743 | Ga0265334_10000779 | |||
| 1744 | Ga0265334_10001841 | |||
| 1745 | Ga0265318_10003299 | |||
| 1746 | Ga0265318_10004973 | |||
| 1747 | Ga0265318_10012681 | |||
| 1748 | Ga0265318_10033385 | |||
| 1749 | Ga0265323_10003721 | |||
| 1750 | Ga0265322_10008566 | |||
| 1751 | Ga0265336_10005688 | |||
| 1752 | Ga0265336_10006447 | |||
| 1753 | Ga0307515_10000009 | |||
| 1754 | Ga0307515_10006702 | |||
| 1755 | Ga0307515_10024889 | |||
| 1756 | Ga0307515_10230042 | |||
| 1757 | Ga0265338_10000679 | |||
| 1758 | Ga0265338_10001152 | |||
| 1759 | Ga0265338_10005362 | |||
| 1760 | Ga0265338_10010906 | |||
| 1761 | Ga0265338_10011154 | |||
| 1762 | Ga0265338_10074830 | |||
| 1763 | Ga0265338_10079656 | |||
| 1764 | Ga0265338_10092062 | |||
| 1765 | Ga0265324_10014329 | |||
| 1766 | Ga0307512_10010595 | |||
| 1767 | Ga0307512_10019581 | |||
| 1768 | Ga0307512_10027640 | |||
| 1769 | Ga0265330_10008786 | |||
| 1770 | Ga0265328_10016705 | |||
| 1771 | Ga0265325_10001783 | |||
| 1772 | Ga0265325_10002349 | |||
| 1773 | Ga0265325_10019566 | |||
| 1774 | Ga0265325_10069747 | |||
| 1775 | Ga0265340_10000809 | |||
| 1776 | Ga0265340_10009646 | |||
| 1777 | Ga0265339_10033597 | |||
| 1778 | Ga0265339_10045089 | |||
| 1779 | Ga0265331_10008923 | |||
| 1780 | Ga0265327_10002649 | |||
| 1781 | Ga0265327_10017087 | |||
| 1782 | Ga0265316_10009561 | |||
| 1783 | Ga0265316_10021650 | |||
| 1784 | Ga0265316_10025164 | |||
| 1785 | Ga0307513_10023734 | |||
| 1786 | Ga0307513_10030348 | |||
| 1787 | Ga0307509_10000667 | |||
| 1788 | Ga0307509_10043590 | |||
| 1789 | Ga0307408_100099560 | |||
| 1790 | Ga0307408_100190631 | |||
| 1791 | Ga0265313_10005174 | |||
| 1792 | Ga0307508_10005723 | |||
| 1793 | Ga0265342_10001655 | |||
| 1794 | Ga0265342_10022454 | |||
| 1795 | Ga0307405_10009118 | |||
| 1796 | Ga0307413_10000299 | |||
| 1797 | Ga0307410_10114442 | |||
| 1798 | Ga0307407_10000825 | |||
| 1799 | Ga0307412_10102490 | |||
| 1800 | Ga0307409_100033811 | |||
| 1801 | Ga0307409_100061177 | |||
| 1802 | Ga0307416_100000136 | |||
| 1803 | Ga0307416_100005885 | |||
| 1804 | Ga0307416_100015872 | |||
| 1805 | Ga0307416_100061884 | |||
| 1806 | Ga0307416_100107333 | |||
| 1807 | Ga0307411_10069901 | |||
| 1808 | Ga0307411_10070601 | |||
| 1809 | Ga0307411_10079055 | |||
| 1810 | Ga0307415_100000839 | |||
| 1811 | Ga0307415_100080111 | |||
| 1812 | Ga0307415_100203265 | |||
| 1813 | Ga0307507_10028126 | |||
| 1814 | Ga0316215_1002027 | |||
| 1815 | Ga0373930_0000488 | |||
| 1816 | Ga0373950_0001069 | |||
| 1817 | Ga0373959_0001976 | |||
| 1818 | Ga0373938_0012343 | |||
| 1819 | Ga0373926_0001382 | |||
| 1820 | Ga0373926_0005112 | |||
| 1821 | Ga0373928_0001028 | |||
| 1822 | Ga0373944_0001008 | |||
| 1823 | Ga0373944_0001192 | |||
| 1824 | Ga0373949_0028040 | |||
| 1825 | Ga0373951_0004038 | |||
| 1826 | Ga0373952_0001358 | |||
| 1827 | Ga0373923_0005361 | |||
| 1828 | Ga0373932_0000979 | |||
| 1829 | Ga0373936_0000585 | |||
| 1830 | Ga0373936_0002070 | |||
| 1831 | Ga0373936_0006229 | |||
| 1832 | Ga0373945_0000090 | |||
| 1833 | Ga0373953_0036143 | |||
| 1834 | Ga0373954_0022396 | |||
| 1835 | Ga0373956_0000874 | |||
| 1836 | Ga0373956_0019277 | |||
| 1837 | Ga0373956_0038892 | |||
| 1838 | Ga0373956_0039901 | |||
| 1839 | Ga0373957_0002753 | |||
| 1840 | Ga0373957_0026940 | |||
| 1841 | Ga0373943_0000104 | |||
| 1842 | Ga0373943_0008043 | |||
| 1843 | Ga0373946_0002267 | |||
| 1844 | Ga0373955_0002010 | |||
| 1845 | Ga0373955_0002560 | |||
| 1846 | Ga0373955_0014606 | |||
| 1847 | Ga0373955_0030142 | |||
| 1848 | Ga0373955_0032617 | |||
| 1849 | Ga0373955_0033759 | |||
| 1850 | Ga0373955_0061553 | |||
| 1851 | Ga0373942_0001525 | |||
| 1852 | Ga0373961_0004337 | |||
| 1853 | Ga0373962_0000626 | |||
| 1854 | Ga0373962_0001080 | |||
| 1855 | Ga0373924_0013109 | |||
| 1856 | Ga0373931_0003262 | |||
| 1857 | Ga0373935_0006235 | |||
| 1858 | Ga0373935_0033493 | |||
| 1859 | Ga0373935_0043310 | |||
| 1860 | Ga0373927_0007217 | |||
| 1861 | Ga0373927_0065136 | |||
| 1862 | Ga0373933_0000760 | |||
| 1863 | Ga0373933_0008678 | |||
| 1864 | Ga0373933_0010157 | |||
| 1865 | Ga0373933_0029338 | |||
| 1866 | Ga0373933_0072700 | |||
| 1867 | Ga0373947_0000460 | |||
| 1868 | Ga0373947_0047710 | |||
| 1869 | Ga0373947_0060790 | |||
| 1870 | Ga0373937_0000406 | |||
| 1871 | Ga0373937_0005868 | |||
| 1872 | Ga0373937_0012674 | |||
| 1873 | Ga0373937_0032936 | |||
| 1874 | Ga0373937_0078124 | |||
| 1875 | Ga0373937_0081566 | |||
| 1876 | Ga0373937_0103835 | |||
| 1877 | Ga0373937_0179047 | |||
| 1878 | Ga0373937_0199713 | |||
| 1879 | Ga0372808_003886 | |||
| 1880 | Ga0373925_0000004 | |||
| 1881 | Ga0373925_0001409 | |||
| 1882 | Ga0373925_0002467 | |||
| 1883 | Ga0373925_0019281 | |||
| 1884 | Ga0373925_0037647 | |||
| 1885 | Ga0395900_0106821 | |||
| 1886 | Ga0395898_0001504 | |||
| 1887 | Ga0395898_0146426 | |||
| 1888 | Ga0436364_0139618 | |||
| 1889 | Ga0436364_0159890 | |||
| 1890 | Ga0436364_0186251 | |||
| 1891 | Ga0436364_0345410 | |||
| 1892 | Ga0436364_0451820 | |||
| 1893 | Ga0436364_0664281 | |||
| 1894 | Ga0436364_0676343 | |||
| 1895 | Ga0436364_1274919 | |||
| 1896 | Ga0395901_0008894 | |||
| 1897 | Ga0395901_0133392 | |||
| 1898 | Ga0436365_0370589 | |||
| 1899 | Ga0436365_0557948 | |||
| 1900 | Ga0436365_0639646 | |||
| 1901 | Ga0436360_0030969 | |||
| 1902 | Ga0436360_0154330 | |||
| 1903 | Ga0436361_0276991 | |||
| 1904 | Ga0451807_1684515 | |||
| 1905 | Ga0450896_003549 | |||
| 1906 | Ga0450896_003658 | |||
| 1907 | Ga0450908_011786 | |||
| 1908 | Ga0439435_0001331 | |||
| 1909 | Ga0439464_0001418 | |||
| 1910 | Ga0450918_004683 | |||
| 1911 | Ga0450918_008445 | |||
| 1912 | Ga0451577_0020955 | |||
| 1913 | Ga0466969_0005774 | |||
| 1914 | Ga0466966_0048210 | |||
| 1915 | Ga0466966_0083597 | |||
| 1916 | Ga0466961_0005895 | |||
| 1917 | Ga0466963_0042053 | |||
| 1918 | Ga0466963_0090470 | |||
| 1919 | Ga0453684_0000001 | |||
| 1920 | Ga0453684_0004863 | |||
| 1921 | Ga0466970_0002420 | |||
| 1922 | Ga0466957_0029740 | |||
| 1923 | Ga0466957_0095548 | |||
| 1924 | Ga0466959_0163469 | |||
| 1925 | Ga0451576_0004103 | |||
| 1926 | Ga0451576_0029138 | |||
| 1927 | Ga0451576_0145019 | |||
| 1928 | Ga0466958_0023207 | |||
| 1929 | Ga0466967_0042086 | |||
| 1930 | Ga0466967_0065790 | |||
| 1931 | Ga0466967_0066811 | |||
| 1932 | Ga0495592_0018531 | |||
| 1933 | Ga0495592_0039445 | |||
| 1934 | Ga0495592_0062315 | |||
| 1935 | Ga0495592_0184008 | |||
| 1936 | Ga0495603_0013850 | |||
| 1937 | Ga0495603_0071715 | |||
| 1938 | Ga0495629_0002850 | |||
| 1939 | Ga0495629_0007579 | |||
| 1940 | Ga0495629_0048146 | |||
| 1941 | Ga0495629_0135605 | |||
| 1942 | Ga0495638_0009937 | |||
| 1943 | Ga0495641_0007256 | |||
| 1944 | Ga0495641_0010925 | |||
| 1945 | Ga0495651_0000437 | |||
| 1946 | Ga0495651_0001176 | |||
| 1947 | Ga0495651_0003070 | |||
| 1948 | Ga0495651_0005058 | |||
| 1949 | Ga0495651_0007845 | |||
| 1950 | Ga0495651_0014743 | |||
| 1951 | Ga0495651_0030177 | |||
| 1952 | Ga0495651_0032330 | |||
| 1953 | Ga0495651_0033556 | |||
| 1954 | Ga0495651_0068699 | |||
| 1955 | Ga0495651_0081442 | |||
| 1956 | Ga0495651_0110506 | |||
| 1957 | Ga0495653_0000407 | |||
| 1958 | Ga0495653_0002317 | |||
| 1959 | Ga0495653_0009600 | |||
| 1960 | Ga0495653_0013273 | |||
| 1961 | Ga0495653_0053880 | |||
| 1962 | Ga0495653_0077684 | |||
| 1963 | Ga0495580_0006861 | |||
| 1964 | Ga0495580_0023623 | |||
| 1965 | Ga0495580_0023806 | |||
| 1966 | Ga0495580_0061933 | |||
| 1967 | Ga0495582_0006991 | |||
| 1968 | Ga0495582_0009072 | |||
| 1969 | Ga0495639_0002073 | |||
| 1970 | Ga0495639_0031725 | |||
| 1971 | Ga0495639_0053488 | |||
| 1972 | Ga0495662_0004407 | |||
| 1973 | Ga0495662_0013626 | |||
| 1974 | Ga0495662_0015117 | |||
| 1975 | Ga0495664_0000070 | |||
| 1976 | Ga0495664_0010231 | |||
| 1977 | Ga0495664_0011516 | |||
| 1978 | Ga0495664_0013847 | |||
| 1979 | Ga0495664_0020660 | |||
| 1980 | Ga0495664_0138832 | |||
| 1981 | Ga0495594_0003845 | |||
| 1982 | Ga0495608_0004948 | |||
| 1983 | Ga0495608_0035306 | |||
| 1984 | Ga0495608_0038284 | |||
| 1985 | Ga0495608_0039932 | |||
| 1986 | Ga0495618_0008733 | |||
| 1987 | Ga0495618_0040054 | |||
| 1988 | Ga0495618_0051326 | |||
| 1989 | Ga0495618_0064583 | |||
| 1990 | Ga0495628_0016933 | |||
| 1991 | Ga0495628_0037299 | |||
| 1992 | Ga0495628_0104663 | |||
| 1993 | Ga0495630_0006775 | |||
| 1994 | Ga0495630_0032489 | |||
| 1995 | Ga0495630_0058423 | |||
| 1996 | Ga0495630_0072868 | |||
| 1997 | Ga0495643_0002153 | |||
| 1998 | Ga0495666_0004590 | |||
| 1999 | Ga0495666_0037298 | |||
| 2000 | Ga0495652_0001203 | |||
| 2001 | Ga0495652_0001429 | |||
| 2002 | Ga0495652_0012348 | |||
| 2003 | Ga0495652_0014814 | |||
| 2004 | Ga0495652_0050574 | |||
| 2005 | Ga0495652_0071635 | |||
| 2006 | Ga0495652_0109352 | |||
| 2007 | Ga0495652_0118948 | |||
| 2008 | Ga0495665_0003759 | |||
| 2009 | Ga0495665_0007128 | |||
| 2010 | Ga0495665_0015168 | |||
| 2011 | Ga0495665_0064285 | |||
| 2012 | Ga0495640_0009337 | |||
| 2013 | Ga0495640_0015950 | |||
| 2014 | Ga0495640_0135910 | |||
| 2015 | Ga0495586_0003806 | |||
| 2016 | Ga0495586_0007625 | |||
| 2017 | Ga0495587_0002491 | |||
| 2018 | Ga0495587_0004386 | |||
| 2019 | Ga0495587_0005606 | |||
| 2020 | Ga0495587_0014118 | |||
| 2021 | Ga0495587_0018231 | |||
| 2022 | Ga0495645_0010250 | |||
| 2023 | Ga0495645_0015740 | |||
| 2024 | Ga0495645_0038194 | |||
| 2025 | Ga0495645_0079590 | |||
| 2026 | Ga0495645_0079730 | |||
| 2027 | Ga0495667_0001491 | |||
| 2028 | Ga0495667_0005979 | |||
| 2029 | Ga0495667_0009858 | |||
| 2030 | Ga0495667_0011460 | |||
| 2031 | Ga0495667_0011838 | |||
| 2032 | Ga0495667_0038291 | |||
| 2033 | Ga0495667_0049933 | |||
| 2034 | Ga0495667_0121292 | |||
| 2035 | Ga0495667_0155536 | |||
| 2036 | Ga0495634_0006657 | |||
| 2037 | Ga0495634_0009471 | |||
| 2038 | Ga0495634_0031928 | |||
| 2039 | Ga0495634_0040416 | |||
| 2040 | Ga0495634_0127395 | |||
| 2041 | Ga0495634_0162098 | |||
| 2042 | Ga0495635_0000481 | |||
| 2043 | Ga0495635_0002646 | |||
| 2044 | Ga0495635_0030773 | |||
| 2045 | Ga0495635_0056436 | |||
| 2046 | Ga0495635_0067683 | |||
| 2047 | Ga0495659_0062484 | |||
| 2048 | Ga0495657_0000870 | |||
| 2049 | Ga0495657_0004127 | |||
| 2050 | Ga0495657_0010117 | |||
| 2051 | Ga0495657_0022123 | |||
| 2052 | Ga0495657_0087581 | |||
| 2053 | Ga0495657_0114943 | |||
| 2054 | Ga0495599_0007250 | |||
| 2055 | Ga0495599_0013754 | |||
| 2056 | Ga0495599_0026362 | |||
| 2057 | Ga0495599_0052522 | |||
| 2058 | Ga0495599_0107518 | |||
| 2059 | Ga0495623_0032170 | |||
| 2060 | Ga0495623_0037736 | |||
| 2061 | Ga0495623_0052019 | |||
| 2062 | Ga0495623_0065874 | |||
| 2063 | Ga0495623_0081623 | |||
| 2064 | Ga0495623_0096821 | |||
| 2065 | Ga0495646_0008505 | |||
| 2066 | Ga0495647_0032845 | |||
| 2067 | Ga0495658_0002586 | |||
| 2068 | Ga0495658_0021126 | |||
| 2069 | Ga0495658_0046587 | |||
| 2070 | Ga0495613_0002935 | |||
| 2071 | Ga0495613_0042287 | |||
| 2072 | Ga0495613_0178205 | |||
| 2073 | Ga0495624_0000293 | |||
| 2074 | Ga0495624_0006924 | |||
| 2075 | Ga0495624_0011892 | |||
| 2076 | Ga0495600_0000600 | |||
| 2077 | Ga0495600_0012730 | |||
| 2078 | Ga0495600_0033853 | |||
| 2079 | Ga0495600_0068217 | |||
| 2080 | Ga0495600_0070101 | |||
| 2081 | Ga0495600_0082008 | |||
| 2082 | Ga0495581_0014125 | |||
| 2083 | Ga0495604_0003381 | |||
| 2084 | Ga0495604_0006541 | |||
| 2085 | Ga0495604_0015284 | |||
| 2086 | Ga0495604_0039903 | |||
| 2087 | Ga0495604_0080649 | |||
| 2088 | Ga0495604_0111216 | |||
| 2089 | Ga0495674_0000077 | |||
| 2090 | Ga0495674_0000901 | |||
| 2091 | Ga0495674_0007780 | |||
| 2092 | Ga0495674_0030820 | |||
| 2093 | Ga0495674_0035531 | |||
| 2094 | Ga0495674_0052846 | |||
| 2095 | Ga0495674_0065766 | |||
| 2096 | Ga0495674_0131774 | |||
| 2097 | Ga0495674_0273540 | |||
| 2098 | Ga0495672_0007107 | |||
| 2099 | Ga0495676_0004113 | |||
| 2100 | Ga0495676_0013863 | |||
| 2101 | Ga0495676_0056744 | |||
| 2102 | Ga0495680_0001678 | |||
| 2103 | Ga0495680_0001803 | |||
| 2104 | Ga0495680_0003169 | |||
| 2105 | Ga0495680_0008073 | |||
| 2106 | Ga0495680_0012601 | |||
| 2107 | Ga0495680_0014478 | |||
| 2108 | Ga0495680_0023912 | |||
| 2109 | Ga0495680_0053834 | |||
| 2110 | Ga0495675_0009946 | |||
| 2111 | Ga0495675_0047864 | |||
| 2112 | Ga0495684_0001680 | |||
| 2113 | Ga0495684_0012081 | |||
| 2114 | Ga0495684_0027276 | |||
| 2115 | Ga0495684_0035736 | |||
| 2116 | Ga0495684_0042936 | |||
| 2117 | Ga0495684_0084185 | |||
| 2118 | Ga0495684_0090109 | |||
| 2119 | Ga0495602_0011381 | |||
| 2120 | Ga0495602_0037498 | |||
| 2121 | Ga0495602_0047374 | |||
| 2122 | Ga0495602_0086400 | |||
| 2123 | Ga0495602_0112823 | |||
| 2124 | Ga0495614_0017083 | |||
| 2125 | Ga0495614_0022071 | |||
| 2126 | Ga0496100_0023016 | |||
| 2127 | Ga0496100_0044842 | |||
| 2128 | Ga0496100_0077236 | |||
| 2129 | Ga0496100_0176057 | |||
| 2130 | Ga0496101_0036098 | |||
| 2131 | Ga0496101_0040618 | |||
| 2132 | Ga0496101_0107030 | |||
| 2133 | Ga0496102_0062625 | |||
| 2134 | Ga0496102_0075959 | |||
| 2135 | Ga0496102_0102624 | |||
| 2136 | Ga0496102_0203960 | |||
| 2137 | Ga0496103_0015893 | |||
| 2138 | Ga0496103_0017090 | |||
| 2139 | Ga0496104_0001708 | |||
| 2140 | Ga0496104_0016517 | |||
| 2141 | Ga0496104_0017912 | |||
| 2142 | Ga0496104_0034539 | |||
| 2143 | Ga0496104_0045391 | |||
| 2144 | Ga0496104_0078058 | |||
| 2145 | Ga0496104_0129341 | |||
| 2146 | Ga0496104_0165323 | |||
| 2147 | Ga0496104_0175815 | |||
| 2148 | Ga0496105_0000625 | |||
| 2149 | Ga0496105_0000887 | |||
| 2150 | Ga0496105_0029467 | |||
| 2151 | Ga0496105_0037873 | |||
| 2152 | Ga0496105_0052327 | |||
| 2153 | Ga0496105_0253858 | |||
| 2154 | Ga0496106_0012256 | |||
| 2155 | Ga0496107_0019023 | |||
| 2156 | Ga0496107_0035839 | |||
| 2157 | Ga0496107_0232111 | |||
| 2158 | Ga0496108_0042706 | |||
| 2159 | Ga0496108_0087987 | |||
| 2160 | Ga0496108_0102292 | |||
| 2161 | Ga0496108_0105859 | |||
| 2162 | Ga0496108_0135224 | |||
| 2163 | Ga0496109_0001425 | |||
| 2164 | Ga0496109_0005983 | |||
| 2165 | Ga0496109_0020322 | |||
| 2166 | Ga0496109_0020526 | |||
| 2167 | Ga0496109_0029342 | |||
| 2168 | Ga0496109_0039820 | |||
| 2169 | Ga0496109_0069813 | |||
| 2170 | Ga0496109_0081258 | |||
| 2171 | Ga0496109_0151526 | |||
| 2172 | Ga0496109_0235224 | |||
| 2173 | Ga0496110_0005415 | |||
| 2174 | Ga0496110_0006954 | |||
| 2175 | Ga0496110_0019391 | |||
| 2176 | Ga0496110_0028459 | |||
| 2177 | Ga0496110_0036800 | |||
| 2178 | Ga0496110_0057099 | |||
| 2179 | Ga0496110_0112267 | |||
| 2180 | Ga0496110_0219280 | |||
| 2181 | Ga0496110_0222628 | |||
| 2182 | Ga0496110_0311703 | |||
| 2183 | Ga0496111_0006167 | |||
| 2184 | Ga0496111_0008568 | |||
| 2185 | Ga0496111_0009075 | |||
| 2186 | Ga0496111_0012389 | |||
| 2187 | Ga0496111_0016514 | |||
| 2188 | Ga0496111_0125802 | |||
| 2189 | Ga0496111_0135228 | |||
| 2190 | Ga0496112_0000654 | |||
| 2191 | Ga0496112_0002559 | |||
| 2192 | Ga0496112_0014517 | |||
| 2193 | Ga0496112_0020544 | |||
| 2194 | Ga0496112_0180383 | |||
| 2195 | Ga0496112_0239148 | |||
| 2196 | Ga0496112_0288560 | |||
| 2197 | Ga0496113_0008932 | |||
| 2198 | Ga0496113_0134744 | |||
| 2199 | Ga0496114_0004635 | |||
| 2200 | Ga0496114_0005458 | |||
| 2201 | Ga0496114_0010895 | |||
| 2202 | Ga0496114_0023442 | |||
| 2203 | Ga0496114_0045384 | |||
| 2204 | Ga0496114_0046621 | |||
| 2205 | Ga0496114_0070585 | |||
| 2206 | Ga0496114_0107297 | |||
| 2207 | Ga0496114_0152765 | |||
| 2208 | Ga0496114_0173904 | |||
| 2209 | Ga0496114_0235530 | |||
| 2210 | Ga0496114_0324048 | |||
| 2211 | Ga0496115_0001765 | |||
| 2212 | Ga0496115_0001917 | |||
| 2213 | Ga0496115_0002525 | |||
| 2214 | Ga0496115_0011376 | |||
| 2215 | Ga0496115_0049719 | |||
| 2216 | Ga0496115_0192278 | |||
| 2217 | Ga0496121_0105771 | |||
| 2218 | Ga0496124_0065485 | |||
| 2219 | Ga0496126_0000006 | |||
| 2220 | Ga0501291_001996 | |||
| 2221 | Ga0501034_0003291 | |||
| 2222 | Ga0501036_0005010 | |||
| 2223 | Ga0501036_0056559 | |||
| 2224 | Ga0501037_0024927 | |||
| 2225 | Ga0501038_0001599 | |||
| 2226 | Ga0501039_0063559 | |||
| 2227 | Ga0501039_0098416 | |||
| 2228 | Ga0501039_0139976 | |||
| 2229 | Ga0501041_0021851 | |||
| 2230 | Ga0501042_0011725 | |||
| 2231 | Ga0501042_0021843 | |||
| 2232 | Ga0501042_0173170 | |||
| 2233 | Ga0501043_0006372 | |||
| 2234 | Ga0501047_0005090 | |||
| 2235 | Ga0501048_0018829 | |||
| 2236 | Ga0501070_0000314 | |||
| 2237 | Ga0501071_0126062 | |||
| 2238 | Ga0501072_0066142 | |||
| 2239 | Ga0501073_0073531 | |||
| 2240 | Ga0501074_0002246 | |||
| 2241 | Ga0501074_0021828 | |||
| 2242 | Ga0501075_0029669 | |||
| 2243 | Ga0501075_0033968 | |||
| 2244 | Ga0501076_0014490 | |||
| 2245 | Ga0501076_0021386 | |||
| 2246 | Ga0501076_0068563 | |||
| 2247 | Ga0501076_0217288 | |||
| 2248 | Ga0501081_0083960 | |||
| 2249 | Ga0501044_0137006 | |||
| 2250 | Ga0501045_0010998 | |||
| 2251 | nmdc:mga03683_2035_c1 | |||
| 2252 | nmdc:mga00v17_26612_c1 | |||
| 2253 | nmdc:mga00v17_30340_c1 | |||
| 2254 | nmdc:mga00v17_49490_c1 | |||
| 2255 | nmdc:mga0yw44_9232_c1 | |||
| 2256 | nmdc:mga0k408_12317_c1 | |||
| 2257 | nmdc:mga06z11_17220_c1 | |||
| 2258 | nmdc:mga06z11_82205_c1 | |||
| 2259 | nmdc:mga04h51_32797_c1 | |||
| 2260 | nmdc:mga07m45_26584_c1 | |||
| 2261 | nmdc:mga07m45_37579_c1 | |||
| 2262 | nmdc:mga07m45_9881_c1 | |||
| 2263 | nmdc:mga05p37_117793_c1 | |||
| 2264 | nmdc:mga05p37_11943_c1 | |||
| 2265 | nmdc:mga05p37_16331_c1 | |||
| 2266 | nmdc:mga05p37_1840_c1 | |||
| 2267 | nmdc:mga05p37_196089_c1 | |||
| 2268 | nmdc:mga05p37_4567_c1 | |||
| 2269 | nmdc:mga05p37_56374_c1 | |||
| 2270 | nmdc:mga05p37_83890_c1 | |||
| 2271 | nmdc:mga09592_17930_c1 | |||
| 2272 | nmdc:mga09592_83422_c1 | |||
| 2273 | nmdc:mga0qj67_24732_c1 | |||
| 2274 | nmdc:mga0qj67_32716_c1 | |||
| 2275 | nmdc:mga0qj67_4023_c1 | |||
| 2276 | nmdc:mga06r32_106426_c1 | |||
| 2277 | nmdc:mga06r32_183620_c1 | |||
| 2278 | nmdc:mga06r32_34653_c1 | |||
| 2279 | nmdc:mga06r32_6030_c1 | |||
| 2280 | nmdc:mga06r32_8420_c1 | |||
| 2281 | nmdc:mga08y16_15584_c1 | |||
| 2282 | nmdc:mga08y16_21084_c1 | |||
| 2283 | nmdc:mga08y16_5415_c1 | |||
| 2284 | nmdc:mga08y16_5687_c1 | |||
| 2285 | nmdc:mga08y16_62648_c1 | |||
| 2286 | nmdc:mga08y16_81888_c1 | |||
| 2287 | nmdc:mga08y16_85518_c1 | |||
| 2288 | nmdc:mga08y16_90531_c1 | |||
| 2289 | nmdc:mga08y16_9_c1 | |||
| 2290 | nmdc:mga0n895_19119_c1 | |||
| 2291 | nmdc:mga0n895_3820_c1 | |||
| 2292 | nmdc:mga0n895_45936_c1 | |||
| 2293 | nmdc:mga0rr50_100550_c1 | |||
| 2294 | nmdc:mga0rr50_289831_c1 | |||
| 2295 | nmdc:mga0rr50_78383_c1 | |||
| 2296 | nmdc:mga0rr50_9061_c1 | |||
| 2297 | nmdc:mga08x19_7857_c1 | |||
| 2298 | nmdc:mga0a205_192610_c1 | |||
| 2299 | nmdc:mga0a205_2892_c2 | |||
| 2300 | nmdc:mga0a205_51890_c1 | |||
| 2301 | Ga0495601_0014020 | |||
| 2302 | Ga0495601_0020222 | |||
| 2303 | Ga0495601_0025242 | |||
| 2304 | Ga0495612_0001488 | |||
| 2305 | Ga0495612_0011812 | |||
| 2306 | Ga0495612_0038746 | |||
| 2307 | Ga0500635_0008858 | |||
| 2308 | Ga0495595_0001958 | |||
| 2309 | Ga0495595_0010954 | |||
| 2310 | Ga0495595_0011505 | |||
| 2311 | Ga0495619_0004191 | |||
| 2312 | Ga0495619_0008447 | |||
| 2313 | Ga0495619_0011816 | |||
| 2314 | Ga0495619_0031770 | |||
| 2315 | Ga0495619_0046942 | |||
| 2316 | Ga0495619_0091317 | |||
| 2317 | Ga0495619_0130575 | |||
| 2318 | Ga0500646_0000226 | |||
| 2319 | Ga0500566_0000309 | |||
| 2320 | Ga0500592_005590 | |||
| 2321 | Ga0500593_000445 | |||
| 2322 | Ga0500564_032533 | |||
| 2323 | Ga0500577_0033069 | |||
| 2324 | Ga0500588_0010585 | |||
| 2325 | Ga0500603_002800 | |||
| 2326 | Ga0500616_0000083 | |||
| 2327 | Ga0501084_0054670 | |||
| 2328 | Ga0530510_0009419 | |||
| 2329 | Ga0530510_0031818 | |||
| 2330 | 2508674807 | |||
| 2331 | 2676488350 | |||
| 2332 | 2791910294 | |||
| 2333 | 2795787262 | |||
| 2334 | 2837269927 | |||
| 2335 | 2887479765 | |||
| 2336 | 2895434757 | |||
| 2337 | 8002778267 | |||
| 2338 | 8055067781 | |||
| 2339 | 8055179032 | |||
| 2340 | 8057571791 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kam-assembly2.cif.gz_B | x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m | 0.9647 | 12 | 435 |
| 4kam-assembly2.cif.gz_A | x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m | 0.9646 | 12 | 435 |
| 4kam-assembly3.cif.gz_C | x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m | 0.9613 | 12 | 435 |
| 8sf5-assembly1.cif.gz_B-2 | promiscuous amino acid gamma synthase from caldicellulosiruptor hydrothermalis in open conformation | 0.9611 | 12 | 432 |
| 4kam-assembly3.cif.gz_D | x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m | 0.9599 | 12 | 430 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kamA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.979 | 74 | 298 | 3.40.640.10 |
| 4kamA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9705 | 74 | 298 | 3.40.640.10 |
| 4kamB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.961 | 300 | 435 | 3.90.1150.10 |
| 1ukjB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9575 | 299 | 431 | 3.90.1150.10 |
| 1pffB01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9555 | 75 | 296 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T0V080-F1-model_v4 | O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) | 0.9877 | 89 | 310 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-A0A7S2W7Z0-F1-model_v4 | Cystathionine gamma-lyase | 0.9849 | 145 | 231 |
GO:0005737
GO:0016846 GO:0019346 GO:0030170 |
| AF-X8FDD2-F1-model_v4 | deleted | 0.9839 | 152 | 347 |
|
| AF-A0A3E2EGZ1-F1-model_v4 | deleted | 0.9838 | 76 | 413 |
|
| AF-A0A1F4F6V6-F1-model_v4 | O-acetylhomoserine aminocarboxypropyltransferase | 0.9838 | 140 | 435 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |