F491062
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1165 | 445 | 1145 | 391 |
Family's Representative Sequence
| Representative Sequence | 3300005456|Ga0070678_100000982|Ga0070678_10000098216 |
| Length | 427 |
| Sequence | MEFAMDRGRRPGPAPAVYDAEIRRSFVQSHKPLVNAPPAAAARPAVRALVASQIREVANAAMDDPNVLAFWFGEPDEVTPAFIRDEAAAALARGETFYTHNFGIPELREAIAAYVSHWHRPTAVTSIAATASGMSALMLAVQSLVAPGDRVVVVTPLWPNLVEIPKILSGDVAIVPLAFGTRGWTLDVDRLLAALTPRTRVLMLNSPNNPTGWTISRAAQVAILAHCRRHGIWIVADDVYERLYYEGDAACAPSFLAIAHPDERVVSTNSFSKSWCMTGWRLGWIVAPPALMPDLGKLIEYNTSCSPVFVQRAGVAAITQGEPAVGRTRSRFRAARDYLVDALAALPGIEIAPPPGAMYAFFRVDGLTDSLGFCKDLVRDAGLGLAPGSAFGPEGEGFVRWCFASDLGRLQDGVDRLARFLRARVPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 4 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 5 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 6 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 7 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 8 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 9 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 10 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 11 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 12 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 13 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 14 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 15 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 16 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 17 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 18 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 19 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 20 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 21 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 22 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 23 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 24 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 25 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 26 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 27 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 76 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 110 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 111 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 116 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 120 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 121 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 122 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 123 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 124 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 125 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 126 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 244 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 248 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 249 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 251 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 253 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 254 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 255 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 256 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 257 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 258 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 259 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 260 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 261 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 262 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 263 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 264 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 265 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 266 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 267 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 268 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 269 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 270 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 271 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 272 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 274 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 278 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 280 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 281 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 284 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 285 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 286 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 287 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 289 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 291 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 292 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 293 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 294 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 295 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 296 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 297 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 299 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 300 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 302 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 303 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 304 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 305 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 306 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 307 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 312 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 313 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 314 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 315 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 316 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 317 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 318 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 319 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 320 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 321 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 322 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 323 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 324 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 325 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 326 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 327 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 328 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 380 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 381 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 382 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 383 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 384 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 389 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 390 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 391 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 392 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 415 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 416 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 417 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 418 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 419 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 432 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 433 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 434 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 435 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 436 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 437 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 438 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 439 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 440 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 441 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 442 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 445 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.28 |
| Metatranscriptomes | 0 |
| Isolates | 1.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.75 |
| Nodule | 0 |
| Rhizoplane | 2.75 |
| Rhizosphere | 88.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000023 | 3300002737 | Bacteria | 236658 |
| 2 | JGI25152J39213_1002683 | 3300002773 | Bacteria | 6540 |
| 3 | JGI25151J46595_10043938 | 3300003187 | Bacteria | 1593 |
| 4 | JGI25165J46597_1000030 | 3300003214 | Bacteria | 305254 |
| 5 | JGI25153J46596_10001361 | 3300003215 | Bacteria | 14627 |
| 6 | JGI25153J46596_10004264 | 3300003215 | Bacteria | 7739 |
| 7 | rootH1_10013105 | 3300003316 | Bacteria | 1840 |
| 8 | Ga0055538_1000017 | 3300003751 | Bacteria | 305254 |
| 9 | Ga0055539_1000022 | 3300003752 | Bacteria | 305254 |
| 10 | Ga0055533_1000030 | 3300003756 | Bacteria | 305254 |
| 11 | Ga0055525_1000034 | 3300003759 | Bacteria | 305254 |
| 12 | Ga0055530_10011040 | 3300003791 | Bacteria | 3277 |
| 13 | Ga0055541_1000015 | 3300003841 | Bacteria | 305254 |
| 14 | Ga0065165_1004235 | 3300005262 | Bacteria | 9109 |
| 15 | Ga0065715_10026169 | 3300005293 | Bacteria | 2494 |
| 16 | Ga0070658_10028554 | 3300005327 | Bacteria | 4480 |
| 17 | Ga0070658_10056454 | 3300005327 | Bacteria | 3191 |
| 18 | Ga0070658_10083502 | 3300005327 | Bacteria | 2626 |
| 19 | Ga0070676_10002958 | 3300005328 | Bacteria | 8776 |
| 20 | Ga0070676_10003985 | 3300005328 | Bacteria | 7748 |
| 21 | Ga0070676_10004320 | 3300005328 | Bacteria | 7466 |
| 22 | Ga0070676_10018292 | 3300005328 | Bacteria | 3881 |
| 23 | Ga0070676_10058707 | 3300005328 | Bacteria | 2281 |
| 24 | Ga0070676_10071763 | 3300005328 | Bacteria | 2081 |
| 25 | Ga0070683_100007089 | 3300005329 | Bacteria | 9442 |
| 26 | Ga0070683_100087297 | 3300005329 | Bacteria | 2925 |
| 27 | Ga0070690_100000408 | 3300005330 | Bacteria | 21778 |
| 28 | Ga0070690_100043276 | 3300005330 | Bacteria | 2855 |
| 29 | Ga0070670_100001125 | 3300005331 | Bacteria | 21269 |
| 30 | Ga0070670_100006584 | 3300005331 | Bacteria | 9845 |
| 31 | Ga0070670_100046145 | 3300005331 | Bacteria | 3746 |
| 32 | Ga0070670_100078249 | 3300005331 | Bacteria | 2841 |
| 33 | Ga0070670_100143993 | 3300005331 | Bacteria | 2061 |
| 34 | Ga0070670_100249694 | 3300005331 | Bacteria | 1545 |
| 35 | Ga0070670_100280279 | 3300005331 | Bacteria | 1455 |
| 36 | Ga0070677_10000132 | 3300005333 | Bacteria | 24789 |
| 37 | Ga0070677_10024764 | 3300005333 | Bacteria | 2235 |
| 38 | Ga0068869_100000478 | 3300005334 | Bacteria | 22165 |
| 39 | Ga0068869_100028754 | 3300005334 | Bacteria | 3888 |
| 40 | Ga0068869_100113146 | 3300005334 | Bacteria | 2067 |
| 41 | Ga0070666_10000956 | 3300005335 | Bacteria | 17615 |
| 42 | Ga0070666_10002288 | 3300005335 | Bacteria | 11581 |
| 43 | Ga0070666_10007688 | 3300005335 | Bacteria | 6654 |
| 44 | Ga0070666_10030816 | 3300005335 | Bacteria | 3536 |
| 45 | Ga0070666_10061620 | 3300005335 | Bacteria | 2540 |
| 46 | Ga0070666_10181371 | 3300005335 | Bacteria | 1477 |
| 47 | Ga0070680_100000654 | 3300005336 | Bacteria | 24040 |
| 48 | Ga0070680_100006576 | 3300005336 | Bacteria | 8838 |
| 49 | Ga0070680_100023434 | 3300005336 | Bacteria | 4923 |
| 50 | Ga0070680_100056068 | 3300005336 | Bacteria | 3221 |
| 51 | Ga0070680_100077300 | 3300005336 | Bacteria | 2742 |
| 52 | Ga0070682_100093297 | 3300005337 | Bacteria | 1973 |
| 53 | Ga0070682_100137549 | 3300005337 | Bacteria | 1661 |
| 54 | Ga0068868_100000056 | 3300005338 | Bacteria | 63982 |
| 55 | Ga0068868_100005576 | 3300005338 | Bacteria | 8850 |
| 56 | Ga0068868_100025309 | 3300005338 | Bacteria | 4513 |
| 57 | Ga0068868_100033283 | 3300005338 | Bacteria | 3972 |
| 58 | Ga0068868_100033556 | 3300005338 | Bacteria | 3956 |
| 59 | Ga0068868_100043949 | 3300005338 | Bacteria | 3491 |
| 60 | Ga0068868_100091318 | 3300005338 | Bacteria | 2454 |
| 61 | Ga0068868_100195958 | 3300005338 | Bacteria | 1682 |
| 62 | Ga0070660_100004428 | 3300005339 | Bacteria | 9700 |
| 63 | Ga0070660_100042189 | 3300005339 | Bacteria | 3481 |
| 64 | Ga0070660_100106492 | 3300005339 | Bacteria | 2227 |
| 65 | Ga0070689_100000429 | 3300005340 | Bacteria | 24771 |
| 66 | Ga0070689_100001046 | 3300005340 | Bacteria | 17396 |
| 67 | Ga0070691_10000463 | 3300005341 | Bacteria | 15095 |
| 68 | Ga0070687_100000418 | 3300005343 | Bacteria | 14386 |
| 69 | Ga0070687_100042308 | 3300005343 | Bacteria | 2308 |
| 70 | Ga0070661_100004644 | 3300005344 | Bacteria | 9458 |
| 71 | Ga0070661_100013155 | 3300005344 | Bacteria | 5808 |
| 72 | Ga0070661_100075262 | 3300005344 | Bacteria | 2487 |
| 73 | Ga0070661_100184145 | 3300005344 | Bacteria | 1590 |
| 74 | Ga0070692_10001960 | 3300005345 | Bacteria | 7797 |
| 75 | Ga0070692_10009740 | 3300005345 | Bacteria | 4347 |
| 76 | Ga0070692_10020544 | 3300005345 | Bacteria | 3203 |
| 77 | Ga0070668_100000394 | 3300005347 | Bacteria | 29015 |
| 78 | Ga0070668_100042341 | 3300005347 | Bacteria | 3490 |
| 79 | Ga0070668_100042616 | 3300005347 | Bacteria | 3479 |
| 80 | Ga0070669_100008643 | 3300005353 | Bacteria | 7265 |
| 81 | Ga0070669_100085811 | 3300005353 | Bacteria | 2351 |
| 82 | Ga0070675_100000331 | 3300005354 | Bacteria | 32025 |
| 83 | Ga0070675_100004598 | 3300005354 | Bacteria | 10540 |
| 84 | Ga0070675_100012058 | 3300005354 | Bacteria | 6774 |
| 85 | Ga0070675_100046964 | 3300005354 | Bacteria | 3537 |
| 86 | Ga0070675_100060146 | 3300005354 | Bacteria | 3136 |
| 87 | Ga0070675_100071748 | 3300005354 | Bacteria | 2874 |
| 88 | Ga0070675_100258834 | 3300005354 | Bacteria | 1524 |
| 89 | Ga0070671_100005456 | 3300005355 | Bacteria | 10154 |
| 90 | Ga0070671_100008289 | 3300005355 | Bacteria | 8315 |
| 91 | Ga0070671_100019005 | 3300005355 | Bacteria | 5589 |
| 92 | Ga0070671_100046866 | 3300005355 | Bacteria | 3595 |
| 93 | Ga0070671_100085945 | 3300005355 | Bacteria | 2631 |
| 94 | Ga0070671_100119784 | 3300005355 | Bacteria | 2214 |
| 95 | Ga0070671_100202976 | 3300005355 | Bacteria | 1681 |
| 96 | Ga0070671_100232088 | 3300005355 | Bacteria | 1566 |
| 97 | Ga0070674_100022136 | 3300005356 | Bacteria | 4095 |
| 98 | Ga0070674_100059240 | 3300005356 | Bacteria | 2665 |
| 99 | Ga0070674_100102619 | 3300005356 | Bacteria | 2086 |
| 100 | Ga0070674_100112724 | 3300005356 | Bacteria | 2000 |
| 101 | Ga0070673_100000604 | 3300005364 | Bacteria | 19614 |
| 102 | Ga0070673_100000864 | 3300005364 | Bacteria | 17027 |
| 103 | Ga0070673_100012409 | 3300005364 | Bacteria | 5848 |
| 104 | Ga0070673_100020860 | 3300005364 | Bacteria | 4735 |
| 105 | Ga0070673_100056935 | 3300005364 | Bacteria | 3087 |
| 106 | Ga0070673_100060353 | 3300005364 | Bacteria | 3005 |
| 107 | Ga0070673_100135633 | 3300005364 | Bacteria | 2071 |
| 108 | Ga0070688_100000230 | 3300005365 | Bacteria | 29284 |
| 109 | Ga0070688_100084572 | 3300005365 | Bacteria | 2061 |
| 110 | Ga0070659_100003790 | 3300005366 | Bacteria | 10789 |
| 111 | Ga0070659_100008273 | 3300005366 | Bacteria | 7595 |
| 112 | Ga0070659_100023109 | 3300005366 | Bacteria | 4753 |
| 113 | Ga0070659_100084594 | 3300005366 | Bacteria | 2536 |
| 114 | Ga0070659_100095385 | 3300005366 | Bacteria | 2389 |
| 115 | Ga0070667_100010007 | 3300005367 | Bacteria | 7858 |
| 116 | Ga0070667_100010248 | 3300005367 | Bacteria | 7744 |
| 117 | Ga0070667_100035009 | 3300005367 | Bacteria | 4205 |
| 118 | Ga0070667_100091829 | 3300005367 | Bacteria | 2611 |
| 119 | Ga0070667_100116327 | 3300005367 | Bacteria | 2322 |
| 120 | Ga0070709_10197228 | 3300005434 | Bacteria | 1424 |
| 121 | Ga0070714_100054800 | 3300005435 | Bacteria | 3407 |
| 122 | Ga0070714_100120648 | 3300005435 | Bacteria | 2332 |
| 123 | Ga0070713_100000026 | 3300005436 | Bacteria | 95308 |
| 124 | Ga0070713_100015306 | 3300005436 | Bacteria | 5726 |
| 125 | Ga0070713_100015774 | 3300005436 | Bacteria | 5661 |
| 126 | Ga0070710_10003855 | 3300005437 | Bacteria | 7096 |
| 127 | Ga0070710_10052356 | 3300005437 | Bacteria | 2295 |
| 128 | Ga0070701_10001314 | 3300005438 | Bacteria | 9150 |
| 129 | Ga0070711_100003823 | 3300005439 | Bacteria | 8844 |
| 130 | Ga0070705_100000855 | 3300005440 | Bacteria | 17121 |
| 131 | Ga0070705_100001310 | 3300005440 | Bacteria | 13336 |
| 132 | Ga0070705_100032917 | 3300005440 | Bacteria | 2885 |
| 133 | Ga0070705_100050606 | 3300005440 | Bacteria | 2417 |
| 134 | Ga0070705_100192981 | 3300005440 | Bacteria | 1390 |
| 135 | Ga0070700_100000499 | 3300005441 | Bacteria | 19616 |
| 136 | Ga0070700_100001470 | 3300005441 | Bacteria | 11726 |
| 137 | Ga0070700_100009928 | 3300005441 | Bacteria | 5237 |
| 138 | Ga0070694_100000452 | 3300005444 | Bacteria | 22463 |
| 139 | Ga0070694_100031467 | 3300005444 | Bacteria | 3479 |
| 140 | Ga0070708_100000244 | 3300005445 | Bacteria | 40474 |
| 141 | Ga0070663_100000131 | 3300005455 | Bacteria | 35664 |
| 142 | Ga0070663_100042005 | 3300005455 | Bacteria | 3211 |
| 143 | Ga0070678_100000982 | 3300005456 | Bacteria | 14738 |
| 144 | Ga0070678_100001058 | 3300005456 | Bacteria | 14357 |
| 145 | Ga0070678_100001348 | 3300005456 | Bacteria | 13061 |
| 146 | Ga0070678_100002956 | 3300005456 | Bacteria | 9418 |
| 147 | Ga0070678_100033732 | 3300005456 | Bacteria | 3557 |
| 148 | Ga0070678_100122600 | 3300005456 | Bacteria | 2052 |
| 149 | Ga0070678_100162985 | 3300005456 | Bacteria | 1808 |
| 150 | Ga0070662_100001081 | 3300005457 | Bacteria | 16613 |
| 151 | Ga0070662_100010407 | 3300005457 | Bacteria | 6101 |
| 152 | Ga0070662_100011777 | 3300005457 | Bacteria | 5777 |
| 153 | Ga0070662_100044780 | 3300005457 | Bacteria | 3171 |
| 154 | Ga0070662_100188529 | 3300005457 | Bacteria | 1629 |
| 155 | Ga0070681_10000591 | 3300005458 | Bacteria | 29907 |
| 156 | Ga0070681_10009598 | 3300005458 | Bacteria | 9515 |
| 157 | Ga0070681_10235524 | 3300005458 | Bacteria | 1745 |
| 158 | Ga0068867_100000085 | 3300005459 | Bacteria | 58473 |
| 159 | Ga0068867_100000623 | 3300005459 | Bacteria | 23419 |
| 160 | Ga0068867_100000816 | 3300005459 | Bacteria | 21045 |
| 161 | Ga0068867_100003590 | 3300005459 | Bacteria | 10912 |
| 162 | Ga0068867_100004350 | 3300005459 | Bacteria | 9972 |
| 163 | Ga0068867_100008539 | 3300005459 | Bacteria | 7229 |
| 164 | Ga0068867_100015261 | 3300005459 | Bacteria | 5445 |
| 165 | Ga0068867_100034695 | 3300005459 | Bacteria | 3658 |
| 166 | Ga0068867_100039935 | 3300005459 | Bacteria | 3422 |
| 167 | Ga0068867_100051046 | 3300005459 | Bacteria | 3050 |
| 168 | Ga0068867_100080552 | 3300005459 | Bacteria | 2452 |
| 169 | Ga0068867_100098413 | 3300005459 | Bacteria | 2230 |
| 170 | Ga0068867_100202833 | 3300005459 | Bacteria | 1588 |
| 171 | Ga0070685_10001090 | 3300005466 | Bacteria | 14533 |
| 172 | Ga0070706_100000822 | 3300005467 | Bacteria | 34270 |
| 173 | Ga0070706_100013361 | 3300005467 | Bacteria | 7588 |
| 174 | Ga0070706_100051853 | 3300005467 | Bacteria | 3787 |
| 175 | Ga0070706_100074494 | 3300005467 | Bacteria | 3142 |
| 176 | Ga0070707_100030193 | 3300005468 | Bacteria | 5158 |
| 177 | Ga0070698_100012253 | 3300005471 | Bacteria | 9084 |
| 178 | Ga0070699_100013502 | 3300005518 | Bacteria | 7034 |
| 179 | Ga0070699_100025470 | 3300005518 | Bacteria | 5099 |
| 180 | Ga0070699_100265700 | 3300005518 | Bacteria | 1535 |
| 181 | Ga0070679_100010847 | 3300005530 | Bacteria | 8658 |
| 182 | Ga0070679_100020566 | 3300005530 | Bacteria | 6437 |
| 183 | Ga0070679_100022808 | 3300005530 | Bacteria | 6122 |
| 184 | Ga0070679_100084435 | 3300005530 | Bacteria | 3163 |
| 185 | Ga0070679_100110668 | 3300005530 | Bacteria | 2733 |
| 186 | Ga0070684_100001615 | 3300005535 | Bacteria | 16295 |
| 187 | Ga0070697_100006508 | 3300005536 | Bacteria | 9042 |
| 188 | Ga0070697_100009128 | 3300005536 | Bacteria | 7746 |
| 189 | Ga0070697_100038739 | 3300005536 | Bacteria | 3852 |
| 190 | Ga0070697_100124956 | 3300005536 | Bacteria | 2155 |
| 191 | Ga0068853_100002757 | 3300005539 | Bacteria | 13266 |
| 192 | Ga0068853_100022134 | 3300005539 | Bacteria | 5305 |
| 193 | Ga0068853_100023858 | 3300005539 | Bacteria | 5126 |
| 194 | Ga0068853_100052361 | 3300005539 | Bacteria | 3517 |
| 195 | Ga0068853_100059584 | 3300005539 | Bacteria | 3298 |
| 196 | Ga0070672_100000244 | 3300005543 | Bacteria | 30475 |
| 197 | Ga0070672_100007832 | 3300005543 | Bacteria | 7289 |
| 198 | Ga0070672_100010686 | 3300005543 | Bacteria | 6377 |
| 199 | Ga0070672_100032941 | 3300005543 | Bacteria | 3918 |
| 200 | Ga0070672_100047976 | 3300005543 | Bacteria | 3316 |
| 201 | Ga0070672_100052637 | 3300005543 | Bacteria | 3179 |
| 202 | Ga0070672_100056213 | 3300005543 | Bacteria | 3085 |
| 203 | Ga0070672_100081645 | 3300005543 | Bacteria | 2592 |
| 204 | Ga0070672_100097015 | 3300005543 | Bacteria | 2386 |
| 205 | Ga0070672_100145914 | 3300005543 | Bacteria | 1955 |
| 206 | Ga0070672_100167749 | 3300005543 | Bacteria | 1824 |
| 207 | Ga0070686_100003488 | 3300005544 | Bacteria | 8625 |
| 208 | Ga0070686_100022128 | 3300005544 | Bacteria | 3783 |
| 209 | Ga0070695_100000414 | 3300005545 | Bacteria | 22079 |
| 210 | Ga0070696_100000012 | 3300005546 | Bacteria | 79388 |
| 211 | Ga0070696_100002814 | 3300005546 | Bacteria | 11555 |
| 212 | Ga0070696_100002873 | 3300005546 | Bacteria | 11454 |
| 213 | Ga0070696_100012065 | 3300005546 | Bacteria | 5789 |
| 214 | Ga0070696_100029845 | 3300005546 | Bacteria | 3730 |
| 215 | Ga0070696_100044653 | 3300005546 | Bacteria | 3068 |
| 216 | Ga0070693_100000222 | 3300005547 | Bacteria | 26434 |
| 217 | Ga0070665_100003667 | 3300005548 | Bacteria | 16273 |
| 218 | Ga0070665_100005917 | 3300005548 | Bacteria | 12530 |
| 219 | Ga0070665_100012901 | 3300005548 | Bacteria | 8416 |
| 220 | Ga0070665_100140576 | 3300005548 | Bacteria | 2418 |
| 221 | Ga0070665_100148142 | 3300005548 | Bacteria | 2350 |
| 222 | Ga0070665_100209694 | 3300005548 | Bacteria | 1949 |
| 223 | Ga0070704_100000233 | 3300005549 | Bacteria | 23631 |
| 224 | Ga0070704_100002235 | 3300005549 | Bacteria | 10801 |
| 225 | Ga0070704_100008012 | 3300005549 | Bacteria | 6309 |
| 226 | Ga0070704_100279965 | 3300005549 | Bacteria | 1381 |
| 227 | Ga0068855_100006214 | 3300005563 | Bacteria | 14557 |
| 228 | Ga0068855_100016816 | 3300005563 | Bacteria | 8796 |
| 229 | Ga0068855_100079076 | 3300005563 | Bacteria | 3814 |
| 230 | Ga0068855_100129357 | 3300005563 | Bacteria | 2885 |
| 231 | Ga0068855_100162772 | 3300005563 | Bacteria | 2531 |
| 232 | Ga0068855_100358908 | 3300005563 | Bacteria | 1604 |
| 233 | Ga0070664_100013471 | 3300005564 | Bacteria | 6660 |
| 234 | Ga0070664_100021750 | 3300005564 | Bacteria | 5289 |
| 235 | Ga0070664_100021935 | 3300005564 | Bacteria | 5265 |
| 236 | Ga0070664_100067479 | 3300005564 | Bacteria | 3057 |
| 237 | Ga0070664_100098882 | 3300005564 | Bacteria | 2535 |
| 238 | Ga0070664_100149220 | 3300005564 | Bacteria | 2063 |
| 239 | Ga0068857_100082907 | 3300005577 | Bacteria | 2864 |
| 240 | Ga0068857_100120434 | 3300005577 | Bacteria | 2362 |
| 241 | Ga0068857_100224021 | 3300005577 | Bacteria | 1718 |
| 242 | Ga0068854_100006996 | 3300005578 | Bacteria | 7195 |
| 243 | Ga0068854_100013191 | 3300005578 | Bacteria | 5415 |
| 244 | Ga0068854_100031641 | 3300005578 | Bacteria | 3677 |
| 245 | Ga0068854_100316135 | 3300005578 | Bacteria | 1268 |
| 246 | Ga0068856_100001379 | 3300005614 | Bacteria | 25540 |
| 247 | Ga0068856_100003093 | 3300005614 | Bacteria | 16983 |
| 248 | Ga0068856_100007697 | 3300005614 | Bacteria | 10513 |
| 249 | Ga0068856_100013314 | 3300005614 | Bacteria | 7966 |
| 250 | Ga0068856_100022222 | 3300005614 | Bacteria | 6167 |
| 251 | Ga0068856_100113954 | 3300005614 | Bacteria | 2703 |
| 252 | Ga0068856_100114569 | 3300005614 | Bacteria | 2695 |
| 253 | Ga0068856_100206184 | 3300005614 | Bacteria | 1980 |
| 254 | Ga0070702_100046926 | 3300005615 | Bacteria | 2451 |
| 255 | Ga0068852_100002691 | 3300005616 | Bacteria | 12273 |
| 256 | Ga0068852_100018064 | 3300005616 | Bacteria | 5548 |
| 257 | Ga0068852_100021127 | 3300005616 | Bacteria | 5189 |
| 258 | Ga0068852_100039269 | 3300005616 | Bacteria | 3984 |
| 259 | Ga0068852_100059635 | 3300005616 | Bacteria | 3310 |
| 260 | Ga0068852_100062389 | 3300005616 | Bacteria | 3242 |
| 261 | Ga0068852_100069540 | 3300005616 | Bacteria | 3086 |
| 262 | Ga0068852_100127398 | 3300005616 | Bacteria | 2340 |
| 263 | Ga0068852_100153298 | 3300005616 | Bacteria | 2145 |
| 264 | Ga0068852_100207156 | 3300005616 | Bacteria | 1858 |
| 265 | Ga0068852_100236606 | 3300005616 | Bacteria | 1743 |
| 266 | Ga0068852_100296836 | 3300005616 | Bacteria | 1563 |
| 267 | Ga0068859_100000264 | 3300005617 | Bacteria | 52493 |
| 268 | Ga0068859_100005934 | 3300005617 | Bacteria | 12397 |
| 269 | Ga0068859_100012677 | 3300005617 | Bacteria | 8476 |
| 270 | Ga0068859_100080523 | 3300005617 | Bacteria | 3297 |
| 271 | Ga0068859_100126563 | 3300005617 | Bacteria | 2624 |
| 272 | Ga0068859_100197894 | 3300005617 | Bacteria | 2094 |
| 273 | Ga0068859_100310053 | 3300005617 | Bacteria | 1672 |
| 274 | Ga0068859_100316770 | 3300005617 | Bacteria | 1654 |
| 275 | Ga0068864_100000916 | 3300005618 | Bacteria | 24730 |
| 276 | Ga0068864_100002228 | 3300005618 | Bacteria | 16021 |
| 277 | Ga0068864_100017374 | 3300005618 | Bacteria | 5998 |
| 278 | Ga0068864_100051344 | 3300005618 | Bacteria | 3552 |
| 279 | Ga0068864_100055591 | 3300005618 | Bacteria | 3418 |
| 280 | Ga0068866_10000392 | 3300005718 | Bacteria | 20460 |
| 281 | Ga0068866_10001767 | 3300005718 | Bacteria | 9095 |
| 282 | Ga0068866_10049708 | 3300005718 | Bacteria | 2126 |
| 283 | Ga0068861_100000033 | 3300005719 | Bacteria | 64659 |
| 284 | Ga0068861_100010234 | 3300005719 | Bacteria | 6510 |
| 285 | Ga0068861_100142382 | 3300005719 | Bacteria | 1958 |
| 286 | Ga0068861_100159755 | 3300005719 | Bacteria | 1858 |
| 287 | Ga0068851_10017527 | 3300005834 | Bacteria | 3441 |
| 288 | Ga0068851_10019315 | 3300005834 | Bacteria | 3292 |
| 289 | Ga0068870_10016973 | 3300005840 | Bacteria | 3492 |
| 290 | Ga0068870_10080055 | 3300005840 | Bacteria | 1804 |
| 291 | Ga0068870_10100589 | 3300005840 | Bacteria | 1633 |
| 292 | Ga0068863_100013029 | 3300005841 | Bacteria | 8018 |
| 293 | Ga0068863_100114074 | 3300005841 | Bacteria | 2574 |
| 294 | Ga0068858_100000612 | 3300005842 | Bacteria | 37346 |
| 295 | Ga0068858_100003471 | 3300005842 | Bacteria | 15627 |
| 296 | Ga0068858_100010466 | 3300005842 | Bacteria | 8787 |
| 297 | Ga0068858_100091245 | 3300005842 | Bacteria | 2835 |
| 298 | Ga0068858_100143489 | 3300005842 | Bacteria | 2242 |
| 299 | Ga0068858_100173220 | 3300005842 | Bacteria | 2036 |
| 300 | Ga0068860_100003755 | 3300005843 | Bacteria | 15614 |
| 301 | Ga0068860_100044323 | 3300005843 | Bacteria | 4240 |
| 302 | Ga0068860_100077813 | 3300005843 | Bacteria | 3155 |
| 303 | Ga0068860_100085339 | 3300005843 | Bacteria | 3004 |
| 304 | Ga0068860_100096000 | 3300005843 | Bacteria | 2826 |
| 305 | Ga0068862_100001281 | 3300005844 | Bacteria | 23556 |
| 306 | Ga0068862_100132045 | 3300005844 | Bacteria | 2209 |
| 307 | Ga0068862_100361584 | 3300005844 | Bacteria | 1349 |
| 308 | Ga0081539_10009781 | 3300005985 | Bacteria | 7930 |
| 309 | Ga0081539_10035756 | 3300005985 | Bacteria | 2981 |
| 310 | Ga0075363_100005285 | 3300006048 | Bacteria | 5731 |
| 311 | Ga0075363_100007751 | 3300006048 | Bacteria | 4958 |
| 312 | Ga0075363_100010665 | 3300006048 | Bacteria | 4374 |
| 313 | Ga0070715_10030822 | 3300006163 | Bacteria | 2172 |
| 314 | Ga0070716_100003120 | 3300006173 | Bacteria | 7744 |
| 315 | Ga0070712_100000161 | 3300006175 | Bacteria | 36151 |
| 316 | Ga0070712_100039945 | 3300006175 | Bacteria | 3213 |
| 317 | Ga0075362_10050760 | 3300006177 | Bacteria | 1855 |
| 318 | Ga0075362_10060715 | 3300006177 | Bacteria | 1709 |
| 319 | Ga0075366_10001677 | 3300006195 | Bacteria | 11115 |
| 320 | Ga0075366_10025704 | 3300006195 | Bacteria | 3442 |
| 321 | Ga0097621_100000801 | 3300006237 | Bacteria | 22153 |
| 322 | Ga0097621_100009465 | 3300006237 | Bacteria | 7074 |
| 323 | Ga0097621_100017589 | 3300006237 | Bacteria | 5433 |
| 324 | Ga0097621_100038903 | 3300006237 | Bacteria | 3818 |
| 325 | Ga0097621_100043902 | 3300006237 | Bacteria | 3605 |
| 326 | Ga0097621_100084754 | 3300006237 | Bacteria | 2643 |
| 327 | Ga0097621_100123217 | 3300006237 | Bacteria | 2200 |
| 328 | Ga0097621_100147315 | 3300006237 | Bacteria | 2017 |
| 329 | Ga0075370_10013121 | 3300006353 | Bacteria | 4396 |
| 330 | Ga0075370_10038289 | 3300006353 | Bacteria | 2698 |
| 331 | Ga0075370_10040878 | 3300006353 | Bacteria | 2617 |
| 332 | Ga0068871_100001405 | 3300006358 | Bacteria | 16118 |
| 333 | Ga0068871_100032604 | 3300006358 | Bacteria | 4117 |
| 334 | Ga0068871_100049131 | 3300006358 | Bacteria | 3408 |
| 335 | Ga0068871_100085416 | 3300006358 | Bacteria | 2620 |
| 336 | Ga0068871_100086705 | 3300006358 | Bacteria | 2601 |
| 337 | Ga0068871_100192975 | 3300006358 | Bacteria | 1755 |
| 338 | Ga0068871_100196935 | 3300006358 | Bacteria | 1738 |
| 339 | Ga0075428_100001225 | 3300006844 | Bacteria | 27466 |
| 340 | Ga0075428_100067479 | 3300006844 | Bacteria | 3915 |
| 341 | Ga0075428_100097524 | 3300006844 | Bacteria | 3204 |
| 342 | Ga0075428_100189894 | 3300006844 | Bacteria | 2222 |
| 343 | Ga0075430_100000744 | 3300006846 | Bacteria | 25022 |
| 344 | Ga0075430_100043796 | 3300006846 | Bacteria | 3784 |
| 345 | Ga0075430_100251176 | 3300006846 | Bacteria | 1465 |
| 346 | Ga0075431_100067720 | 3300006847 | Bacteria | 3686 |
| 347 | Ga0075431_100095124 | 3300006847 | Bacteria | 3075 |
| 348 | Ga0075431_100134649 | 3300006847 | Bacteria | 2547 |
| 349 | Ga0075433_10002752 | 3300006852 | Bacteria | 13454 |
| 350 | Ga0075434_100000072 | 3300006871 | Bacteria | 53106 |
| 351 | Ga0075434_100002297 | 3300006871 | Bacteria | 16724 |
| 352 | Ga0075434_100064943 | 3300006871 | Bacteria | 3635 |
| 353 | Ga0075429_100001431 | 3300006880 | Bacteria | 19585 |
| 354 | Ga0075429_100029191 | 3300006880 | Bacteria | 4790 |
| 355 | Ga0075429_100029373 | 3300006880 | Bacteria | 4775 |
| 356 | Ga0075429_100037279 | 3300006880 | Bacteria | 4232 |
| 357 | Ga0075429_100178054 | 3300006880 | Bacteria | 1863 |
| 358 | Ga0068865_100000629 | 3300006881 | Bacteria | 19879 |
| 359 | Ga0068865_100008959 | 3300006881 | Bacteria | 6193 |
| 360 | Ga0068865_100013757 | 3300006881 | Bacteria | 5126 |
| 361 | Ga0068865_100070772 | 3300006881 | Bacteria | 2472 |
| 362 | Ga0068865_100185594 | 3300006881 | Bacteria | 1604 |
| 363 | Ga0075436_100001274 | 3300006914 | Bacteria | 17112 |
| 364 | Ga0075436_100064732 | 3300006914 | Bacteria | 2527 |
| 365 | Ga0097620_100000264 | 3300006931 | Bacteria | 52493 |
| 366 | Ga0097620_100005934 | 3300006931 | Bacteria | 12397 |
| 367 | Ga0097620_100012677 | 3300006931 | Bacteria | 8476 |
| 368 | Ga0097620_100080523 | 3300006931 | Bacteria | 3297 |
| 369 | Ga0097620_100126567 | 3300006931 | Bacteria | 2624 |
| 370 | Ga0097620_100197907 | 3300006931 | Bacteria | 2094 |
| 371 | Ga0097620_100310035 | 3300006931 | Bacteria | 1672 |
| 372 | Ga0097620_100316769 | 3300006931 | Bacteria | 1654 |
| 373 | Ga0075435_100001177 | 3300007076 | Bacteria | 16722 |
| 374 | Ga0075435_100002554 | 3300007076 | Bacteria | 12128 |
| 375 | Ga0075435_100035111 | 3300007076 | Bacteria | 3978 |
| 376 | Ga0075435_100160042 | 3300007076 | Bacteria | 1896 |
| 377 | Ga0105240_10017700 | 3300009093 | Bacteria | 9595 |
| 378 | Ga0111539_10053322 | 3300009094 | Bacteria | 4814 |
| 379 | Ga0111539_10070517 | 3300009094 | Bacteria | 4126 |
| 380 | Ga0111539_10170262 | 3300009094 | Bacteria | 2545 |
| 381 | Ga0111539_10174383 | 3300009094 | Bacteria | 2512 |
| 382 | Ga0111539_10260075 | 3300009094 | Bacteria | 2020 |
| 383 | Ga0111539_10269538 | 3300009094 | Bacteria | 1982 |
| 384 | Ga0105245_10000059 | 3300009098 | Bacteria | 121609 |
| 385 | Ga0105245_10001181 | 3300009098 | Bacteria | 23678 |
| 386 | Ga0105245_10084181 | 3300009098 | Bacteria | 2913 |
| 387 | Ga0105245_10263677 | 3300009098 | Bacteria | 1678 |
| 388 | Ga0114129_10009453 | 3300009147 | Bacteria | 13896 |
| 389 | Ga0114129_10047700 | 3300009147 | Bacteria | 6018 |
| 390 | Ga0114129_10057183 | 3300009147 | Bacteria | 5460 |
| 391 | Ga0114129_10066712 | 3300009147 | Bacteria | 5019 |
| 392 | Ga0114129_10268214 | 3300009147 | Bacteria | 2285 |
| 393 | Ga0114129_10282859 | 3300009147 | Bacteria | 2216 |
| 394 | Ga0105243_10001329 | 3300009148 | Bacteria | 22047 |
| 395 | Ga0105243_10006779 | 3300009148 | Bacteria | 8830 |
| 396 | Ga0105243_10009228 | 3300009148 | Bacteria | 7531 |
| 397 | Ga0105243_10016225 | 3300009148 | Bacteria | 5636 |
| 398 | Ga0105241_10017607 | 3300009174 | Bacteria | 5253 |
| 399 | Ga0105241_10027447 | 3300009174 | Bacteria | 4240 |
| 400 | Ga0105241_10042066 | 3300009174 | Bacteria | 3455 |
| 401 | Ga0105241_10049461 | 3300009174 | Bacteria | 3201 |
| 402 | Ga0105242_10002209 | 3300009176 | Bacteria | 15350 |
| 403 | Ga0105242_10094021 | 3300009176 | Bacteria | 2528 |
| 404 | Ga0105248_10004100 | 3300009177 | Bacteria | 16114 |
| 405 | Ga0105248_10017866 | 3300009177 | Bacteria | 7827 |
| 406 | Ga0105248_10049621 | 3300009177 | Bacteria | 4707 |
| 407 | Ga0105248_10125562 | 3300009177 | Bacteria | 2895 |
| 408 | Ga0105248_10183953 | 3300009177 | Bacteria | 2355 |
| 409 | Ga0105248_10266796 | 3300009177 | Bacteria | 1927 |
| 410 | Ga0105237_10000548 | 3300009545 | Bacteria | 52739 |
| 411 | Ga0105237_10179641 | 3300009545 | Bacteria | 2117 |
| 412 | Ga0105237_10188996 | 3300009545 | Bacteria | 2060 |
| 413 | Ga0105238_10235083 | 3300009551 | Bacteria | 1810 |
| 414 | Ga0105249_10001192 | 3300009553 | Bacteria | 22932 |
| 415 | Ga0105249_10108229 | 3300009553 | Bacteria | 2624 |
| 416 | Ga0105239_10001569 | 3300010375 | Bacteria | 30171 |
| 417 | Ga0105239_10023152 | 3300010375 | Bacteria | 6846 |
| 418 | Ga0105239_10271650 | 3300010375 | Bacteria | 1907 |
| 419 | Ga0105239_10302553 | 3300010375 | Bacteria | 1801 |
| 420 | Ga0105239_10333231 | 3300010375 | Bacteria | 1712 |
| 421 | Ga0105239_10363776 | 3300010375 | Bacteria | 1634 |
| 422 | Ga0105246_10007984 | 3300011119 | Bacteria | 6496 |
| 423 | Ga0157373_10001932 | 3300013100 | Bacteria | 15747 |
| 424 | Ga0157373_10003632 | 3300013100 | Bacteria | 11653 |
| 425 | Ga0157373_10219848 | 3300013100 | Bacteria | 1340 |
| 426 | Ga0157371_10000303 | 3300013102 | Bacteria | 64643 |
| 427 | Ga0157371_10095081 | 3300013102 | Bacteria | 2112 |
| 428 | Ga0157370_10002404 | 3300013104 | Bacteria | 22564 |
| 429 | Ga0157370_10011858 | 3300013104 | Bacteria | 9092 |
| 430 | Ga0157370_10016198 | 3300013104 | Bacteria | 7555 |
| 431 | Ga0157370_10050708 | 3300013104 | Bacteria | 3966 |
| 432 | Ga0157369_10119962 | 3300013105 | Bacteria | 2791 |
| 433 | Ga0157374_10000954 | 3300013296 | Bacteria | 25106 |
| 434 | Ga0157374_10001736 | 3300013296 | Bacteria | 18275 |
| 435 | Ga0157374_10005865 | 3300013296 | Bacteria | 10372 |
| 436 | Ga0157374_10082868 | 3300013296 | Bacteria | 3046 |
| 437 | Ga0157374_10287448 | 3300013296 | Bacteria | 1624 |
| 438 | Ga0157378_10000693 | 3300013297 | Bacteria | 31696 |
| 439 | Ga0157378_10004675 | 3300013297 | Bacteria | 12013 |
| 440 | Ga0157378_10093736 | 3300013297 | Bacteria | 2734 |
| 441 | Ga0157378_10142923 | 3300013297 | Bacteria | 2223 |
| 442 | Ga0163162_10051681 | 3300013306 | Bacteria | 4124 |
| 443 | Ga0163162_10071605 | 3300013306 | Bacteria | 3520 |
| 444 | Ga0163162_10087391 | 3300013306 | Bacteria | 3196 |
| 445 | Ga0157372_10002828 | 3300013307 | Bacteria | 18755 |
| 446 | Ga0157372_10008434 | 3300013307 | Bacteria | 10940 |
| 447 | Ga0157372_10011850 | 3300013307 | Bacteria | 9287 |
| 448 | Ga0157372_10019251 | 3300013307 | Bacteria | 7351 |
| 449 | Ga0157372_10071584 | 3300013307 | Bacteria | 3905 |
| 450 | Ga0157372_10097839 | 3300013307 | Bacteria | 3347 |
| 451 | Ga0157372_10154108 | 3300013307 | Bacteria | 2653 |
| 452 | Ga0157372_10258427 | 3300013307 | Bacteria | 2022 |
| 453 | Ga0157372_10404695 | 3300013307 | Bacteria | 1590 |
| 454 | Ga0157375_10001655 | 3300013308 | Bacteria | 19164 |
| 455 | Ga0157375_10003889 | 3300013308 | Bacteria | 12962 |
| 456 | Ga0157375_10013200 | 3300013308 | Bacteria | 7345 |
| 457 | Ga0157375_10031297 | 3300013308 | Bacteria | 5027 |
| 458 | Ga0157375_10058150 | 3300013308 | Bacteria | 3824 |
| 459 | Ga0157375_10095972 | 3300013308 | Bacteria | 3037 |
| 460 | Ga0157375_10225102 | 3300013308 | Bacteria | 2035 |
| 461 | Ga0157375_10254724 | 3300013308 | Bacteria | 1916 |
| 462 | Ga0157375_10319675 | 3300013308 | Bacteria | 1717 |
| 463 | Ga0163163_10000225 | 3300014325 | Bacteria | 58314 |
| 464 | Ga0163163_10178375 | 3300014325 | Bacteria | 2171 |
| 465 | Ga0157380_10018722 | 3300014326 | Bacteria | 5147 |
| 466 | Ga0157380_10200133 | 3300014326 | Bacteria | 1771 |
| 467 | Ga0157380_10300573 | 3300014326 | Bacteria | 1478 |
| 468 | Ga0157377_10000028 | 3300014745 | Bacteria | 134810 |
| 469 | Ga0157377_10037330 | 3300014745 | Bacteria | 2676 |
| 470 | Ga0157379_10001851 | 3300014968 | Bacteria | 17503 |
| 471 | Ga0157379_10005162 | 3300014968 | Bacteria | 11213 |
| 472 | Ga0157379_10019810 | 3300014968 | Bacteria | 5945 |
| 473 | Ga0157379_10037900 | 3300014968 | Bacteria | 4300 |
| 474 | Ga0157379_10114247 | 3300014968 | Bacteria | 2427 |
| 475 | Ga0157376_10002436 | 3300014969 | Bacteria | 12585 |
| 476 | Ga0157376_10003620 | 3300014969 | Bacteria | 10665 |
| 477 | Ga0157376_10012494 | 3300014969 | Bacteria | 6305 |
| 478 | Ga0157376_10023935 | 3300014969 | Bacteria | 4789 |
| 479 | Ga0157376_10061744 | 3300014969 | Bacteria | 3151 |
| 480 | Ga0157376_10284193 | 3300014969 | Bacteria | 1559 |
| 481 | Ga0182005_1000134 | 3300015265 | Bacteria | 53164 |
| 482 | Ga0182005_1015578 | 3300015265 | Bacteria | 2119 |
| 483 | Ga0163161_10019913 | 3300017792 | Bacteria | 4706 |
| 484 | Ga0163161_10023133 | 3300017792 | Bacteria | 4380 |
| 485 | Ga0163161_10028638 | 3300017792 | Bacteria | 3956 |
| 486 | Ga0209760_103086 | 3300025207 | Bacteria | 1497 |
| 487 | Ga0209784_100034 | 3300025224 | Bacteria | 305504 |
| 488 | Ga0209566_100038 | 3300025225 | Bacteria | 305504 |
| 489 | Ga0209674_100056 | 3300025226 | Bacteria | 305504 |
| 490 | Ga0209563_100057 | 3300025230 | Bacteria | 305604 |
| 491 | Ga0207427_101302 | 3300025231 | Bacteria | 9415 |
| 492 | Ga0209437_100071 | 3300025233 | Bacteria | 305604 |
| 493 | Ga0207425_1002124 | 3300025245 | Bacteria | 7283 |
| 494 | Ga0209677_100035 | 3300025253 | Bacteria | 305504 |
| 495 | Ga0209129_1000369 | 3300025258 | Bacteria | 36698 |
| 496 | Ga0209233_1000094 | 3300025261 | Bacteria | 305604 |
| 497 | Ga0209564_1000046 | 3300025295 | Bacteria | 373787 |
| 498 | Ga0209758_1000369 | 3300025297 | Bacteria | 79541 |
| 499 | Ga0209758_1000709 | 3300025297 | Bacteria | 49238 |
| 500 | Ga0209050_1001458 | 3300025298 | Bacteria | 25343 |
| 501 | Ga0207697_10014910 | 3300025315 | Bacteria | 3218 |
| 502 | Ga0207697_10024015 | 3300025315 | Bacteria | 2497 |
| 503 | Ga0207656_10007341 | 3300025321 | Bacteria | 4008 |
| 504 | Ga0207682_10000044 | 3300025893 | Bacteria | 51808 |
| 505 | Ga0207682_10001919 | 3300025893 | Bacteria | 9447 |
| 506 | Ga0207682_10014581 | 3300025893 | Bacteria | 3063 |
| 507 | Ga0207692_10019407 | 3300025898 | Bacteria | 3072 |
| 508 | Ga0207642_10009742 | 3300025899 | Bacteria | 3354 |
| 509 | Ga0207642_10018667 | 3300025899 | Bacteria | 2667 |
| 510 | Ga0207680_10000757 | 3300025903 | Bacteria | 15225 |
| 511 | Ga0207680_10068690 | 3300025903 | Bacteria | 2187 |
| 512 | Ga0207680_10107525 | 3300025903 | Bacteria | 1803 |
| 513 | Ga0207647_10020345 | 3300025904 | Bacteria | 4451 |
| 514 | Ga0207699_10200235 | 3300025906 | Bacteria | 1353 |
| 515 | Ga0207645_10000590 | 3300025907 | Bacteria | 30055 |
| 516 | Ga0207645_10001566 | 3300025907 | Bacteria | 18680 |
| 517 | Ga0207645_10003988 | 3300025907 | Bacteria | 11007 |
| 518 | Ga0207645_10011786 | 3300025907 | Bacteria | 5953 |
| 519 | Ga0207645_10011960 | 3300025907 | Bacteria | 5904 |
| 520 | Ga0207645_10014014 | 3300025907 | Bacteria | 5377 |
| 521 | Ga0207645_10020128 | 3300025907 | Bacteria | 4369 |
| 522 | Ga0207645_10029674 | 3300025907 | Bacteria | 3525 |
| 523 | Ga0207643_10029280 | 3300025908 | Bacteria | 3062 |
| 524 | Ga0207705_10029785 | 3300025909 | Bacteria | 3891 |
| 525 | Ga0207705_10035487 | 3300025909 | Bacteria | 3567 |
| 526 | Ga0207705_10069511 | 3300025909 | Bacteria | 2551 |
| 527 | Ga0207705_10072390 | 3300025909 | Bacteria | 2500 |
| 528 | Ga0207684_10002827 | 3300025910 | Bacteria | 17250 |
| 529 | Ga0207684_10037641 | 3300025910 | Bacteria | 4105 |
| 530 | Ga0207684_10062819 | 3300025910 | Bacteria | 3153 |
| 531 | Ga0207654_10018181 | 3300025911 | Bacteria | 3685 |
| 532 | Ga0207654_10040723 | 3300025911 | Bacteria | 2619 |
| 533 | Ga0207707_10001629 | 3300025912 | Bacteria | 20695 |
| 534 | Ga0207707_10006002 | 3300025912 | Bacteria | 10633 |
| 535 | Ga0207707_10116682 | 3300025912 | Bacteria | 2333 |
| 536 | Ga0207707_10140668 | 3300025912 | Bacteria | 2110 |
| 537 | Ga0207695_10058138 | 3300025913 | Bacteria | 4015 |
| 538 | Ga0207695_10077664 | 3300025913 | Bacteria | 3371 |
| 539 | Ga0207695_10106135 | 3300025913 | Bacteria | 2795 |
| 540 | Ga0207671_10012212 | 3300025914 | Bacteria | 6926 |
| 541 | Ga0207671_10161946 | 3300025914 | Bacteria | 1733 |
| 542 | Ga0207693_10000075 | 3300025915 | Bacteria | 88428 |
| 543 | Ga0207693_10051893 | 3300025915 | Bacteria | 3217 |
| 544 | Ga0207693_10066228 | 3300025915 | Bacteria | 2828 |
| 545 | Ga0207663_10005149 | 3300025916 | Bacteria | 6576 |
| 546 | Ga0207663_10099085 | 3300025916 | Bacteria | 1953 |
| 547 | Ga0207660_10004807 | 3300025917 | Bacteria | 8789 |
| 548 | Ga0207660_10032183 | 3300025917 | Bacteria | 3619 |
| 549 | Ga0207660_10065721 | 3300025917 | Bacteria | 2622 |
| 550 | Ga0207660_10098596 | 3300025917 | Bacteria | 2180 |
| 551 | Ga0207660_10185416 | 3300025917 | Bacteria | 1618 |
| 552 | Ga0207662_10000782 | 3300025918 | Bacteria | 14603 |
| 553 | Ga0207662_10014355 | 3300025918 | Bacteria | 4442 |
| 554 | Ga0207662_10020257 | 3300025918 | Bacteria | 3793 |
| 555 | Ga0207662_10049947 | 3300025918 | Bacteria | 2483 |
| 556 | Ga0207657_10000160 | 3300025919 | Bacteria | 69252 |
| 557 | Ga0207657_10001114 | 3300025919 | Bacteria | 28498 |
| 558 | Ga0207657_10010217 | 3300025919 | Bacteria | 9375 |
| 559 | Ga0207657_10016351 | 3300025919 | Bacteria | 7158 |
| 560 | Ga0207657_10041179 | 3300025919 | Bacteria | 4086 |
| 561 | Ga0207657_10115206 | 3300025919 | Bacteria | 2216 |
| 562 | Ga0207657_10140961 | 3300025919 | Bacteria | 1969 |
| 563 | Ga0207649_10011309 | 3300025920 | Bacteria | 4918 |
| 564 | Ga0207649_10027765 | 3300025920 | Bacteria | 3326 |
| 565 | Ga0207649_10090977 | 3300025920 | Bacteria | 1998 |
| 566 | Ga0207649_10097300 | 3300025920 | Bacteria | 1940 |
| 567 | Ga0207652_10005271 | 3300025921 | Bacteria | 10493 |
| 568 | Ga0207652_10045778 | 3300025921 | Bacteria | 3730 |
| 569 | Ga0207652_10056935 | 3300025921 | Bacteria | 3366 |
| 570 | Ga0207652_10072814 | 3300025921 | Bacteria | 2988 |
| 571 | Ga0207681_10001478 | 3300025923 | Bacteria | 15151 |
| 572 | Ga0207681_10015245 | 3300025923 | Bacteria | 4792 |
| 573 | Ga0207681_10095094 | 3300025923 | Bacteria | 2136 |
| 574 | Ga0207694_10004147 | 3300025924 | Bacteria | 11379 |
| 575 | Ga0207650_10001071 | 3300025925 | Bacteria | 20336 |
| 576 | Ga0207650_10012849 | 3300025925 | Bacteria | 5785 |
| 577 | Ga0207650_10015944 | 3300025925 | Bacteria | 5243 |
| 578 | Ga0207650_10034045 | 3300025925 | Bacteria | 3693 |
| 579 | Ga0207650_10114180 | 3300025925 | Bacteria | 2095 |
| 580 | Ga0207659_10002022 | 3300025926 | Bacteria | 12018 |
| 581 | Ga0207659_10002849 | 3300025926 | Bacteria | 10309 |
| 582 | Ga0207659_10017392 | 3300025926 | Bacteria | 4697 |
| 583 | Ga0207659_10053368 | 3300025926 | Bacteria | 2883 |
| 584 | Ga0207659_10063691 | 3300025926 | Bacteria | 2666 |
| 585 | Ga0207687_10000697 | 3300025927 | Bacteria | 22694 |
| 586 | Ga0207687_10045063 | 3300025927 | Bacteria | 3047 |
| 587 | Ga0207687_10059098 | 3300025927 | Bacteria | 2700 |
| 588 | Ga0207687_10089341 | 3300025927 | Bacteria | 2243 |
| 589 | Ga0207700_10000375 | 3300025928 | Bacteria | 26197 |
| 590 | Ga0207700_10001042 | 3300025928 | Bacteria | 15977 |
| 591 | Ga0207700_10033017 | 3300025928 | Bacteria | 3699 |
| 592 | Ga0207700_10054627 | 3300025928 | Bacteria | 2999 |
| 593 | Ga0207664_10036805 | 3300025929 | Bacteria | 3784 |
| 594 | Ga0207664_10106868 | 3300025929 | Bacteria | 2321 |
| 595 | Ga0207664_10234165 | 3300025929 | Bacteria | 1597 |
| 596 | Ga0207644_10004238 | 3300025931 | Bacteria | 9309 |
| 597 | Ga0207644_10004260 | 3300025931 | Bacteria | 9282 |
| 598 | Ga0207644_10007845 | 3300025931 | Bacteria | 6972 |
| 599 | Ga0207644_10008258 | 3300025931 | Bacteria | 6821 |
| 600 | Ga0207644_10008540 | 3300025931 | Bacteria | 6701 |
| 601 | Ga0207644_10024864 | 3300025931 | Bacteria | 4114 |
| 602 | Ga0207644_10119555 | 3300025931 | Bacteria | 2004 |
| 603 | Ga0207644_10161287 | 3300025931 | Bacteria | 1743 |
| 604 | Ga0207644_10167079 | 3300025931 | Bacteria | 1715 |
| 605 | Ga0207644_10214578 | 3300025931 | Bacteria | 1523 |
| 606 | Ga0207690_10009822 | 3300025932 | Bacteria | 5686 |
| 607 | Ga0207690_10028675 | 3300025932 | Bacteria | 3529 |
| 608 | Ga0207690_10094129 | 3300025932 | Bacteria | 2125 |
| 609 | Ga0207706_10000023 | 3300025933 | Bacteria | 153979 |
| 610 | Ga0207706_10012342 | 3300025933 | Bacteria | 7782 |
| 611 | Ga0207706_10018245 | 3300025933 | Bacteria | 6314 |
| 612 | Ga0207706_10031665 | 3300025933 | Bacteria | 4711 |
| 613 | Ga0207706_10037748 | 3300025933 | Bacteria | 4288 |
| 614 | Ga0207706_10365038 | 3300025933 | Bacteria | 1254 |
| 615 | Ga0207686_10002631 | 3300025934 | Bacteria | 9742 |
| 616 | Ga0207686_10015450 | 3300025934 | Bacteria | 4269 |
| 617 | Ga0207686_10086859 | 3300025934 | Bacteria | 2055 |
| 618 | Ga0207709_10001580 | 3300025935 | Bacteria | 15546 |
| 619 | Ga0207709_10003401 | 3300025935 | Bacteria | 9499 |
| 620 | Ga0207709_10012911 | 3300025935 | Bacteria | 4606 |
| 621 | Ga0207670_10008559 | 3300025936 | Bacteria | 5784 |
| 622 | Ga0207669_10002735 | 3300025937 | Bacteria | 7556 |
| 623 | Ga0207669_10005538 | 3300025937 | Bacteria | 5677 |
| 624 | Ga0207669_10052423 | 3300025937 | Bacteria | 2451 |
| 625 | Ga0207669_10132096 | 3300025937 | Bacteria | 1717 |
| 626 | Ga0207704_10000370 | 3300025938 | Bacteria | 20772 |
| 627 | Ga0207704_10002182 | 3300025938 | Bacteria | 8774 |
| 628 | Ga0207704_10018516 | 3300025938 | Bacteria | 3637 |
| 629 | Ga0207704_10066390 | 3300025938 | Bacteria | 2264 |
| 630 | Ga0207665_10039585 | 3300025939 | Bacteria | 3143 |
| 631 | Ga0207691_10000022 | 3300025940 | Bacteria | 132936 |
| 632 | Ga0207691_10000224 | 3300025940 | Bacteria | 55186 |
| 633 | Ga0207691_10005312 | 3300025940 | Bacteria | 12435 |
| 634 | Ga0207691_10008031 | 3300025940 | Bacteria | 10145 |
| 635 | Ga0207691_10011546 | 3300025940 | Bacteria | 8480 |
| 636 | Ga0207691_10027913 | 3300025940 | Bacteria | 5288 |
| 637 | Ga0207691_10034393 | 3300025940 | Bacteria | 4712 |
| 638 | Ga0207691_10036114 | 3300025940 | Bacteria | 4579 |
| 639 | Ga0207691_10042701 | 3300025940 | Bacteria | 4178 |
| 640 | Ga0207691_10051226 | 3300025940 | Bacteria | 3776 |
| 641 | Ga0207691_10225604 | 3300025940 | Bacteria | 1623 |
| 642 | Ga0207711_10000092 | 3300025941 | Bacteria | 95507 |
| 643 | Ga0207711_10007461 | 3300025941 | Bacteria | 9150 |
| 644 | Ga0207711_10012405 | 3300025941 | Bacteria | 7085 |
| 645 | Ga0207711_10063435 | 3300025941 | Bacteria | 3189 |
| 646 | Ga0207711_10114492 | 3300025941 | Bacteria | 2402 |
| 647 | Ga0207711_10328737 | 3300025941 | Bacteria | 1414 |
| 648 | Ga0207689_10003609 | 3300025942 | Bacteria | 14136 |
| 649 | Ga0207689_10004291 | 3300025942 | Bacteria | 12973 |
| 650 | Ga0207689_10008652 | 3300025942 | Bacteria | 8862 |
| 651 | Ga0207689_10009095 | 3300025942 | Bacteria | 8600 |
| 652 | Ga0207689_10039935 | 3300025942 | Bacteria | 3884 |
| 653 | Ga0207689_10094530 | 3300025942 | Bacteria | 2455 |
| 654 | Ga0207689_10301895 | 3300025942 | Bacteria | 1327 |
| 655 | Ga0207661_10082231 | 3300025944 | Bacteria | 2662 |
| 656 | Ga0207679_10010809 | 3300025945 | Bacteria | 5885 |
| 657 | Ga0207679_10021666 | 3300025945 | Bacteria | 4361 |
| 658 | Ga0207679_10106268 | 3300025945 | Bacteria | 2206 |
| 659 | Ga0207679_10134897 | 3300025945 | Bacteria | 1986 |
| 660 | Ga0207667_10012582 | 3300025949 | Bacteria | 9733 |
| 661 | Ga0207667_10025154 | 3300025949 | Bacteria | 6523 |
| 662 | Ga0207667_10026382 | 3300025949 | Bacteria | 6349 |
| 663 | Ga0207667_10061993 | 3300025949 | Bacteria | 3911 |
| 664 | Ga0207667_10081291 | 3300025949 | Bacteria | 3357 |
| 665 | Ga0207667_10186021 | 3300025949 | Bacteria | 2132 |
| 666 | Ga0207651_10000135 | 3300025960 | Bacteria | 31996 |
| 667 | Ga0207651_10012862 | 3300025960 | Bacteria | 4758 |
| 668 | Ga0207651_10013505 | 3300025960 | Bacteria | 4676 |
| 669 | Ga0207651_10046202 | 3300025960 | Bacteria | 2926 |
| 670 | Ga0207651_10092471 | 3300025960 | Bacteria | 2218 |
| 671 | Ga0207712_10004221 | 3300025961 | Bacteria | 9065 |
| 672 | Ga0207668_10016076 | 3300025972 | Bacteria | 4662 |
| 673 | Ga0207668_10041154 | 3300025972 | Bacteria | 3122 |
| 674 | Ga0207668_10041705 | 3300025972 | Bacteria | 3104 |
| 675 | Ga0207640_10009134 | 3300025981 | Bacteria | 5537 |
| 676 | Ga0207640_10016844 | 3300025981 | Bacteria | 4261 |
| 677 | Ga0207640_10062336 | 3300025981 | Bacteria | 2474 |
| 678 | Ga0207658_10001652 | 3300025986 | Bacteria | 17020 |
| 679 | Ga0207658_10008305 | 3300025986 | Bacteria | 7069 |
| 680 | Ga0207658_10011567 | 3300025986 | Bacteria | 6007 |
| 681 | Ga0207677_10000768 | 3300026023 | Bacteria | 18466 |
| 682 | Ga0207677_10011737 | 3300026023 | Bacteria | 5006 |
| 683 | Ga0207677_10062984 | 3300026023 | Bacteria | 2575 |
| 684 | Ga0207677_10068482 | 3300026023 | Bacteria | 2491 |
| 685 | Ga0207677_10084101 | 3300026023 | Bacteria | 2293 |
| 686 | Ga0207677_10241849 | 3300026023 | Bacteria | 1461 |
| 687 | Ga0207703_10000820 | 3300026035 | Bacteria | 30614 |
| 688 | Ga0207703_10037103 | 3300026035 | Bacteria | 3882 |
| 689 | Ga0207639_10003328 | 3300026041 | Bacteria | 10819 |
| 690 | Ga0207639_10006189 | 3300026041 | Bacteria | 8128 |
| 691 | Ga0207639_10025204 | 3300026041 | Bacteria | 4312 |
| 692 | Ga0207639_10040340 | 3300026041 | Bacteria | 3483 |
| 693 | Ga0207639_10132300 | 3300026041 | Bacteria | 2067 |
| 694 | Ga0207678_10000500 | 3300026067 | Bacteria | 35694 |
| 695 | Ga0207678_10018317 | 3300026067 | Bacteria | 6150 |
| 696 | Ga0207678_10021448 | 3300026067 | Bacteria | 5663 |
| 697 | Ga0207708_10000617 | 3300026075 | Bacteria | 27309 |
| 698 | Ga0207708_10028414 | 3300026075 | Bacteria | 4236 |
| 699 | Ga0207702_10004347 | 3300026078 | Bacteria | 12633 |
| 700 | Ga0207702_10004753 | 3300026078 | Bacteria | 11988 |
| 701 | Ga0207702_10011508 | 3300026078 | Bacteria | 7372 |
| 702 | Ga0207702_10030713 | 3300026078 | Bacteria | 4475 |
| 703 | Ga0207702_10064993 | 3300026078 | Bacteria | 3124 |
| 704 | Ga0207702_10098222 | 3300026078 | Bacteria | 2579 |
| 705 | Ga0207702_10106709 | 3300026078 | Bacteria | 2482 |
| 706 | Ga0207641_10004639 | 3300026088 | Bacteria | 11862 |
| 707 | Ga0207641_10004870 | 3300026088 | Bacteria | 11552 |
| 708 | Ga0207641_10010037 | 3300026088 | Bacteria | 7788 |
| 709 | Ga0207641_10039034 | 3300026088 | Bacteria | 3970 |
| 710 | Ga0207641_10180077 | 3300026088 | Bacteria | 1935 |
| 711 | Ga0207648_10000089 | 3300026089 | Bacteria | 86359 |
| 712 | Ga0207648_10000130 | 3300026089 | Bacteria | 74342 |
| 713 | Ga0207648_10000146 | 3300026089 | Bacteria | 70573 |
| 714 | Ga0207648_10002519 | 3300026089 | Bacteria | 19654 |
| 715 | Ga0207648_10003749 | 3300026089 | Bacteria | 15887 |
| 716 | Ga0207648_10006200 | 3300026089 | Bacteria | 11910 |
| 717 | Ga0207648_10006998 | 3300026089 | Bacteria | 11152 |
| 718 | Ga0207648_10011303 | 3300026089 | Bacteria | 8416 |
| 719 | Ga0207648_10035654 | 3300026089 | Bacteria | 4383 |
| 720 | Ga0207648_10045838 | 3300026089 | Bacteria | 3834 |
| 721 | Ga0207648_10063670 | 3300026089 | Bacteria | 3214 |
| 722 | Ga0207648_10089702 | 3300026089 | Bacteria | 2686 |
| 723 | Ga0207648_10126836 | 3300026089 | Bacteria | 2245 |
| 724 | Ga0207648_10250198 | 3300026089 | Bacteria | 1580 |
| 725 | Ga0207676_10000097 | 3300026095 | Bacteria | 78464 |
| 726 | Ga0207676_10004846 | 3300026095 | Bacteria | 9538 |
| 727 | Ga0207676_10014293 | 3300026095 | Bacteria | 5708 |
| 728 | Ga0207676_10042101 | 3300026095 | Bacteria | 3511 |
| 729 | Ga0207674_10000236 | 3300026116 | Bacteria | 68955 |
| 730 | Ga0207674_10007783 | 3300026116 | Bacteria | 12466 |
| 731 | Ga0207674_10020685 | 3300026116 | Bacteria | 7102 |
| 732 | Ga0207674_10051358 | 3300026116 | Bacteria | 4208 |
| 733 | Ga0207674_10092585 | 3300026116 | Bacteria | 3012 |
| 734 | Ga0207674_10106806 | 3300026116 | Bacteria | 2776 |
| 735 | Ga0207674_10179580 | 3300026116 | Bacteria | 2068 |
| 736 | Ga0207675_100000857 | 3300026118 | Bacteria | 30347 |
| 737 | Ga0207675_100001694 | 3300026118 | Bacteria | 22071 |
| 738 | Ga0207675_100048651 | 3300026118 | Bacteria | 3958 |
| 739 | Ga0207675_100109636 | 3300026118 | Bacteria | 2604 |
| 740 | Ga0207683_10000283 | 3300026121 | Bacteria | 45381 |
| 741 | Ga0207683_10001343 | 3300026121 | Bacteria | 22211 |
| 742 | Ga0207683_10003069 | 3300026121 | Bacteria | 14600 |
| 743 | Ga0207683_10003588 | 3300026121 | Bacteria | 13534 |
| 744 | Ga0207683_10025161 | 3300026121 | Bacteria | 5133 |
| 745 | Ga0207683_10050435 | 3300026121 | Bacteria | 3645 |
| 746 | Ga0207683_10148771 | 3300026121 | Bacteria | 2113 |
| 747 | Ga0207683_10167427 | 3300026121 | Bacteria | 1989 |
| 748 | Ga0207683_10186229 | 3300026121 | Bacteria | 1883 |
| 749 | Ga0207683_10205759 | 3300026121 | Bacteria | 1790 |
| 750 | Ga0207683_10223045 | 3300026121 | Bacteria | 1718 |
| 751 | Ga0207698_10006776 | 3300026142 | Bacteria | 7161 |
| 752 | Ga0207698_10021518 | 3300026142 | Bacteria | 4462 |
| 753 | Ga0207698_10058537 | 3300026142 | Bacteria | 2987 |
| 754 | Ga0207698_10069098 | 3300026142 | Bacteria | 2792 |
| 755 | Ga0209967_1003126 | 3300027364 | Bacteria | 2170 |
| 756 | Ga0209995_1000765 | 3300027471 | Bacteria | 4943 |
| 757 | Ga0209968_1000471 | 3300027526 | Bacteria | 6435 |
| 758 | Ga0209970_1002455 | 3300027614 | Bacteria | 3156 |
| 759 | Ga0209983_1004988 | 3300027665 | Bacteria | 2771 |
| 760 | Ga0209971_1001379 | 3300027682 | Bacteria | 6042 |
| 761 | Ga0209966_1000005 | 3300027695 | Bacteria | 103734 |
| 762 | Ga0209813_10003834 | 3300027866 | Bacteria | 3556 |
| 763 | Ga0207428_10051779 | 3300027907 | Bacteria | 3281 |
| 764 | Ga0207428_10097111 | 3300027907 | Bacteria | 2281 |
| 765 | Ga0207428_10135074 | 3300027907 | Bacteria | 1886 |
| 766 | Ga0268266_10003808 | 3300028379 | Bacteria | 14754 |
| 767 | Ga0268266_10011396 | 3300028379 | Bacteria | 7731 |
| 768 | Ga0268266_10028877 | 3300028379 | Bacteria | 4713 |
| 769 | Ga0268266_10085660 | 3300028379 | Bacteria | 2753 |
| 770 | Ga0268266_10145527 | 3300028379 | Bacteria | 2130 |
| 771 | Ga0268265_10003627 | 3300028380 | Bacteria | 11017 |
| 772 | Ga0268265_10005565 | 3300028380 | Bacteria | 8598 |
| 773 | Ga0268265_10063972 | 3300028380 | Bacteria | 2832 |
| 774 | Ga0268265_10167125 | 3300028380 | Bacteria | 1876 |
| 775 | Ga0268264_10000892 | 3300028381 | Bacteria | 31423 |
| 776 | Ga0268264_10023671 | 3300028381 | Bacteria | 5008 |
| 777 | Ga0307517_10095981 | 3300028786 | Bacteria | 2380 |
| 778 | Ga0307515_10001342 | 3300028794 | Bacteria | 55698 |
| 779 | Ga0307515_10006289 | 3300028794 | Bacteria | 23807 |
| 780 | Ga0307515_10114736 | 3300028794 | Bacteria | 3110 |
| 781 | Ga0265338_10001649 | 3300028800 | Bacteria | 35677 |
| 782 | Ga0265332_10001972 | 3300031238 | Bacteria | 10802 |
| 783 | Ga0265331_10001617 | 3300031250 | Bacteria | 16448 |
| 784 | Ga0307513_10074316 | 3300031456 | Bacteria | 3535 |
| 785 | Ga0307513_10091450 | 3300031456 | Bacteria | 3101 |
| 786 | Ga0307509_10280150 | 3300031507 | Bacteria | 1429 |
| 787 | Ga0307408_100008287 | 3300031548 | Bacteria | 6861 |
| 788 | Ga0307408_100018326 | 3300031548 | Bacteria | 4697 |
| 789 | Ga0307408_100049977 | 3300031548 | Bacteria | 3005 |
| 790 | Ga0307508_10000004 | 3300031616 | Bacteria | 287547 |
| 791 | Ga0307508_10143264 | 3300031616 | Bacteria | 1994 |
| 792 | Ga0307514_10009601 | 3300031649 | Bacteria | 8125 |
| 793 | Ga0316575_10007395 | 3300031665 | Bacteria | 3976 |
| 794 | Ga0316579_10035589 | 3300031691 | Bacteria | 2295 |
| 795 | Ga0265342_10011453 | 3300031712 | Bacteria | 6070 |
| 796 | Ga0307516_10000234 | 3300031730 | Bacteria | 71156 |
| 797 | Ga0307516_10013729 | 3300031730 | Bacteria | 8603 |
| 798 | Ga0307516_10079315 | 3300031730 | Bacteria | 3128 |
| 799 | Ga0307516_10110733 | 3300031730 | Bacteria | 2549 |
| 800 | Ga0307516_10147970 | 3300031730 | Bacteria | 2112 |
| 801 | Ga0307405_10001503 | 3300031731 | Bacteria | 9868 |
| 802 | Ga0307405_10007502 | 3300031731 | Bacteria | 5462 |
| 803 | Ga0307405_10083394 | 3300031731 | Bacteria | 2095 |
| 804 | Ga0307413_10006139 | 3300031824 | Bacteria | 5454 |
| 805 | Ga0307410_10009445 | 3300031852 | Bacteria | 5469 |
| 806 | Ga0307410_10011320 | 3300031852 | Bacteria | 5096 |
| 807 | Ga0307406_10015337 | 3300031901 | Bacteria | 4431 |
| 808 | Ga0307407_10000312 | 3300031903 | Bacteria | 14375 |
| 809 | Ga0307412_10043148 | 3300031911 | Bacteria | 2935 |
| 810 | Ga0307412_10065398 | 3300031911 | Bacteria | 2461 |
| 811 | Ga0307412_10130941 | 3300031911 | Bacteria | 1822 |
| 812 | Ga0307409_100000086 | 3300031995 | Bacteria | 33256 |
| 813 | Ga0307409_100004420 | 3300031995 | Bacteria | 7893 |
| 814 | Ga0307409_100024728 | 3300031995 | Bacteria | 4196 |
| 815 | Ga0307416_100006561 | 3300032002 | Bacteria | 7298 |
| 816 | Ga0307416_100025400 | 3300032002 | Bacteria | 4342 |
| 817 | Ga0307416_100117705 | 3300032002 | Bacteria | 2359 |
| 818 | Ga0307411_10000630 | 3300032005 | Bacteria | 12756 |
| 819 | Ga0307411_10006711 | 3300032005 | Bacteria | 5785 |
| 820 | Ga0307415_100001036 | 3300032126 | Bacteria | 12874 |
| 821 | Ga0307415_100027857 | 3300032126 | Bacteria | 3586 |
| 822 | Ga0316583_10013543 | 3300032133 | Bacteria | 2943 |
| 823 | Ga0373959_0004801 | 3300034820 | Bacteria | 2195 |
| 824 | Ga0373926_0001086 | 3300035083 | Bacteria | 8015 |
| 825 | Ga0373934_0001247 | 3300035086 | Bacteria | 9261 |
| 826 | Ga0373944_0009665 | 3300035089 | Bacteria | 2618 |
| 827 | Ga0373951_0002478 | 3300035091 | Bacteria | 4651 |
| 828 | Ga0373923_0002361 | 3300035111 | Bacteria | 5789 |
| 829 | Ga0373932_0002947 | 3300035112 | Bacteria | 4192 |
| 830 | Ga0373936_0001617 | 3300035113 | Bacteria | 8236 |
| 831 | Ga0373936_0024397 | 3300035113 | Bacteria | 2361 |
| 832 | Ga0373936_0027944 | 3300035113 | Bacteria | 2215 |
| 833 | Ga0373936_0038432 | 3300035113 | Bacteria | 1913 |
| 834 | Ga0373939_0003489 | 3300035114 | Bacteria | 3693 |
| 835 | Ga0373941_0006274 | 3300035115 | Bacteria | 2855 |
| 836 | Ga0373941_0012599 | 3300035115 | Bacteria | 2215 |
| 837 | Ga0373945_0011893 | 3300035116 | Bacteria | 2883 |
| 838 | Ga0373953_0015475 | 3300035117 | Bacteria | 2765 |
| 839 | Ga0373954_0000190 | 3300035118 | Bacteria | 22280 |
| 840 | Ga0373954_0002677 | 3300035118 | Bacteria | 7494 |
| 841 | Ga0373954_0026208 | 3300035118 | Bacteria | 2671 |
| 842 | Ga0373957_0015384 | 3300035120 | Bacteria | 2632 |
| 843 | Ga0373943_0017634 | 3300035170 | Bacteria | 3267 |
| 844 | Ga0373943_0023852 | 3300035170 | Bacteria | 2848 |
| 845 | Ga0373943_0024870 | 3300035170 | Bacteria | 2795 |
| 846 | Ga0373943_0050248 | 3300035170 | Bacteria | 2048 |
| 847 | Ga0373946_0011423 | 3300035171 | Bacteria | 3312 |
| 848 | Ga0373955_0000975 | 3300035172 | Bacteria | 12157 |
| 849 | Ga0373955_0023682 | 3300035172 | Bacteria | 3131 |
| 850 | Ga0373942_0002583 | 3300035207 | Bacteria | 4367 |
| 851 | Ga0373961_0014827 | 3300035241 | Bacteria | 1984 |
| 852 | Ga0373962_0024180 | 3300035242 | Bacteria | 1622 |
| 853 | Ga0373931_0000211 | 3300035691 | Bacteria | 24945 |
| 854 | Ga0373931_0009283 | 3300035691 | Bacteria | 4699 |
| 855 | Ga0373931_0010357 | 3300035691 | Bacteria | 4480 |
| 856 | Ga0373931_0076900 | 3300035691 | Bacteria | 1834 |
| 857 | Ga0373931_0101337 | 3300035691 | Bacteria | 1620 |
| 858 | Ga0373935_0006447 | 3300035692 | Bacteria | 7007 |
| 859 | Ga0373935_0010631 | 3300035692 | Bacteria | 5525 |
| 860 | Ga0373935_0039213 | 3300035692 | Bacteria | 2969 |
| 861 | Ga0373935_0069721 | 3300035692 | Bacteria | 2265 |
| 862 | Ga0373927_0006714 | 3300035695 | Bacteria | 7829 |
| 863 | Ga0373927_0013233 | 3300035695 | Bacteria | 5486 |
| 864 | Ga0373927_0040566 | 3300035695 | Bacteria | 3019 |
| 865 | Ga0373933_0001198 | 3300035724 | Bacteria | 15354 |
| 866 | Ga0373933_0152329 | 3300035724 | Bacteria | 1465 |
| 867 | Ga0373947_0025742 | 3300035725 | Bacteria | 3432 |
| 868 | Ga0373947_0030345 | 3300035725 | Bacteria | 3176 |
| 869 | Ga0373947_0069821 | 3300035725 | Bacteria | 2151 |
| 870 | Ga0373947_0111025 | 3300035725 | Bacteria | 1732 |
| 871 | Ga0373947_0133146 | 3300035725 | Bacteria | 1589 |
| 872 | Ga0373937_0002537 | 3300036401 | Bacteria | 15169 |
| 873 | Ga0373937_0003543 | 3300036401 | Bacteria | 13145 |
| 874 | Ga0373937_0009758 | 3300036401 | Bacteria | 8369 |
| 875 | Ga0373937_0021365 | 3300036401 | Bacteria | 5810 |
| 876 | Ga0373937_0024061 | 3300036401 | Bacteria | 5491 |
| 877 | Ga0373937_0085863 | 3300036401 | Bacteria | 2912 |
| 878 | Ga0373937_0109042 | 3300036401 | Bacteria | 2574 |
| 879 | Ga0373937_0123401 | 3300036401 | Bacteria | 2415 |
| 880 | Ga0373937_0223321 | 3300036401 | Bacteria | 1773 |
| 881 | Ga0373937_0383215 | 3300036401 | Bacteria | 1333 |
| 882 | Ga0316582_0004577 | 3300036647 | Bacteria | 7005 |
| 883 | Ga0316584_0181576 | 3300036712 | Bacteria | 1558 |
| 884 | Ga0373925_0020666 | 3300037068 | Bacteria | 4796 |
| 885 | Ga0373925_0032450 | 3300037068 | Bacteria | 3844 |
| 886 | Ga0373925_0043468 | 3300037068 | Bacteria | 3335 |
| 887 | Ga0373925_0161996 | 3300037068 | Bacteria | 1762 |
| 888 | Ga0395898_0039327 | 3300037466 | Bacteria | 4682 |
| 889 | Ga0395905_0012222 | 3300037471 | Bacteria | 8266 |
| 890 | Ga0395905_0025977 | 3300037471 | Bacteria | 5521 |
| 891 | Ga0316581_0002921 | 3300037588 | Bacteria | 4186 |
| 892 | Ga0242420_011280 | 3300038996 | Bacteria | 1496 |
| 893 | Ga0436365_0038862 | 3300039437 | Bacteria | 3854 |
| 894 | Ga0436360_1141743 | 3300039438 | Bacteria | 1354 |
| 895 | Ga0451793_1931907 | 3300041452 | Bacteria | 2621 |
| 896 | Ga0451797_0881475 | 3300041453 | Bacteria | 2073 |
| 897 | Ga0451800_1606912 | 3300041459 | Bacteria | 1652 |
| 898 | Ga0451802_0448423 | 3300041460 | Bacteria | 2227 |
| 899 | Ga0451802_2186402 | 3300041460 | Bacteria | 3470 |
| 900 | Ga0451807_0803462 | 3300041486 | Bacteria | 5880 |
| 901 | Ga0439441_004433 | 3300042001 | Bacteria | 2128 |
| 902 | Ga0439441_007290 | 3300042001 | Bacteria | 1777 |
| 903 | Ga0439449_0031255 | 3300042007 | Bacteria | 1985 |
| 904 | Ga0439455_0008812 | 3300042012 | Bacteria | 2171 |
| 905 | Ga0450896_016730 | 3300042133 | Bacteria | 1055 |
| 906 | Ga0439446_0011224 | 3300042156 | Bacteria | 2429 |
| 907 | Ga0439435_0012465 | 3300042436 | Bacteria | 2061 |
| 908 | Ga0439435_0018176 | 3300042436 | Bacteria | 1786 |
| 909 | Ga0439444_0000219 | 3300042437 | Bacteria | 5523 |
| 910 | Ga0439460_0000400 | 3300042461 | Bacteria | 9230 |
| 911 | Ga0451577_0028262 | 3300042876 | Bacteria | 5073 |
| 912 | Ga0451577_0029690 | 3300042876 | Bacteria | 4942 |
| 913 | Ga0451577_0065139 | 3300042876 | Bacteria | 3249 |
| 914 | Ga0466966_0098515 | 3300044684 | Bacteria | 1810 |
| 915 | Ga0466961_0099060 | 3300044693 | Bacteria | 1837 |
| 916 | Ga0453684_0098333 | 3300044712 | Bacteria | 3588 |
| 917 | Ga0453684_0114983 | 3300044712 | Bacteria | 3261 |
| 918 | Ga0466971_0022938 | 3300044719 | Bacteria | 2782 |
| 919 | Ga0466959_0020291 | 3300045049 | Bacteria | 4894 |
| 920 | Ga0451576_0000717 | 3300045051 | Bacteria | 66791 |
| 921 | Ga0451576_0081846 | 3300045051 | Bacteria | 3357 |
| 922 | Ga0451576_0129993 | 3300045051 | Bacteria | 2625 |
| 923 | Ga0451576_0135584 | 3300045051 | Bacteria | 2567 |
| 924 | Ga0451576_0268556 | 3300045051 | Bacteria | 1783 |
| 925 | Ga0466967_0076090 | 3300045976 | Bacteria | 3018 |
| 926 | Ga0495592_0005643 | 3300046454 | Bacteria | 9252 |
| 927 | Ga0495592_0015266 | 3300046454 | Bacteria | 5829 |
| 928 | Ga0495629_0017686 | 3300046459 | Bacteria | 5109 |
| 929 | Ga0495651_0054004 | 3300046462 | Bacteria | 3091 |
| 930 | Ga0495653_0029078 | 3300046463 | Bacteria | 4415 |
| 931 | Ga0495653_0183975 | 3300046463 | Bacteria | 1431 |
| 932 | Ga0495650_0017254 | 3300046471 | Bacteria | 3624 |
| 933 | Ga0495580_0028421 | 3300046472 | Bacteria | 4064 |
| 934 | Ga0495580_0032991 | 3300046472 | Bacteria | 3731 |
| 935 | Ga0495582_0017872 | 3300046473 | Bacteria | 3876 |
| 936 | Ga0495582_0119634 | 3300046473 | Bacteria | 1483 |
| 937 | Ga0495639_0005941 | 3300046475 | Bacteria | 5253 |
| 938 | Ga0495662_0064117 | 3300046476 | Bacteria | 1775 |
| 939 | Ga0495662_0074210 | 3300046476 | Bacteria | 1650 |
| 940 | Ga0495607_0042320 | 3300046501 | Bacteria | 2700 |
| 941 | Ga0495606_0111842 | 3300046507 | Bacteria | 1646 |
| 942 | Ga0495608_0005998 | 3300046511 | Bacteria | 8635 |
| 943 | Ga0495608_0024512 | 3300046511 | Bacteria | 4123 |
| 944 | Ga0495610_0092200 | 3300046512 | Bacteria | 1371 |
| 945 | Ga0495616_0076593 | 3300046513 | Bacteria | 1607 |
| 946 | Ga0495618_0004023 | 3300046514 | Bacteria | 9066 |
| 947 | Ga0495628_0012137 | 3300046516 | Bacteria | 7263 |
| 948 | Ga0495628_0020679 | 3300046516 | Bacteria | 5425 |
| 949 | Ga0495630_0048541 | 3300046517 | Bacteria | 3177 |
| 950 | Ga0495632_0015895 | 3300046519 | Bacteria | 4203 |
| 951 | Ga0495632_0046309 | 3300046519 | Bacteria | 2162 |
| 952 | Ga0495643_0023064 | 3300046522 | Bacteria | 3542 |
| 953 | Ga0495666_0076535 | 3300046526 | Bacteria | 1586 |
| 954 | Ga0495642_0020765 | 3300046528 | Bacteria | 2582 |
| 955 | Ga0495652_0015115 | 3300046529 | Bacteria | 6914 |
| 956 | Ga0495652_0164752 | 3300046529 | Bacteria | 1717 |
| 957 | Ga0495640_0150735 | 3300046533 | Bacteria | 1494 |
| 958 | Ga0495586_0001577 | 3300046535 | Bacteria | 12562 |
| 959 | Ga0495586_0044286 | 3300046535 | Bacteria | 2397 |
| 960 | Ga0495586_0123956 | 3300046535 | Bacteria | 1444 |
| 961 | Ga0495598_0014774 | 3300046537 | Bacteria | 1958 |
| 962 | Ga0495598_0044033 | 3300046537 | Bacteria | 1317 |
| 963 | Ga0495621_0009375 | 3300046539 | Bacteria | 2971 |
| 964 | Ga0495645_0077557 | 3300046543 | Bacteria | 2389 |
| 965 | Ga0495667_0037862 | 3300046559 | Bacteria | 3213 |
| 966 | Ga0495634_0031516 | 3300046642 | Bacteria | 3651 |
| 967 | Ga0495625_0013071 | 3300046660 | Bacteria | 6690 |
| 968 | Ga0495635_0003031 | 3300046663 | Bacteria | 11540 |
| 969 | Ga0495659_0007805 | 3300046664 | Bacteria | 3394 |
| 970 | Ga0495657_0038956 | 3300046675 | Bacteria | 3268 |
| 971 | Ga0495599_0000548 | 3300046678 | Bacteria | 21463 |
| 972 | Ga0495623_0025917 | 3300046679 | Bacteria | 3776 |
| 973 | Ga0495646_0063817 | 3300046680 | Bacteria | 2185 |
| 974 | Ga0495647_0000651 | 3300046681 | Bacteria | 10297 |
| 975 | Ga0495647_0044756 | 3300046681 | Bacteria | 1698 |
| 976 | Ga0495658_0013973 | 3300046683 | Bacteria | 4094 |
| 977 | Ga0495658_0019751 | 3300046683 | Bacteria | 3522 |
| 978 | Ga0495658_0041560 | 3300046683 | Bacteria | 2562 |
| 979 | Ga0495658_0119361 | 3300046683 | Bacteria | 1593 |
| 980 | Ga0495658_0149212 | 3300046683 | Bacteria | 1435 |
| 981 | Ga0495613_0011703 | 3300046689 | Bacteria | 6521 |
| 982 | Ga0495613_0023120 | 3300046689 | Bacteria | 4633 |
| 983 | Ga0495624_0028753 | 3300046690 | Bacteria | 3630 |
| 984 | Ga0495624_0031322 | 3300046690 | Bacteria | 3459 |
| 985 | Ga0495600_0000693 | 3300046809 | Bacteria | 17639 |
| 986 | Ga0495600_0034611 | 3300046809 | Bacteria | 3280 |
| 987 | Ga0495600_0148896 | 3300046809 | Bacteria | 1516 |
| 988 | Ga0495581_0002924 | 3300047315 | Bacteria | 9771 |
| 989 | Ga0495604_0033075 | 3300047317 | Bacteria | 4095 |
| 990 | Ga0495604_0039016 | 3300047317 | Bacteria | 3734 |
| 991 | Ga0495676_0053864 | 3300047321 | Bacteria | 3202 |
| 992 | Ga0495676_0197936 | 3300047321 | Bacteria | 1397 |
| 993 | Ga0495680_0001182 | 3300047322 | Bacteria | 28660 |
| 994 | Ga0495684_0004189 | 3300047471 | Bacteria | 11264 |
| 995 | Ga0495686_0019436 | 3300047472 | Bacteria | 4537 |
| 996 | Ga0495593_0052353 | 3300047673 | Bacteria | 2158 |
| 997 | Ga0495602_0054880 | 3300048088 | Bacteria | 3514 |
| 998 | Ga0495602_0067075 | 3300048088 | Bacteria | 3088 |
| 999 | Ga0496100_0081464 | 3300048903 | Bacteria | 2187 |
| 1000 | Ga0496101_0083959 | 3300048904 | Bacteria | 2358 |
| 1001 | Ga0496102_0015518 | 3300048905 | Bacteria | 6635 |
| 1002 | Ga0496102_0063871 | 3300048905 | Bacteria | 3372 |
| 1003 | Ga0496102_0092383 | 3300048905 | Bacteria | 2802 |
| 1004 | Ga0496103_0060462 | 3300048906 | Bacteria | 2355 |
| 1005 | Ga0496103_0116332 | 3300048906 | Bacteria | 1701 |
| 1006 | Ga0496104_0000979 | 3300048907 | Bacteria | 24446 |
| 1007 | Ga0496105_0004778 | 3300048908 | Bacteria | 10227 |
| 1008 | Ga0496106_0003978 | 3300048909 | Bacteria | 11045 |
| 1009 | Ga0496106_0262316 | 3300048909 | Bacteria | 1382 |
| 1010 | Ga0496108_0024755 | 3300048911 | Bacteria | 4944 |
| 1011 | Ga0496108_0100478 | 3300048911 | Bacteria | 2467 |
| 1012 | Ga0496108_0196137 | 3300048911 | Bacteria | 1751 |
| 1013 | Ga0496109_0002675 | 3300048912 | Bacteria | 14963 |
| 1014 | Ga0496109_0131220 | 3300048912 | Bacteria | 2339 |
| 1015 | Ga0496109_0143497 | 3300048912 | Bacteria | 2233 |
| 1016 | Ga0496110_0031132 | 3300048913 | Bacteria | 4602 |
| 1017 | Ga0496110_0175682 | 3300048913 | Bacteria | 1944 |
| 1018 | Ga0496112_0002483 | 3300048915 | Bacteria | 14882 |
| 1019 | Ga0496113_0031390 | 3300048916 | Bacteria | 3856 |
| 1020 | Ga0496114_0079674 | 3300048917 | Bacteria | 2765 |
| 1021 | Ga0496114_0096028 | 3300048917 | Bacteria | 2523 |
| 1022 | Ga0496114_0155721 | 3300048917 | Bacteria | 1984 |
| 1023 | Ga0496115_0007123 | 3300048918 | Bacteria | 8212 |
| 1024 | Ga0496115_0016973 | 3300048918 | Bacteria | 5553 |
| 1025 | Ga0496124_0079466 | 3300048927 | Bacteria | 2701 |
| 1026 | Ga0501032_0159011 | 3300049569 | Bacteria | 1484 |
| 1027 | Ga0501033_0009551 | 3300049570 | Bacteria | 7465 |
| 1028 | Ga0501033_0066034 | 3300049570 | Bacteria | 2661 |
| 1029 | Ga0501036_0003867 | 3300049572 | Bacteria | 12013 |
| 1030 | Ga0501038_0012500 | 3300049574 | Bacteria | 7757 |
| 1031 | Ga0501039_0003349 | 3300049575 | Bacteria | 11973 |
| 1032 | Ga0501040_0000593 | 3300049576 | Bacteria | 22098 |
| 1033 | Ga0501040_0058683 | 3300049576 | Bacteria | 2643 |
| 1034 | Ga0501041_0000034 | 3300049577 | Bacteria | 44700 |
| 1035 | Ga0501041_0017326 | 3300049577 | Bacteria | 4287 |
| 1036 | Ga0501041_0063723 | 3300049577 | Bacteria | 2257 |
| 1037 | Ga0501042_0001135 | 3300049578 | Bacteria | 15356 |
| 1038 | Ga0501042_0150441 | 3300049578 | Bacteria | 1678 |
| 1039 | Ga0501043_0000023 | 3300049579 | Bacteria | 154331 |
| 1040 | Ga0501046_0000018 | 3300049580 | Bacteria | 220589 |
| 1041 | Ga0501046_0007125 | 3300049580 | Bacteria | 9835 |
| 1042 | Ga0501046_0022216 | 3300049580 | Bacteria | 5228 |
| 1043 | Ga0501046_0049469 | 3300049580 | Bacteria | 3325 |
| 1044 | Ga0501047_0000020 | 3300049581 | Bacteria | 259377 |
| 1045 | Ga0501048_0002498 | 3300049582 | Bacteria | 14043 |
| 1046 | Ga0501048_0006069 | 3300049582 | Bacteria | 9201 |
| 1047 | Ga0501067_0072118 | 3300049583 | Bacteria | 1913 |
| 1048 | Ga0501067_0135554 | 3300049583 | Bacteria | 1371 |
| 1049 | Ga0501068_0033554 | 3300049584 | Bacteria | 3057 |
| 1050 | Ga0501068_0174237 | 3300049584 | Bacteria | 1359 |
| 1051 | Ga0501071_0058042 | 3300049587 | Bacteria | 2797 |
| 1052 | Ga0501071_0068028 | 3300049587 | Bacteria | 2591 |
| 1053 | Ga0501072_0006856 | 3300049588 | Bacteria | 8645 |
| 1054 | Ga0501072_0053645 | 3300049588 | Bacteria | 3175 |
| 1055 | Ga0501072_0073752 | 3300049588 | Bacteria | 2698 |
| 1056 | Ga0501073_0039581 | 3300049589 | Bacteria | 3339 |
| 1057 | Ga0501076_0001930 | 3300049592 | Bacteria | 14154 |
| 1058 | Ga0501076_0002817 | 3300049592 | Bacteria | 12027 |
| 1059 | Ga0501079_0001432 | 3300049741 | Bacteria | 16839 |
| 1060 | Ga0501079_0047140 | 3300049741 | Bacteria | 3325 |
| 1061 | Ga0501079_0059998 | 3300049741 | Bacteria | 2934 |
| 1062 | Ga0501080_0066030 | 3300049742 | Bacteria | 3365 |
| 1063 | Ga0501080_0105488 | 3300049742 | Bacteria | 2613 |
| 1064 | Ga0501080_0256342 | 3300049742 | Bacteria | 1594 |
| 1065 | Ga0501081_0004050 | 3300049743 | Bacteria | 9386 |
| 1066 | Ga0501081_0005463 | 3300049743 | Bacteria | 8204 |
| 1067 | Ga0501081_0007324 | 3300049743 | Bacteria | 7164 |
| 1068 | Ga0501081_0055997 | 3300049743 | Bacteria | 2724 |
| 1069 | Ga0501045_0004925 | 3300049824 | Bacteria | 9247 |
| 1070 | Ga0501045_0016490 | 3300049824 | Bacteria | 5249 |
| 1071 | nmdc:mga03683_23735_c1 | 3300050489 | Bacteria | 2393 |
| 1072 | nmdc:mga03683_28632_c1 | 3300050489 | Bacteria | 2217 |
| 1073 | nmdc:mga0k408_22347_c2 | 3300050493 | Bacteria | 2462 |
| 1074 | nmdc:mga0k408_26433_c1 | 3300050493 | Bacteria | 3291 |
| 1075 | nmdc:mga0k408_3661_c1 | 3300050493 | Bacteria | 6079 |
| 1076 | nmdc:mga0k408_3911_c1 | 3300050493 | Bacteria | 2488 |
| 1077 | nmdc:mga0k408_43371_c1 | 3300050493 | Bacteria | 2592 |
| 1078 | nmdc:mga0k408_49895_c1 | 3300050493 | Bacteria | 2423 |
| 1079 | nmdc:mga0k408_8306_c1 | 3300050493 | Bacteria | 5570 |
| 1080 | nmdc:mga06z11_28394_c1 | 3300050494 | Bacteria | 2684 |
| 1081 | nmdc:mga06z11_59157_c1 | 3300050494 | Bacteria | 1991 |
| 1082 | nmdc:mga04h51_19898_c1 | 3300050495 | Bacteria | 1997 |
| 1083 | nmdc:mga07m45_40105_c1 | 3300050496 | Bacteria | 2620 |
| 1084 | nmdc:mga07m45_95219_c1 | 3300050496 | Bacteria | 1708 |
| 1085 | nmdc:mga05p37_250307_c1 | 3300050507 | Bacteria | 2125 |
| 1086 | nmdc:mga05p37_349_c1 | 3300050507 | Bacteria | 49419 |
| 1087 | nmdc:mga05p37_46938_c1 | 3300050507 | Bacteria | 5311 |
| 1088 | nmdc:mga05p37_5467_c1 | 3300050507 | Bacteria | 14916 |
| 1089 | nmdc:mga09592_12140_c1 | 3300050508 | Bacteria | 7011 |
| 1090 | nmdc:mga09592_27185_c1 | 3300050508 | Bacteria | 4748 |
| 1091 | nmdc:mga09592_301692_c1 | 3300050508 | Bacteria | 1389 |
| 1092 | nmdc:mga09592_3199_c1 | 3300050508 | Bacteria | 13275 |
| 1093 | nmdc:mga09592_43660_c1 | 3300050508 | Bacteria | 3771 |
| 1094 | nmdc:mga09592_525_c1 | 3300050508 | Bacteria | 28937 |
| 1095 | nmdc:mga0qj67_33113_c1 | 3300050509 | Bacteria | 3250 |
| 1096 | nmdc:mga0qj67_570_c1 | 3300050509 | Bacteria | 25144 |
| 1097 | nmdc:mga06r32_104794_c1 | 3300050510 | Bacteria | 2778 |
| 1098 | nmdc:mga06r32_20725_c1 | 3300050510 | Bacteria | 6055 |
| 1099 | nmdc:mga06r32_238785_c1 | 3300050510 | Bacteria | 1805 |
| 1100 | nmdc:mga06r32_345428_c1 | 3300050510 | Bacteria | 1472 |
| 1101 | nmdc:mga06r32_349297_c1 | 3300050510 | Bacteria | 1464 |
| 1102 | nmdc:mga06r32_52852_c1 | 3300050510 | Bacteria | 3892 |
| 1103 | nmdc:mga06r32_84807_c1 | 3300050510 | Bacteria | 3088 |
| 1104 | nmdc:mga08y16_37237_c1 | 3300050511 | Bacteria | 5110 |
| 1105 | nmdc:mga08y16_75316_c1 | 3300050511 | Bacteria | 3518 |
| 1106 | nmdc:mga08y16_86836_c1 | 3300050511 | Bacteria | 3260 |
| 1107 | nmdc:mga0n895_1603_c1 | 3300050512 | Bacteria | 17025 |
| 1108 | nmdc:mga0n895_173933_c1 | 3300050512 | Bacteria | 2185 |
| 1109 | nmdc:mga0n895_267816_c1 | 3300050512 | Bacteria | 1733 |
| 1110 | nmdc:mga0n895_33184_c1 | 3300050512 | Bacteria | 4960 |
| 1111 | nmdc:mga0rr50_210015_c1 | 3300050513 | Bacteria | 1603 |
| 1112 | nmdc:mga0rr50_237379_c1 | 3300050513 | Bacteria | 1510 |
| 1113 | nmdc:mga0rr50_387018_c1 | 3300050513 | Bacteria | 1180 |
| 1114 | nmdc:mga0rr50_62033_c1 | 3300050513 | Bacteria | 2818 |
| 1115 | nmdc:mga0rr50_626_c1 | 3300050513 | Bacteria | 18966 |
| 1116 | nmdc:mga08x19_117640_c1 | 3300050514 | Bacteria | 1778 |
| 1117 | nmdc:mga08x19_32882_c1 | 3300050514 | Bacteria | 3271 |
| 1118 | nmdc:mga08x19_351_c1 | 3300050514 | Bacteria | 33305 |
| 1119 | nmdc:mga0a205_75_c1 | 3300050515 | Bacteria | 54682 |
| 1120 | nmdc:mga0a205_99575_c1 | 3300050515 | Bacteria | 2805 |
| 1121 | Ga0495601_0039865 | 3300053077 | Bacteria | 2941 |
| 1122 | Ga0495601_0064175 | 3300053077 | Bacteria | 2335 |
| 1123 | Ga0495595_0087452 | 3300053084 | Bacteria | 1492 |
| 1124 | Ga0495619_0003146 | 3300053085 | Bacteria | 10704 |
| 1125 | Ga0495619_0065552 | 3300053085 | Bacteria | 2423 |
| 1126 | Ga0500578_0000787 | 3300053086 | Bacteria | 37120 |
| 1127 | Ga0500578_0052977 | 3300053086 | Bacteria | 2598 |
| 1128 | Ga0500644_0001485 | 3300053088 | Bacteria | 6173 |
| 1129 | Ga0500651_0033977 | 3300053093 | Bacteria | 3215 |
| 1130 | Ga0500651_0036431 | 3300053093 | Bacteria | 3099 |
| 1131 | Ga0500628_009946 | 3300053129 | Bacteria | 1689 |
| 1132 | Ga0500642_0022297 | 3300053130 | Bacteria | 2524 |
| 1133 | Ga0500642_0051534 | 3300053130 | Bacteria | 1819 |
| 1134 | Ga0500652_001423 | 3300053131 | Bacteria | 7424 |
| 1135 | Ga0500655_004063 | 3300053133 | Bacteria | 2637 |
| 1136 | Ga0500574_005427 | 3300053141 | Bacteria | 2482 |
| 1137 | Ga0500622_0000160 | 3300053156 | Bacteria | 70774 |
| 1138 | Ga0500634_0000600 | 3300053161 | Bacteria | 12029 |
| 1139 | Ga0500645_002594 | 3300053730 | Bacteria | 7944 |
| 1140 | Ga0501084_0015576 | 3300054114 | Bacteria | 6306 |
| 1141 | Ga0501084_0033682 | 3300054114 | Bacteria | 4285 |
| 1142 | Ga0501084_0042749 | 3300054114 | Bacteria | 3791 |
| 1143 | Ga0501082_0025146 | 3300060353 | Bacteria | 5130 |
| 1144 | Ga0466962_0014620 | 3300061719 | Bacteria | 3783 |
| 1145 | Ga0530510_0005240 | 3300061734 | Bacteria | 8952 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026089 | Ga0207648_10089702 | Ga0207648_100897023 | 326 |
| 2 | 3300042133 | Ga0450896_016730 | Ga0450896_016730_20_1027 | 334 |
| 3 | 3300049741 | Ga0501079_0047140 | Ga0501079_0047140_2284_3315 | 337 |
| 4 | 3300046519 | Ga0495632_0015895 | Ga0495632_0015895_1185_2336 | 344 |
| 5 | 3300005843 | Ga0068860_100085339 | Ga0068860_1000853391 | 349 |
| 6 | 3300005343 | Ga0070687_100042308 | Ga0070687_1000423081 | 350 |
| 7 | 3300005543 | Ga0070672_100010686 | Ga0070672_1000106869 | 350 |
| 8 | 3300005617 | Ga0068859_100126563 | Ga0068859_1001265632 | 350 |
| 9 | 3300005842 | Ga0068858_100091245 | Ga0068858_1000912452 | 350 |
| 10 | 3300006931 | Ga0097620_100126567 | Ga0097620_1001265672 | 350 |
| 11 | 3300013308 | Ga0157375_10031297 | Ga0157375_100312975 | 350 |
| 12 | 3300025918 | Ga0207662_10049947 | Ga0207662_100499472 | 350 |
| 13 | 3300025940 | Ga0207691_10042701 | Ga0207691_100427013 | 350 |
| 14 | 3300050513 | nmdc:mga0rr50_387018_c1 | nmdc:mga0rr50_387018_c1_20_1165 | 351 |
| 15 | 3300005518 | Ga0070699_100013502 | Ga0070699_1000135024 | 353 |
| 16 | 3300006914 | Ga0075436_100001274 | Ga0075436_10000127412 | 353 |
| 17 | 3300050493 | nmdc:mga0k408_26433_c1 | nmdc:mga0k408_26433_c1_2099_3265 | 353 |
| 18 | 3300050514 | nmdc:mga08x19_351_c1 | nmdc:mga08x19_351_c1_3845_4909 | 353 |
| 19 | 3300006048 | Ga0075363_100007751 | Ga0075363_1000077514 | 354 |
| 20 | 3300006353 | Ga0075370_10038289 | Ga0075370_100382892 | 354 |
| 21 | 3300050496 | nmdc:mga07m45_40105_c1 | nmdc:mga07m45_40105_c1_647_1813 | 354 |
| 22 | 3300053093 | Ga0500651_0036431 | Ga0500651_0036431_1281_2447 | 354 |
| 23 | 3300053129 | Ga0500628_009946 | Ga0500628_009946_446_1612 | 354 |
| 24 | 3300053130 | Ga0500642_0022297 | Ga0500642_0022297_108_1274 | 354 |
| 25 | 3300053131 | Ga0500652_001423 | Ga0500652_001423_1146_2312 | 354 |
| 26 | 3300053133 | Ga0500655_004063 | Ga0500655_004063_522_1688 | 354 |
| 27 | 3300053156 | Ga0500622_0000160 | Ga0500622_0000160_41117_42283 | 354 |
| 28 | 3300006871 | Ga0075434_100064943 | Ga0075434_1000649432 | 355 |
| 29 | 3300050493 | nmdc:mga0k408_49895_c1 | nmdc:mga0k408_49895_c1_1307_2398 | 357 |
| 30 | 3300031911 | Ga0307412_10130941 | Ga0307412_101309412 | 358 |
| 31 | iso_pu_bacteria | 2511231002 | 2511243448 | 359 |
| 32 | 3300027364 | Ga0209967_1003126 | Ga0209967_10031262 | 360 |
| 33 | 3300048906 | Ga0496103_0116332 | Ga0496103_0116332_587_1681 | 360 |
| 34 | 3300006844 | Ga0075428_100189894 | Ga0075428_1001898944 | 363 |
| 35 | 3300026041 | Ga0207639_10132300 | Ga0207639_101323002 | 365 |
| 36 | 3300025942 | Ga0207689_10009095 | Ga0207689_100090957 | 367 |
| 37 | 3300009094 | Ga0111539_10260075 | Ga0111539_102600752 | 368 |
| 38 | 3300028380 | Ga0268265_10063972 | Ga0268265_100639723 | 368 |
| 39 | 3300050512 | nmdc:mga0n895_33184_c1 | nmdc:mga0n895_33184_c1_3132_4301 | 368 |
| 40 | 3300035724 | Ga0373933_0152329 | Ga0373933_0152329_53_1318 | 369 |
| 41 | 3300036401 | Ga0373937_0223321 | Ga0373937_0223321_419_1684 | 369 |
| 42 | 3300025925 | Ga0207650_10012849 | Ga0207650_100128493 | 371 |
| 43 | iso_pu_bacteria | 2919704043 | 2919709061 | 371 |
| 44 | iso_pu_bacteria | 2547132374 | 2548500147 | 372 |
| 45 | iso_pu_bacteria | 2643221570 | 2643864816 | 372 |
| 46 | iso_pu_bacteria | 2643221596 | 2643991179 | 372 |
| 47 | iso_pu_bacteria | 2643221652 | 2644293949 | 372 |
| 48 | iso_pu_bacteria | 2643221717 | 2644644534 | 372 |
| 49 | iso_pu_bacteria | 2990710928 | 2990711738 | 372 |
| 50 | 3300005440 | Ga0070705_100001310 | Ga0070705_1000013104 | 373 |
| 51 | 3300005467 | Ga0070706_100074494 | Ga0070706_1000744943 | 373 |
| 52 | 3300005518 | Ga0070699_100025470 | Ga0070699_1000254704 | 373 |
| 53 | 3300005536 | Ga0070697_100009128 | Ga0070697_1000091285 | 373 |
| 54 | 3300005546 | Ga0070696_100002814 | Ga0070696_10000281411 | 373 |
| 55 | 3300007076 | Ga0075435_100035111 | Ga0075435_1000351113 | 373 |
| 56 | 3300015265 | Ga0182005_1015578 | Ga0182005_10155782 | 373 |
| 57 | 3300025910 | Ga0207684_10037641 | Ga0207684_100376413 | 373 |
| 58 | 3300050513 | nmdc:mga0rr50_62033_c1 | nmdc:mga0rr50_62033_c1_104_1228 | 373 |
| 59 | iso_pu_bacteria | 2585428057 | 2587730410 | 373 |
| 60 | iso_pu_bacteria | 2585428058 | 2587733172 | 373 |
| 61 | iso_pu_bacteria | 2585428062 | 2587755901 | 373 |
| 62 | iso_pu_bacteria | 2588253510 | 2588294407 | 373 |
| 63 | iso_pu_bacteria | 2643221592 | 2643968972 | 373 |
| 64 | iso_pu_bacteria | 2643221625 | 2644144103 | 373 |
| 65 | iso_pu_bacteria | 2643221648 | 2644273223 | 373 |
| 66 | iso_pu_bacteria | 2643221654 | 2644304343 | 373 |
| 67 | 3300005614 | Ga0068856_100113954 | Ga0068856_1001139543 | 374 |
| 68 | 3300006880 | Ga0075429_100001431 | Ga0075429_1000014315 | 374 |
| 69 | 3300006880 | Ga0075429_100037279 | Ga0075429_1000372792 | 374 |
| 70 | 3300050508 | nmdc:mga09592_12140_c1 | nmdc:mga09592_12140_c1_3102_4244 | 374 |
| 71 | iso_pu_bacteria | 2643221660 | 2644340142 | 374 |
| 72 | 3300003316 | rootH1_10013105 | rootH1_100131052 | 375 |
| 73 | 3300005457 | Ga0070662_100010407 | Ga0070662_1000104078 | 375 |
| 74 | 3300005467 | Ga0070706_100000822 | Ga0070706_10000082225 | 375 |
| 75 | 3300005468 | Ga0070707_100030193 | Ga0070707_1000301934 | 375 |
| 76 | 3300005518 | Ga0070699_100265700 | Ga0070699_1002657001 | 375 |
| 77 | 3300005614 | Ga0068856_100114569 | Ga0068856_1001145692 | 375 |
| 78 | 3300005616 | Ga0068852_100127398 | Ga0068852_1001273982 | 375 |
| 79 | 3300006048 | Ga0075363_100005285 | Ga0075363_1000052853 | 375 |
| 80 | 3300006177 | Ga0075362_10060715 | Ga0075362_100607152 | 375 |
| 81 | 3300006353 | Ga0075370_10013121 | Ga0075370_100131212 | 375 |
| 82 | 3300009098 | Ga0105245_10000059 | Ga0105245_1000005988 | 375 |
| 83 | 3300009147 | Ga0114129_10282859 | Ga0114129_102828592 | 375 |
| 84 | 3300009545 | Ga0105237_10179641 | Ga0105237_101796412 | 375 |
| 85 | 3300010375 | Ga0105239_10363776 | Ga0105239_103637762 | 375 |
| 86 | 3300014969 | Ga0157376_10023935 | Ga0157376_100239352 | 375 |
| 87 | 3300025910 | Ga0207684_10002827 | Ga0207684_1000282713 | 375 |
| 88 | 3300025914 | Ga0207671_10161946 | Ga0207671_101619462 | 375 |
| 89 | 3300025921 | Ga0207652_10056935 | Ga0207652_100569352 | 375 |
| 90 | 3300025927 | Ga0207687_10000697 | Ga0207687_100006979 | 375 |
| 91 | 3300025933 | Ga0207706_10018245 | Ga0207706_100182455 | 375 |
| 92 | 3300026116 | Ga0207674_10092585 | Ga0207674_100925852 | 375 |
| 93 | 3300026142 | Ga0207698_10058537 | Ga0207698_100585373 | 375 |
| 94 | 3300028786 | Ga0307517_10095981 | Ga0307517_100959812 | 375 |
| 95 | 3300031616 | Ga0307508_10143264 | Ga0307508_101432642 | 375 |
| 96 | 3300031730 | Ga0307516_10000234 | Ga0307516_1000023412 | 375 |
| 97 | 3300035115 | Ga0373941_0006274 | Ga0373941_0006274_957_2087 | 375 |
| 98 | 3300035241 | Ga0373961_0014827 | Ga0373961_0014827_784_1914 | 375 |
| 99 | 3300035691 | Ga0373931_0076900 | Ga0373931_0076900_225_1355 | 375 |
| 100 | 3300039438 | Ga0436360_1141743 | Ga0436360_1141743_25_1179 | 375 |
| 101 | 3300042436 | Ga0439435_0018176 | Ga0439435_0018176_627_1757 | 375 |
| 102 | 3300042876 | Ga0451577_0065139 | Ga0451577_0065139_1690_2841 | 375 |
| 103 | 3300045051 | Ga0451576_0081846 | Ga0451576_0081846_365_1516 | 375 |
| 104 | 3300046517 | Ga0495630_0048541 | Ga0495630_0048541_1897_3042 | 375 |
| 105 | 3300046690 | Ga0495624_0028753 | Ga0495624_0028753_121_1266 | 375 |
| 106 | 3300047321 | Ga0495676_0053864 | Ga0495676_0053864_878_2023 | 375 |
| 107 | 3300049583 | Ga0501067_0072118 | Ga0501067_0072118_411_1541 | 375 |
| 108 | 3300050489 | nmdc:mga03683_23735_c1 | nmdc:mga03683_23735_c1_20_1165 | 375 |
| 109 | 3300050493 | nmdc:mga0k408_43371_c1 | nmdc:mga0k408_43371_c1_898_2043 | 375 |
| 110 | 3300050494 | nmdc:mga06z11_28394_c1 | nmdc:mga06z11_28394_c1_1369_2514 | 375 |
| 111 | 3300050513 | nmdc:mga0rr50_237379_c1 | nmdc:mga0rr50_237379_c1_235_1386 | 375 |
| 112 | 3300053088 | Ga0500644_0001485 | Ga0500644_0001485_4310_5497 | 375 |
| 113 | 3300053093 | Ga0500651_0033977 | Ga0500651_0033977_1716_2897 | 375 |
| 114 | iso_pu_bacteria | 2842780639 | 2842783640 | 375 |
| 115 | 3300005327 | Ga0070658_10056454 | Ga0070658_100564542 | 376 |
| 116 | 3300005328 | Ga0070676_10018292 | Ga0070676_100182923 | 376 |
| 117 | 3300005331 | Ga0070670_100001125 | Ga0070670_1000011256 | 376 |
| 118 | 3300005331 | Ga0070670_100078249 | Ga0070670_1000782492 | 376 |
| 119 | 3300005338 | Ga0068868_100025309 | Ga0068868_1000253096 | 376 |
| 120 | 3300005338 | Ga0068868_100091318 | Ga0068868_1000913183 | 376 |
| 121 | 3300005354 | Ga0070675_100046964 | Ga0070675_1000469643 | 376 |
| 122 | 3300005355 | Ga0070671_100232088 | Ga0070671_1002320881 | 376 |
| 123 | 3300005364 | Ga0070673_100012409 | Ga0070673_1000124093 | 376 |
| 124 | 3300005364 | Ga0070673_100020860 | Ga0070673_1000208605 | 376 |
| 125 | 3300005367 | Ga0070667_100035009 | Ga0070667_1000350093 | 376 |
| 126 | 3300005459 | Ga0068867_100008539 | Ga0068867_1000085392 | 376 |
| 127 | 3300005459 | Ga0068867_100015261 | Ga0068867_1000152614 | 376 |
| 128 | 3300005459 | Ga0068867_100051046 | Ga0068867_1000510463 | 376 |
| 129 | 3300005543 | Ga0070672_100000244 | Ga0070672_10000024422 | 376 |
| 130 | 3300005616 | Ga0068852_100153298 | Ga0068852_1001532981 | 376 |
| 131 | 3300005618 | Ga0068864_100051344 | Ga0068864_1000513444 | 376 |
| 132 | 3300005840 | Ga0068870_10100589 | Ga0068870_101005892 | 376 |
| 133 | 3300006237 | Ga0097621_100043902 | Ga0097621_1000439023 | 376 |
| 134 | 3300006237 | Ga0097621_100147315 | Ga0097621_1001473152 | 376 |
| 135 | 3300006881 | Ga0068865_100070772 | Ga0068865_1000707723 | 376 |
| 136 | 3300014969 | Ga0157376_10061744 | Ga0157376_100617442 | 376 |
| 137 | 3300014969 | Ga0157376_10284193 | Ga0157376_102841931 | 376 |
| 138 | 3300025315 | Ga0207697_10014910 | Ga0207697_100149103 | 376 |
| 139 | 3300025893 | Ga0207682_10014581 | Ga0207682_100145814 | 376 |
| 140 | 3300025907 | Ga0207645_10011960 | Ga0207645_100119603 | 376 |
| 141 | 3300025909 | Ga0207705_10035487 | Ga0207705_100354873 | 376 |
| 142 | 3300025925 | Ga0207650_10001071 | Ga0207650_1000107117 | 376 |
| 143 | 3300025925 | Ga0207650_10034045 | Ga0207650_100340453 | 376 |
| 144 | 3300025931 | Ga0207644_10119555 | Ga0207644_101195551 | 376 |
| 145 | 3300025937 | Ga0207669_10002735 | Ga0207669_100027353 | 376 |
| 146 | 3300025940 | Ga0207691_10005312 | Ga0207691_100053123 | 376 |
| 147 | 3300025940 | Ga0207691_10027913 | Ga0207691_100279133 | 376 |
| 148 | 3300025960 | Ga0207651_10012862 | Ga0207651_100128625 | 376 |
| 149 | 3300025960 | Ga0207651_10046202 | Ga0207651_100462023 | 376 |
| 150 | 3300026023 | Ga0207677_10241849 | Ga0207677_102418491 | 376 |
| 151 | 3300026089 | Ga0207648_10011303 | Ga0207648_100113038 | 376 |
| 152 | 3300026089 | Ga0207648_10035654 | Ga0207648_100356543 | 376 |
| 153 | 3300026095 | Ga0207676_10042101 | Ga0207676_100421014 | 376 |
| 154 | 3300026121 | Ga0207683_10003588 | Ga0207683_100035883 | 376 |
| 155 | 3300026121 | Ga0207683_10186229 | Ga0207683_101862292 | 376 |
| 156 | 3300027614 | Ga0209970_1002455 | Ga0209970_10024552 | 376 |
| 157 | 3300027682 | Ga0209971_1001379 | Ga0209971_10013794 | 376 |
| 158 | 3300031548 | Ga0307408_100008287 | Ga0307408_1000082873 | 376 |
| 159 | 3300031548 | Ga0307408_100049977 | Ga0307408_1000499772 | 376 |
| 160 | 3300031731 | Ga0307405_10083394 | Ga0307405_100833943 | 376 |
| 161 | 3300031852 | Ga0307410_10009445 | Ga0307410_100094454 | 376 |
| 162 | 3300031911 | Ga0307412_10043148 | Ga0307412_100431482 | 376 |
| 163 | 3300031995 | Ga0307409_100024728 | Ga0307409_1000247286 | 376 |
| 164 | 3300032005 | Ga0307411_10006711 | Ga0307411_100067112 | 376 |
| 165 | 3300032126 | Ga0307415_100027857 | Ga0307415_1000278573 | 376 |
| 166 | 3300036401 | Ga0373937_0021365 | Ga0373937_0021365_3803_4951 | 376 |
| 167 | 3300044712 | Ga0453684_0098333 | Ga0453684_0098333_343_1491 | 376 |
| 168 | 3300046471 | Ga0495650_0017254 | Ga0495650_0017254_1685_2833 | 376 |
| 169 | 3300048917 | Ga0496114_0096028 | Ga0496114_0096028_442_1644 | 376 |
| 170 | 3300048927 | Ga0496124_0079466 | Ga0496124_0079466_821_1969 | 376 |
| 171 | 3300050510 | nmdc:mga06r32_345428_c1 | nmdc:mga06r32_345428_c1_317_1450 | 376 |
| 172 | 3300053077 | Ga0495601_0064175 | Ga0495601_0064175_305_1453 | 376 |
| 173 | 3300002773 | JGI25152J39213_1002683 | JGI25152J39213_10026836 | 377 |
| 174 | 3300003215 | JGI25153J46596_10001361 | JGI25153J46596_1000136113 | 377 |
| 175 | 3300003215 | JGI25153J46596_10004264 | JGI25153J46596_100042647 | 377 |
| 176 | 3300003791 | Ga0055530_10011040 | Ga0055530_100110403 | 377 |
| 177 | 3300005262 | Ga0065165_1004235 | Ga0065165_100423510 | 377 |
| 178 | 3300005328 | Ga0070676_10004320 | Ga0070676_100043203 | 377 |
| 179 | 3300005328 | Ga0070676_10058707 | Ga0070676_100587073 | 377 |
| 180 | 3300005331 | Ga0070670_100046145 | Ga0070670_1000461451 | 377 |
| 181 | 3300005331 | Ga0070670_100143993 | Ga0070670_1001439931 | 377 |
| 182 | 3300005334 | Ga0068869_100113146 | Ga0068869_1001131461 | 377 |
| 183 | 3300005338 | Ga0068868_100195958 | Ga0068868_1001959582 | 377 |
| 184 | 3300005344 | Ga0070661_100184145 | Ga0070661_1001841451 | 377 |
| 185 | 3300005354 | Ga0070675_100012058 | Ga0070675_1000120582 | 377 |
| 186 | 3300005354 | Ga0070675_100258834 | Ga0070675_1002588342 | 377 |
| 187 | 3300005355 | Ga0070671_100202976 | Ga0070671_1002029762 | 377 |
| 188 | 3300005364 | Ga0070673_100056935 | Ga0070673_1000569353 | 377 |
| 189 | 3300005364 | Ga0070673_100135633 | Ga0070673_1001356332 | 377 |
| 190 | 3300005434 | Ga0070709_10197228 | Ga0070709_101972282 | 377 |
| 191 | 3300005437 | Ga0070710_10052356 | Ga0070710_100523562 | 377 |
| 192 | 3300005455 | Ga0070663_100000131 | Ga0070663_10000013132 | 377 |
| 193 | 3300005456 | Ga0070678_100122600 | Ga0070678_1001226002 | 377 |
| 194 | 3300005459 | Ga0068867_100000085 | Ga0068867_1000000853 | 377 |
| 195 | 3300005459 | Ga0068867_100004350 | Ga0068867_10000435010 | 377 |
| 196 | 3300005459 | Ga0068867_100034695 | Ga0068867_1000346951 | 377 |
| 197 | 3300005530 | Ga0070679_100084435 | Ga0070679_1000844352 | 377 |
| 198 | 3300005543 | Ga0070672_100145914 | Ga0070672_1001459142 | 377 |
| 199 | 3300005543 | Ga0070672_100167749 | Ga0070672_1001677491 | 377 |
| 200 | 3300005546 | Ga0070696_100012065 | Ga0070696_1000120652 | 377 |
| 201 | 3300005548 | Ga0070665_100209694 | Ga0070665_1002096941 | 377 |
| 202 | 3300005577 | Ga0068857_100082907 | Ga0068857_1000829072 | 377 |
| 203 | 3300005578 | Ga0068854_100316135 | Ga0068854_1003161351 | 377 |
| 204 | 3300005616 | Ga0068852_100069540 | Ga0068852_1000695401 | 377 |
| 205 | 3300006195 | Ga0075366_10025704 | Ga0075366_100257043 | 377 |
| 206 | 3300009093 | Ga0105240_10017700 | Ga0105240_100177001 | 377 |
| 207 | 3300009148 | Ga0105243_10009228 | Ga0105243_100092285 | 377 |
| 208 | 3300009545 | Ga0105237_10000548 | Ga0105237_1000054830 | 377 |
| 209 | 3300010375 | Ga0105239_10001569 | Ga0105239_1000156913 | 377 |
| 210 | 3300013308 | Ga0157375_10254724 | Ga0157375_102547242 | 377 |
| 211 | 3300013308 | Ga0157375_10319675 | Ga0157375_103196752 | 377 |
| 212 | 3300014326 | Ga0157380_10200133 | Ga0157380_102001332 | 377 |
| 213 | 3300014745 | Ga0157377_10000028 | Ga0157377_1000002860 | 377 |
| 214 | 3300025245 | Ga0207425_1002124 | Ga0207425_10021247 | 377 |
| 215 | 3300025258 | Ga0209129_1000369 | Ga0209129_100036921 | 377 |
| 216 | 3300025295 | Ga0209564_1000046 | Ga0209564_1000046118 | 377 |
| 217 | 3300025297 | Ga0209758_1000369 | Ga0209758_100036916 | 377 |
| 218 | 3300025297 | Ga0209758_1000709 | Ga0209758_100070918 | 377 |
| 219 | 3300025298 | Ga0209050_1001458 | Ga0209050_100145822 | 377 |
| 220 | 3300025315 | Ga0207697_10024015 | Ga0207697_100240151 | 377 |
| 221 | 3300025893 | Ga0207682_10001919 | Ga0207682_1000191913 | 377 |
| 222 | 3300025906 | Ga0207699_10200235 | Ga0207699_102002351 | 377 |
| 223 | 3300025907 | Ga0207645_10003988 | Ga0207645_100039883 | 377 |
| 224 | 3300025913 | Ga0207695_10077664 | Ga0207695_100776641 | 377 |
| 225 | 3300025914 | Ga0207671_10012212 | Ga0207671_100122125 | 377 |
| 226 | 3300025920 | Ga0207649_10097300 | Ga0207649_100973002 | 377 |
| 227 | 3300025924 | Ga0207694_10004147 | Ga0207694_100041479 | 377 |
| 228 | 3300025925 | Ga0207650_10015944 | Ga0207650_100159447 | 377 |
| 229 | 3300025926 | Ga0207659_10053368 | Ga0207659_100533682 | 377 |
| 230 | 3300025931 | Ga0207644_10214578 | Ga0207644_102145782 | 377 |
| 231 | 3300025938 | Ga0207704_10018516 | Ga0207704_100185163 | 377 |
| 232 | 3300025941 | Ga0207711_10328737 | Ga0207711_103287372 | 377 |
| 233 | 3300025942 | Ga0207689_10301895 | Ga0207689_103018951 | 377 |
| 234 | 3300026067 | Ga0207678_10000500 | Ga0207678_1000050031 | 377 |
| 235 | 3300026089 | Ga0207648_10000146 | Ga0207648_1000014612 | 377 |
| 236 | 3300026089 | Ga0207648_10006998 | Ga0207648_100069982 | 377 |
| 237 | 3300026116 | Ga0207674_10106806 | Ga0207674_101068062 | 377 |
| 238 | 3300026121 | Ga0207683_10025161 | Ga0207683_100251617 | 377 |
| 239 | 3300026121 | Ga0207683_10050435 | Ga0207683_100504351 | 377 |
| 240 | 3300026121 | Ga0207683_10167427 | Ga0207683_101674272 | 377 |
| 241 | 3300027526 | Ga0209968_1000471 | Ga0209968_10004716 | 377 |
| 242 | 3300027695 | Ga0209966_1000005 | Ga0209966_100000526 | 377 |
| 243 | 3300028379 | Ga0268266_10145527 | Ga0268266_101455273 | 377 |
| 244 | 3300028794 | Ga0307515_10001342 | Ga0307515_1000134241 | 377 |
| 245 | 3300028794 | Ga0307515_10006289 | Ga0307515_1000628919 | 377 |
| 246 | 3300028794 | Ga0307515_10114736 | Ga0307515_101147363 | 377 |
| 247 | 3300031456 | Ga0307513_10074316 | Ga0307513_100743163 | 377 |
| 248 | 3300031456 | Ga0307513_10091450 | Ga0307513_100914503 | 377 |
| 249 | 3300031507 | Ga0307509_10280150 | Ga0307509_102801502 | 377 |
| 250 | 3300031616 | Ga0307508_10000004 | Ga0307508_10000004112 | 377 |
| 251 | 3300031649 | Ga0307514_10009601 | Ga0307514_100096013 | 377 |
| 252 | 3300031730 | Ga0307516_10013729 | Ga0307516_100137294 | 377 |
| 253 | 3300031730 | Ga0307516_10079315 | Ga0307516_100793152 | 377 |
| 254 | 3300031730 | Ga0307516_10147970 | Ga0307516_101479703 | 377 |
| 255 | 3300035083 | Ga0373926_0001086 | Ga0373926_0001086_698_1891 | 377 |
| 256 | 3300035089 | Ga0373944_0009665 | Ga0373944_0009665_514_1707 | 377 |
| 257 | 3300035113 | Ga0373936_0001617 | Ga0373936_0001617_1029_2222 | 377 |
| 258 | 3300035116 | Ga0373945_0011893 | Ga0373945_0011893_324_1517 | 377 |
| 259 | 3300035170 | Ga0373943_0024870 | Ga0373943_0024870_1413_2606 | 377 |
| 260 | 3300035171 | Ga0373946_0011423 | Ga0373946_0011423_977_2170 | 377 |
| 261 | 3300035695 | Ga0373927_0040566 | Ga0373927_0040566_818_2011 | 377 |
| 262 | 3300035725 | Ga0373947_0111025 | Ga0373947_0111025_482_1675 | 377 |
| 263 | 3300036401 | Ga0373937_0009758 | Ga0373937_0009758_7016_8167 | 377 |
| 264 | 3300036401 | Ga0373937_0123401 | Ga0373937_0123401_748_1899 | 377 |
| 265 | 3300037471 | Ga0395905_0012222 | Ga0395905_0012222_3630_4808 | 377 |
| 266 | 3300037471 | Ga0395905_0025977 | Ga0395905_0025977_2643_3803 | 377 |
| 267 | 3300041452 | Ga0451793_1931907 | Ga0451793_1931907_466_1617 | 377 |
| 268 | 3300041453 | Ga0451797_0881475 | Ga0451797_0881475_865_2016 | 377 |
| 269 | 3300041460 | Ga0451802_0448423 | Ga0451802_0448423_678_1829 | 377 |
| 270 | 3300041460 | Ga0451802_2186402 | Ga0451802_2186402_1418_2578 | 377 |
| 271 | 3300042007 | Ga0439449_0031255 | Ga0439449_0031255_164_1336 | 377 |
| 272 | 3300042012 | Ga0439455_0008812 | Ga0439455_0008812_756_1907 | 377 |
| 273 | 3300044712 | Ga0453684_0114983 | Ga0453684_0114983_826_1977 | 377 |
| 274 | 3300046473 | Ga0495582_0119634 | Ga0495582_0119634_184_1377 | 377 |
| 275 | 3300046475 | Ga0495639_0005941 | Ga0495639_0005941_1302_2495 | 377 |
| 276 | 3300046512 | Ga0495610_0092200 | Ga0495610_0092200_154_1305 | 377 |
| 277 | 3300046519 | Ga0495632_0046309 | Ga0495632_0046309_243_1394 | 377 |
| 278 | 3300046522 | Ga0495643_0023064 | Ga0495643_0023064_437_1588 | 377 |
| 279 | 3300046660 | Ga0495625_0013071 | Ga0495625_0013071_3206_4357 | 377 |
| 280 | 3300046681 | Ga0495647_0000651 | Ga0495647_0000651_4474_5667 | 377 |
| 281 | 3300046683 | Ga0495658_0019751 | Ga0495658_0019751_144_1337 | 377 |
| 282 | 3300046683 | Ga0495658_0149212 | Ga0495658_0149212_50_1201 | 377 |
| 283 | 3300047321 | Ga0495676_0197936 | Ga0495676_0197936_166_1359 | 377 |
| 284 | 3300047472 | Ga0495686_0019436 | Ga0495686_0019436_2036_3187 | 377 |
| 285 | 3300048905 | Ga0496102_0015518 | Ga0496102_0015518_2037_3188 | 377 |
| 286 | 3300048911 | Ga0496108_0024755 | Ga0496108_0024755_147_1298 | 377 |
| 287 | 3300049579 | Ga0501043_0000023 | Ga0501043_0000023_106255_107415 | 377 |
| 288 | 3300049580 | Ga0501046_0000018 | Ga0501046_0000018_113147_114307 | 377 |
| 289 | 3300049581 | Ga0501047_0000020 | Ga0501047_0000020_151956_153116 | 377 |
| 290 | 3300049582 | Ga0501048_0002498 | Ga0501048_0002498_921_2081 | 377 |
| 291 | 3300049824 | Ga0501045_0016490 | Ga0501045_0016490_1408_2568 | 377 |
| 292 | 3300050493 | nmdc:mga0k408_22347_c2 | nmdc:mga0k408_22347_c2_996_2147 | 377 |
| 293 | 3300050493 | nmdc:mga0k408_3911_c1 | nmdc:mga0k408_3911_c1_152_1303 | 377 |
| 294 | 3300050493 | nmdc:mga0k408_8306_c1 | nmdc:mga0k408_8306_c1_3649_4800 | 377 |
| 295 | 3300050494 | nmdc:mga06z11_59157_c1 | nmdc:mga06z11_59157_c1_19_1170 | 377 |
| 296 | 3300053086 | Ga0500578_0000787 | Ga0500578_0000787_30699_31850 | 377 |
| 297 | 3300053086 | Ga0500578_0052977 | Ga0500578_0052977_525_1676 | 377 |
| 298 | 3300053130 | Ga0500642_0051534 | Ga0500642_0051534_131_1282 | 377 |
| 299 | 3300053730 | Ga0500645_002594 | Ga0500645_002594_932_2083 | 377 |
| 300 | 3300003187 | JGI25151J46595_10043938 | JGI25151J46595_100439382 | 378 |
| 301 | 3300035695 | Ga0373927_0006714 | Ga0373927_0006714_2278_3474 | 378 |
| 302 | 3300045051 | Ga0451576_0129993 | Ga0451576_0129993_1165_2319 | 378 |
| 303 | 3300048909 | Ga0496106_0262316 | Ga0496106_0262316_169_1365 | 378 |
| 304 | 3300005459 | Ga0068867_100202833 | Ga0068867_1002028332 | 379 |
| 305 | 3300006195 | Ga0075366_10001677 | Ga0075366_100016779 | 379 |
| 306 | 3300042876 | Ga0451577_0029690 | Ga0451577_0029690_3753_4925 | 379 |
| 307 | 3300046501 | Ga0495607_0042320 | Ga0495607_0042320_439_1605 | 379 |
| 308 | 3300046507 | Ga0495606_0111842 | Ga0495606_0111842_352_1518 | 379 |
| 309 | 3300046513 | Ga0495616_0076593 | Ga0495616_0076593_242_1408 | 379 |
| 310 | 3300050493 | nmdc:mga0k408_3661_c1 | nmdc:mga0k408_3661_c1_1964_3136 | 379 |
| 311 | 3300005355 | Ga0070671_100085945 | Ga0070671_1000859452 | 380 |
| 312 | 3300005471 | Ga0070698_100012253 | Ga0070698_1000122534 | 380 |
| 313 | 3300005543 | Ga0070672_100047976 | Ga0070672_1000479762 | 380 |
| 314 | 3300005549 | Ga0070704_100002235 | Ga0070704_1000022356 | 380 |
| 315 | 3300005617 | Ga0068859_100310053 | Ga0068859_1003100532 | 380 |
| 316 | 3300005718 | Ga0068866_10049708 | Ga0068866_100497082 | 380 |
| 317 | 3300005985 | Ga0081539_10009781 | Ga0081539_100097814 | 380 |
| 318 | 3300006844 | Ga0075428_100097524 | Ga0075428_1000975242 | 380 |
| 319 | 3300006847 | Ga0075431_100134649 | Ga0075431_1001346493 | 380 |
| 320 | 3300006880 | Ga0075429_100029191 | Ga0075429_1000291912 | 380 |
| 321 | 3300006931 | Ga0097620_100310035 | Ga0097620_1003100351 | 380 |
| 322 | 3300009094 | Ga0111539_10174383 | Ga0111539_101743832 | 380 |
| 323 | 3300009147 | Ga0114129_10047700 | Ga0114129_100477007 | 380 |
| 324 | 3300013308 | Ga0157375_10095972 | Ga0157375_100959722 | 380 |
| 325 | 3300014968 | Ga0157379_10114247 | Ga0157379_101142473 | 380 |
| 326 | 3300025913 | Ga0207695_10106135 | Ga0207695_101061352 | 380 |
| 327 | 3300025919 | Ga0207657_10140961 | Ga0207657_101409612 | 380 |
| 328 | 3300028380 | Ga0268265_10167125 | Ga0268265_101671252 | 380 |
| 329 | 3300031730 | Ga0307516_10110733 | Ga0307516_101107333 | 380 |
| 330 | 3300042001 | Ga0439441_004433 | Ga0439441_004433_49_1209 | 380 |
| 331 | 3300042001 | Ga0439441_007290 | Ga0439441_007290_485_1636 | 380 |
| 332 | 3300046539 | Ga0495621_0009375 | Ga0495621_0009375_780_1931 | 380 |
| 333 | 3300048912 | Ga0496109_0131220 | Ga0496109_0131220_634_1815 | 380 |
| 334 | 3300050507 | nmdc:mga05p37_250307_c1 | nmdc:mga05p37_250307_c1_762_1955 | 380 |
| 335 | 3300050507 | nmdc:mga05p37_5467_c1 | nmdc:mga05p37_5467_c1_13390_14541 | 380 |
| 336 | 3300050508 | nmdc:mga09592_525_c1 | nmdc:mga09592_525_c1_3786_4937 | 380 |
| 337 | 3300050511 | nmdc:mga08y16_75316_c1 | nmdc:mga08y16_75316_c1_988_2139 | 380 |
| 338 | iso_pu_bacteria | 2939669807 | 2939669955 | 380 |
| 339 | 3300005328 | Ga0070676_10003985 | Ga0070676_100039853 | 381 |
| 340 | 3300005330 | Ga0070690_100043276 | Ga0070690_1000432762 | 381 |
| 341 | 3300005331 | Ga0070670_100249694 | Ga0070670_1002496941 | 381 |
| 342 | 3300005331 | Ga0070670_100280279 | Ga0070670_1002802791 | 381 |
| 343 | 3300005333 | Ga0070677_10024764 | Ga0070677_100247642 | 381 |
| 344 | 3300005335 | Ga0070666_10061620 | Ga0070666_100616202 | 381 |
| 345 | 3300005338 | Ga0068868_100033556 | Ga0068868_1000335563 | 381 |
| 346 | 3300005347 | Ga0070668_100042341 | Ga0070668_1000423413 | 381 |
| 347 | 3300005354 | Ga0070675_100060146 | Ga0070675_1000601463 | 381 |
| 348 | 3300005355 | Ga0070671_100005456 | Ga0070671_10000545611 | 381 |
| 349 | 3300005356 | Ga0070674_100059240 | Ga0070674_1000592402 | 381 |
| 350 | 3300005367 | Ga0070667_100091829 | Ga0070667_1000918292 | 381 |
| 351 | 3300005441 | Ga0070700_100009928 | Ga0070700_1000099284 | 381 |
| 352 | 3300005456 | Ga0070678_100033732 | Ga0070678_1000337321 | 381 |
| 353 | 3300005456 | Ga0070678_100162985 | Ga0070678_1001629852 | 381 |
| 354 | 3300005457 | Ga0070662_100188529 | Ga0070662_1001885292 | 381 |
| 355 | 3300005459 | Ga0068867_100080552 | Ga0068867_1000805522 | 381 |
| 356 | 3300005459 | Ga0068867_100098413 | Ga0068867_1000984131 | 381 |
| 357 | 3300005543 | Ga0070672_100056213 | Ga0070672_1000562134 | 381 |
| 358 | 3300005543 | Ga0070672_100081645 | Ga0070672_1000816452 | 381 |
| 359 | 3300005543 | Ga0070672_100097015 | Ga0070672_1000970151 | 381 |
| 360 | 3300005578 | Ga0068854_100031641 | Ga0068854_1000316412 | 381 |
| 361 | 3300005616 | Ga0068852_100207156 | Ga0068852_1002071562 | 381 |
| 362 | 3300005616 | Ga0068852_100236606 | Ga0068852_1002366062 | 381 |
| 363 | 3300005617 | Ga0068859_100080523 | Ga0068859_1000805233 | 381 |
| 364 | 3300005617 | Ga0068859_100316770 | Ga0068859_1003167702 | 381 |
| 365 | 3300005718 | Ga0068866_10001767 | Ga0068866_100017679 | 381 |
| 366 | 3300005719 | Ga0068861_100142382 | Ga0068861_1001423822 | 381 |
| 367 | 3300005841 | Ga0068863_100114074 | Ga0068863_1001140742 | 381 |
| 368 | 3300005842 | Ga0068858_100143489 | Ga0068858_1001434892 | 381 |
| 369 | 3300006237 | Ga0097621_100123217 | Ga0097621_1001232173 | 381 |
| 370 | 3300006358 | Ga0068871_100086705 | Ga0068871_1000867052 | 381 |
| 371 | 3300006358 | Ga0068871_100196935 | Ga0068871_1001969352 | 381 |
| 372 | 3300006844 | Ga0075428_100001225 | Ga0075428_1000012257 | 381 |
| 373 | 3300006880 | Ga0075429_100029373 | Ga0075429_1000293731 | 381 |
| 374 | 3300006881 | Ga0068865_100185594 | Ga0068865_1001855942 | 381 |
| 375 | 3300006931 | Ga0097620_100080523 | Ga0097620_1000805233 | 381 |
| 376 | 3300006931 | Ga0097620_100316769 | Ga0097620_1003167692 | 381 |
| 377 | 3300009094 | Ga0111539_10053322 | Ga0111539_100533222 | 381 |
| 378 | 3300009094 | Ga0111539_10170262 | Ga0111539_101702622 | 381 |
| 379 | 3300009098 | Ga0105245_10084181 | Ga0105245_100841813 | 381 |
| 380 | 3300009147 | Ga0114129_10009453 | Ga0114129_100094534 | 381 |
| 381 | 3300009148 | Ga0105243_10016225 | Ga0105243_100162252 | 381 |
| 382 | 3300009176 | Ga0105242_10094021 | Ga0105242_100940212 | 381 |
| 383 | 3300009177 | Ga0105248_10017866 | Ga0105248_100178662 | 381 |
| 384 | 3300009177 | Ga0105248_10049621 | Ga0105248_100496212 | 381 |
| 385 | 3300009177 | Ga0105248_10183953 | Ga0105248_101839532 | 381 |
| 386 | 3300009553 | Ga0105249_10108229 | Ga0105249_101082293 | 381 |
| 387 | 3300013296 | Ga0157374_10287448 | Ga0157374_102874482 | 381 |
| 388 | 3300013297 | Ga0157378_10093736 | Ga0157378_100937362 | 381 |
| 389 | 3300013308 | Ga0157375_10003889 | Ga0157375_100038893 | 381 |
| 390 | 3300025899 | Ga0207642_10009742 | Ga0207642_100097423 | 381 |
| 391 | 3300025903 | Ga0207680_10107525 | Ga0207680_101075252 | 381 |
| 392 | 3300025907 | Ga0207645_10014014 | Ga0207645_100140146 | 381 |
| 393 | 3300025918 | Ga0207662_10014355 | Ga0207662_100143553 | 381 |
| 394 | 3300025925 | Ga0207650_10114180 | Ga0207650_101141803 | 381 |
| 395 | 3300025926 | Ga0207659_10017392 | Ga0207659_100173922 | 381 |
| 396 | 3300025927 | Ga0207687_10089341 | Ga0207687_100893412 | 381 |
| 397 | 3300025931 | Ga0207644_10024864 | Ga0207644_100248643 | 381 |
| 398 | 3300025931 | Ga0207644_10167079 | Ga0207644_101670792 | 381 |
| 399 | 3300025933 | Ga0207706_10037748 | Ga0207706_100377483 | 381 |
| 400 | 3300025933 | Ga0207706_10365038 | Ga0207706_103650381 | 381 |
| 401 | 3300025934 | Ga0207686_10086859 | Ga0207686_100868592 | 381 |
| 402 | 3300025935 | Ga0207709_10012911 | Ga0207709_100129112 | 381 |
| 403 | 3300025937 | Ga0207669_10052423 | Ga0207669_100524232 | 381 |
| 404 | 3300025938 | Ga0207704_10066390 | Ga0207704_100663902 | 381 |
| 405 | 3300025940 | Ga0207691_10011546 | Ga0207691_1001154612 | 381 |
| 406 | 3300025940 | Ga0207691_10051226 | Ga0207691_100512264 | 381 |
| 407 | 3300025940 | Ga0207691_10225604 | Ga0207691_102256042 | 381 |
| 408 | 3300025941 | Ga0207711_10007461 | Ga0207711_100074613 | 381 |
| 409 | 3300025941 | Ga0207711_10114492 | Ga0207711_101144921 | 381 |
| 410 | 3300025942 | Ga0207689_10094530 | Ga0207689_100945301 | 381 |
| 411 | 3300025961 | Ga0207712_10004221 | Ga0207712_100042218 | 381 |
| 412 | 3300025981 | Ga0207640_10062336 | Ga0207640_100623362 | 381 |
| 413 | 3300025986 | Ga0207658_10008305 | Ga0207658_100083058 | 381 |
| 414 | 3300026075 | Ga0207708_10028414 | Ga0207708_100284145 | 381 |
| 415 | 3300026088 | Ga0207641_10004639 | Ga0207641_100046396 | 381 |
| 416 | 3300026089 | Ga0207648_10063670 | Ga0207648_100636702 | 381 |
| 417 | 3300026089 | Ga0207648_10250198 | Ga0207648_102501982 | 381 |
| 418 | 3300026118 | Ga0207675_100048651 | Ga0207675_1000486513 | 381 |
| 419 | 3300026121 | Ga0207683_10205759 | Ga0207683_102057592 | 381 |
| 420 | 3300026142 | Ga0207698_10069098 | Ga0207698_100690981 | 381 |
| 421 | 3300027907 | Ga0207428_10051779 | Ga0207428_100517792 | 381 |
| 422 | 3300031665 | Ga0316575_10007395 | Ga0316575_100073954 | 381 |
| 423 | 3300031691 | Ga0316579_10035589 | Ga0316579_100355892 | 381 |
| 424 | 3300032133 | Ga0316583_10013543 | Ga0316583_100135432 | 381 |
| 425 | 3300035113 | Ga0373936_0038432 | Ga0373936_0038432_700_1863 | 381 |
| 426 | 3300035692 | Ga0373935_0069721 | Ga0373935_0069721_908_2071 | 381 |
| 427 | 3300035695 | Ga0373927_0013233 | Ga0373927_0013233_2951_4123 | 381 |
| 428 | 3300036401 | Ga0373937_0383215 | Ga0373937_0383215_80_1243 | 381 |
| 429 | 3300036647 | Ga0316582_0004577 | Ga0316582_0004577_1599_2753 | 381 |
| 430 | 3300036712 | Ga0316584_0181576 | Ga0316584_0181576_213_1367 | 381 |
| 431 | 3300037068 | Ga0373925_0043468 | Ga0373925_0043468_765_1937 | 381 |
| 432 | 3300037068 | Ga0373925_0161996 | Ga0373925_0161996_110_1273 | 381 |
| 433 | 3300037588 | Ga0316581_0002921 | Ga0316581_0002921_603_1757 | 381 |
| 434 | 3300044684 | Ga0466966_0098515 | Ga0466966_0098515_346_1542 | 381 |
| 435 | 3300044693 | Ga0466961_0099060 | Ga0466961_0099060_89_1285 | 381 |
| 436 | 3300044719 | Ga0466971_0022938 | Ga0466971_0022938_588_1784 | 381 |
| 437 | 3300045049 | Ga0466959_0020291 | Ga0466959_0020291_1922_3118 | 381 |
| 438 | 3300046683 | Ga0495658_0041560 | Ga0495658_0041560_1102_2310 | 381 |
| 439 | 3300049589 | Ga0501073_0039581 | Ga0501073_0039581_555_1709 | 381 |
| 440 | 3300049742 | Ga0501080_0105488 | Ga0501080_0105488_975_2129 | 381 |
| 441 | 3300050507 | nmdc:mga05p37_349_c1 | nmdc:mga05p37_349_c1_21347_22540 | 381 |
| 442 | 3300050508 | nmdc:mga09592_3199_c1 | nmdc:mga09592_3199_c1_5919_7112 | 381 |
| 443 | 3300050508 | nmdc:mga09592_43660_c1 | nmdc:mga09592_43660_c1_123_1316 | 381 |
| 444 | 3300050509 | nmdc:mga0qj67_33113_c1 | nmdc:mga0qj67_33113_c1_170_1321 | 381 |
| 445 | 3300050510 | nmdc:mga06r32_84807_c1 | nmdc:mga06r32_84807_c1_252_1445 | 381 |
| 446 | 3300050511 | nmdc:mga08y16_86836_c1 | nmdc:mga08y16_86836_c1_1933_3126 | 381 |
| 447 | 3300053085 | Ga0495619_0065552 | Ga0495619_0065552_165_1328 | 381 |
| 448 | 3300061719 | Ga0466962_0014620 | Ga0466962_0014620_892_2088 | 381 |
| 449 | 3300005327 | Ga0070658_10028554 | Ga0070658_100285542 | 382 |
| 450 | 3300005329 | Ga0070683_100007089 | Ga0070683_1000070891 | 382 |
| 451 | 3300005330 | Ga0070690_100000408 | Ga0070690_10000040812 | 382 |
| 452 | 3300005334 | Ga0068869_100000478 | Ga0068869_10000047812 | 382 |
| 453 | 3300005336 | Ga0070680_100000654 | Ga0070680_10000065424 | 382 |
| 454 | 3300005338 | Ga0068868_100000056 | Ga0068868_10000005652 | 382 |
| 455 | 3300005339 | Ga0070660_100106492 | Ga0070660_1001064922 | 382 |
| 456 | 3300005340 | Ga0070689_100000429 | Ga0070689_10000042923 | 382 |
| 457 | 3300005341 | Ga0070691_10000463 | Ga0070691_100004634 | 382 |
| 458 | 3300005343 | Ga0070687_100000418 | Ga0070687_10000041813 | 382 |
| 459 | 3300005344 | Ga0070661_100075262 | Ga0070661_1000752622 | 382 |
| 460 | 3300005345 | Ga0070692_10001960 | Ga0070692_100019608 | 382 |
| 461 | 3300005366 | Ga0070659_100084594 | Ga0070659_1000845942 | 382 |
| 462 | 3300005438 | Ga0070701_10001314 | Ga0070701_100013143 | 382 |
| 463 | 3300005440 | Ga0070705_100000855 | Ga0070705_1000008556 | 382 |
| 464 | 3300005441 | Ga0070700_100001470 | Ga0070700_1000014704 | 382 |
| 465 | 3300005444 | Ga0070694_100000452 | Ga0070694_1000004524 | 382 |
| 466 | 3300005459 | Ga0068867_100000623 | Ga0068867_10000062312 | 382 |
| 467 | 3300005530 | Ga0070679_100022808 | Ga0070679_1000228085 | 382 |
| 468 | 3300005536 | Ga0070697_100124956 | Ga0070697_1001249562 | 382 |
| 469 | 3300005539 | Ga0068853_100052361 | Ga0068853_1000523613 | 382 |
| 470 | 3300005544 | Ga0070686_100003488 | Ga0070686_1000034886 | 382 |
| 471 | 3300005545 | Ga0070695_100000414 | Ga0070695_10000041411 | 382 |
| 472 | 3300005546 | Ga0070696_100000012 | Ga0070696_10000001220 | 382 |
| 473 | 3300005547 | Ga0070693_100000222 | Ga0070693_10000022211 | 382 |
| 474 | 3300005549 | Ga0070704_100000233 | Ga0070704_10000023314 | 382 |
| 475 | 3300005563 | Ga0068855_100006214 | Ga0068855_10000621412 | 382 |
| 476 | 3300005564 | Ga0070664_100021750 | Ga0070664_1000217501 | 382 |
| 477 | 3300005577 | Ga0068857_100224021 | Ga0068857_1002240211 | 382 |
| 478 | 3300005614 | Ga0068856_100007697 | Ga0068856_1000076972 | 382 |
| 479 | 3300005614 | Ga0068856_100013314 | Ga0068856_1000133149 | 382 |
| 480 | 3300005616 | Ga0068852_100021127 | Ga0068852_1000211275 | 382 |
| 481 | 3300005617 | Ga0068859_100005934 | Ga0068859_10000593412 | 382 |
| 482 | 3300005718 | Ga0068866_10000392 | Ga0068866_1000039220 | 382 |
| 483 | 3300005719 | Ga0068861_100000033 | Ga0068861_10000003314 | 382 |
| 484 | 3300005834 | Ga0068851_10019315 | Ga0068851_100193153 | 382 |
| 485 | 3300005840 | Ga0068870_10080055 | Ga0068870_100800552 | 382 |
| 486 | 3300005842 | Ga0068858_100003471 | Ga0068858_1000034716 | 382 |
| 487 | 3300005843 | Ga0068860_100003755 | Ga0068860_1000037556 | 382 |
| 488 | 3300005844 | Ga0068862_100001281 | Ga0068862_10000128112 | 382 |
| 489 | 3300006237 | Ga0097621_100000801 | Ga0097621_10000080110 | 382 |
| 490 | 3300006358 | Ga0068871_100001405 | Ga0068871_10000140514 | 382 |
| 491 | 3300006881 | Ga0068865_100000629 | Ga0068865_1000006294 | 382 |
| 492 | 3300006931 | Ga0097620_100005934 | Ga0097620_1000059343 | 382 |
| 493 | 3300009098 | Ga0105245_10001181 | Ga0105245_1000118113 | 382 |
| 494 | 3300009148 | Ga0105243_10001329 | Ga0105243_1000132912 | 382 |
| 495 | 3300009174 | Ga0105241_10017607 | Ga0105241_100176073 | 382 |
| 496 | 3300009176 | Ga0105242_10002209 | Ga0105242_1000220913 | 382 |
| 497 | 3300009553 | Ga0105249_10001192 | Ga0105249_1000119211 | 382 |
| 498 | 3300010375 | Ga0105239_10023152 | Ga0105239_100231527 | 382 |
| 499 | 3300013296 | Ga0157374_10082868 | Ga0157374_100828684 | 382 |
| 500 | 3300013297 | Ga0157378_10000693 | Ga0157378_1000069312 | 382 |
| 501 | 3300014969 | Ga0157376_10002436 | Ga0157376_1000243611 | 382 |
| 502 | 3300025904 | Ga0207647_10020345 | Ga0207647_100203453 | 382 |
| 503 | 3300025909 | Ga0207705_10072390 | Ga0207705_100723903 | 382 |
| 504 | 3300025911 | Ga0207654_10018181 | Ga0207654_100181813 | 382 |
| 505 | 3300025917 | Ga0207660_10004807 | Ga0207660_100048078 | 382 |
| 506 | 3300025918 | Ga0207662_10000782 | Ga0207662_100007824 | 382 |
| 507 | 3300025920 | Ga0207649_10027765 | Ga0207649_100277655 | 382 |
| 508 | 3300025921 | Ga0207652_10072814 | Ga0207652_100728142 | 382 |
| 509 | 3300025926 | Ga0207659_10063691 | Ga0207659_100636912 | 382 |
| 510 | 3300025932 | Ga0207690_10094129 | Ga0207690_100941292 | 382 |
| 511 | 3300025934 | Ga0207686_10015450 | Ga0207686_100154504 | 382 |
| 512 | 3300025935 | Ga0207709_10003401 | Ga0207709_100034013 | 382 |
| 513 | 3300025938 | Ga0207704_10000370 | Ga0207704_1000037023 | 382 |
| 514 | 3300025942 | Ga0207689_10003609 | Ga0207689_100036095 | 382 |
| 515 | 3300025945 | Ga0207679_10134897 | Ga0207679_101348972 | 382 |
| 516 | 3300025949 | Ga0207667_10061993 | Ga0207667_100619934 | 382 |
| 517 | 3300025981 | Ga0207640_10009134 | Ga0207640_100091344 | 382 |
| 518 | 3300026023 | Ga0207677_10000768 | Ga0207677_1000076811 | 382 |
| 519 | 3300026041 | Ga0207639_10025204 | Ga0207639_100252044 | 382 |
| 520 | 3300026041 | Ga0207639_10040340 | Ga0207639_100403402 | 382 |
| 521 | 3300026075 | Ga0207708_10000617 | Ga0207708_1000061714 | 382 |
| 522 | 3300026078 | Ga0207702_10064993 | Ga0207702_100649932 | 382 |
| 523 | 3300026089 | Ga0207648_10000130 | Ga0207648_1000013067 | 382 |
| 524 | 3300026089 | Ga0207648_10126836 | Ga0207648_101268362 | 382 |
| 525 | 3300026116 | Ga0207674_10020685 | Ga0207674_100206852 | 382 |
| 526 | 3300026118 | Ga0207675_100001694 | Ga0207675_10000169412 | 382 |
| 527 | 3300026118 | Ga0207675_100109636 | Ga0207675_1001096362 | 382 |
| 528 | 3300028380 | Ga0268265_10003627 | Ga0268265_1000362711 | 382 |
| 529 | 3300028381 | Ga0268264_10000892 | Ga0268264_1000089224 | 382 |
| 530 | 3300035691 | Ga0373931_0101337 | Ga0373931_0101337_383_1576 | 382 |
| 531 | 3300041459 | Ga0451800_1606912 | Ga0451800_1606912_310_1545 | 382 |
| 532 | 3300053161 | Ga0500634_0000600 | Ga0500634_0000600_7854_9068 | 382 |
| 533 | 3300005336 | Ga0070680_100006576 | Ga0070680_1000065762 | 383 |
| 534 | 3300005530 | Ga0070679_100020566 | Ga0070679_1000205664 | 383 |
| 535 | 3300005985 | Ga0081539_10035756 | Ga0081539_100357563 | 383 |
| 536 | 3300006846 | Ga0075430_100251176 | Ga0075430_1002511762 | 383 |
| 537 | 3300006880 | Ga0075429_100178054 | Ga0075429_1001780542 | 383 |
| 538 | 3300009147 | Ga0114129_10268214 | Ga0114129_102682142 | 383 |
| 539 | 3300025917 | Ga0207660_10032183 | Ga0207660_100321831 | 383 |
| 540 | 3300025928 | Ga0207700_10033017 | Ga0207700_100330173 | 383 |
| 541 | 3300050507 | nmdc:mga05p37_46938_c1 | nmdc:mga05p37_46938_c1_547_1707 | 383 |
| 542 | 3300050508 | nmdc:mga09592_27185_c1 | nmdc:mga09592_27185_c1_959_2119 | 383 |
| 543 | 3300050510 | nmdc:mga06r32_349297_c1 | nmdc:mga06r32_349297_c1_155_1315 | 383 |
| 544 | 3300005329 | Ga0070683_100087297 | Ga0070683_1000872973 | 384 |
| 545 | 3300005336 | Ga0070680_100023434 | Ga0070680_1000234347 | 384 |
| 546 | 3300005336 | Ga0070680_100077300 | Ga0070680_1000773002 | 384 |
| 547 | 3300005337 | Ga0070682_100137549 | Ga0070682_1001375492 | 384 |
| 548 | 3300005338 | Ga0068868_100033283 | Ga0068868_1000332832 | 384 |
| 549 | 3300005345 | Ga0070692_10020544 | Ga0070692_100205442 | 384 |
| 550 | 3300005353 | Ga0070669_100008643 | Ga0070669_1000086437 | 384 |
| 551 | 3300005354 | Ga0070675_100004598 | Ga0070675_10000459811 | 384 |
| 552 | 3300005355 | Ga0070671_100046866 | Ga0070671_1000468665 | 384 |
| 553 | 3300005366 | Ga0070659_100008273 | Ga0070659_1000082739 | 384 |
| 554 | 3300005441 | Ga0070700_100000499 | Ga0070700_10000049915 | 384 |
| 555 | 3300005457 | Ga0070662_100044780 | Ga0070662_1000447802 | 384 |
| 556 | 3300005458 | Ga0070681_10009598 | Ga0070681_100095985 | 384 |
| 557 | 3300005459 | Ga0068867_100000816 | Ga0068867_1000008168 | 384 |
| 558 | 3300005530 | Ga0070679_100010847 | Ga0070679_1000108473 | 384 |
| 559 | 3300005539 | Ga0068853_100023858 | Ga0068853_1000238583 | 384 |
| 560 | 3300005543 | Ga0070672_100032941 | Ga0070672_1000329414 | 384 |
| 561 | 3300005563 | Ga0068855_100129357 | Ga0068855_1001293572 | 384 |
| 562 | 3300005563 | Ga0068855_100162772 | Ga0068855_1001627721 | 384 |
| 563 | 3300005564 | Ga0070664_100098882 | Ga0070664_1000988822 | 384 |
| 564 | 3300005577 | Ga0068857_100120434 | Ga0068857_1001204341 | 384 |
| 565 | 3300005578 | Ga0068854_100006996 | Ga0068854_1000069969 | 384 |
| 566 | 3300005614 | Ga0068856_100003093 | Ga0068856_1000030935 | 384 |
| 567 | 3300005614 | Ga0068856_100206184 | Ga0068856_1002061842 | 384 |
| 568 | 3300005616 | Ga0068852_100062389 | Ga0068852_1000623893 | 384 |
| 569 | 3300005616 | Ga0068852_100296836 | Ga0068852_1002968361 | 384 |
| 570 | 3300005618 | Ga0068864_100055591 | Ga0068864_1000555913 | 384 |
| 571 | 3300005719 | Ga0068861_100010234 | Ga0068861_1000102345 | 384 |
| 572 | 3300005842 | Ga0068858_100173220 | Ga0068858_1001732201 | 384 |
| 573 | 3300005843 | Ga0068860_100096000 | Ga0068860_1000960003 | 384 |
| 574 | 3300005844 | Ga0068862_100132045 | Ga0068862_1001320452 | 384 |
| 575 | 3300006881 | Ga0068865_100008959 | Ga0068865_1000089595 | 384 |
| 576 | 3300009094 | Ga0111539_10070517 | Ga0111539_100705172 | 384 |
| 577 | 3300009098 | Ga0105245_10263677 | Ga0105245_102636772 | 384 |
| 578 | 3300009148 | Ga0105243_10006779 | Ga0105243_1000677910 | 384 |
| 579 | 3300009174 | Ga0105241_10049461 | Ga0105241_100494613 | 384 |
| 580 | 3300009177 | Ga0105248_10125562 | Ga0105248_101255623 | 384 |
| 581 | 3300010375 | Ga0105239_10302553 | Ga0105239_103025532 | 384 |
| 582 | 3300013296 | Ga0157374_10005865 | Ga0157374_100058652 | 384 |
| 583 | 3300013306 | Ga0163162_10051681 | Ga0163162_100516813 | 384 |
| 584 | 3300013306 | Ga0163162_10071605 | Ga0163162_100716053 | 384 |
| 585 | 3300013307 | Ga0157372_10002828 | Ga0157372_100028286 | 384 |
| 586 | 3300013307 | Ga0157372_10019251 | Ga0157372_100192512 | 384 |
| 587 | 3300014326 | Ga0157380_10018722 | Ga0157380_100187227 | 384 |
| 588 | 3300014745 | Ga0157377_10037330 | Ga0157377_100373302 | 384 |
| 589 | 3300014968 | Ga0157379_10037900 | Ga0157379_100379003 | 384 |
| 590 | 3300017792 | Ga0163161_10023133 | Ga0163161_100231333 | 384 |
| 591 | 3300025899 | Ga0207642_10018667 | Ga0207642_100186673 | 384 |
| 592 | 3300025907 | Ga0207645_10029674 | Ga0207645_100296743 | 384 |
| 593 | 3300025912 | Ga0207707_10006002 | Ga0207707_100060024 | 384 |
| 594 | 3300025919 | Ga0207657_10016351 | Ga0207657_100163513 | 384 |
| 595 | 3300025921 | Ga0207652_10005271 | Ga0207652_100052714 | 384 |
| 596 | 3300025923 | Ga0207681_10001478 | Ga0207681_1000147812 | 384 |
| 597 | 3300025923 | Ga0207681_10015245 | Ga0207681_100152455 | 384 |
| 598 | 3300025927 | Ga0207687_10045063 | Ga0207687_100450633 | 384 |
| 599 | 3300025931 | Ga0207644_10008258 | Ga0207644_100082589 | 384 |
| 600 | 3300025932 | Ga0207690_10009822 | Ga0207690_100098227 | 384 |
| 601 | 3300025933 | Ga0207706_10031665 | Ga0207706_100316652 | 384 |
| 602 | 3300025935 | Ga0207709_10001580 | Ga0207709_100015805 | 384 |
| 603 | 3300025938 | Ga0207704_10002182 | Ga0207704_100021825 | 384 |
| 604 | 3300025940 | Ga0207691_10036114 | Ga0207691_100361142 | 384 |
| 605 | 3300025941 | Ga0207711_10063435 | Ga0207711_100634352 | 384 |
| 606 | 3300025942 | Ga0207689_10004291 | Ga0207689_100042919 | 384 |
| 607 | 3300025949 | Ga0207667_10081291 | Ga0207667_100812913 | 384 |
| 608 | 3300026023 | Ga0207677_10068482 | Ga0207677_100684823 | 384 |
| 609 | 3300026035 | Ga0207703_10037103 | Ga0207703_100371033 | 384 |
| 610 | 3300026067 | Ga0207678_10018317 | Ga0207678_100183176 | 384 |
| 611 | 3300026078 | Ga0207702_10004753 | Ga0207702_100047537 | 384 |
| 612 | 3300026078 | Ga0207702_10030713 | Ga0207702_100307133 | 384 |
| 613 | 3300026089 | Ga0207648_10002519 | Ga0207648_1000251915 | 384 |
| 614 | 3300026089 | Ga0207648_10045838 | Ga0207648_100458384 | 384 |
| 615 | 3300026095 | Ga0207676_10014293 | Ga0207676_100142933 | 384 |
| 616 | 3300026116 | Ga0207674_10051358 | Ga0207674_100513583 | 384 |
| 617 | 3300026118 | Ga0207675_100000857 | Ga0207675_10000085711 | 384 |
| 618 | 3300026121 | Ga0207683_10148771 | Ga0207683_101487713 | 384 |
| 619 | 3300027665 | Ga0209983_1004988 | Ga0209983_10049882 | 384 |
| 620 | 3300027907 | Ga0207428_10097111 | Ga0207428_100971112 | 384 |
| 621 | 3300028380 | Ga0268265_10005565 | Ga0268265_100055657 | 384 |
| 622 | 3300031731 | Ga0307405_10007502 | Ga0307405_100075023 | 384 |
| 623 | 3300031911 | Ga0307412_10065398 | Ga0307412_100653982 | 384 |
| 624 | 3300031995 | Ga0307409_100000086 | Ga0307409_10000008633 | 384 |
| 625 | 3300032002 | Ga0307416_100117705 | Ga0307416_1001177052 | 384 |
| 626 | 3300035242 | Ga0373962_0024180 | Ga0373962_0024180_157_1371 | 384 |
| 627 | 3300035691 | Ga0373931_0009283 | Ga0373931_0009283_1043_2257 | 384 |
| 628 | 3300038996 | Ga0242420_011280 | Ga0242420_011280_316_1485 | 384 |
| 629 | 3300039437 | Ga0436365_0038862 | Ga0436365_0038862_1542_2714 | 384 |
| 630 | 3300042156 | Ga0439446_0011224 | Ga0439446_0011224_1159_2322 | 384 |
| 631 | 3300042436 | Ga0439435_0012465 | Ga0439435_0012465_566_1729 | 384 |
| 632 | 3300045051 | Ga0451576_0135584 | Ga0451576_0135584_1020_2234 | 384 |
| 633 | 3300045976 | Ga0466967_0076090 | Ga0466967_0076090_966_2129 | 384 |
| 634 | 3300046537 | Ga0495598_0044033 | Ga0495598_0044033_127_1290 | 384 |
| 635 | 3300048904 | Ga0496101_0083959 | Ga0496101_0083959_470_1684 | 384 |
| 636 | 3300048911 | Ga0496108_0100478 | Ga0496108_0100478_169_1383 | 384 |
| 637 | 3300048912 | Ga0496109_0143497 | Ga0496109_0143497_10_1224 | 384 |
| 638 | 3300048913 | Ga0496110_0031132 | Ga0496110_0031132_1001_2215 | 384 |
| 639 | 3300048916 | Ga0496113_0031390 | Ga0496113_0031390_1093_2307 | 384 |
| 640 | 3300048917 | Ga0496114_0155721 | Ga0496114_0155721_602_1816 | 384 |
| 641 | 3300048918 | Ga0496115_0007123 | Ga0496115_0007123_5729_6943 | 384 |
| 642 | 3300049570 | Ga0501033_0009551 | Ga0501033_0009551_1109_2284 | 384 |
| 643 | 3300049572 | Ga0501036_0003867 | Ga0501036_0003867_3282_4457 | 384 |
| 644 | 3300049574 | Ga0501038_0012500 | Ga0501038_0012500_3413_4588 | 384 |
| 645 | 3300049575 | Ga0501039_0003349 | Ga0501039_0003349_7242_8417 | 384 |
| 646 | 3300049576 | Ga0501040_0000593 | Ga0501040_0000593_2192_3367 | 384 |
| 647 | 3300049577 | Ga0501041_0000034 | Ga0501041_0000034_39743_40918 | 384 |
| 648 | 3300049578 | Ga0501042_0001135 | Ga0501042_0001135_11004_12179 | 384 |
| 649 | 3300049580 | Ga0501046_0007125 | Ga0501046_0007125_5255_6430 | 384 |
| 650 | 3300049582 | Ga0501048_0006069 | Ga0501048_0006069_6595_7770 | 384 |
| 651 | 3300049584 | Ga0501068_0033554 | Ga0501068_0033554_662_1837 | 384 |
| 652 | 3300049587 | Ga0501071_0058042 | Ga0501071_0058042_23_1198 | 384 |
| 653 | 3300049588 | Ga0501072_0006856 | Ga0501072_0006856_1935_3110 | 384 |
| 654 | 3300049592 | Ga0501076_0001930 | Ga0501076_0001930_12229_13404 | 384 |
| 655 | 3300049741 | Ga0501079_0001432 | Ga0501079_0001432_6767_7942 | 384 |
| 656 | 3300049743 | Ga0501081_0004050 | Ga0501081_0004050_3241_4416 | 384 |
| 657 | 3300050510 | nmdc:mga06r32_52852_c1 | nmdc:mga06r32_52852_c1_2690_3868 | 384 |
| 658 | 3300050511 | nmdc:mga08y16_37237_c1 | nmdc:mga08y16_37237_c1_1545_2708 | 384 |
| 659 | 3300050513 | nmdc:mga0rr50_210015_c1 | nmdc:mga0rr50_210015_c1_378_1556 | 384 |
| 660 | 3300054114 | Ga0501084_0015576 | Ga0501084_0015576_2075_3250 | 384 |
| 661 | 3300060353 | Ga0501082_0025146 | Ga0501082_0025146_3219_4394 | 384 |
| 662 | 3300061734 | Ga0530510_0005240 | Ga0530510_0005240_1966_3141 | 384 |
| 663 | 3300005435 | Ga0070714_100120648 | Ga0070714_1001206481 | 385 |
| 664 | 3300005436 | Ga0070713_100000026 | Ga0070713_10000002614 | 385 |
| 665 | 3300005458 | Ga0070681_10000591 | Ga0070681_1000059113 | 385 |
| 666 | 3300005467 | Ga0070706_100013361 | Ga0070706_1000133615 | 385 |
| 667 | 3300005530 | Ga0070679_100110668 | Ga0070679_1001106682 | 385 |
| 668 | 3300005536 | Ga0070697_100006508 | Ga0070697_1000065088 | 385 |
| 669 | 3300005563 | Ga0068855_100358908 | Ga0068855_1003589082 | 385 |
| 670 | 3300006846 | Ga0075430_100000744 | Ga0075430_1000007443 | 385 |
| 671 | 3300006871 | Ga0075434_100000072 | Ga0075434_10000007247 | 385 |
| 672 | 3300007076 | Ga0075435_100002554 | Ga0075435_1000025544 | 385 |
| 673 | 3300007076 | Ga0075435_100160042 | Ga0075435_1001600422 | 385 |
| 674 | 3300009094 | Ga0111539_10269538 | Ga0111539_102695383 | 385 |
| 675 | 3300009147 | Ga0114129_10057183 | Ga0114129_100571835 | 385 |
| 676 | 3300013104 | Ga0157370_10002404 | Ga0157370_100024043 | 385 |
| 677 | 3300014326 | Ga0157380_10300573 | Ga0157380_103005731 | 385 |
| 678 | 3300014969 | Ga0157376_10003620 | Ga0157376_100036208 | 385 |
| 679 | 3300025912 | Ga0207707_10001629 | Ga0207707_1000162911 | 385 |
| 680 | 3300025921 | Ga0207652_10045778 | Ga0207652_100457784 | 385 |
| 681 | 3300025928 | Ga0207700_10000375 | Ga0207700_1000037523 | 385 |
| 682 | 3300025929 | Ga0207664_10036805 | Ga0207664_100368052 | 385 |
| 683 | 3300025949 | Ga0207667_10012582 | Ga0207667_100125825 | 385 |
| 684 | 3300026078 | Ga0207702_10098222 | Ga0207702_100982222 | 385 |
| 685 | 3300027907 | Ga0207428_10135074 | Ga0207428_101350742 | 385 |
| 686 | 3300042437 | Ga0439444_0000219 | Ga0439444_0000219_3955_5133 | 385 |
| 687 | 3300042461 | Ga0439460_0000400 | Ga0439460_0000400_3689_4867 | 385 |
| 688 | 3300046528 | Ga0495642_0020765 | Ga0495642_0020765_1202_2368 | 385 |
| 689 | 3300049576 | Ga0501040_0058683 | Ga0501040_0058683_977_2155 | 385 |
| 690 | 3300049584 | Ga0501068_0174237 | Ga0501068_0174237_156_1331 | 385 |
| 691 | 3300049588 | Ga0501072_0073752 | Ga0501072_0073752_563_1729 | 385 |
| 692 | 3300050508 | nmdc:mga09592_301692_c1 | nmdc:mga09592_301692_c1_143_1318 | 385 |
| 693 | 3300050509 | nmdc:mga0qj67_570_c1 | nmdc:mga0qj67_570_c1_5957_7123 | 385 |
| 694 | 3300050510 | nmdc:mga06r32_104794_c1 | nmdc:mga06r32_104794_c1_801_1967 | 385 |
| 695 | 3300050512 | nmdc:mga0n895_1603_c1 | nmdc:mga0n895_1603_c1_10678_11856 | 385 |
| 696 | 3300050512 | nmdc:mga0n895_267816_c1 | nmdc:mga0n895_267816_c1_535_1719 | 385 |
| 697 | 3300050513 | nmdc:mga0rr50_626_c1 | nmdc:mga0rr50_626_c1_2767_3945 | 385 |
| 698 | 3300050514 | nmdc:mga08x19_32882_c1 | nmdc:mga08x19_32882_c1_1682_2860 | 385 |
| 699 | 3300050515 | nmdc:mga0a205_99575_c1 | nmdc:mga0a205_99575_c1_1259_2452 | 385 |
| 700 | 3300005293 | Ga0065715_10026169 | Ga0065715_100261693 | 386 |
| 701 | 3300005327 | Ga0070658_10083502 | Ga0070658_100835022 | 386 |
| 702 | 3300005328 | Ga0070676_10002958 | Ga0070676_100029589 | 386 |
| 703 | 3300005328 | Ga0070676_10071763 | Ga0070676_100717631 | 386 |
| 704 | 3300005331 | Ga0070670_100006584 | Ga0070670_1000065848 | 386 |
| 705 | 3300005333 | Ga0070677_10000132 | Ga0070677_1000013223 | 386 |
| 706 | 3300005334 | Ga0068869_100028754 | Ga0068869_1000287544 | 386 |
| 707 | 3300005335 | Ga0070666_10002288 | Ga0070666_100022888 | 386 |
| 708 | 3300005335 | Ga0070666_10030816 | Ga0070666_100308162 | 386 |
| 709 | 3300005335 | Ga0070666_10181371 | Ga0070666_101813711 | 386 |
| 710 | 3300005336 | Ga0070680_100056068 | Ga0070680_1000560683 | 386 |
| 711 | 3300005338 | Ga0068868_100005576 | Ga0068868_1000055766 | 386 |
| 712 | 3300005338 | Ga0068868_100043949 | Ga0068868_1000439494 | 386 |
| 713 | 3300005347 | Ga0070668_100000394 | Ga0070668_10000039415 | 386 |
| 714 | 3300005347 | Ga0070668_100042616 | Ga0070668_1000426164 | 386 |
| 715 | 3300005354 | Ga0070675_100000331 | Ga0070675_10000033130 | 386 |
| 716 | 3300005355 | Ga0070671_100019005 | Ga0070671_1000190054 | 386 |
| 717 | 3300005355 | Ga0070671_100119784 | Ga0070671_1001197842 | 386 |
| 718 | 3300005356 | Ga0070674_100102619 | Ga0070674_1001026192 | 386 |
| 719 | 3300005356 | Ga0070674_100112724 | Ga0070674_1001127243 | 386 |
| 720 | 3300005364 | Ga0070673_100000864 | Ga0070673_10000086416 | 386 |
| 721 | 3300005364 | Ga0070673_100060353 | Ga0070673_1000603533 | 386 |
| 722 | 3300005365 | Ga0070688_100084572 | Ga0070688_1000845722 | 386 |
| 723 | 3300005367 | Ga0070667_100010248 | Ga0070667_1000102484 | 386 |
| 724 | 3300005367 | Ga0070667_100116327 | Ga0070667_1001163271 | 386 |
| 725 | 3300005440 | Ga0070705_100192981 | Ga0070705_1001929811 | 386 |
| 726 | 3300005444 | Ga0070694_100031467 | Ga0070694_1000314674 | 386 |
| 727 | 3300005445 | Ga0070708_100000244 | Ga0070708_10000024433 | 386 |
| 728 | 3300005455 | Ga0070663_100042005 | Ga0070663_1000420052 | 386 |
| 729 | 3300005456 | Ga0070678_100001058 | Ga0070678_1000010584 | 386 |
| 730 | 3300005456 | Ga0070678_100001348 | Ga0070678_1000013484 | 386 |
| 731 | 3300005459 | Ga0068867_100003590 | Ga0068867_1000035904 | 386 |
| 732 | 3300005536 | Ga0070697_100038739 | Ga0070697_1000387392 | 386 |
| 733 | 3300005539 | Ga0068853_100002757 | Ga0068853_1000027571 | 386 |
| 734 | 3300005543 | Ga0070672_100052637 | Ga0070672_1000526372 | 386 |
| 735 | 3300005544 | Ga0070686_100022128 | Ga0070686_1000221282 | 386 |
| 736 | 3300005546 | Ga0070696_100002873 | Ga0070696_10000287310 | 386 |
| 737 | 3300005546 | Ga0070696_100029845 | Ga0070696_1000298455 | 386 |
| 738 | 3300005546 | Ga0070696_100044653 | Ga0070696_1000446534 | 386 |
| 739 | 3300005548 | Ga0070665_100012901 | Ga0070665_1000129015 | 386 |
| 740 | 3300005549 | Ga0070704_100008012 | Ga0070704_1000080124 | 386 |
| 741 | 3300005564 | Ga0070664_100067479 | Ga0070664_1000674793 | 386 |
| 742 | 3300005614 | Ga0068856_100022222 | Ga0068856_1000222226 | 386 |
| 743 | 3300005615 | Ga0070702_100046926 | Ga0070702_1000469262 | 386 |
| 744 | 3300005616 | Ga0068852_100059635 | Ga0068852_1000596352 | 386 |
| 745 | 3300005617 | Ga0068859_100012677 | Ga0068859_1000126779 | 386 |
| 746 | 3300005617 | Ga0068859_100197894 | Ga0068859_1001978942 | 386 |
| 747 | 3300005618 | Ga0068864_100002228 | Ga0068864_1000022282 | 386 |
| 748 | 3300005618 | Ga0068864_100017374 | Ga0068864_1000173745 | 386 |
| 749 | 3300005719 | Ga0068861_100159755 | Ga0068861_1001597552 | 386 |
| 750 | 3300005834 | Ga0068851_10017527 | Ga0068851_100175274 | 386 |
| 751 | 3300005840 | Ga0068870_10016973 | Ga0068870_100169733 | 386 |
| 752 | 3300005841 | Ga0068863_100013029 | Ga0068863_1000130293 | 386 |
| 753 | 3300005842 | Ga0068858_100000612 | Ga0068858_10000061219 | 386 |
| 754 | 3300005842 | Ga0068858_100010466 | Ga0068858_1000104669 | 386 |
| 755 | 3300005843 | Ga0068860_100044323 | Ga0068860_1000443235 | 386 |
| 756 | 3300005843 | Ga0068860_100077813 | Ga0068860_1000778134 | 386 |
| 757 | 3300005844 | Ga0068862_100361584 | Ga0068862_1003615841 | 386 |
| 758 | 3300006237 | Ga0097621_100017589 | Ga0097621_1000175891 | 386 |
| 759 | 3300006237 | Ga0097621_100038903 | Ga0097621_1000389032 | 386 |
| 760 | 3300006358 | Ga0068871_100032604 | Ga0068871_1000326043 | 386 |
| 761 | 3300006358 | Ga0068871_100049131 | Ga0068871_1000491314 | 386 |
| 762 | 3300006358 | Ga0068871_100192975 | Ga0068871_1001929751 | 386 |
| 763 | 3300006846 | Ga0075430_100043796 | Ga0075430_1000437963 | 386 |
| 764 | 3300006847 | Ga0075431_100067720 | Ga0075431_1000677201 | 386 |
| 765 | 3300006852 | Ga0075433_10002752 | Ga0075433_1000275214 | 386 |
| 766 | 3300006871 | Ga0075434_100002297 | Ga0075434_10000229716 | 386 |
| 767 | 3300006881 | Ga0068865_100013757 | Ga0068865_1000137576 | 386 |
| 768 | 3300006914 | Ga0075436_100064732 | Ga0075436_1000647322 | 386 |
| 769 | 3300006931 | Ga0097620_100012677 | Ga0097620_1000126779 | 386 |
| 770 | 3300006931 | Ga0097620_100197907 | Ga0097620_1001979072 | 386 |
| 771 | 3300007076 | Ga0075435_100001177 | Ga0075435_10000117716 | 386 |
| 772 | 3300009177 | Ga0105248_10266796 | Ga0105248_102667962 | 386 |
| 773 | 3300013104 | Ga0157370_10050708 | Ga0157370_100507082 | 386 |
| 774 | 3300013296 | Ga0157374_10001736 | Ga0157374_100017364 | 386 |
| 775 | 3300013297 | Ga0157378_10004675 | Ga0157378_100046753 | 386 |
| 776 | 3300013306 | Ga0163162_10087391 | Ga0163162_100873913 | 386 |
| 777 | 3300013307 | Ga0157372_10011850 | Ga0157372_100118503 | 386 |
| 778 | 3300013307 | Ga0157372_10258427 | Ga0157372_102584272 | 386 |
| 779 | 3300013308 | Ga0157375_10013200 | Ga0157375_100132007 | 386 |
| 780 | 3300013308 | Ga0157375_10058150 | Ga0157375_100581503 | 386 |
| 781 | 3300014325 | Ga0163163_10178375 | Ga0163163_101783753 | 386 |
| 782 | 3300014968 | Ga0157379_10005162 | Ga0157379_100051626 | 386 |
| 783 | 3300014968 | Ga0157379_10019810 | Ga0157379_100198103 | 386 |
| 784 | 3300014969 | Ga0157376_10012494 | Ga0157376_100124944 | 386 |
| 785 | 3300017792 | Ga0163161_10019913 | Ga0163161_100199132 | 386 |
| 786 | 3300025321 | Ga0207656_10007341 | Ga0207656_100073412 | 386 |
| 787 | 3300025893 | Ga0207682_10000044 | Ga0207682_1000004428 | 386 |
| 788 | 3300025907 | Ga0207645_10000590 | Ga0207645_100005902 | 386 |
| 789 | 3300025907 | Ga0207645_10001566 | Ga0207645_1000156613 | 386 |
| 790 | 3300025908 | Ga0207643_10029280 | Ga0207643_100292805 | 386 |
| 791 | 3300025909 | Ga0207705_10069511 | Ga0207705_100695114 | 386 |
| 792 | 3300025917 | Ga0207660_10065721 | Ga0207660_100657212 | 386 |
| 793 | 3300025917 | Ga0207660_10185416 | Ga0207660_101854162 | 386 |
| 794 | 3300025923 | Ga0207681_10095094 | Ga0207681_100950942 | 386 |
| 795 | 3300025926 | Ga0207659_10002022 | Ga0207659_100020222 | 386 |
| 796 | 3300025926 | Ga0207659_10002849 | Ga0207659_100028499 | 386 |
| 797 | 3300025931 | Ga0207644_10004238 | Ga0207644_100042388 | 386 |
| 798 | 3300025931 | Ga0207644_10008540 | Ga0207644_100085408 | 386 |
| 799 | 3300025937 | Ga0207669_10132096 | Ga0207669_101320962 | 386 |
| 800 | 3300025940 | Ga0207691_10000022 | Ga0207691_1000002237 | 386 |
| 801 | 3300025940 | Ga0207691_10000224 | Ga0207691_1000022416 | 386 |
| 802 | 3300025941 | Ga0207711_10012405 | Ga0207711_100124054 | 386 |
| 803 | 3300025942 | Ga0207689_10039935 | Ga0207689_100399352 | 386 |
| 804 | 3300025944 | Ga0207661_10082231 | Ga0207661_100822313 | 386 |
| 805 | 3300025960 | Ga0207651_10013505 | Ga0207651_100135052 | 386 |
| 806 | 3300025960 | Ga0207651_10092471 | Ga0207651_100924713 | 386 |
| 807 | 3300025972 | Ga0207668_10016076 | Ga0207668_100160764 | 386 |
| 808 | 3300025972 | Ga0207668_10041154 | Ga0207668_100411542 | 386 |
| 809 | 3300025972 | Ga0207668_10041705 | Ga0207668_100417053 | 386 |
| 810 | 3300025986 | Ga0207658_10011567 | Ga0207658_100115674 | 386 |
| 811 | 3300026023 | Ga0207677_10084101 | Ga0207677_100841013 | 386 |
| 812 | 3300026041 | Ga0207639_10006189 | Ga0207639_100061894 | 386 |
| 813 | 3300026067 | Ga0207678_10021448 | Ga0207678_100214484 | 386 |
| 814 | 3300026078 | Ga0207702_10106709 | Ga0207702_101067093 | 386 |
| 815 | 3300026088 | Ga0207641_10010037 | Ga0207641_100100374 | 386 |
| 816 | 3300026088 | Ga0207641_10039034 | Ga0207641_100390344 | 386 |
| 817 | 3300026089 | Ga0207648_10000089 | Ga0207648_1000008982 | 386 |
| 818 | 3300026089 | Ga0207648_10003749 | Ga0207648_100037496 | 386 |
| 819 | 3300026095 | Ga0207676_10004846 | Ga0207676_100048469 | 386 |
| 820 | 3300026121 | Ga0207683_10000283 | Ga0207683_1000028324 | 386 |
| 821 | 3300026121 | Ga0207683_10001343 | Ga0207683_100013436 | 386 |
| 822 | 3300026142 | Ga0207698_10006776 | Ga0207698_100067766 | 386 |
| 823 | 3300027471 | Ga0209995_1000765 | Ga0209995_10007651 | 386 |
| 824 | 3300028379 | Ga0268266_10003808 | Ga0268266_1000380814 | 386 |
| 825 | 3300028379 | Ga0268266_10085660 | Ga0268266_100856602 | 386 |
| 826 | 3300031238 | Ga0265332_10001972 | Ga0265332_100019723 | 386 |
| 827 | 3300031250 | Ga0265331_10001617 | Ga0265331_100016178 | 386 |
| 828 | 3300031712 | Ga0265342_10011453 | Ga0265342_100114532 | 386 |
| 829 | 3300032002 | Ga0307416_100025400 | Ga0307416_1000254002 | 386 |
| 830 | 3300034820 | Ga0373959_0004801 | Ga0373959_0004801_25_1218 | 386 |
| 831 | 3300035091 | Ga0373951_0002478 | Ga0373951_0002478_3032_4225 | 386 |
| 832 | 3300035112 | Ga0373932_0002947 | Ga0373932_0002947_2460_3653 | 386 |
| 833 | 3300035114 | Ga0373939_0003489 | Ga0373939_0003489_1458_2651 | 386 |
| 834 | 3300035115 | Ga0373941_0012599 | Ga0373941_0012599_968_2161 | 386 |
| 835 | 3300035118 | Ga0373954_0000190 | Ga0373954_0000190_6626_7795 | 386 |
| 836 | 3300035172 | Ga0373955_0023682 | Ga0373955_0023682_1670_2842 | 386 |
| 837 | 3300035207 | Ga0373942_0002583 | Ga0373942_0002583_2569_3738 | 386 |
| 838 | 3300035691 | Ga0373931_0000211 | Ga0373931_0000211_13613_14806 | 386 |
| 839 | 3300035691 | Ga0373931_0010357 | Ga0373931_0010357_3104_4276 | 386 |
| 840 | 3300036401 | Ga0373937_0003543 | Ga0373937_0003543_11269_12438 | 386 |
| 841 | 3300036401 | Ga0373937_0085863 | Ga0373937_0085863_337_1509 | 386 |
| 842 | 3300041486 | Ga0451807_0803462 | Ga0451807_0803462_1931_3103 | 386 |
| 843 | 3300042876 | Ga0451577_0028262 | Ga0451577_0028262_2768_3940 | 386 |
| 844 | 3300045051 | Ga0451576_0000717 | Ga0451576_0000717_60119_61291 | 386 |
| 845 | 3300046476 | Ga0495662_0064117 | Ga0495662_0064117_446_1615 | 386 |
| 846 | 3300046535 | Ga0495586_0044286 | Ga0495586_0044286_1123_2292 | 386 |
| 847 | 3300046537 | Ga0495598_0014774 | Ga0495598_0014774_261_1433 | 386 |
| 848 | 3300048911 | Ga0496108_0196137 | Ga0496108_0196137_126_1301 | 386 |
| 849 | 3300049569 | Ga0501032_0159011 | Ga0501032_0159011_146_1336 | 386 |
| 850 | 3300049570 | Ga0501033_0066034 | Ga0501033_0066034_569_1759 | 386 |
| 851 | 3300049577 | Ga0501041_0063723 | Ga0501041_0063723_50_1219 | 386 |
| 852 | 3300049578 | Ga0501042_0150441 | Ga0501042_0150441_229_1416 | 386 |
| 853 | 3300049580 | Ga0501046_0022216 | Ga0501046_0022216_3026_4216 | 386 |
| 854 | 3300049583 | Ga0501067_0135554 | Ga0501067_0135554_59_1234 | 386 |
| 855 | 3300049588 | Ga0501072_0053645 | Ga0501072_0053645_1061_2251 | 386 |
| 856 | 3300049592 | Ga0501076_0002817 | Ga0501076_0002817_523_1713 | 386 |
| 857 | 3300049741 | Ga0501079_0059998 | Ga0501079_0059998_273_1442 | 386 |
| 858 | 3300049742 | Ga0501080_0066030 | Ga0501080_0066030_339_1508 | 386 |
| 859 | 3300049743 | Ga0501081_0005463 | Ga0501081_0005463_6703_7872 | 386 |
| 860 | 3300049743 | Ga0501081_0007324 | Ga0501081_0007324_1353_2543 | 386 |
| 861 | 3300049824 | Ga0501045_0004925 | Ga0501045_0004925_1543_2733 | 386 |
| 862 | 3300050510 | nmdc:mga06r32_238785_c1 | nmdc:mga06r32_238785_c1_86_1258 | 386 |
| 863 | 3300050512 | nmdc:mga0n895_173933_c1 | nmdc:mga0n895_173933_c1_426_1688 | 386 |
| 864 | 3300050514 | nmdc:mga08x19_117640_c1 | nmdc:mga08x19_117640_c1_348_1517 | 386 |
| 865 | 3300050515 | nmdc:mga0a205_75_c1 | nmdc:mga0a205_75_c1_27244_28506 | 386 |
| 866 | 3300054114 | Ga0501084_0033682 | Ga0501084_0033682_2608_3798 | 386 |
| 867 | 3300054114 | Ga0501084_0042749 | Ga0501084_0042749_2036_3205 | 386 |
| 868 | 3300005335 | Ga0070666_10000956 | Ga0070666_100009568 | 387 |
| 869 | 3300005337 | Ga0070682_100093297 | Ga0070682_1000932971 | 387 |
| 870 | 3300005339 | Ga0070660_100004428 | Ga0070660_1000044288 | 387 |
| 871 | 3300005339 | Ga0070660_100042189 | Ga0070660_1000421893 | 387 |
| 872 | 3300005340 | Ga0070689_100001046 | Ga0070689_10000104610 | 387 |
| 873 | 3300005344 | Ga0070661_100013155 | Ga0070661_1000131552 | 387 |
| 874 | 3300005345 | Ga0070692_10009740 | Ga0070692_100097403 | 387 |
| 875 | 3300005353 | Ga0070669_100085811 | Ga0070669_1000858112 | 387 |
| 876 | 3300005354 | Ga0070675_100071748 | Ga0070675_1000717483 | 387 |
| 877 | 3300005355 | Ga0070671_100008289 | Ga0070671_1000082893 | 387 |
| 878 | 3300005356 | Ga0070674_100022136 | Ga0070674_1000221362 | 387 |
| 879 | 3300005364 | Ga0070673_100000604 | Ga0070673_10000060413 | 387 |
| 880 | 3300005365 | Ga0070688_100000230 | Ga0070688_10000023014 | 387 |
| 881 | 3300005366 | Ga0070659_100003790 | Ga0070659_1000037904 | 387 |
| 882 | 3300005366 | Ga0070659_100023109 | Ga0070659_1000231094 | 387 |
| 883 | 3300005366 | Ga0070659_100095385 | Ga0070659_1000953852 | 387 |
| 884 | 3300005435 | Ga0070714_100054800 | Ga0070714_1000548004 | 387 |
| 885 | 3300005436 | Ga0070713_100015306 | Ga0070713_1000153066 | 387 |
| 886 | 3300005436 | Ga0070713_100015774 | Ga0070713_1000157747 | 387 |
| 887 | 3300005437 | Ga0070710_10003855 | Ga0070710_100038552 | 387 |
| 888 | 3300005439 | Ga0070711_100003823 | Ga0070711_1000038232 | 387 |
| 889 | 3300005440 | Ga0070705_100032917 | Ga0070705_1000329172 | 387 |
| 890 | 3300005440 | Ga0070705_100050606 | Ga0070705_1000506062 | 387 |
| 891 | 3300005456 | Ga0070678_100002956 | Ga0070678_1000029562 | 387 |
| 892 | 3300005457 | Ga0070662_100001081 | Ga0070662_1000010814 | 387 |
| 893 | 3300005457 | Ga0070662_100011777 | Ga0070662_1000117774 | 387 |
| 894 | 3300005458 | Ga0070681_10235524 | Ga0070681_102355242 | 387 |
| 895 | 3300005459 | Ga0068867_100039935 | Ga0068867_1000399353 | 387 |
| 896 | 3300005466 | Ga0070685_10001090 | Ga0070685_100010906 | 387 |
| 897 | 3300005467 | Ga0070706_100051853 | Ga0070706_1000518532 | 387 |
| 898 | 3300005535 | Ga0070684_100001615 | Ga0070684_10000161511 | 387 |
| 899 | 3300005539 | Ga0068853_100022134 | Ga0068853_1000221341 | 387 |
| 900 | 3300005539 | Ga0068853_100059584 | Ga0068853_1000595842 | 387 |
| 901 | 3300005543 | Ga0070672_100007832 | Ga0070672_1000078322 | 387 |
| 902 | 3300005548 | Ga0070665_100005917 | Ga0070665_1000059178 | 387 |
| 903 | 3300005548 | Ga0070665_100140576 | Ga0070665_1001405763 | 387 |
| 904 | 3300005549 | Ga0070704_100279965 | Ga0070704_1002799651 | 387 |
| 905 | 3300005563 | Ga0068855_100016816 | Ga0068855_1000168165 | 387 |
| 906 | 3300005564 | Ga0070664_100013471 | Ga0070664_1000134714 | 387 |
| 907 | 3300005564 | Ga0070664_100149220 | Ga0070664_1001492202 | 387 |
| 908 | 3300005614 | Ga0068856_100001379 | Ga0068856_10000137920 | 387 |
| 909 | 3300005616 | Ga0068852_100002691 | Ga0068852_1000026912 | 387 |
| 910 | 3300005616 | Ga0068852_100018064 | Ga0068852_1000180644 | 387 |
| 911 | 3300005617 | Ga0068859_100000264 | Ga0068859_10000026435 | 387 |
| 912 | 3300005618 | Ga0068864_100000916 | Ga0068864_10000091617 | 387 |
| 913 | 3300006163 | Ga0070715_10030822 | Ga0070715_100308221 | 387 |
| 914 | 3300006173 | Ga0070716_100003120 | Ga0070716_1000031205 | 387 |
| 915 | 3300006175 | Ga0070712_100000161 | Ga0070712_10000016113 | 387 |
| 916 | 3300006237 | Ga0097621_100009465 | Ga0097621_1000094659 | 387 |
| 917 | 3300006358 | Ga0068871_100085416 | Ga0068871_1000854163 | 387 |
| 918 | 3300006844 | Ga0075428_100067479 | Ga0075428_1000674793 | 387 |
| 919 | 3300006847 | Ga0075431_100095124 | Ga0075431_1000951242 | 387 |
| 920 | 3300006931 | Ga0097620_100000264 | Ga0097620_10000026435 | 387 |
| 921 | 3300009147 | Ga0114129_10066712 | Ga0114129_100667125 | 387 |
| 922 | 3300009174 | Ga0105241_10027447 | Ga0105241_100274472 | 387 |
| 923 | 3300009174 | Ga0105241_10042066 | Ga0105241_100420661 | 387 |
| 924 | 3300009177 | Ga0105248_10004100 | Ga0105248_1000410014 | 387 |
| 925 | 3300009545 | Ga0105237_10188996 | Ga0105237_101889962 | 387 |
| 926 | 3300010375 | Ga0105239_10271650 | Ga0105239_102716502 | 387 |
| 927 | 3300010375 | Ga0105239_10333231 | Ga0105239_103332312 | 387 |
| 928 | 3300011119 | Ga0105246_10007984 | Ga0105246_100079845 | 387 |
| 929 | 3300013100 | Ga0157373_10001932 | Ga0157373_100019326 | 387 |
| 930 | 3300013100 | Ga0157373_10003632 | Ga0157373_100036322 | 387 |
| 931 | 3300013100 | Ga0157373_10219848 | Ga0157373_102198481 | 387 |
| 932 | 3300013102 | Ga0157371_10000303 | Ga0157371_1000030356 | 387 |
| 933 | 3300013102 | Ga0157371_10095081 | Ga0157371_100950811 | 387 |
| 934 | 3300013104 | Ga0157370_10011858 | Ga0157370_100118582 | 387 |
| 935 | 3300013104 | Ga0157370_10016198 | Ga0157370_100161982 | 387 |
| 936 | 3300013105 | Ga0157369_10119962 | Ga0157369_101199624 | 387 |
| 937 | 3300013296 | Ga0157374_10000954 | Ga0157374_100009549 | 387 |
| 938 | 3300013297 | Ga0157378_10142923 | Ga0157378_101429232 | 387 |
| 939 | 3300013307 | Ga0157372_10008434 | Ga0157372_100084348 | 387 |
| 940 | 3300013307 | Ga0157372_10097839 | Ga0157372_100978393 | 387 |
| 941 | 3300013307 | Ga0157372_10404695 | Ga0157372_104046952 | 387 |
| 942 | 3300013308 | Ga0157375_10001655 | Ga0157375_1000165512 | 387 |
| 943 | 3300013308 | Ga0157375_10225102 | Ga0157375_102251022 | 387 |
| 944 | 3300014325 | Ga0163163_10000225 | Ga0163163_1000022543 | 387 |
| 945 | 3300014968 | Ga0157379_10001851 | Ga0157379_1000185114 | 387 |
| 946 | 3300017792 | Ga0163161_10028638 | Ga0163161_100286382 | 387 |
| 947 | 3300025898 | Ga0207692_10019407 | Ga0207692_100194074 | 387 |
| 948 | 3300025903 | Ga0207680_10000757 | Ga0207680_100007572 | 387 |
| 949 | 3300025907 | Ga0207645_10011786 | Ga0207645_100117865 | 387 |
| 950 | 3300025907 | Ga0207645_10020128 | Ga0207645_100201283 | 387 |
| 951 | 3300025910 | Ga0207684_10062819 | Ga0207684_100628193 | 387 |
| 952 | 3300025911 | Ga0207654_10040723 | Ga0207654_100407232 | 387 |
| 953 | 3300025912 | Ga0207707_10116682 | Ga0207707_101166823 | 387 |
| 954 | 3300025912 | Ga0207707_10140668 | Ga0207707_101406682 | 387 |
| 955 | 3300025913 | Ga0207695_10058138 | Ga0207695_100581382 | 387 |
| 956 | 3300025915 | Ga0207693_10000075 | Ga0207693_1000007576 | 387 |
| 957 | 3300025915 | Ga0207693_10066228 | Ga0207693_100662284 | 387 |
| 958 | 3300025916 | Ga0207663_10005149 | Ga0207663_100051495 | 387 |
| 959 | 3300025916 | Ga0207663_10099085 | Ga0207663_100990852 | 387 |
| 960 | 3300025917 | Ga0207660_10098596 | Ga0207660_100985962 | 387 |
| 961 | 3300025918 | Ga0207662_10020257 | Ga0207662_100202572 | 387 |
| 962 | 3300025919 | Ga0207657_10000160 | Ga0207657_1000016059 | 387 |
| 963 | 3300025919 | Ga0207657_10001114 | Ga0207657_100011148 | 387 |
| 964 | 3300025919 | Ga0207657_10010217 | Ga0207657_100102179 | 387 |
| 965 | 3300025919 | Ga0207657_10041179 | Ga0207657_100411792 | 387 |
| 966 | 3300025919 | Ga0207657_10115206 | Ga0207657_101152062 | 387 |
| 967 | 3300025920 | Ga0207649_10011309 | Ga0207649_100113094 | 387 |
| 968 | 3300025920 | Ga0207649_10090977 | Ga0207649_100909772 | 387 |
| 969 | 3300025927 | Ga0207687_10059098 | Ga0207687_100590984 | 387 |
| 970 | 3300025928 | Ga0207700_10001042 | Ga0207700_100010429 | 387 |
| 971 | 3300025928 | Ga0207700_10054627 | Ga0207700_100546272 | 387 |
| 972 | 3300025929 | Ga0207664_10106868 | Ga0207664_101068682 | 387 |
| 973 | 3300025929 | Ga0207664_10234165 | Ga0207664_102341652 | 387 |
| 974 | 3300025931 | Ga0207644_10004260 | Ga0207644_100042603 | 387 |
| 975 | 3300025931 | Ga0207644_10007845 | Ga0207644_100078452 | 387 |
| 976 | 3300025932 | Ga0207690_10028675 | Ga0207690_100286752 | 387 |
| 977 | 3300025933 | Ga0207706_10000023 | Ga0207706_10000023121 | 387 |
| 978 | 3300025933 | Ga0207706_10012342 | Ga0207706_100123428 | 387 |
| 979 | 3300025934 | Ga0207686_10002631 | Ga0207686_100026317 | 387 |
| 980 | 3300025936 | Ga0207670_10008559 | Ga0207670_100085594 | 387 |
| 981 | 3300025937 | Ga0207669_10005538 | Ga0207669_100055384 | 387 |
| 982 | 3300025939 | Ga0207665_10039585 | Ga0207665_100395852 | 387 |
| 983 | 3300025940 | Ga0207691_10008031 | Ga0207691_100080312 | 387 |
| 984 | 3300025941 | Ga0207711_10000092 | Ga0207711_1000009256 | 387 |
| 985 | 3300025942 | Ga0207689_10008652 | Ga0207689_100086523 | 387 |
| 986 | 3300025945 | Ga0207679_10010809 | Ga0207679_100108093 | 387 |
| 987 | 3300025945 | Ga0207679_10106268 | Ga0207679_101062682 | 387 |
| 988 | 3300025949 | Ga0207667_10026382 | Ga0207667_100263823 | 387 |
| 989 | 3300025949 | Ga0207667_10186021 | Ga0207667_101860212 | 387 |
| 990 | 3300025960 | Ga0207651_10000135 | Ga0207651_1000013514 | 387 |
| 991 | 3300025986 | Ga0207658_10001652 | Ga0207658_1000165215 | 387 |
| 992 | 3300026023 | Ga0207677_10011737 | Ga0207677_100117372 | 387 |
| 993 | 3300026035 | Ga0207703_10000820 | Ga0207703_1000082012 | 387 |
| 994 | 3300026041 | Ga0207639_10003328 | Ga0207639_100033284 | 387 |
| 995 | 3300026078 | Ga0207702_10004347 | Ga0207702_1000434710 | 387 |
| 996 | 3300026078 | Ga0207702_10011508 | Ga0207702_100115085 | 387 |
| 997 | 3300026088 | Ga0207641_10004870 | Ga0207641_100048707 | 387 |
| 998 | 3300026095 | Ga0207676_10000097 | Ga0207676_1000009744 | 387 |
| 999 | 3300026116 | Ga0207674_10000236 | Ga0207674_100002363 | 387 |
| 1000 | 3300026116 | Ga0207674_10007783 | Ga0207674_100077835 | 387 |
| 1001 | 3300026121 | Ga0207683_10003069 | Ga0207683_100030695 | 387 |
| 1002 | 3300026121 | Ga0207683_10223045 | Ga0207683_102230451 | 387 |
| 1003 | 3300026142 | Ga0207698_10021518 | Ga0207698_100215182 | 387 |
| 1004 | 3300028379 | Ga0268266_10011396 | Ga0268266_100113968 | 387 |
| 1005 | 3300028381 | Ga0268264_10023671 | Ga0268264_100236712 | 387 |
| 1006 | 3300031548 | Ga0307408_100018326 | Ga0307408_1000183265 | 387 |
| 1007 | 3300031731 | Ga0307405_10001503 | Ga0307405_100015033 | 387 |
| 1008 | 3300031824 | Ga0307413_10006139 | Ga0307413_100061391 | 387 |
| 1009 | 3300031852 | Ga0307410_10011320 | Ga0307410_100113203 | 387 |
| 1010 | 3300031901 | Ga0307406_10015337 | Ga0307406_100153373 | 387 |
| 1011 | 3300031903 | Ga0307407_10000312 | Ga0307407_100003124 | 387 |
| 1012 | 3300031995 | Ga0307409_100004420 | Ga0307409_1000044203 | 387 |
| 1013 | 3300032002 | Ga0307416_100006561 | Ga0307416_1000065612 | 387 |
| 1014 | 3300032005 | Ga0307411_10000630 | Ga0307411_100006304 | 387 |
| 1015 | 3300032126 | Ga0307415_100001036 | Ga0307415_10000103611 | 387 |
| 1016 | 3300035086 | Ga0373934_0001247 | Ga0373934_0001247_4044_5234 | 387 |
| 1017 | 3300035111 | Ga0373923_0002361 | Ga0373923_0002361_874_2064 | 387 |
| 1018 | 3300035113 | Ga0373936_0024397 | Ga0373936_0024397_430_1620 | 387 |
| 1019 | 3300035113 | Ga0373936_0027944 | Ga0373936_0027944_709_1899 | 387 |
| 1020 | 3300035117 | Ga0373953_0015475 | Ga0373953_0015475_469_1659 | 387 |
| 1021 | 3300035118 | Ga0373954_0002677 | Ga0373954_0002677_589_1779 | 387 |
| 1022 | 3300035118 | Ga0373954_0026208 | Ga0373954_0026208_1310_2500 | 387 |
| 1023 | 3300035120 | Ga0373957_0015384 | Ga0373957_0015384_1427_2617 | 387 |
| 1024 | 3300035170 | Ga0373943_0017634 | Ga0373943_0017634_166_1356 | 387 |
| 1025 | 3300035170 | Ga0373943_0050248 | Ga0373943_0050248_544_1734 | 387 |
| 1026 | 3300035172 | Ga0373955_0000975 | Ga0373955_0000975_1489_2679 | 387 |
| 1027 | 3300035692 | Ga0373935_0010631 | Ga0373935_0010631_922_2112 | 387 |
| 1028 | 3300035692 | Ga0373935_0039213 | Ga0373935_0039213_1099_2289 | 387 |
| 1029 | 3300035724 | Ga0373933_0001198 | Ga0373933_0001198_4652_5842 | 387 |
| 1030 | 3300035725 | Ga0373947_0025742 | Ga0373947_0025742_1348_2538 | 387 |
| 1031 | 3300035725 | Ga0373947_0030345 | Ga0373947_0030345_782_1972 | 387 |
| 1032 | 3300035725 | Ga0373947_0069821 | Ga0373947_0069821_132_1322 | 387 |
| 1033 | 3300036401 | Ga0373937_0002537 | Ga0373937_0002537_2576_3766 | 387 |
| 1034 | 3300036401 | Ga0373937_0024061 | Ga0373937_0024061_423_1613 | 387 |
| 1035 | 3300036401 | Ga0373937_0109042 | Ga0373937_0109042_1311_2510 | 387 |
| 1036 | 3300037068 | Ga0373925_0020666 | Ga0373925_0020666_2385_3575 | 387 |
| 1037 | 3300037068 | Ga0373925_0032450 | Ga0373925_0032450_2517_3731 | 387 |
| 1038 | 3300037466 | Ga0395898_0039327 | Ga0395898_0039327_3046_4230 | 387 |
| 1039 | 3300045051 | Ga0451576_0268556 | Ga0451576_0268556_148_1398 | 387 |
| 1040 | 3300046454 | Ga0495592_0005643 | Ga0495592_0005643_6883_8112 | 387 |
| 1041 | 3300046459 | Ga0495629_0017686 | Ga0495629_0017686_1554_2744 | 387 |
| 1042 | 3300046463 | Ga0495653_0183975 | Ga0495653_0183975_138_1328 | 387 |
| 1043 | 3300046472 | Ga0495580_0032991 | Ga0495580_0032991_1341_2531 | 387 |
| 1044 | 3300046473 | Ga0495582_0017872 | Ga0495582_0017872_2405_3595 | 387 |
| 1045 | 3300046476 | Ga0495662_0074210 | Ga0495662_0074210_402_1592 | 387 |
| 1046 | 3300046511 | Ga0495608_0005998 | Ga0495608_0005998_3758_4987 | 387 |
| 1047 | 3300046516 | Ga0495628_0020679 | Ga0495628_0020679_3759_4988 | 387 |
| 1048 | 3300046526 | Ga0495666_0076535 | Ga0495666_0076535_134_1315 | 387 |
| 1049 | 3300046529 | Ga0495652_0164752 | Ga0495652_0164752_489_1679 | 387 |
| 1050 | 3300046533 | Ga0495640_0150735 | Ga0495640_0150735_161_1351 | 387 |
| 1051 | 3300046535 | Ga0495586_0001577 | Ga0495586_0001577_4478_5707 | 387 |
| 1052 | 3300046535 | Ga0495586_0123956 | Ga0495586_0123956_150_1340 | 387 |
| 1053 | 3300046559 | Ga0495667_0037862 | Ga0495667_0037862_334_1515 | 387 |
| 1054 | 3300046642 | Ga0495634_0031516 | Ga0495634_0031516_1132_2361 | 387 |
| 1055 | 3300046663 | Ga0495635_0003031 | Ga0495635_0003031_1119_2309 | 387 |
| 1056 | 3300046664 | Ga0495659_0007805 | Ga0495659_0007805_1283_2473 | 387 |
| 1057 | 3300046679 | Ga0495623_0025917 | Ga0495623_0025917_700_1890 | 387 |
| 1058 | 3300046681 | Ga0495647_0044756 | Ga0495647_0044756_262_1452 | 387 |
| 1059 | 3300046683 | Ga0495658_0013973 | Ga0495658_0013973_830_2059 | 387 |
| 1060 | 3300046683 | Ga0495658_0119361 | Ga0495658_0119361_157_1347 | 387 |
| 1061 | 3300046689 | Ga0495613_0011703 | Ga0495613_0011703_863_2053 | 387 |
| 1062 | 3300046689 | Ga0495613_0023120 | Ga0495613_0023120_534_1763 | 387 |
| 1063 | 3300046809 | Ga0495600_0034611 | Ga0495600_0034611_644_1825 | 387 |
| 1064 | 3300046809 | Ga0495600_0148896 | Ga0495600_0148896_288_1478 | 387 |
| 1065 | 3300047315 | Ga0495581_0002924 | Ga0495581_0002924_7340_8530 | 387 |
| 1066 | 3300047317 | Ga0495604_0039016 | Ga0495604_0039016_1638_2828 | 387 |
| 1067 | 3300047322 | Ga0495680_0001182 | Ga0495680_0001182_24889_26118 | 387 |
| 1068 | 3300047471 | Ga0495684_0004189 | Ga0495684_0004189_10049_11239 | 387 |
| 1069 | 3300047673 | Ga0495593_0052353 | Ga0495593_0052353_311_1501 | 387 |
| 1070 | 3300048088 | Ga0495602_0054880 | Ga0495602_0054880_1709_2899 | 387 |
| 1071 | 3300048903 | Ga0496100_0081464 | Ga0496100_0081464_286_1476 | 387 |
| 1072 | 3300048905 | Ga0496102_0063871 | Ga0496102_0063871_830_2041 | 387 |
| 1073 | 3300048905 | Ga0496102_0092383 | Ga0496102_0092383_1234_2424 | 387 |
| 1074 | 3300048907 | Ga0496104_0000979 | Ga0496104_0000979_21333_22523 | 387 |
| 1075 | 3300048908 | Ga0496105_0004778 | Ga0496105_0004778_2134_3324 | 387 |
| 1076 | 3300048909 | Ga0496106_0003978 | Ga0496106_0003978_464_1675 | 387 |
| 1077 | 3300048912 | Ga0496109_0002675 | Ga0496109_0002675_10282_11472 | 387 |
| 1078 | 3300048913 | Ga0496110_0175682 | Ga0496110_0175682_515_1705 | 387 |
| 1079 | 3300048915 | Ga0496112_0002483 | Ga0496112_0002483_6364_7554 | 387 |
| 1080 | 3300048917 | Ga0496114_0079674 | Ga0496114_0079674_190_1380 | 387 |
| 1081 | 3300048918 | Ga0496115_0016973 | Ga0496115_0016973_3545_4735 | 387 |
| 1082 | 3300049587 | Ga0501071_0068028 | Ga0501071_0068028_559_1734 | 387 |
| 1083 | 3300049742 | Ga0501080_0256342 | Ga0501080_0256342_103_1278 | 387 |
| 1084 | 3300049743 | Ga0501081_0055997 | Ga0501081_0055997_642_1832 | 387 |
| 1085 | 3300050510 | nmdc:mga06r32_20725_c1 | nmdc:mga06r32_20725_c1_1620_2795 | 387 |
| 1086 | 3300053084 | Ga0495595_0087452 | Ga0495595_0087452_286_1476 | 387 |
| 1087 | 3300053085 | Ga0495619_0003146 | Ga0495619_0003146_1662_2852 | 387 |
| 1088 | 3300005335 | Ga0070666_10007688 | Ga0070666_100076887 | 388 |
| 1089 | 3300005344 | Ga0070661_100004644 | Ga0070661_1000046446 | 388 |
| 1090 | 3300005367 | Ga0070667_100010007 | Ga0070667_1000100072 | 388 |
| 1091 | 3300005456 | Ga0070678_100000982 | Ga0070678_10000098216 | 388 |
| 1092 | 3300005548 | Ga0070665_100003667 | Ga0070665_10000366715 | 388 |
| 1093 | 3300005548 | Ga0070665_100148142 | Ga0070665_1001481422 | 388 |
| 1094 | 3300005563 | Ga0068855_100079076 | Ga0068855_1000790763 | 388 |
| 1095 | 3300005564 | Ga0070664_100021935 | Ga0070664_1000219354 | 388 |
| 1096 | 3300005578 | Ga0068854_100013191 | Ga0068854_1000131912 | 388 |
| 1097 | 3300005616 | Ga0068852_100039269 | Ga0068852_1000392692 | 388 |
| 1098 | 3300006175 | Ga0070712_100039945 | Ga0070712_1000399452 | 388 |
| 1099 | 3300006237 | Ga0097621_100084754 | Ga0097621_1000847542 | 388 |
| 1100 | 3300009551 | Ga0105238_10235083 | Ga0105238_102350832 | 388 |
| 1101 | 3300013307 | Ga0157372_10071584 | Ga0157372_100715842 | 388 |
| 1102 | 3300013307 | Ga0157372_10154108 | Ga0157372_101541082 | 388 |
| 1103 | 3300025903 | Ga0207680_10068690 | Ga0207680_100686903 | 388 |
| 1104 | 3300025909 | Ga0207705_10029785 | Ga0207705_100297852 | 388 |
| 1105 | 3300025915 | Ga0207693_10051893 | Ga0207693_100518932 | 388 |
| 1106 | 3300025931 | Ga0207644_10161287 | Ga0207644_101612872 | 388 |
| 1107 | 3300025940 | Ga0207691_10034393 | Ga0207691_100343932 | 388 |
| 1108 | 3300025945 | Ga0207679_10021666 | Ga0207679_100216662 | 388 |
| 1109 | 3300025949 | Ga0207667_10025154 | Ga0207667_100251544 | 388 |
| 1110 | 3300025981 | Ga0207640_10016844 | Ga0207640_100168442 | 388 |
| 1111 | 3300026023 | Ga0207677_10062984 | Ga0207677_100629843 | 388 |
| 1112 | 3300026089 | Ga0207648_10006200 | Ga0207648_1000620010 | 388 |
| 1113 | 3300026116 | Ga0207674_10179580 | Ga0207674_101795802 | 388 |
| 1114 | 3300028379 | Ga0268266_10028877 | Ga0268266_100288772 | 388 |
| 1115 | 3300028800 | Ga0265338_10001649 | Ga0265338_1000164921 | 388 |
| 1116 | 3300035170 | Ga0373943_0023852 | Ga0373943_0023852_115_1323 | 388 |
| 1117 | 3300035725 | Ga0373947_0133146 | Ga0373947_0133146_352_1560 | 388 |
| 1118 | 3300046472 | Ga0495580_0028421 | Ga0495580_0028421_2690_3880 | 388 |
| 1119 | 3300048906 | Ga0496103_0060462 | Ga0496103_0060462_1143_2324 | 388 |
| 1120 | iso_pu_bacteria | 2818991436 | 2819542252 | 388 |
| 1121 | 3300049577 | Ga0501041_0017326 | Ga0501041_0017326_2618_3805 | 389 |
| 1122 | 3300049580 | Ga0501046_0049469 | Ga0501046_0049469_1283_2470 | 389 |
| 1123 | 3300006048 | Ga0075363_100010665 | Ga0075363_1000106655 | 391 |
| 1124 | 3300006177 | Ga0075362_10050760 | Ga0075362_100507602 | 391 |
| 1125 | 3300006353 | Ga0075370_10040878 | Ga0075370_100408783 | 391 |
| 1126 | 3300026088 | Ga0207641_10180077 | Ga0207641_101800773 | 391 |
| 1127 | 3300027866 | Ga0209813_10003834 | Ga0209813_100038343 | 391 |
| 1128 | 3300035692 | Ga0373935_0006447 | Ga0373935_0006447_4098_5429 | 391 |
| 1129 | 3300050489 | nmdc:mga03683_28632_c1 | nmdc:mga03683_28632_c1_773_1987 | 391 |
| 1130 | 3300050495 | nmdc:mga04h51_19898_c1 | nmdc:mga04h51_19898_c1_553_1767 | 391 |
| 1131 | 3300050496 | nmdc:mga07m45_95219_c1 | nmdc:mga07m45_95219_c1_161_1375 | 391 |
| 1132 | 3300002737 | JGI25162J39368_1000023 | JGI25162J39368_1000023191 | 392 |
| 1133 | 3300003214 | JGI25165J46597_1000030 | JGI25165J46597_1000030109 | 392 |
| 1134 | 3300003751 | Ga0055538_1000017 | Ga0055538_1000017191 | 392 |
| 1135 | 3300003752 | Ga0055539_1000022 | Ga0055539_1000022191 | 392 |
| 1136 | 3300003756 | Ga0055533_1000030 | Ga0055533_1000030191 | 392 |
| 1137 | 3300003759 | Ga0055525_1000034 | Ga0055525_1000034191 | 392 |
| 1138 | 3300003841 | Ga0055541_1000015 | Ga0055541_1000015191 | 392 |
| 1139 | 3300015265 | Ga0182005_1000134 | Ga0182005_100013457 | 392 |
| 1140 | 3300025207 | Ga0209760_103086 | Ga0209760_1030862 | 392 |
| 1141 | 3300025224 | Ga0209784_100034 | Ga0209784_100034109 | 392 |
| 1142 | 3300025225 | Ga0209566_100038 | Ga0209566_100038190 | 392 |
| 1143 | 3300025226 | Ga0209674_100056 | Ga0209674_100056109 | 392 |
| 1144 | 3300025230 | Ga0209563_100057 | Ga0209563_100057190 | 392 |
| 1145 | 3300025231 | Ga0207427_101302 | Ga0207427_1013024 | 392 |
| 1146 | 3300025233 | Ga0209437_100071 | Ga0209437_100071190 | 392 |
| 1147 | 3300025253 | Ga0209677_100035 | Ga0209677_100035109 | 392 |
| 1148 | 3300025261 | Ga0209233_1000094 | Ga0209233_1000094190 | 392 |
| 1149 | 3300046454 | Ga0495592_0015266 | Ga0495592_0015266_3749_4927 | 392 |
| 1150 | 3300046462 | Ga0495651_0054004 | Ga0495651_0054004_42_1220 | 392 |
| 1151 | 3300046463 | Ga0495653_0029078 | Ga0495653_0029078_83_1261 | 392 |
| 1152 | 3300046511 | Ga0495608_0024512 | Ga0495608_0024512_800_1978 | 392 |
| 1153 | 3300046514 | Ga0495618_0004023 | Ga0495618_0004023_3650_4828 | 392 |
| 1154 | 3300046516 | Ga0495628_0012137 | Ga0495628_0012137_1703_2881 | 392 |
| 1155 | 3300046529 | Ga0495652_0015115 | Ga0495652_0015115_4550_5728 | 392 |
| 1156 | 3300046543 | Ga0495645_0077557 | Ga0495645_0077557_154_1332 | 392 |
| 1157 | 3300046675 | Ga0495657_0038956 | Ga0495657_0038956_1528_2706 | 392 |
| 1158 | 3300046678 | Ga0495599_0000548 | Ga0495599_0000548_3945_5123 | 392 |
| 1159 | 3300046680 | Ga0495646_0063817 | Ga0495646_0063817_625_1803 | 392 |
| 1160 | 3300046690 | Ga0495624_0031322 | Ga0495624_0031322_58_1236 | 392 |
| 1161 | 3300046809 | Ga0495600_0000693 | Ga0495600_0000693_14351_15529 | 392 |
| 1162 | 3300047317 | Ga0495604_0033075 | Ga0495604_0033075_599_1777 | 392 |
| 1163 | 3300048088 | Ga0495602_0067075 | Ga0495602_0067075_697_1875 | 392 |
| 1164 | 3300053077 | Ga0495601_0039865 | Ga0495601_0039865_696_1874 | 392 |
| 1165 | 3300053141 | Ga0500574_005427 | Ga0500574_005427_1214_2392 | 392 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1o4s-assembly1.cif.gz_A | crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution | 0.9392 | 8 | 392 |
| 5wmh-assembly2.cif.gz_C | arabidopsis thaliana prephenate aminotransferase | 0.9377 | 7 | 390 |
| 1o4s-assembly1.cif.gz_A | crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution | 0.9368 | 8 | 392 |
| 2o0r-assembly1.cif.gz_B | the three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis | 0.9333 | 8 | 388 |
| 2z61-assembly1.cif.gz_A-2 | crystal structure of mj0684 from methanococcus jannaschii reveals its similarity in the active site to kynurenine aminotransferases | 0.9321 | 8 | 390 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xi9B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9565 | 291 | 391 | 3.90.1150.10 |
| 4cvqB01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9523 | 300 | 391 | 3.90.1150.10 |
| 1v2eB02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9512 | 47 | 288 | 3.40.640.10 |
| af_A0A1D6I5Q5_168_402_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9491 | 49 | 286 | 3.40.640.10 |
| af_Q2FZL1_278_379_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9463 | 289 | 387 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4D4JWV6-F1-model_v4 | Aminotransferase (EC 2.6.1.-) | 0.9835 | 9 | 392 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 |
| AF-A0A497PRW2-F1-model_v4 | Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | 0.9832 | 294 | 391 |
GO:0006520
GO:0008483 |
| AF-A0A2W4ZWD8-F1-model_v4 | Aminotransferase (EC 2.6.1.-) | 0.9739 | 144 | 388 |
GO:0006520
GO:0008483 GO:0009058 GO:0016829 GO:0030170 |
| AF-A0A4D4JWV6-F1-model_v4 | Aminotransferase (EC 2.6.1.-) | 0.966 | 9 | 392 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 |
| AF-A0A7S7SJI4-F1-model_v4 | Pyridoxal phosphate-dependent aminotransferase | 0.9654 | 5 | 392 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar