F491062

General Info

Members Datasets Scaffolds Average Seq Length
1165 445 1145 391

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100000982|Ga0070678_10000098216
Length 427
Sequence MEFAMDRGRRPGPAPAVYDAEIRRSFVQSHKPLVNAPPAAAARPAVRALVASQIREVANAAMDDPNVLAFWFGEPDEVTPAFIRDEAAAALARGETFYTHNFGIPELREAIAAYVSHWHRPTAVTSIAATASGMSALMLAVQSLVAPGDRVVVVTPLWPNLVEIPKILSGDVAIVPLAFGTRGWTLDVDRLLAALTPRTRVLMLNSPNNPTGWTISRAAQVAILAHCRRHGIWIVADDVYERLYYEGDAACAPSFLAIAHPDERVVSTNSFSKSWCMTGWRLGWIVAPPALMPDLGKLIEYNTSCSPVFVQRAGVAAITQGEPAVGRTRSRFRAARDYLVDALAALPGIEIAPPPGAMYAFFRVDGLTDSLGFCKDLVRDAGLGLAPGSAFGPEGEGFVRWCFASDLGRLQDGVDRLARFLRARVPQ

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
11 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
12 2643221652 Acidovorax sp. Root402 Isolate Unclassified
13 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
14 2643221660 Methylibium sp. Root1272 Isolate Unclassified
15 2643221717 Acidovorax sp. Root267 Isolate Unclassified
16 2818991436 Collimonas arenae 515 Isolate Unclassified
17 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
18 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
19 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
20 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
21 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
22 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
28 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
29 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
77 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
78 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
112 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
120 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
121 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
122 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
123 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
124 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
125 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
126 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
165 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
166 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
168 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
169 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
243 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
244 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
248 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
249 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
250 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
251 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
252 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
253 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
254 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
255 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
256 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
257 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
258 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
259 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
260 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
261 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
262 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
263 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
264 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
265 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
266 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
267 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
270 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
271 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
272 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
273 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
274 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
275 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
276 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
277 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
279 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
281 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
282 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
283 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
284 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
285 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
286 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
287 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
288 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
289 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
290 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
291 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
292 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
293 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
294 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
295 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
296 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
297 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
298 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
299 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
300 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
302 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
303 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
304 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
305 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
306 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
307 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
308 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
309 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
310 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
311 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
312 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
313 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
314 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
315 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
316 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
317 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
318 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
319 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
320 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
321 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
322 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
323 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
324 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
325 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
326 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
327 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
328 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
329 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
330 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
331 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
332 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
333 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
334 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
335 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
336 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
337 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
338 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
339 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
340 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
341 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
342 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
343 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
344 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
345 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
346 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
347 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
348 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
349 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
350 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
351 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
352 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
353 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
354 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
355 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
356 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
357 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
358 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
359 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
360 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
361 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
362 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
363 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
364 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
365 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
366 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
367 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
368 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
369 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
370 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
371 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
372 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
373 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
374 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
375 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
376 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
377 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
378 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
379 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
380 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
381 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
382 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
383 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
389 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
390 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
391 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
392 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
405 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
406 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
407 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
408 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
409 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
410 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
411 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
412 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
413 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
414 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
415 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
416 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
417 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
418 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
419 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
420 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
421 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
422 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
423 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
424 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
425 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
426 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
427 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
428 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
429 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
430 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
431 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
432 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
433 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
434 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
435 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
436 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
437 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
438 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
439 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
440 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
441 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
442 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
443 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
444 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
445 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.75
Nodule 0
Rhizoplane 2.75
Rhizosphere 88.84
Stem 0
Stem Tuber 0
Unclassified 2.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000023 3300002737 Bacteria 236658
2 JGI25152J39213_1002683 3300002773 Bacteria 6540
3 JGI25151J46595_10043938 3300003187 Bacteria 1593
4 JGI25165J46597_1000030 3300003214 Bacteria 305254
5 JGI25153J46596_10001361 3300003215 Bacteria 14627
6 JGI25153J46596_10004264 3300003215 Bacteria 7739
7 rootH1_10013105 3300003316 Bacteria 1840
8 Ga0055538_1000017 3300003751 Bacteria 305254
9 Ga0055539_1000022 3300003752 Bacteria 305254
10 Ga0055533_1000030 3300003756 Bacteria 305254
11 Ga0055525_1000034 3300003759 Bacteria 305254
12 Ga0055530_10011040 3300003791 Bacteria 3277
13 Ga0055541_1000015 3300003841 Bacteria 305254
14 Ga0065165_1004235 3300005262 Bacteria 9109
15 Ga0065715_10026169 3300005293 Bacteria 2494
16 Ga0070658_10028554 3300005327 Bacteria 4480
17 Ga0070658_10056454 3300005327 Bacteria 3191
18 Ga0070658_10083502 3300005327 Bacteria 2626
19 Ga0070676_10002958 3300005328 Bacteria 8776
20 Ga0070676_10003985 3300005328 Bacteria 7748
21 Ga0070676_10004320 3300005328 Bacteria 7466
22 Ga0070676_10018292 3300005328 Bacteria 3881
23 Ga0070676_10058707 3300005328 Bacteria 2281
24 Ga0070676_10071763 3300005328 Bacteria 2081
25 Ga0070683_100007089 3300005329 Bacteria 9442
26 Ga0070683_100087297 3300005329 Bacteria 2925
27 Ga0070690_100000408 3300005330 Bacteria 21778
28 Ga0070690_100043276 3300005330 Bacteria 2855
29 Ga0070670_100001125 3300005331 Bacteria 21269
30 Ga0070670_100006584 3300005331 Bacteria 9845
31 Ga0070670_100046145 3300005331 Bacteria 3746
32 Ga0070670_100078249 3300005331 Bacteria 2841
33 Ga0070670_100143993 3300005331 Bacteria 2061
34 Ga0070670_100249694 3300005331 Bacteria 1545
35 Ga0070670_100280279 3300005331 Bacteria 1455
36 Ga0070677_10000132 3300005333 Bacteria 24789
37 Ga0070677_10024764 3300005333 Bacteria 2235
38 Ga0068869_100000478 3300005334 Bacteria 22165
39 Ga0068869_100028754 3300005334 Bacteria 3888
40 Ga0068869_100113146 3300005334 Bacteria 2067
41 Ga0070666_10000956 3300005335 Bacteria 17615
42 Ga0070666_10002288 3300005335 Bacteria 11581
43 Ga0070666_10007688 3300005335 Bacteria 6654
44 Ga0070666_10030816 3300005335 Bacteria 3536
45 Ga0070666_10061620 3300005335 Bacteria 2540
46 Ga0070666_10181371 3300005335 Bacteria 1477
47 Ga0070680_100000654 3300005336 Bacteria 24040
48 Ga0070680_100006576 3300005336 Bacteria 8838
49 Ga0070680_100023434 3300005336 Bacteria 4923
50 Ga0070680_100056068 3300005336 Bacteria 3221
51 Ga0070680_100077300 3300005336 Bacteria 2742
52 Ga0070682_100093297 3300005337 Bacteria 1973
53 Ga0070682_100137549 3300005337 Bacteria 1661
54 Ga0068868_100000056 3300005338 Bacteria 63982
55 Ga0068868_100005576 3300005338 Bacteria 8850
56 Ga0068868_100025309 3300005338 Bacteria 4513
57 Ga0068868_100033283 3300005338 Bacteria 3972
58 Ga0068868_100033556 3300005338 Bacteria 3956
59 Ga0068868_100043949 3300005338 Bacteria 3491
60 Ga0068868_100091318 3300005338 Bacteria 2454
61 Ga0068868_100195958 3300005338 Bacteria 1682
62 Ga0070660_100004428 3300005339 Bacteria 9700
63 Ga0070660_100042189 3300005339 Bacteria 3481
64 Ga0070660_100106492 3300005339 Bacteria 2227
65 Ga0070689_100000429 3300005340 Bacteria 24771
66 Ga0070689_100001046 3300005340 Bacteria 17396
67 Ga0070691_10000463 3300005341 Bacteria 15095
68 Ga0070687_100000418 3300005343 Bacteria 14386
69 Ga0070687_100042308 3300005343 Bacteria 2308
70 Ga0070661_100004644 3300005344 Bacteria 9458
71 Ga0070661_100013155 3300005344 Bacteria 5808
72 Ga0070661_100075262 3300005344 Bacteria 2487
73 Ga0070661_100184145 3300005344 Bacteria 1590
74 Ga0070692_10001960 3300005345 Bacteria 7797
75 Ga0070692_10009740 3300005345 Bacteria 4347
76 Ga0070692_10020544 3300005345 Bacteria 3203
77 Ga0070668_100000394 3300005347 Bacteria 29015
78 Ga0070668_100042341 3300005347 Bacteria 3490
79 Ga0070668_100042616 3300005347 Bacteria 3479
80 Ga0070669_100008643 3300005353 Bacteria 7265
81 Ga0070669_100085811 3300005353 Bacteria 2351
82 Ga0070675_100000331 3300005354 Bacteria 32025
83 Ga0070675_100004598 3300005354 Bacteria 10540
84 Ga0070675_100012058 3300005354 Bacteria 6774
85 Ga0070675_100046964 3300005354 Bacteria 3537
86 Ga0070675_100060146 3300005354 Bacteria 3136
87 Ga0070675_100071748 3300005354 Bacteria 2874
88 Ga0070675_100258834 3300005354 Bacteria 1524
89 Ga0070671_100005456 3300005355 Bacteria 10154
90 Ga0070671_100008289 3300005355 Bacteria 8315
91 Ga0070671_100019005 3300005355 Bacteria 5589
92 Ga0070671_100046866 3300005355 Bacteria 3595
93 Ga0070671_100085945 3300005355 Bacteria 2631
94 Ga0070671_100119784 3300005355 Bacteria 2214
95 Ga0070671_100202976 3300005355 Bacteria 1681
96 Ga0070671_100232088 3300005355 Bacteria 1566
97 Ga0070674_100022136 3300005356 Bacteria 4095
98 Ga0070674_100059240 3300005356 Bacteria 2665
99 Ga0070674_100102619 3300005356 Bacteria 2086
100 Ga0070674_100112724 3300005356 Bacteria 2000
101 Ga0070673_100000604 3300005364 Bacteria 19614
102 Ga0070673_100000864 3300005364 Bacteria 17027
103 Ga0070673_100012409 3300005364 Bacteria 5848
104 Ga0070673_100020860 3300005364 Bacteria 4735
105 Ga0070673_100056935 3300005364 Bacteria 3087
106 Ga0070673_100060353 3300005364 Bacteria 3005
107 Ga0070673_100135633 3300005364 Bacteria 2071
108 Ga0070688_100000230 3300005365 Bacteria 29284
109 Ga0070688_100084572 3300005365 Bacteria 2061
110 Ga0070659_100003790 3300005366 Bacteria 10789
111 Ga0070659_100008273 3300005366 Bacteria 7595
112 Ga0070659_100023109 3300005366 Bacteria 4753
113 Ga0070659_100084594 3300005366 Bacteria 2536
114 Ga0070659_100095385 3300005366 Bacteria 2389
115 Ga0070667_100010007 3300005367 Bacteria 7858
116 Ga0070667_100010248 3300005367 Bacteria 7744
117 Ga0070667_100035009 3300005367 Bacteria 4205
118 Ga0070667_100091829 3300005367 Bacteria 2611
119 Ga0070667_100116327 3300005367 Bacteria 2322
120 Ga0070709_10197228 3300005434 Bacteria 1424
121 Ga0070714_100054800 3300005435 Bacteria 3407
122 Ga0070714_100120648 3300005435 Bacteria 2332
123 Ga0070713_100000026 3300005436 Bacteria 95308
124 Ga0070713_100015306 3300005436 Bacteria 5726
125 Ga0070713_100015774 3300005436 Bacteria 5661
126 Ga0070710_10003855 3300005437 Bacteria 7096
127 Ga0070710_10052356 3300005437 Bacteria 2295
128 Ga0070701_10001314 3300005438 Bacteria 9150
129 Ga0070711_100003823 3300005439 Bacteria 8844
130 Ga0070705_100000855 3300005440 Bacteria 17121
131 Ga0070705_100001310 3300005440 Bacteria 13336
132 Ga0070705_100032917 3300005440 Bacteria 2885
133 Ga0070705_100050606 3300005440 Bacteria 2417
134 Ga0070705_100192981 3300005440 Bacteria 1390
135 Ga0070700_100000499 3300005441 Bacteria 19616
136 Ga0070700_100001470 3300005441 Bacteria 11726
137 Ga0070700_100009928 3300005441 Bacteria 5237
138 Ga0070694_100000452 3300005444 Bacteria 22463
139 Ga0070694_100031467 3300005444 Bacteria 3479
140 Ga0070708_100000244 3300005445 Bacteria 40474
141 Ga0070663_100000131 3300005455 Bacteria 35664
142 Ga0070663_100042005 3300005455 Bacteria 3211
143 Ga0070678_100000982 3300005456 Bacteria 14738
144 Ga0070678_100001058 3300005456 Bacteria 14357
145 Ga0070678_100001348 3300005456 Bacteria 13061
146 Ga0070678_100002956 3300005456 Bacteria 9418
147 Ga0070678_100033732 3300005456 Bacteria 3557
148 Ga0070678_100122600 3300005456 Bacteria 2052
149 Ga0070678_100162985 3300005456 Bacteria 1808
150 Ga0070662_100001081 3300005457 Bacteria 16613
151 Ga0070662_100010407 3300005457 Bacteria 6101
152 Ga0070662_100011777 3300005457 Bacteria 5777
153 Ga0070662_100044780 3300005457 Bacteria 3171
154 Ga0070662_100188529 3300005457 Bacteria 1629
155 Ga0070681_10000591 3300005458 Bacteria 29907
156 Ga0070681_10009598 3300005458 Bacteria 9515
157 Ga0070681_10235524 3300005458 Bacteria 1745
158 Ga0068867_100000085 3300005459 Bacteria 58473
159 Ga0068867_100000623 3300005459 Bacteria 23419
160 Ga0068867_100000816 3300005459 Bacteria 21045
161 Ga0068867_100003590 3300005459 Bacteria 10912
162 Ga0068867_100004350 3300005459 Bacteria 9972
163 Ga0068867_100008539 3300005459 Bacteria 7229
164 Ga0068867_100015261 3300005459 Bacteria 5445
165 Ga0068867_100034695 3300005459 Bacteria 3658
166 Ga0068867_100039935 3300005459 Bacteria 3422
167 Ga0068867_100051046 3300005459 Bacteria 3050
168 Ga0068867_100080552 3300005459 Bacteria 2452
169 Ga0068867_100098413 3300005459 Bacteria 2230
170 Ga0068867_100202833 3300005459 Bacteria 1588
171 Ga0070685_10001090 3300005466 Bacteria 14533
172 Ga0070706_100000822 3300005467 Bacteria 34270
173 Ga0070706_100013361 3300005467 Bacteria 7588
174 Ga0070706_100051853 3300005467 Bacteria 3787
175 Ga0070706_100074494 3300005467 Bacteria 3142
176 Ga0070707_100030193 3300005468 Bacteria 5158
177 Ga0070698_100012253 3300005471 Bacteria 9084
178 Ga0070699_100013502 3300005518 Bacteria 7034
179 Ga0070699_100025470 3300005518 Bacteria 5099
180 Ga0070699_100265700 3300005518 Bacteria 1535
181 Ga0070679_100010847 3300005530 Bacteria 8658
182 Ga0070679_100020566 3300005530 Bacteria 6437
183 Ga0070679_100022808 3300005530 Bacteria 6122
184 Ga0070679_100084435 3300005530 Bacteria 3163
185 Ga0070679_100110668 3300005530 Bacteria 2733
186 Ga0070684_100001615 3300005535 Bacteria 16295
187 Ga0070697_100006508 3300005536 Bacteria 9042
188 Ga0070697_100009128 3300005536 Bacteria 7746
189 Ga0070697_100038739 3300005536 Bacteria 3852
190 Ga0070697_100124956 3300005536 Bacteria 2155
191 Ga0068853_100002757 3300005539 Bacteria 13266
192 Ga0068853_100022134 3300005539 Bacteria 5305
193 Ga0068853_100023858 3300005539 Bacteria 5126
194 Ga0068853_100052361 3300005539 Bacteria 3517
195 Ga0068853_100059584 3300005539 Bacteria 3298
196 Ga0070672_100000244 3300005543 Bacteria 30475
197 Ga0070672_100007832 3300005543 Bacteria 7289
198 Ga0070672_100010686 3300005543 Bacteria 6377
199 Ga0070672_100032941 3300005543 Bacteria 3918
200 Ga0070672_100047976 3300005543 Bacteria 3316
201 Ga0070672_100052637 3300005543 Bacteria 3179
202 Ga0070672_100056213 3300005543 Bacteria 3085
203 Ga0070672_100081645 3300005543 Bacteria 2592
204 Ga0070672_100097015 3300005543 Bacteria 2386
205 Ga0070672_100145914 3300005543 Bacteria 1955
206 Ga0070672_100167749 3300005543 Bacteria 1824
207 Ga0070686_100003488 3300005544 Bacteria 8625
208 Ga0070686_100022128 3300005544 Bacteria 3783
209 Ga0070695_100000414 3300005545 Bacteria 22079
210 Ga0070696_100000012 3300005546 Bacteria 79388
211 Ga0070696_100002814 3300005546 Bacteria 11555
212 Ga0070696_100002873 3300005546 Bacteria 11454
213 Ga0070696_100012065 3300005546 Bacteria 5789
214 Ga0070696_100029845 3300005546 Bacteria 3730
215 Ga0070696_100044653 3300005546 Bacteria 3068
216 Ga0070693_100000222 3300005547 Bacteria 26434
217 Ga0070665_100003667 3300005548 Bacteria 16273
218 Ga0070665_100005917 3300005548 Bacteria 12530
219 Ga0070665_100012901 3300005548 Bacteria 8416
220 Ga0070665_100140576 3300005548 Bacteria 2418
221 Ga0070665_100148142 3300005548 Bacteria 2350
222 Ga0070665_100209694 3300005548 Bacteria 1949
223 Ga0070704_100000233 3300005549 Bacteria 23631
224 Ga0070704_100002235 3300005549 Bacteria 10801
225 Ga0070704_100008012 3300005549 Bacteria 6309
226 Ga0070704_100279965 3300005549 Bacteria 1381
227 Ga0068855_100006214 3300005563 Bacteria 14557
228 Ga0068855_100016816 3300005563 Bacteria 8796
229 Ga0068855_100079076 3300005563 Bacteria 3814
230 Ga0068855_100129357 3300005563 Bacteria 2885
231 Ga0068855_100162772 3300005563 Bacteria 2531
232 Ga0068855_100358908 3300005563 Bacteria 1604
233 Ga0070664_100013471 3300005564 Bacteria 6660
234 Ga0070664_100021750 3300005564 Bacteria 5289
235 Ga0070664_100021935 3300005564 Bacteria 5265
236 Ga0070664_100067479 3300005564 Bacteria 3057
237 Ga0070664_100098882 3300005564 Bacteria 2535
238 Ga0070664_100149220 3300005564 Bacteria 2063
239 Ga0068857_100082907 3300005577 Bacteria 2864
240 Ga0068857_100120434 3300005577 Bacteria 2362
241 Ga0068857_100224021 3300005577 Bacteria 1718
242 Ga0068854_100006996 3300005578 Bacteria 7195
243 Ga0068854_100013191 3300005578 Bacteria 5415
244 Ga0068854_100031641 3300005578 Bacteria 3677
245 Ga0068854_100316135 3300005578 Bacteria 1268
246 Ga0068856_100001379 3300005614 Bacteria 25540
247 Ga0068856_100003093 3300005614 Bacteria 16983
248 Ga0068856_100007697 3300005614 Bacteria 10513
249 Ga0068856_100013314 3300005614 Bacteria 7966
250 Ga0068856_100022222 3300005614 Bacteria 6167
251 Ga0068856_100113954 3300005614 Bacteria 2703
252 Ga0068856_100114569 3300005614 Bacteria 2695
253 Ga0068856_100206184 3300005614 Bacteria 1980
254 Ga0070702_100046926 3300005615 Bacteria 2451
255 Ga0068852_100002691 3300005616 Bacteria 12273
256 Ga0068852_100018064 3300005616 Bacteria 5548
257 Ga0068852_100021127 3300005616 Bacteria 5189
258 Ga0068852_100039269 3300005616 Bacteria 3984
259 Ga0068852_100059635 3300005616 Bacteria 3310
260 Ga0068852_100062389 3300005616 Bacteria 3242
261 Ga0068852_100069540 3300005616 Bacteria 3086
262 Ga0068852_100127398 3300005616 Bacteria 2340
263 Ga0068852_100153298 3300005616 Bacteria 2145
264 Ga0068852_100207156 3300005616 Bacteria 1858
265 Ga0068852_100236606 3300005616 Bacteria 1743
266 Ga0068852_100296836 3300005616 Bacteria 1563
267 Ga0068859_100000264 3300005617 Bacteria 52493
268 Ga0068859_100005934 3300005617 Bacteria 12397
269 Ga0068859_100012677 3300005617 Bacteria 8476
270 Ga0068859_100080523 3300005617 Bacteria 3297
271 Ga0068859_100126563 3300005617 Bacteria 2624
272 Ga0068859_100197894 3300005617 Bacteria 2094
273 Ga0068859_100310053 3300005617 Bacteria 1672
274 Ga0068859_100316770 3300005617 Bacteria 1654
275 Ga0068864_100000916 3300005618 Bacteria 24730
276 Ga0068864_100002228 3300005618 Bacteria 16021
277 Ga0068864_100017374 3300005618 Bacteria 5998
278 Ga0068864_100051344 3300005618 Bacteria 3552
279 Ga0068864_100055591 3300005618 Bacteria 3418
280 Ga0068866_10000392 3300005718 Bacteria 20460
281 Ga0068866_10001767 3300005718 Bacteria 9095
282 Ga0068866_10049708 3300005718 Bacteria 2126
283 Ga0068861_100000033 3300005719 Bacteria 64659
284 Ga0068861_100010234 3300005719 Bacteria 6510
285 Ga0068861_100142382 3300005719 Bacteria 1958
286 Ga0068861_100159755 3300005719 Bacteria 1858
287 Ga0068851_10017527 3300005834 Bacteria 3441
288 Ga0068851_10019315 3300005834 Bacteria 3292
289 Ga0068870_10016973 3300005840 Bacteria 3492
290 Ga0068870_10080055 3300005840 Bacteria 1804
291 Ga0068870_10100589 3300005840 Bacteria 1633
292 Ga0068863_100013029 3300005841 Bacteria 8018
293 Ga0068863_100114074 3300005841 Bacteria 2574
294 Ga0068858_100000612 3300005842 Bacteria 37346
295 Ga0068858_100003471 3300005842 Bacteria 15627
296 Ga0068858_100010466 3300005842 Bacteria 8787
297 Ga0068858_100091245 3300005842 Bacteria 2835
298 Ga0068858_100143489 3300005842 Bacteria 2242
299 Ga0068858_100173220 3300005842 Bacteria 2036
300 Ga0068860_100003755 3300005843 Bacteria 15614
301 Ga0068860_100044323 3300005843 Bacteria 4240
302 Ga0068860_100077813 3300005843 Bacteria 3155
303 Ga0068860_100085339 3300005843 Bacteria 3004
304 Ga0068860_100096000 3300005843 Bacteria 2826
305 Ga0068862_100001281 3300005844 Bacteria 23556
306 Ga0068862_100132045 3300005844 Bacteria 2209
307 Ga0068862_100361584 3300005844 Bacteria 1349
308 Ga0081539_10009781 3300005985 Bacteria 7930
309 Ga0081539_10035756 3300005985 Bacteria 2981
310 Ga0075363_100005285 3300006048 Bacteria 5731
311 Ga0075363_100007751 3300006048 Bacteria 4958
312 Ga0075363_100010665 3300006048 Bacteria 4374
313 Ga0070715_10030822 3300006163 Bacteria 2172
314 Ga0070716_100003120 3300006173 Bacteria 7744
315 Ga0070712_100000161 3300006175 Bacteria 36151
316 Ga0070712_100039945 3300006175 Bacteria 3213
317 Ga0075362_10050760 3300006177 Bacteria 1855
318 Ga0075362_10060715 3300006177 Bacteria 1709
319 Ga0075366_10001677 3300006195 Bacteria 11115
320 Ga0075366_10025704 3300006195 Bacteria 3442
321 Ga0097621_100000801 3300006237 Bacteria 22153
322 Ga0097621_100009465 3300006237 Bacteria 7074
323 Ga0097621_100017589 3300006237 Bacteria 5433
324 Ga0097621_100038903 3300006237 Bacteria 3818
325 Ga0097621_100043902 3300006237 Bacteria 3605
326 Ga0097621_100084754 3300006237 Bacteria 2643
327 Ga0097621_100123217 3300006237 Bacteria 2200
328 Ga0097621_100147315 3300006237 Bacteria 2017
329 Ga0075370_10013121 3300006353 Bacteria 4396
330 Ga0075370_10038289 3300006353 Bacteria 2698
331 Ga0075370_10040878 3300006353 Bacteria 2617
332 Ga0068871_100001405 3300006358 Bacteria 16118
333 Ga0068871_100032604 3300006358 Bacteria 4117
334 Ga0068871_100049131 3300006358 Bacteria 3408
335 Ga0068871_100085416 3300006358 Bacteria 2620
336 Ga0068871_100086705 3300006358 Bacteria 2601
337 Ga0068871_100192975 3300006358 Bacteria 1755
338 Ga0068871_100196935 3300006358 Bacteria 1738
339 Ga0075428_100001225 3300006844 Bacteria 27466
340 Ga0075428_100067479 3300006844 Bacteria 3915
341 Ga0075428_100097524 3300006844 Bacteria 3204
342 Ga0075428_100189894 3300006844 Bacteria 2222
343 Ga0075430_100000744 3300006846 Bacteria 25022
344 Ga0075430_100043796 3300006846 Bacteria 3784
345 Ga0075430_100251176 3300006846 Bacteria 1465
346 Ga0075431_100067720 3300006847 Bacteria 3686
347 Ga0075431_100095124 3300006847 Bacteria 3075
348 Ga0075431_100134649 3300006847 Bacteria 2547
349 Ga0075433_10002752 3300006852 Bacteria 13454
350 Ga0075434_100000072 3300006871 Bacteria 53106
351 Ga0075434_100002297 3300006871 Bacteria 16724
352 Ga0075434_100064943 3300006871 Bacteria 3635
353 Ga0075429_100001431 3300006880 Bacteria 19585
354 Ga0075429_100029191 3300006880 Bacteria 4790
355 Ga0075429_100029373 3300006880 Bacteria 4775
356 Ga0075429_100037279 3300006880 Bacteria 4232
357 Ga0075429_100178054 3300006880 Bacteria 1863
358 Ga0068865_100000629 3300006881 Bacteria 19879
359 Ga0068865_100008959 3300006881 Bacteria 6193
360 Ga0068865_100013757 3300006881 Bacteria 5126
361 Ga0068865_100070772 3300006881 Bacteria 2472
362 Ga0068865_100185594 3300006881 Bacteria 1604
363 Ga0075436_100001274 3300006914 Bacteria 17112
364 Ga0075436_100064732 3300006914 Bacteria 2527
365 Ga0097620_100000264 3300006931 Bacteria 52493
366 Ga0097620_100005934 3300006931 Bacteria 12397
367 Ga0097620_100012677 3300006931 Bacteria 8476
368 Ga0097620_100080523 3300006931 Bacteria 3297
369 Ga0097620_100126567 3300006931 Bacteria 2624
370 Ga0097620_100197907 3300006931 Bacteria 2094
371 Ga0097620_100310035 3300006931 Bacteria 1672
372 Ga0097620_100316769 3300006931 Bacteria 1654
373 Ga0075435_100001177 3300007076 Bacteria 16722
374 Ga0075435_100002554 3300007076 Bacteria 12128
375 Ga0075435_100035111 3300007076 Bacteria 3978
376 Ga0075435_100160042 3300007076 Bacteria 1896
377 Ga0105240_10017700 3300009093 Bacteria 9595
378 Ga0111539_10053322 3300009094 Bacteria 4814
379 Ga0111539_10070517 3300009094 Bacteria 4126
380 Ga0111539_10170262 3300009094 Bacteria 2545
381 Ga0111539_10174383 3300009094 Bacteria 2512
382 Ga0111539_10260075 3300009094 Bacteria 2020
383 Ga0111539_10269538 3300009094 Bacteria 1982
384 Ga0105245_10000059 3300009098 Bacteria 121609
385 Ga0105245_10001181 3300009098 Bacteria 23678
386 Ga0105245_10084181 3300009098 Bacteria 2913
387 Ga0105245_10263677 3300009098 Bacteria 1678
388 Ga0114129_10009453 3300009147 Bacteria 13896
389 Ga0114129_10047700 3300009147 Bacteria 6018
390 Ga0114129_10057183 3300009147 Bacteria 5460
391 Ga0114129_10066712 3300009147 Bacteria 5019
392 Ga0114129_10268214 3300009147 Bacteria 2285
393 Ga0114129_10282859 3300009147 Bacteria 2216
394 Ga0105243_10001329 3300009148 Bacteria 22047
395 Ga0105243_10006779 3300009148 Bacteria 8830
396 Ga0105243_10009228 3300009148 Bacteria 7531
397 Ga0105243_10016225 3300009148 Bacteria 5636
398 Ga0105241_10017607 3300009174 Bacteria 5253
399 Ga0105241_10027447 3300009174 Bacteria 4240
400 Ga0105241_10042066 3300009174 Bacteria 3455
401 Ga0105241_10049461 3300009174 Bacteria 3201
402 Ga0105242_10002209 3300009176 Bacteria 15350
403 Ga0105242_10094021 3300009176 Bacteria 2528
404 Ga0105248_10004100 3300009177 Bacteria 16114
405 Ga0105248_10017866 3300009177 Bacteria 7827
406 Ga0105248_10049621 3300009177 Bacteria 4707
407 Ga0105248_10125562 3300009177 Bacteria 2895
408 Ga0105248_10183953 3300009177 Bacteria 2355
409 Ga0105248_10266796 3300009177 Bacteria 1927
410 Ga0105237_10000548 3300009545 Bacteria 52739
411 Ga0105237_10179641 3300009545 Bacteria 2117
412 Ga0105237_10188996 3300009545 Bacteria 2060
413 Ga0105238_10235083 3300009551 Bacteria 1810
414 Ga0105249_10001192 3300009553 Bacteria 22932
415 Ga0105249_10108229 3300009553 Bacteria 2624
416 Ga0105239_10001569 3300010375 Bacteria 30171
417 Ga0105239_10023152 3300010375 Bacteria 6846
418 Ga0105239_10271650 3300010375 Bacteria 1907
419 Ga0105239_10302553 3300010375 Bacteria 1801
420 Ga0105239_10333231 3300010375 Bacteria 1712
421 Ga0105239_10363776 3300010375 Bacteria 1634
422 Ga0105246_10007984 3300011119 Bacteria 6496
423 Ga0157373_10001932 3300013100 Bacteria 15747
424 Ga0157373_10003632 3300013100 Bacteria 11653
425 Ga0157373_10219848 3300013100 Bacteria 1340
426 Ga0157371_10000303 3300013102 Bacteria 64643
427 Ga0157371_10095081 3300013102 Bacteria 2112
428 Ga0157370_10002404 3300013104 Bacteria 22564
429 Ga0157370_10011858 3300013104 Bacteria 9092
430 Ga0157370_10016198 3300013104 Bacteria 7555
431 Ga0157370_10050708 3300013104 Bacteria 3966
432 Ga0157369_10119962 3300013105 Bacteria 2791
433 Ga0157374_10000954 3300013296 Bacteria 25106
434 Ga0157374_10001736 3300013296 Bacteria 18275
435 Ga0157374_10005865 3300013296 Bacteria 10372
436 Ga0157374_10082868 3300013296 Bacteria 3046
437 Ga0157374_10287448 3300013296 Bacteria 1624
438 Ga0157378_10000693 3300013297 Bacteria 31696
439 Ga0157378_10004675 3300013297 Bacteria 12013
440 Ga0157378_10093736 3300013297 Bacteria 2734
441 Ga0157378_10142923 3300013297 Bacteria 2223
442 Ga0163162_10051681 3300013306 Bacteria 4124
443 Ga0163162_10071605 3300013306 Bacteria 3520
444 Ga0163162_10087391 3300013306 Bacteria 3196
445 Ga0157372_10002828 3300013307 Bacteria 18755
446 Ga0157372_10008434 3300013307 Bacteria 10940
447 Ga0157372_10011850 3300013307 Bacteria 9287
448 Ga0157372_10019251 3300013307 Bacteria 7351
449 Ga0157372_10071584 3300013307 Bacteria 3905
450 Ga0157372_10097839 3300013307 Bacteria 3347
451 Ga0157372_10154108 3300013307 Bacteria 2653
452 Ga0157372_10258427 3300013307 Bacteria 2022
453 Ga0157372_10404695 3300013307 Bacteria 1590
454 Ga0157375_10001655 3300013308 Bacteria 19164
455 Ga0157375_10003889 3300013308 Bacteria 12962
456 Ga0157375_10013200 3300013308 Bacteria 7345
457 Ga0157375_10031297 3300013308 Bacteria 5027
458 Ga0157375_10058150 3300013308 Bacteria 3824
459 Ga0157375_10095972 3300013308 Bacteria 3037
460 Ga0157375_10225102 3300013308 Bacteria 2035
461 Ga0157375_10254724 3300013308 Bacteria 1916
462 Ga0157375_10319675 3300013308 Bacteria 1717
463 Ga0163163_10000225 3300014325 Bacteria 58314
464 Ga0163163_10178375 3300014325 Bacteria 2171
465 Ga0157380_10018722 3300014326 Bacteria 5147
466 Ga0157380_10200133 3300014326 Bacteria 1771
467 Ga0157380_10300573 3300014326 Bacteria 1478
468 Ga0157377_10000028 3300014745 Bacteria 134810
469 Ga0157377_10037330 3300014745 Bacteria 2676
470 Ga0157379_10001851 3300014968 Bacteria 17503
471 Ga0157379_10005162 3300014968 Bacteria 11213
472 Ga0157379_10019810 3300014968 Bacteria 5945
473 Ga0157379_10037900 3300014968 Bacteria 4300
474 Ga0157379_10114247 3300014968 Bacteria 2427
475 Ga0157376_10002436 3300014969 Bacteria 12585
476 Ga0157376_10003620 3300014969 Bacteria 10665
477 Ga0157376_10012494 3300014969 Bacteria 6305
478 Ga0157376_10023935 3300014969 Bacteria 4789
479 Ga0157376_10061744 3300014969 Bacteria 3151
480 Ga0157376_10284193 3300014969 Bacteria 1559
481 Ga0182005_1000134 3300015265 Bacteria 53164
482 Ga0182005_1015578 3300015265 Bacteria 2119
483 Ga0163161_10019913 3300017792 Bacteria 4706
484 Ga0163161_10023133 3300017792 Bacteria 4380
485 Ga0163161_10028638 3300017792 Bacteria 3956
486 Ga0209760_103086 3300025207 Bacteria 1497
487 Ga0209784_100034 3300025224 Bacteria 305504
488 Ga0209566_100038 3300025225 Bacteria 305504
489 Ga0209674_100056 3300025226 Bacteria 305504
490 Ga0209563_100057 3300025230 Bacteria 305604
491 Ga0207427_101302 3300025231 Bacteria 9415
492 Ga0209437_100071 3300025233 Bacteria 305604
493 Ga0207425_1002124 3300025245 Bacteria 7283
494 Ga0209677_100035 3300025253 Bacteria 305504
495 Ga0209129_1000369 3300025258 Bacteria 36698
496 Ga0209233_1000094 3300025261 Bacteria 305604
497 Ga0209564_1000046 3300025295 Bacteria 373787
498 Ga0209758_1000369 3300025297 Bacteria 79541
499 Ga0209758_1000709 3300025297 Bacteria 49238
500 Ga0209050_1001458 3300025298 Bacteria 25343
501 Ga0207697_10014910 3300025315 Bacteria 3218
502 Ga0207697_10024015 3300025315 Bacteria 2497
503 Ga0207656_10007341 3300025321 Bacteria 4008
504 Ga0207682_10000044 3300025893 Bacteria 51808
505 Ga0207682_10001919 3300025893 Bacteria 9447
506 Ga0207682_10014581 3300025893 Bacteria 3063
507 Ga0207692_10019407 3300025898 Bacteria 3072
508 Ga0207642_10009742 3300025899 Bacteria 3354
509 Ga0207642_10018667 3300025899 Bacteria 2667
510 Ga0207680_10000757 3300025903 Bacteria 15225
511 Ga0207680_10068690 3300025903 Bacteria 2187
512 Ga0207680_10107525 3300025903 Bacteria 1803
513 Ga0207647_10020345 3300025904 Bacteria 4451
514 Ga0207699_10200235 3300025906 Bacteria 1353
515 Ga0207645_10000590 3300025907 Bacteria 30055
516 Ga0207645_10001566 3300025907 Bacteria 18680
517 Ga0207645_10003988 3300025907 Bacteria 11007
518 Ga0207645_10011786 3300025907 Bacteria 5953
519 Ga0207645_10011960 3300025907 Bacteria 5904
520 Ga0207645_10014014 3300025907 Bacteria 5377
521 Ga0207645_10020128 3300025907 Bacteria 4369
522 Ga0207645_10029674 3300025907 Bacteria 3525
523 Ga0207643_10029280 3300025908 Bacteria 3062
524 Ga0207705_10029785 3300025909 Bacteria 3891
525 Ga0207705_10035487 3300025909 Bacteria 3567
526 Ga0207705_10069511 3300025909 Bacteria 2551
527 Ga0207705_10072390 3300025909 Bacteria 2500
528 Ga0207684_10002827 3300025910 Bacteria 17250
529 Ga0207684_10037641 3300025910 Bacteria 4105
530 Ga0207684_10062819 3300025910 Bacteria 3153
531 Ga0207654_10018181 3300025911 Bacteria 3685
532 Ga0207654_10040723 3300025911 Bacteria 2619
533 Ga0207707_10001629 3300025912 Bacteria 20695
534 Ga0207707_10006002 3300025912 Bacteria 10633
535 Ga0207707_10116682 3300025912 Bacteria 2333
536 Ga0207707_10140668 3300025912 Bacteria 2110
537 Ga0207695_10058138 3300025913 Bacteria 4015
538 Ga0207695_10077664 3300025913 Bacteria 3371
539 Ga0207695_10106135 3300025913 Bacteria 2795
540 Ga0207671_10012212 3300025914 Bacteria 6926
541 Ga0207671_10161946 3300025914 Bacteria 1733
542 Ga0207693_10000075 3300025915 Bacteria 88428
543 Ga0207693_10051893 3300025915 Bacteria 3217
544 Ga0207693_10066228 3300025915 Bacteria 2828
545 Ga0207663_10005149 3300025916 Bacteria 6576
546 Ga0207663_10099085 3300025916 Bacteria 1953
547 Ga0207660_10004807 3300025917 Bacteria 8789
548 Ga0207660_10032183 3300025917 Bacteria 3619
549 Ga0207660_10065721 3300025917 Bacteria 2622
550 Ga0207660_10098596 3300025917 Bacteria 2180
551 Ga0207660_10185416 3300025917 Bacteria 1618
552 Ga0207662_10000782 3300025918 Bacteria 14603
553 Ga0207662_10014355 3300025918 Bacteria 4442
554 Ga0207662_10020257 3300025918 Bacteria 3793
555 Ga0207662_10049947 3300025918 Bacteria 2483
556 Ga0207657_10000160 3300025919 Bacteria 69252
557 Ga0207657_10001114 3300025919 Bacteria 28498
558 Ga0207657_10010217 3300025919 Bacteria 9375
559 Ga0207657_10016351 3300025919 Bacteria 7158
560 Ga0207657_10041179 3300025919 Bacteria 4086
561 Ga0207657_10115206 3300025919 Bacteria 2216
562 Ga0207657_10140961 3300025919 Bacteria 1969
563 Ga0207649_10011309 3300025920 Bacteria 4918
564 Ga0207649_10027765 3300025920 Bacteria 3326
565 Ga0207649_10090977 3300025920 Bacteria 1998
566 Ga0207649_10097300 3300025920 Bacteria 1940
567 Ga0207652_10005271 3300025921 Bacteria 10493
568 Ga0207652_10045778 3300025921 Bacteria 3730
569 Ga0207652_10056935 3300025921 Bacteria 3366
570 Ga0207652_10072814 3300025921 Bacteria 2988
571 Ga0207681_10001478 3300025923 Bacteria 15151
572 Ga0207681_10015245 3300025923 Bacteria 4792
573 Ga0207681_10095094 3300025923 Bacteria 2136
574 Ga0207694_10004147 3300025924 Bacteria 11379
575 Ga0207650_10001071 3300025925 Bacteria 20336
576 Ga0207650_10012849 3300025925 Bacteria 5785
577 Ga0207650_10015944 3300025925 Bacteria 5243
578 Ga0207650_10034045 3300025925 Bacteria 3693
579 Ga0207650_10114180 3300025925 Bacteria 2095
580 Ga0207659_10002022 3300025926 Bacteria 12018
581 Ga0207659_10002849 3300025926 Bacteria 10309
582 Ga0207659_10017392 3300025926 Bacteria 4697
583 Ga0207659_10053368 3300025926 Bacteria 2883
584 Ga0207659_10063691 3300025926 Bacteria 2666
585 Ga0207687_10000697 3300025927 Bacteria 22694
586 Ga0207687_10045063 3300025927 Bacteria 3047
587 Ga0207687_10059098 3300025927 Bacteria 2700
588 Ga0207687_10089341 3300025927 Bacteria 2243
589 Ga0207700_10000375 3300025928 Bacteria 26197
590 Ga0207700_10001042 3300025928 Bacteria 15977
591 Ga0207700_10033017 3300025928 Bacteria 3699
592 Ga0207700_10054627 3300025928 Bacteria 2999
593 Ga0207664_10036805 3300025929 Bacteria 3784
594 Ga0207664_10106868 3300025929 Bacteria 2321
595 Ga0207664_10234165 3300025929 Bacteria 1597
596 Ga0207644_10004238 3300025931 Bacteria 9309
597 Ga0207644_10004260 3300025931 Bacteria 9282
598 Ga0207644_10007845 3300025931 Bacteria 6972
599 Ga0207644_10008258 3300025931 Bacteria 6821
600 Ga0207644_10008540 3300025931 Bacteria 6701
601 Ga0207644_10024864 3300025931 Bacteria 4114
602 Ga0207644_10119555 3300025931 Bacteria 2004
603 Ga0207644_10161287 3300025931 Bacteria 1743
604 Ga0207644_10167079 3300025931 Bacteria 1715
605 Ga0207644_10214578 3300025931 Bacteria 1523
606 Ga0207690_10009822 3300025932 Bacteria 5686
607 Ga0207690_10028675 3300025932 Bacteria 3529
608 Ga0207690_10094129 3300025932 Bacteria 2125
609 Ga0207706_10000023 3300025933 Bacteria 153979
610 Ga0207706_10012342 3300025933 Bacteria 7782
611 Ga0207706_10018245 3300025933 Bacteria 6314
612 Ga0207706_10031665 3300025933 Bacteria 4711
613 Ga0207706_10037748 3300025933 Bacteria 4288
614 Ga0207706_10365038 3300025933 Bacteria 1254
615 Ga0207686_10002631 3300025934 Bacteria 9742
616 Ga0207686_10015450 3300025934 Bacteria 4269
617 Ga0207686_10086859 3300025934 Bacteria 2055
618 Ga0207709_10001580 3300025935 Bacteria 15546
619 Ga0207709_10003401 3300025935 Bacteria 9499
620 Ga0207709_10012911 3300025935 Bacteria 4606
621 Ga0207670_10008559 3300025936 Bacteria 5784
622 Ga0207669_10002735 3300025937 Bacteria 7556
623 Ga0207669_10005538 3300025937 Bacteria 5677
624 Ga0207669_10052423 3300025937 Bacteria 2451
625 Ga0207669_10132096 3300025937 Bacteria 1717
626 Ga0207704_10000370 3300025938 Bacteria 20772
627 Ga0207704_10002182 3300025938 Bacteria 8774
628 Ga0207704_10018516 3300025938 Bacteria 3637
629 Ga0207704_10066390 3300025938 Bacteria 2264
630 Ga0207665_10039585 3300025939 Bacteria 3143
631 Ga0207691_10000022 3300025940 Bacteria 132936
632 Ga0207691_10000224 3300025940 Bacteria 55186
633 Ga0207691_10005312 3300025940 Bacteria 12435
634 Ga0207691_10008031 3300025940 Bacteria 10145
635 Ga0207691_10011546 3300025940 Bacteria 8480
636 Ga0207691_10027913 3300025940 Bacteria 5288
637 Ga0207691_10034393 3300025940 Bacteria 4712
638 Ga0207691_10036114 3300025940 Bacteria 4579
639 Ga0207691_10042701 3300025940 Bacteria 4178
640 Ga0207691_10051226 3300025940 Bacteria 3776
641 Ga0207691_10225604 3300025940 Bacteria 1623
642 Ga0207711_10000092 3300025941 Bacteria 95507
643 Ga0207711_10007461 3300025941 Bacteria 9150
644 Ga0207711_10012405 3300025941 Bacteria 7085
645 Ga0207711_10063435 3300025941 Bacteria 3189
646 Ga0207711_10114492 3300025941 Bacteria 2402
647 Ga0207711_10328737 3300025941 Bacteria 1414
648 Ga0207689_10003609 3300025942 Bacteria 14136
649 Ga0207689_10004291 3300025942 Bacteria 12973
650 Ga0207689_10008652 3300025942 Bacteria 8862
651 Ga0207689_10009095 3300025942 Bacteria 8600
652 Ga0207689_10039935 3300025942 Bacteria 3884
653 Ga0207689_10094530 3300025942 Bacteria 2455
654 Ga0207689_10301895 3300025942 Bacteria 1327
655 Ga0207661_10082231 3300025944 Bacteria 2662
656 Ga0207679_10010809 3300025945 Bacteria 5885
657 Ga0207679_10021666 3300025945 Bacteria 4361
658 Ga0207679_10106268 3300025945 Bacteria 2206
659 Ga0207679_10134897 3300025945 Bacteria 1986
660 Ga0207667_10012582 3300025949 Bacteria 9733
661 Ga0207667_10025154 3300025949 Bacteria 6523
662 Ga0207667_10026382 3300025949 Bacteria 6349
663 Ga0207667_10061993 3300025949 Bacteria 3911
664 Ga0207667_10081291 3300025949 Bacteria 3357
665 Ga0207667_10186021 3300025949 Bacteria 2132
666 Ga0207651_10000135 3300025960 Bacteria 31996
667 Ga0207651_10012862 3300025960 Bacteria 4758
668 Ga0207651_10013505 3300025960 Bacteria 4676
669 Ga0207651_10046202 3300025960 Bacteria 2926
670 Ga0207651_10092471 3300025960 Bacteria 2218
671 Ga0207712_10004221 3300025961 Bacteria 9065
672 Ga0207668_10016076 3300025972 Bacteria 4662
673 Ga0207668_10041154 3300025972 Bacteria 3122
674 Ga0207668_10041705 3300025972 Bacteria 3104
675 Ga0207640_10009134 3300025981 Bacteria 5537
676 Ga0207640_10016844 3300025981 Bacteria 4261
677 Ga0207640_10062336 3300025981 Bacteria 2474
678 Ga0207658_10001652 3300025986 Bacteria 17020
679 Ga0207658_10008305 3300025986 Bacteria 7069
680 Ga0207658_10011567 3300025986 Bacteria 6007
681 Ga0207677_10000768 3300026023 Bacteria 18466
682 Ga0207677_10011737 3300026023 Bacteria 5006
683 Ga0207677_10062984 3300026023 Bacteria 2575
684 Ga0207677_10068482 3300026023 Bacteria 2491
685 Ga0207677_10084101 3300026023 Bacteria 2293
686 Ga0207677_10241849 3300026023 Bacteria 1461
687 Ga0207703_10000820 3300026035 Bacteria 30614
688 Ga0207703_10037103 3300026035 Bacteria 3882
689 Ga0207639_10003328 3300026041 Bacteria 10819
690 Ga0207639_10006189 3300026041 Bacteria 8128
691 Ga0207639_10025204 3300026041 Bacteria 4312
692 Ga0207639_10040340 3300026041 Bacteria 3483
693 Ga0207639_10132300 3300026041 Bacteria 2067
694 Ga0207678_10000500 3300026067 Bacteria 35694
695 Ga0207678_10018317 3300026067 Bacteria 6150
696 Ga0207678_10021448 3300026067 Bacteria 5663
697 Ga0207708_10000617 3300026075 Bacteria 27309
698 Ga0207708_10028414 3300026075 Bacteria 4236
699 Ga0207702_10004347 3300026078 Bacteria 12633
700 Ga0207702_10004753 3300026078 Bacteria 11988
701 Ga0207702_10011508 3300026078 Bacteria 7372
702 Ga0207702_10030713 3300026078 Bacteria 4475
703 Ga0207702_10064993 3300026078 Bacteria 3124
704 Ga0207702_10098222 3300026078 Bacteria 2579
705 Ga0207702_10106709 3300026078 Bacteria 2482
706 Ga0207641_10004639 3300026088 Bacteria 11862
707 Ga0207641_10004870 3300026088 Bacteria 11552
708 Ga0207641_10010037 3300026088 Bacteria 7788
709 Ga0207641_10039034 3300026088 Bacteria 3970
710 Ga0207641_10180077 3300026088 Bacteria 1935
711 Ga0207648_10000089 3300026089 Bacteria 86359
712 Ga0207648_10000130 3300026089 Bacteria 74342
713 Ga0207648_10000146 3300026089 Bacteria 70573
714 Ga0207648_10002519 3300026089 Bacteria 19654
715 Ga0207648_10003749 3300026089 Bacteria 15887
716 Ga0207648_10006200 3300026089 Bacteria 11910
717 Ga0207648_10006998 3300026089 Bacteria 11152
718 Ga0207648_10011303 3300026089 Bacteria 8416
719 Ga0207648_10035654 3300026089 Bacteria 4383
720 Ga0207648_10045838 3300026089 Bacteria 3834
721 Ga0207648_10063670 3300026089 Bacteria 3214
722 Ga0207648_10089702 3300026089 Bacteria 2686
723 Ga0207648_10126836 3300026089 Bacteria 2245
724 Ga0207648_10250198 3300026089 Bacteria 1580
725 Ga0207676_10000097 3300026095 Bacteria 78464
726 Ga0207676_10004846 3300026095 Bacteria 9538
727 Ga0207676_10014293 3300026095 Bacteria 5708
728 Ga0207676_10042101 3300026095 Bacteria 3511
729 Ga0207674_10000236 3300026116 Bacteria 68955
730 Ga0207674_10007783 3300026116 Bacteria 12466
731 Ga0207674_10020685 3300026116 Bacteria 7102
732 Ga0207674_10051358 3300026116 Bacteria 4208
733 Ga0207674_10092585 3300026116 Bacteria 3012
734 Ga0207674_10106806 3300026116 Bacteria 2776
735 Ga0207674_10179580 3300026116 Bacteria 2068
736 Ga0207675_100000857 3300026118 Bacteria 30347
737 Ga0207675_100001694 3300026118 Bacteria 22071
738 Ga0207675_100048651 3300026118 Bacteria 3958
739 Ga0207675_100109636 3300026118 Bacteria 2604
740 Ga0207683_10000283 3300026121 Bacteria 45381
741 Ga0207683_10001343 3300026121 Bacteria 22211
742 Ga0207683_10003069 3300026121 Bacteria 14600
743 Ga0207683_10003588 3300026121 Bacteria 13534
744 Ga0207683_10025161 3300026121 Bacteria 5133
745 Ga0207683_10050435 3300026121 Bacteria 3645
746 Ga0207683_10148771 3300026121 Bacteria 2113
747 Ga0207683_10167427 3300026121 Bacteria 1989
748 Ga0207683_10186229 3300026121 Bacteria 1883
749 Ga0207683_10205759 3300026121 Bacteria 1790
750 Ga0207683_10223045 3300026121 Bacteria 1718
751 Ga0207698_10006776 3300026142 Bacteria 7161
752 Ga0207698_10021518 3300026142 Bacteria 4462
753 Ga0207698_10058537 3300026142 Bacteria 2987
754 Ga0207698_10069098 3300026142 Bacteria 2792
755 Ga0209967_1003126 3300027364 Bacteria 2170
756 Ga0209995_1000765 3300027471 Bacteria 4943
757 Ga0209968_1000471 3300027526 Bacteria 6435
758 Ga0209970_1002455 3300027614 Bacteria 3156
759 Ga0209983_1004988 3300027665 Bacteria 2771
760 Ga0209971_1001379 3300027682 Bacteria 6042
761 Ga0209966_1000005 3300027695 Bacteria 103734
762 Ga0209813_10003834 3300027866 Bacteria 3556
763 Ga0207428_10051779 3300027907 Bacteria 3281
764 Ga0207428_10097111 3300027907 Bacteria 2281
765 Ga0207428_10135074 3300027907 Bacteria 1886
766 Ga0268266_10003808 3300028379 Bacteria 14754
767 Ga0268266_10011396 3300028379 Bacteria 7731
768 Ga0268266_10028877 3300028379 Bacteria 4713
769 Ga0268266_10085660 3300028379 Bacteria 2753
770 Ga0268266_10145527 3300028379 Bacteria 2130
771 Ga0268265_10003627 3300028380 Bacteria 11017
772 Ga0268265_10005565 3300028380 Bacteria 8598
773 Ga0268265_10063972 3300028380 Bacteria 2832
774 Ga0268265_10167125 3300028380 Bacteria 1876
775 Ga0268264_10000892 3300028381 Bacteria 31423
776 Ga0268264_10023671 3300028381 Bacteria 5008
777 Ga0307517_10095981 3300028786 Bacteria 2380
778 Ga0307515_10001342 3300028794 Bacteria 55698
779 Ga0307515_10006289 3300028794 Bacteria 23807
780 Ga0307515_10114736 3300028794 Bacteria 3110
781 Ga0265338_10001649 3300028800 Bacteria 35677
782 Ga0265332_10001972 3300031238 Bacteria 10802
783 Ga0265331_10001617 3300031250 Bacteria 16448
784 Ga0307513_10074316 3300031456 Bacteria 3535
785 Ga0307513_10091450 3300031456 Bacteria 3101
786 Ga0307509_10280150 3300031507 Bacteria 1429
787 Ga0307408_100008287 3300031548 Bacteria 6861
788 Ga0307408_100018326 3300031548 Bacteria 4697
789 Ga0307408_100049977 3300031548 Bacteria 3005
790 Ga0307508_10000004 3300031616 Bacteria 287547
791 Ga0307508_10143264 3300031616 Bacteria 1994
792 Ga0307514_10009601 3300031649 Bacteria 8125
793 Ga0316575_10007395 3300031665 Bacteria 3976
794 Ga0316579_10035589 3300031691 Bacteria 2295
795 Ga0265342_10011453 3300031712 Bacteria 6070
796 Ga0307516_10000234 3300031730 Bacteria 71156
797 Ga0307516_10013729 3300031730 Bacteria 8603
798 Ga0307516_10079315 3300031730 Bacteria 3128
799 Ga0307516_10110733 3300031730 Bacteria 2549
800 Ga0307516_10147970 3300031730 Bacteria 2112
801 Ga0307405_10001503 3300031731 Bacteria 9868
802 Ga0307405_10007502 3300031731 Bacteria 5462
803 Ga0307405_10083394 3300031731 Bacteria 2095
804 Ga0307413_10006139 3300031824 Bacteria 5454
805 Ga0307410_10009445 3300031852 Bacteria 5469
806 Ga0307410_10011320 3300031852 Bacteria 5096
807 Ga0307406_10015337 3300031901 Bacteria 4431
808 Ga0307407_10000312 3300031903 Bacteria 14375
809 Ga0307412_10043148 3300031911 Bacteria 2935
810 Ga0307412_10065398 3300031911 Bacteria 2461
811 Ga0307412_10130941 3300031911 Bacteria 1822
812 Ga0307409_100000086 3300031995 Bacteria 33256
813 Ga0307409_100004420 3300031995 Bacteria 7893
814 Ga0307409_100024728 3300031995 Bacteria 4196
815 Ga0307416_100006561 3300032002 Bacteria 7298
816 Ga0307416_100025400 3300032002 Bacteria 4342
817 Ga0307416_100117705 3300032002 Bacteria 2359
818 Ga0307411_10000630 3300032005 Bacteria 12756
819 Ga0307411_10006711 3300032005 Bacteria 5785
820 Ga0307415_100001036 3300032126 Bacteria 12874
821 Ga0307415_100027857 3300032126 Bacteria 3586
822 Ga0316583_10013543 3300032133 Bacteria 2943
823 Ga0373959_0004801 3300034820 Bacteria 2195
824 Ga0373926_0001086 3300035083 Bacteria 8015
825 Ga0373934_0001247 3300035086 Bacteria 9261
826 Ga0373944_0009665 3300035089 Bacteria 2618
827 Ga0373951_0002478 3300035091 Bacteria 4651
828 Ga0373923_0002361 3300035111 Bacteria 5789
829 Ga0373932_0002947 3300035112 Bacteria 4192
830 Ga0373936_0001617 3300035113 Bacteria 8236
831 Ga0373936_0024397 3300035113 Bacteria 2361
832 Ga0373936_0027944 3300035113 Bacteria 2215
833 Ga0373936_0038432 3300035113 Bacteria 1913
834 Ga0373939_0003489 3300035114 Bacteria 3693
835 Ga0373941_0006274 3300035115 Bacteria 2855
836 Ga0373941_0012599 3300035115 Bacteria 2215
837 Ga0373945_0011893 3300035116 Bacteria 2883
838 Ga0373953_0015475 3300035117 Bacteria 2765
839 Ga0373954_0000190 3300035118 Bacteria 22280
840 Ga0373954_0002677 3300035118 Bacteria 7494
841 Ga0373954_0026208 3300035118 Bacteria 2671
842 Ga0373957_0015384 3300035120 Bacteria 2632
843 Ga0373943_0017634 3300035170 Bacteria 3267
844 Ga0373943_0023852 3300035170 Bacteria 2848
845 Ga0373943_0024870 3300035170 Bacteria 2795
846 Ga0373943_0050248 3300035170 Bacteria 2048
847 Ga0373946_0011423 3300035171 Bacteria 3312
848 Ga0373955_0000975 3300035172 Bacteria 12157
849 Ga0373955_0023682 3300035172 Bacteria 3131
850 Ga0373942_0002583 3300035207 Bacteria 4367
851 Ga0373961_0014827 3300035241 Bacteria 1984
852 Ga0373962_0024180 3300035242 Bacteria 1622
853 Ga0373931_0000211 3300035691 Bacteria 24945
854 Ga0373931_0009283 3300035691 Bacteria 4699
855 Ga0373931_0010357 3300035691 Bacteria 4480
856 Ga0373931_0076900 3300035691 Bacteria 1834
857 Ga0373931_0101337 3300035691 Bacteria 1620
858 Ga0373935_0006447 3300035692 Bacteria 7007
859 Ga0373935_0010631 3300035692 Bacteria 5525
860 Ga0373935_0039213 3300035692 Bacteria 2969
861 Ga0373935_0069721 3300035692 Bacteria 2265
862 Ga0373927_0006714 3300035695 Bacteria 7829
863 Ga0373927_0013233 3300035695 Bacteria 5486
864 Ga0373927_0040566 3300035695 Bacteria 3019
865 Ga0373933_0001198 3300035724 Bacteria 15354
866 Ga0373933_0152329 3300035724 Bacteria 1465
867 Ga0373947_0025742 3300035725 Bacteria 3432
868 Ga0373947_0030345 3300035725 Bacteria 3176
869 Ga0373947_0069821 3300035725 Bacteria 2151
870 Ga0373947_0111025 3300035725 Bacteria 1732
871 Ga0373947_0133146 3300035725 Bacteria 1589
872 Ga0373937_0002537 3300036401 Bacteria 15169
873 Ga0373937_0003543 3300036401 Bacteria 13145
874 Ga0373937_0009758 3300036401 Bacteria 8369
875 Ga0373937_0021365 3300036401 Bacteria 5810
876 Ga0373937_0024061 3300036401 Bacteria 5491
877 Ga0373937_0085863 3300036401 Bacteria 2912
878 Ga0373937_0109042 3300036401 Bacteria 2574
879 Ga0373937_0123401 3300036401 Bacteria 2415
880 Ga0373937_0223321 3300036401 Bacteria 1773
881 Ga0373937_0383215 3300036401 Bacteria 1333
882 Ga0316582_0004577 3300036647 Bacteria 7005
883 Ga0316584_0181576 3300036712 Bacteria 1558
884 Ga0373925_0020666 3300037068 Bacteria 4796
885 Ga0373925_0032450 3300037068 Bacteria 3844
886 Ga0373925_0043468 3300037068 Bacteria 3335
887 Ga0373925_0161996 3300037068 Bacteria 1762
888 Ga0395898_0039327 3300037466 Bacteria 4682
889 Ga0395905_0012222 3300037471 Bacteria 8266
890 Ga0395905_0025977 3300037471 Bacteria 5521
891 Ga0316581_0002921 3300037588 Bacteria 4186
892 Ga0242420_011280 3300038996 Bacteria 1496
893 Ga0436365_0038862 3300039437 Bacteria 3854
894 Ga0436360_1141743 3300039438 Bacteria 1354
895 Ga0451793_1931907 3300041452 Bacteria 2621
896 Ga0451797_0881475 3300041453 Bacteria 2073
897 Ga0451800_1606912 3300041459 Bacteria 1652
898 Ga0451802_0448423 3300041460 Bacteria 2227
899 Ga0451802_2186402 3300041460 Bacteria 3470
900 Ga0451807_0803462 3300041486 Bacteria 5880
901 Ga0439441_004433 3300042001 Bacteria 2128
902 Ga0439441_007290 3300042001 Bacteria 1777
903 Ga0439449_0031255 3300042007 Bacteria 1985
904 Ga0439455_0008812 3300042012 Bacteria 2171
905 Ga0450896_016730 3300042133 Bacteria 1055
906 Ga0439446_0011224 3300042156 Bacteria 2429
907 Ga0439435_0012465 3300042436 Bacteria 2061
908 Ga0439435_0018176 3300042436 Bacteria 1786
909 Ga0439444_0000219 3300042437 Bacteria 5523
910 Ga0439460_0000400 3300042461 Bacteria 9230
911 Ga0451577_0028262 3300042876 Bacteria 5073
912 Ga0451577_0029690 3300042876 Bacteria 4942
913 Ga0451577_0065139 3300042876 Bacteria 3249
914 Ga0466966_0098515 3300044684 Bacteria 1810
915 Ga0466961_0099060 3300044693 Bacteria 1837
916 Ga0453684_0098333 3300044712 Bacteria 3588
917 Ga0453684_0114983 3300044712 Bacteria 3261
918 Ga0466971_0022938 3300044719 Bacteria 2782
919 Ga0466959_0020291 3300045049 Bacteria 4894
920 Ga0451576_0000717 3300045051 Bacteria 66791
921 Ga0451576_0081846 3300045051 Bacteria 3357
922 Ga0451576_0129993 3300045051 Bacteria 2625
923 Ga0451576_0135584 3300045051 Bacteria 2567
924 Ga0451576_0268556 3300045051 Bacteria 1783
925 Ga0466967_0076090 3300045976 Bacteria 3018
926 Ga0495592_0005643 3300046454 Bacteria 9252
927 Ga0495592_0015266 3300046454 Bacteria 5829
928 Ga0495629_0017686 3300046459 Bacteria 5109
929 Ga0495651_0054004 3300046462 Bacteria 3091
930 Ga0495653_0029078 3300046463 Bacteria 4415
931 Ga0495653_0183975 3300046463 Bacteria 1431
932 Ga0495650_0017254 3300046471 Bacteria 3624
933 Ga0495580_0028421 3300046472 Bacteria 4064
934 Ga0495580_0032991 3300046472 Bacteria 3731
935 Ga0495582_0017872 3300046473 Bacteria 3876
936 Ga0495582_0119634 3300046473 Bacteria 1483
937 Ga0495639_0005941 3300046475 Bacteria 5253
938 Ga0495662_0064117 3300046476 Bacteria 1775
939 Ga0495662_0074210 3300046476 Bacteria 1650
940 Ga0495607_0042320 3300046501 Bacteria 2700
941 Ga0495606_0111842 3300046507 Bacteria 1646
942 Ga0495608_0005998 3300046511 Bacteria 8635
943 Ga0495608_0024512 3300046511 Bacteria 4123
944 Ga0495610_0092200 3300046512 Bacteria 1371
945 Ga0495616_0076593 3300046513 Bacteria 1607
946 Ga0495618_0004023 3300046514 Bacteria 9066
947 Ga0495628_0012137 3300046516 Bacteria 7263
948 Ga0495628_0020679 3300046516 Bacteria 5425
949 Ga0495630_0048541 3300046517 Bacteria 3177
950 Ga0495632_0015895 3300046519 Bacteria 4203
951 Ga0495632_0046309 3300046519 Bacteria 2162
952 Ga0495643_0023064 3300046522 Bacteria 3542
953 Ga0495666_0076535 3300046526 Bacteria 1586
954 Ga0495642_0020765 3300046528 Bacteria 2582
955 Ga0495652_0015115 3300046529 Bacteria 6914
956 Ga0495652_0164752 3300046529 Bacteria 1717
957 Ga0495640_0150735 3300046533 Bacteria 1494
958 Ga0495586_0001577 3300046535 Bacteria 12562
959 Ga0495586_0044286 3300046535 Bacteria 2397
960 Ga0495586_0123956 3300046535 Bacteria 1444
961 Ga0495598_0014774 3300046537 Bacteria 1958
962 Ga0495598_0044033 3300046537 Bacteria 1317
963 Ga0495621_0009375 3300046539 Bacteria 2971
964 Ga0495645_0077557 3300046543 Bacteria 2389
965 Ga0495667_0037862 3300046559 Bacteria 3213
966 Ga0495634_0031516 3300046642 Bacteria 3651
967 Ga0495625_0013071 3300046660 Bacteria 6690
968 Ga0495635_0003031 3300046663 Bacteria 11540
969 Ga0495659_0007805 3300046664 Bacteria 3394
970 Ga0495657_0038956 3300046675 Bacteria 3268
971 Ga0495599_0000548 3300046678 Bacteria 21463
972 Ga0495623_0025917 3300046679 Bacteria 3776
973 Ga0495646_0063817 3300046680 Bacteria 2185
974 Ga0495647_0000651 3300046681 Bacteria 10297
975 Ga0495647_0044756 3300046681 Bacteria 1698
976 Ga0495658_0013973 3300046683 Bacteria 4094
977 Ga0495658_0019751 3300046683 Bacteria 3522
978 Ga0495658_0041560 3300046683 Bacteria 2562
979 Ga0495658_0119361 3300046683 Bacteria 1593
980 Ga0495658_0149212 3300046683 Bacteria 1435
981 Ga0495613_0011703 3300046689 Bacteria 6521
982 Ga0495613_0023120 3300046689 Bacteria 4633
983 Ga0495624_0028753 3300046690 Bacteria 3630
984 Ga0495624_0031322 3300046690 Bacteria 3459
985 Ga0495600_0000693 3300046809 Bacteria 17639
986 Ga0495600_0034611 3300046809 Bacteria 3280
987 Ga0495600_0148896 3300046809 Bacteria 1516
988 Ga0495581_0002924 3300047315 Bacteria 9771
989 Ga0495604_0033075 3300047317 Bacteria 4095
990 Ga0495604_0039016 3300047317 Bacteria 3734
991 Ga0495676_0053864 3300047321 Bacteria 3202
992 Ga0495676_0197936 3300047321 Bacteria 1397
993 Ga0495680_0001182 3300047322 Bacteria 28660
994 Ga0495684_0004189 3300047471 Bacteria 11264
995 Ga0495686_0019436 3300047472 Bacteria 4537
996 Ga0495593_0052353 3300047673 Bacteria 2158
997 Ga0495602_0054880 3300048088 Bacteria 3514
998 Ga0495602_0067075 3300048088 Bacteria 3088
999 Ga0496100_0081464 3300048903 Bacteria 2187
1000 Ga0496101_0083959 3300048904 Bacteria 2358
1001 Ga0496102_0015518 3300048905 Bacteria 6635
1002 Ga0496102_0063871 3300048905 Bacteria 3372
1003 Ga0496102_0092383 3300048905 Bacteria 2802
1004 Ga0496103_0060462 3300048906 Bacteria 2355
1005 Ga0496103_0116332 3300048906 Bacteria 1701
1006 Ga0496104_0000979 3300048907 Bacteria 24446
1007 Ga0496105_0004778 3300048908 Bacteria 10227
1008 Ga0496106_0003978 3300048909 Bacteria 11045
1009 Ga0496106_0262316 3300048909 Bacteria 1382
1010 Ga0496108_0024755 3300048911 Bacteria 4944
1011 Ga0496108_0100478 3300048911 Bacteria 2467
1012 Ga0496108_0196137 3300048911 Bacteria 1751
1013 Ga0496109_0002675 3300048912 Bacteria 14963
1014 Ga0496109_0131220 3300048912 Bacteria 2339
1015 Ga0496109_0143497 3300048912 Bacteria 2233
1016 Ga0496110_0031132 3300048913 Bacteria 4602
1017 Ga0496110_0175682 3300048913 Bacteria 1944
1018 Ga0496112_0002483 3300048915 Bacteria 14882
1019 Ga0496113_0031390 3300048916 Bacteria 3856
1020 Ga0496114_0079674 3300048917 Bacteria 2765
1021 Ga0496114_0096028 3300048917 Bacteria 2523
1022 Ga0496114_0155721 3300048917 Bacteria 1984
1023 Ga0496115_0007123 3300048918 Bacteria 8212
1024 Ga0496115_0016973 3300048918 Bacteria 5553
1025 Ga0496124_0079466 3300048927 Bacteria 2701
1026 Ga0501032_0159011 3300049569 Bacteria 1484
1027 Ga0501033_0009551 3300049570 Bacteria 7465
1028 Ga0501033_0066034 3300049570 Bacteria 2661
1029 Ga0501036_0003867 3300049572 Bacteria 12013
1030 Ga0501038_0012500 3300049574 Bacteria 7757
1031 Ga0501039_0003349 3300049575 Bacteria 11973
1032 Ga0501040_0000593 3300049576 Bacteria 22098
1033 Ga0501040_0058683 3300049576 Bacteria 2643
1034 Ga0501041_0000034 3300049577 Bacteria 44700
1035 Ga0501041_0017326 3300049577 Bacteria 4287
1036 Ga0501041_0063723 3300049577 Bacteria 2257
1037 Ga0501042_0001135 3300049578 Bacteria 15356
1038 Ga0501042_0150441 3300049578 Bacteria 1678
1039 Ga0501043_0000023 3300049579 Bacteria 154331
1040 Ga0501046_0000018 3300049580 Bacteria 220589
1041 Ga0501046_0007125 3300049580 Bacteria 9835
1042 Ga0501046_0022216 3300049580 Bacteria 5228
1043 Ga0501046_0049469 3300049580 Bacteria 3325
1044 Ga0501047_0000020 3300049581 Bacteria 259377
1045 Ga0501048_0002498 3300049582 Bacteria 14043
1046 Ga0501048_0006069 3300049582 Bacteria 9201
1047 Ga0501067_0072118 3300049583 Bacteria 1913
1048 Ga0501067_0135554 3300049583 Bacteria 1371
1049 Ga0501068_0033554 3300049584 Bacteria 3057
1050 Ga0501068_0174237 3300049584 Bacteria 1359
1051 Ga0501071_0058042 3300049587 Bacteria 2797
1052 Ga0501071_0068028 3300049587 Bacteria 2591
1053 Ga0501072_0006856 3300049588 Bacteria 8645
1054 Ga0501072_0053645 3300049588 Bacteria 3175
1055 Ga0501072_0073752 3300049588 Bacteria 2698
1056 Ga0501073_0039581 3300049589 Bacteria 3339
1057 Ga0501076_0001930 3300049592 Bacteria 14154
1058 Ga0501076_0002817 3300049592 Bacteria 12027
1059 Ga0501079_0001432 3300049741 Bacteria 16839
1060 Ga0501079_0047140 3300049741 Bacteria 3325
1061 Ga0501079_0059998 3300049741 Bacteria 2934
1062 Ga0501080_0066030 3300049742 Bacteria 3365
1063 Ga0501080_0105488 3300049742 Bacteria 2613
1064 Ga0501080_0256342 3300049742 Bacteria 1594
1065 Ga0501081_0004050 3300049743 Bacteria 9386
1066 Ga0501081_0005463 3300049743 Bacteria 8204
1067 Ga0501081_0007324 3300049743 Bacteria 7164
1068 Ga0501081_0055997 3300049743 Bacteria 2724
1069 Ga0501045_0004925 3300049824 Bacteria 9247
1070 Ga0501045_0016490 3300049824 Bacteria 5249
1071 nmdc:mga03683_23735_c1 3300050489 Bacteria 2393
1072 nmdc:mga03683_28632_c1 3300050489 Bacteria 2217
1073 nmdc:mga0k408_22347_c2 3300050493 Bacteria 2462
1074 nmdc:mga0k408_26433_c1 3300050493 Bacteria 3291
1075 nmdc:mga0k408_3661_c1 3300050493 Bacteria 6079
1076 nmdc:mga0k408_3911_c1 3300050493 Bacteria 2488
1077 nmdc:mga0k408_43371_c1 3300050493 Bacteria 2592
1078 nmdc:mga0k408_49895_c1 3300050493 Bacteria 2423
1079 nmdc:mga0k408_8306_c1 3300050493 Bacteria 5570
1080 nmdc:mga06z11_28394_c1 3300050494 Bacteria 2684
1081 nmdc:mga06z11_59157_c1 3300050494 Bacteria 1991
1082 nmdc:mga04h51_19898_c1 3300050495 Bacteria 1997
1083 nmdc:mga07m45_40105_c1 3300050496 Bacteria 2620
1084 nmdc:mga07m45_95219_c1 3300050496 Bacteria 1708
1085 nmdc:mga05p37_250307_c1 3300050507 Bacteria 2125
1086 nmdc:mga05p37_349_c1 3300050507 Bacteria 49419
1087 nmdc:mga05p37_46938_c1 3300050507 Bacteria 5311
1088 nmdc:mga05p37_5467_c1 3300050507 Bacteria 14916
1089 nmdc:mga09592_12140_c1 3300050508 Bacteria 7011
1090 nmdc:mga09592_27185_c1 3300050508 Bacteria 4748
1091 nmdc:mga09592_301692_c1 3300050508 Bacteria 1389
1092 nmdc:mga09592_3199_c1 3300050508 Bacteria 13275
1093 nmdc:mga09592_43660_c1 3300050508 Bacteria 3771
1094 nmdc:mga09592_525_c1 3300050508 Bacteria 28937
1095 nmdc:mga0qj67_33113_c1 3300050509 Bacteria 3250
1096 nmdc:mga0qj67_570_c1 3300050509 Bacteria 25144
1097 nmdc:mga06r32_104794_c1 3300050510 Bacteria 2778
1098 nmdc:mga06r32_20725_c1 3300050510 Bacteria 6055
1099 nmdc:mga06r32_238785_c1 3300050510 Bacteria 1805
1100 nmdc:mga06r32_345428_c1 3300050510 Bacteria 1472
1101 nmdc:mga06r32_349297_c1 3300050510 Bacteria 1464
1102 nmdc:mga06r32_52852_c1 3300050510 Bacteria 3892
1103 nmdc:mga06r32_84807_c1 3300050510 Bacteria 3088
1104 nmdc:mga08y16_37237_c1 3300050511 Bacteria 5110
1105 nmdc:mga08y16_75316_c1 3300050511 Bacteria 3518
1106 nmdc:mga08y16_86836_c1 3300050511 Bacteria 3260
1107 nmdc:mga0n895_1603_c1 3300050512 Bacteria 17025
1108 nmdc:mga0n895_173933_c1 3300050512 Bacteria 2185
1109 nmdc:mga0n895_267816_c1 3300050512 Bacteria 1733
1110 nmdc:mga0n895_33184_c1 3300050512 Bacteria 4960
1111 nmdc:mga0rr50_210015_c1 3300050513 Bacteria 1603
1112 nmdc:mga0rr50_237379_c1 3300050513 Bacteria 1510
1113 nmdc:mga0rr50_387018_c1 3300050513 Bacteria 1180
1114 nmdc:mga0rr50_62033_c1 3300050513 Bacteria 2818
1115 nmdc:mga0rr50_626_c1 3300050513 Bacteria 18966
1116 nmdc:mga08x19_117640_c1 3300050514 Bacteria 1778
1117 nmdc:mga08x19_32882_c1 3300050514 Bacteria 3271
1118 nmdc:mga08x19_351_c1 3300050514 Bacteria 33305
1119 nmdc:mga0a205_75_c1 3300050515 Bacteria 54682
1120 nmdc:mga0a205_99575_c1 3300050515 Bacteria 2805
1121 Ga0495601_0039865 3300053077 Bacteria 2941
1122 Ga0495601_0064175 3300053077 Bacteria 2335
1123 Ga0495595_0087452 3300053084 Bacteria 1492
1124 Ga0495619_0003146 3300053085 Bacteria 10704
1125 Ga0495619_0065552 3300053085 Bacteria 2423
1126 Ga0500578_0000787 3300053086 Bacteria 37120
1127 Ga0500578_0052977 3300053086 Bacteria 2598
1128 Ga0500644_0001485 3300053088 Bacteria 6173
1129 Ga0500651_0033977 3300053093 Bacteria 3215
1130 Ga0500651_0036431 3300053093 Bacteria 3099
1131 Ga0500628_009946 3300053129 Bacteria 1689
1132 Ga0500642_0022297 3300053130 Bacteria 2524
1133 Ga0500642_0051534 3300053130 Bacteria 1819
1134 Ga0500652_001423 3300053131 Bacteria 7424
1135 Ga0500655_004063 3300053133 Bacteria 2637
1136 Ga0500574_005427 3300053141 Bacteria 2482
1137 Ga0500622_0000160 3300053156 Bacteria 70774
1138 Ga0500634_0000600 3300053161 Bacteria 12029
1139 Ga0500645_002594 3300053730 Bacteria 7944
1140 Ga0501084_0015576 3300054114 Bacteria 6306
1141 Ga0501084_0033682 3300054114 Bacteria 4285
1142 Ga0501084_0042749 3300054114 Bacteria 3791
1143 Ga0501082_0025146 3300060353 Bacteria 5130
1144 Ga0466962_0014620 3300061719 Bacteria 3783
1145 Ga0530510_0005240 3300061734 Bacteria 8952

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10089702 Ga0207648_100897023 326
2 3300042133 Ga0450896_016730 Ga0450896_016730_20_1027 334
3 3300049741 Ga0501079_0047140 Ga0501079_0047140_2284_3315 337
4 3300046519 Ga0495632_0015895 Ga0495632_0015895_1185_2336 344
5 3300005843 Ga0068860_100085339 Ga0068860_1000853391 349
6 3300005343 Ga0070687_100042308 Ga0070687_1000423081 350
7 3300005543 Ga0070672_100010686 Ga0070672_1000106869 350
8 3300005617 Ga0068859_100126563 Ga0068859_1001265632 350
9 3300005842 Ga0068858_100091245 Ga0068858_1000912452 350
10 3300006931 Ga0097620_100126567 Ga0097620_1001265672 350
11 3300013308 Ga0157375_10031297 Ga0157375_100312975 350
12 3300025918 Ga0207662_10049947 Ga0207662_100499472 350
13 3300025940 Ga0207691_10042701 Ga0207691_100427013 350
14 3300050513 nmdc:mga0rr50_387018_c1 nmdc:mga0rr50_387018_c1_20_1165 351
15 3300005518 Ga0070699_100013502 Ga0070699_1000135024 353
16 3300006914 Ga0075436_100001274 Ga0075436_10000127412 353
17 3300050493 nmdc:mga0k408_26433_c1 nmdc:mga0k408_26433_c1_2099_3265 353
18 3300050514 nmdc:mga08x19_351_c1 nmdc:mga08x19_351_c1_3845_4909 353
19 3300006048 Ga0075363_100007751 Ga0075363_1000077514 354
20 3300006353 Ga0075370_10038289 Ga0075370_100382892 354
21 3300050496 nmdc:mga07m45_40105_c1 nmdc:mga07m45_40105_c1_647_1813 354
22 3300053093 Ga0500651_0036431 Ga0500651_0036431_1281_2447 354
23 3300053129 Ga0500628_009946 Ga0500628_009946_446_1612 354
24 3300053130 Ga0500642_0022297 Ga0500642_0022297_108_1274 354
25 3300053131 Ga0500652_001423 Ga0500652_001423_1146_2312 354
26 3300053133 Ga0500655_004063 Ga0500655_004063_522_1688 354
27 3300053156 Ga0500622_0000160 Ga0500622_0000160_41117_42283 354
28 3300006871 Ga0075434_100064943 Ga0075434_1000649432 355
29 3300050493 nmdc:mga0k408_49895_c1 nmdc:mga0k408_49895_c1_1307_2398 357
30 3300031911 Ga0307412_10130941 Ga0307412_101309412 358
31 iso_pu_bacteria 2511231002 2511243448 359
32 3300027364 Ga0209967_1003126 Ga0209967_10031262 360
33 3300048906 Ga0496103_0116332 Ga0496103_0116332_587_1681 360
34 3300006844 Ga0075428_100189894 Ga0075428_1001898944 363
35 3300026041 Ga0207639_10132300 Ga0207639_101323002 365
36 3300025942 Ga0207689_10009095 Ga0207689_100090957 367
37 3300009094 Ga0111539_10260075 Ga0111539_102600752 368
38 3300028380 Ga0268265_10063972 Ga0268265_100639723 368
39 3300050512 nmdc:mga0n895_33184_c1 nmdc:mga0n895_33184_c1_3132_4301 368
40 3300035724 Ga0373933_0152329 Ga0373933_0152329_53_1318 369
41 3300036401 Ga0373937_0223321 Ga0373937_0223321_419_1684 369
42 3300025925 Ga0207650_10012849 Ga0207650_100128493 371
43 iso_pu_bacteria 2919704043 2919709061 371
44 iso_pu_bacteria 2547132374 2548500147 372
45 iso_pu_bacteria 2643221570 2643864816 372
46 iso_pu_bacteria 2643221596 2643991179 372
47 iso_pu_bacteria 2643221652 2644293949 372
48 iso_pu_bacteria 2643221717 2644644534 372
49 iso_pu_bacteria 2990710928 2990711738 372
50 3300005440 Ga0070705_100001310 Ga0070705_1000013104 373
51 3300005467 Ga0070706_100074494 Ga0070706_1000744943 373
52 3300005518 Ga0070699_100025470 Ga0070699_1000254704 373
53 3300005536 Ga0070697_100009128 Ga0070697_1000091285 373
54 3300005546 Ga0070696_100002814 Ga0070696_10000281411 373
55 3300007076 Ga0075435_100035111 Ga0075435_1000351113 373
56 3300015265 Ga0182005_1015578 Ga0182005_10155782 373
57 3300025910 Ga0207684_10037641 Ga0207684_100376413 373
58 3300050513 nmdc:mga0rr50_62033_c1 nmdc:mga0rr50_62033_c1_104_1228 373
59 iso_pu_bacteria 2585428057 2587730410 373
60 iso_pu_bacteria 2585428058 2587733172 373
61 iso_pu_bacteria 2585428062 2587755901 373
62 iso_pu_bacteria 2588253510 2588294407 373
63 iso_pu_bacteria 2643221592 2643968972 373
64 iso_pu_bacteria 2643221625 2644144103 373
65 iso_pu_bacteria 2643221648 2644273223 373
66 iso_pu_bacteria 2643221654 2644304343 373
67 3300005614 Ga0068856_100113954 Ga0068856_1001139543 374
68 3300006880 Ga0075429_100001431 Ga0075429_1000014315 374
69 3300006880 Ga0075429_100037279 Ga0075429_1000372792 374
70 3300050508 nmdc:mga09592_12140_c1 nmdc:mga09592_12140_c1_3102_4244 374
71 iso_pu_bacteria 2643221660 2644340142 374
72 3300003316 rootH1_10013105 rootH1_100131052 375
73 3300005457 Ga0070662_100010407 Ga0070662_1000104078 375
74 3300005467 Ga0070706_100000822 Ga0070706_10000082225 375
75 3300005468 Ga0070707_100030193 Ga0070707_1000301934 375
76 3300005518 Ga0070699_100265700 Ga0070699_1002657001 375
77 3300005614 Ga0068856_100114569 Ga0068856_1001145692 375
78 3300005616 Ga0068852_100127398 Ga0068852_1001273982 375
79 3300006048 Ga0075363_100005285 Ga0075363_1000052853 375
80 3300006177 Ga0075362_10060715 Ga0075362_100607152 375
81 3300006353 Ga0075370_10013121 Ga0075370_100131212 375
82 3300009098 Ga0105245_10000059 Ga0105245_1000005988 375
83 3300009147 Ga0114129_10282859 Ga0114129_102828592 375
84 3300009545 Ga0105237_10179641 Ga0105237_101796412 375
85 3300010375 Ga0105239_10363776 Ga0105239_103637762 375
86 3300014969 Ga0157376_10023935 Ga0157376_100239352 375
87 3300025910 Ga0207684_10002827 Ga0207684_1000282713 375
88 3300025914 Ga0207671_10161946 Ga0207671_101619462 375
89 3300025921 Ga0207652_10056935 Ga0207652_100569352 375
90 3300025927 Ga0207687_10000697 Ga0207687_100006979 375
91 3300025933 Ga0207706_10018245 Ga0207706_100182455 375
92 3300026116 Ga0207674_10092585 Ga0207674_100925852 375
93 3300026142 Ga0207698_10058537 Ga0207698_100585373 375
94 3300028786 Ga0307517_10095981 Ga0307517_100959812 375
95 3300031616 Ga0307508_10143264 Ga0307508_101432642 375
96 3300031730 Ga0307516_10000234 Ga0307516_1000023412 375
97 3300035115 Ga0373941_0006274 Ga0373941_0006274_957_2087 375
98 3300035241 Ga0373961_0014827 Ga0373961_0014827_784_1914 375
99 3300035691 Ga0373931_0076900 Ga0373931_0076900_225_1355 375
100 3300039438 Ga0436360_1141743 Ga0436360_1141743_25_1179 375
101 3300042436 Ga0439435_0018176 Ga0439435_0018176_627_1757 375
102 3300042876 Ga0451577_0065139 Ga0451577_0065139_1690_2841 375
103 3300045051 Ga0451576_0081846 Ga0451576_0081846_365_1516 375
104 3300046517 Ga0495630_0048541 Ga0495630_0048541_1897_3042 375
105 3300046690 Ga0495624_0028753 Ga0495624_0028753_121_1266 375
106 3300047321 Ga0495676_0053864 Ga0495676_0053864_878_2023 375
107 3300049583 Ga0501067_0072118 Ga0501067_0072118_411_1541 375
108 3300050489 nmdc:mga03683_23735_c1 nmdc:mga03683_23735_c1_20_1165 375
109 3300050493 nmdc:mga0k408_43371_c1 nmdc:mga0k408_43371_c1_898_2043 375
110 3300050494 nmdc:mga06z11_28394_c1 nmdc:mga06z11_28394_c1_1369_2514 375
111 3300050513 nmdc:mga0rr50_237379_c1 nmdc:mga0rr50_237379_c1_235_1386 375
112 3300053088 Ga0500644_0001485 Ga0500644_0001485_4310_5497 375
113 3300053093 Ga0500651_0033977 Ga0500651_0033977_1716_2897 375
114 iso_pu_bacteria 2842780639 2842783640 375
115 3300005327 Ga0070658_10056454 Ga0070658_100564542 376
116 3300005328 Ga0070676_10018292 Ga0070676_100182923 376
117 3300005331 Ga0070670_100001125 Ga0070670_1000011256 376
118 3300005331 Ga0070670_100078249 Ga0070670_1000782492 376
119 3300005338 Ga0068868_100025309 Ga0068868_1000253096 376
120 3300005338 Ga0068868_100091318 Ga0068868_1000913183 376
121 3300005354 Ga0070675_100046964 Ga0070675_1000469643 376
122 3300005355 Ga0070671_100232088 Ga0070671_1002320881 376
123 3300005364 Ga0070673_100012409 Ga0070673_1000124093 376
124 3300005364 Ga0070673_100020860 Ga0070673_1000208605 376
125 3300005367 Ga0070667_100035009 Ga0070667_1000350093 376
126 3300005459 Ga0068867_100008539 Ga0068867_1000085392 376
127 3300005459 Ga0068867_100015261 Ga0068867_1000152614 376
128 3300005459 Ga0068867_100051046 Ga0068867_1000510463 376
129 3300005543 Ga0070672_100000244 Ga0070672_10000024422 376
130 3300005616 Ga0068852_100153298 Ga0068852_1001532981 376
131 3300005618 Ga0068864_100051344 Ga0068864_1000513444 376
132 3300005840 Ga0068870_10100589 Ga0068870_101005892 376
133 3300006237 Ga0097621_100043902 Ga0097621_1000439023 376
134 3300006237 Ga0097621_100147315 Ga0097621_1001473152 376
135 3300006881 Ga0068865_100070772 Ga0068865_1000707723 376
136 3300014969 Ga0157376_10061744 Ga0157376_100617442 376
137 3300014969 Ga0157376_10284193 Ga0157376_102841931 376
138 3300025315 Ga0207697_10014910 Ga0207697_100149103 376
139 3300025893 Ga0207682_10014581 Ga0207682_100145814 376
140 3300025907 Ga0207645_10011960 Ga0207645_100119603 376
141 3300025909 Ga0207705_10035487 Ga0207705_100354873 376
142 3300025925 Ga0207650_10001071 Ga0207650_1000107117 376
143 3300025925 Ga0207650_10034045 Ga0207650_100340453 376
144 3300025931 Ga0207644_10119555 Ga0207644_101195551 376
145 3300025937 Ga0207669_10002735 Ga0207669_100027353 376
146 3300025940 Ga0207691_10005312 Ga0207691_100053123 376
147 3300025940 Ga0207691_10027913 Ga0207691_100279133 376
148 3300025960 Ga0207651_10012862 Ga0207651_100128625 376
149 3300025960 Ga0207651_10046202 Ga0207651_100462023 376
150 3300026023 Ga0207677_10241849 Ga0207677_102418491 376
151 3300026089 Ga0207648_10011303 Ga0207648_100113038 376
152 3300026089 Ga0207648_10035654 Ga0207648_100356543 376
153 3300026095 Ga0207676_10042101 Ga0207676_100421014 376
154 3300026121 Ga0207683_10003588 Ga0207683_100035883 376
155 3300026121 Ga0207683_10186229 Ga0207683_101862292 376
156 3300027614 Ga0209970_1002455 Ga0209970_10024552 376
157 3300027682 Ga0209971_1001379 Ga0209971_10013794 376
158 3300031548 Ga0307408_100008287 Ga0307408_1000082873 376
159 3300031548 Ga0307408_100049977 Ga0307408_1000499772 376
160 3300031731 Ga0307405_10083394 Ga0307405_100833943 376
161 3300031852 Ga0307410_10009445 Ga0307410_100094454 376
162 3300031911 Ga0307412_10043148 Ga0307412_100431482 376
163 3300031995 Ga0307409_100024728 Ga0307409_1000247286 376
164 3300032005 Ga0307411_10006711 Ga0307411_100067112 376
165 3300032126 Ga0307415_100027857 Ga0307415_1000278573 376
166 3300036401 Ga0373937_0021365 Ga0373937_0021365_3803_4951 376
167 3300044712 Ga0453684_0098333 Ga0453684_0098333_343_1491 376
168 3300046471 Ga0495650_0017254 Ga0495650_0017254_1685_2833 376
169 3300048917 Ga0496114_0096028 Ga0496114_0096028_442_1644 376
170 3300048927 Ga0496124_0079466 Ga0496124_0079466_821_1969 376
171 3300050510 nmdc:mga06r32_345428_c1 nmdc:mga06r32_345428_c1_317_1450 376
172 3300053077 Ga0495601_0064175 Ga0495601_0064175_305_1453 376
173 3300002773 JGI25152J39213_1002683 JGI25152J39213_10026836 377
174 3300003215 JGI25153J46596_10001361 JGI25153J46596_1000136113 377
175 3300003215 JGI25153J46596_10004264 JGI25153J46596_100042647 377
176 3300003791 Ga0055530_10011040 Ga0055530_100110403 377
177 3300005262 Ga0065165_1004235 Ga0065165_100423510 377
178 3300005328 Ga0070676_10004320 Ga0070676_100043203 377
179 3300005328 Ga0070676_10058707 Ga0070676_100587073 377
180 3300005331 Ga0070670_100046145 Ga0070670_1000461451 377
181 3300005331 Ga0070670_100143993 Ga0070670_1001439931 377
182 3300005334 Ga0068869_100113146 Ga0068869_1001131461 377
183 3300005338 Ga0068868_100195958 Ga0068868_1001959582 377
184 3300005344 Ga0070661_100184145 Ga0070661_1001841451 377
185 3300005354 Ga0070675_100012058 Ga0070675_1000120582 377
186 3300005354 Ga0070675_100258834 Ga0070675_1002588342 377
187 3300005355 Ga0070671_100202976 Ga0070671_1002029762 377
188 3300005364 Ga0070673_100056935 Ga0070673_1000569353 377
189 3300005364 Ga0070673_100135633 Ga0070673_1001356332 377
190 3300005434 Ga0070709_10197228 Ga0070709_101972282 377
191 3300005437 Ga0070710_10052356 Ga0070710_100523562 377
192 3300005455 Ga0070663_100000131 Ga0070663_10000013132 377
193 3300005456 Ga0070678_100122600 Ga0070678_1001226002 377
194 3300005459 Ga0068867_100000085 Ga0068867_1000000853 377
195 3300005459 Ga0068867_100004350 Ga0068867_10000435010 377
196 3300005459 Ga0068867_100034695 Ga0068867_1000346951 377
197 3300005530 Ga0070679_100084435 Ga0070679_1000844352 377
198 3300005543 Ga0070672_100145914 Ga0070672_1001459142 377
199 3300005543 Ga0070672_100167749 Ga0070672_1001677491 377
200 3300005546 Ga0070696_100012065 Ga0070696_1000120652 377
201 3300005548 Ga0070665_100209694 Ga0070665_1002096941 377
202 3300005577 Ga0068857_100082907 Ga0068857_1000829072 377
203 3300005578 Ga0068854_100316135 Ga0068854_1003161351 377
204 3300005616 Ga0068852_100069540 Ga0068852_1000695401 377
205 3300006195 Ga0075366_10025704 Ga0075366_100257043 377
206 3300009093 Ga0105240_10017700 Ga0105240_100177001 377
207 3300009148 Ga0105243_10009228 Ga0105243_100092285 377
208 3300009545 Ga0105237_10000548 Ga0105237_1000054830 377
209 3300010375 Ga0105239_10001569 Ga0105239_1000156913 377
210 3300013308 Ga0157375_10254724 Ga0157375_102547242 377
211 3300013308 Ga0157375_10319675 Ga0157375_103196752 377
212 3300014326 Ga0157380_10200133 Ga0157380_102001332 377
213 3300014745 Ga0157377_10000028 Ga0157377_1000002860 377
214 3300025245 Ga0207425_1002124 Ga0207425_10021247 377
215 3300025258 Ga0209129_1000369 Ga0209129_100036921 377
216 3300025295 Ga0209564_1000046 Ga0209564_1000046118 377
217 3300025297 Ga0209758_1000369 Ga0209758_100036916 377
218 3300025297 Ga0209758_1000709 Ga0209758_100070918 377
219 3300025298 Ga0209050_1001458 Ga0209050_100145822 377
220 3300025315 Ga0207697_10024015 Ga0207697_100240151 377
221 3300025893 Ga0207682_10001919 Ga0207682_1000191913 377
222 3300025906 Ga0207699_10200235 Ga0207699_102002351 377
223 3300025907 Ga0207645_10003988 Ga0207645_100039883 377
224 3300025913 Ga0207695_10077664 Ga0207695_100776641 377
225 3300025914 Ga0207671_10012212 Ga0207671_100122125 377
226 3300025920 Ga0207649_10097300 Ga0207649_100973002 377
227 3300025924 Ga0207694_10004147 Ga0207694_100041479 377
228 3300025925 Ga0207650_10015944 Ga0207650_100159447 377
229 3300025926 Ga0207659_10053368 Ga0207659_100533682 377
230 3300025931 Ga0207644_10214578 Ga0207644_102145782 377
231 3300025938 Ga0207704_10018516 Ga0207704_100185163 377
232 3300025941 Ga0207711_10328737 Ga0207711_103287372 377
233 3300025942 Ga0207689_10301895 Ga0207689_103018951 377
234 3300026067 Ga0207678_10000500 Ga0207678_1000050031 377
235 3300026089 Ga0207648_10000146 Ga0207648_1000014612 377
236 3300026089 Ga0207648_10006998 Ga0207648_100069982 377
237 3300026116 Ga0207674_10106806 Ga0207674_101068062 377
238 3300026121 Ga0207683_10025161 Ga0207683_100251617 377
239 3300026121 Ga0207683_10050435 Ga0207683_100504351 377
240 3300026121 Ga0207683_10167427 Ga0207683_101674272 377
241 3300027526 Ga0209968_1000471 Ga0209968_10004716 377
242 3300027695 Ga0209966_1000005 Ga0209966_100000526 377
243 3300028379 Ga0268266_10145527 Ga0268266_101455273 377
244 3300028794 Ga0307515_10001342 Ga0307515_1000134241 377
245 3300028794 Ga0307515_10006289 Ga0307515_1000628919 377
246 3300028794 Ga0307515_10114736 Ga0307515_101147363 377
247 3300031456 Ga0307513_10074316 Ga0307513_100743163 377
248 3300031456 Ga0307513_10091450 Ga0307513_100914503 377
249 3300031507 Ga0307509_10280150 Ga0307509_102801502 377
250 3300031616 Ga0307508_10000004 Ga0307508_10000004112 377
251 3300031649 Ga0307514_10009601 Ga0307514_100096013 377
252 3300031730 Ga0307516_10013729 Ga0307516_100137294 377
253 3300031730 Ga0307516_10079315 Ga0307516_100793152 377
254 3300031730 Ga0307516_10147970 Ga0307516_101479703 377
255 3300035083 Ga0373926_0001086 Ga0373926_0001086_698_1891 377
256 3300035089 Ga0373944_0009665 Ga0373944_0009665_514_1707 377
257 3300035113 Ga0373936_0001617 Ga0373936_0001617_1029_2222 377
258 3300035116 Ga0373945_0011893 Ga0373945_0011893_324_1517 377
259 3300035170 Ga0373943_0024870 Ga0373943_0024870_1413_2606 377
260 3300035171 Ga0373946_0011423 Ga0373946_0011423_977_2170 377
261 3300035695 Ga0373927_0040566 Ga0373927_0040566_818_2011 377
262 3300035725 Ga0373947_0111025 Ga0373947_0111025_482_1675 377
263 3300036401 Ga0373937_0009758 Ga0373937_0009758_7016_8167 377
264 3300036401 Ga0373937_0123401 Ga0373937_0123401_748_1899 377
265 3300037471 Ga0395905_0012222 Ga0395905_0012222_3630_4808 377
266 3300037471 Ga0395905_0025977 Ga0395905_0025977_2643_3803 377
267 3300041452 Ga0451793_1931907 Ga0451793_1931907_466_1617 377
268 3300041453 Ga0451797_0881475 Ga0451797_0881475_865_2016 377
269 3300041460 Ga0451802_0448423 Ga0451802_0448423_678_1829 377
270 3300041460 Ga0451802_2186402 Ga0451802_2186402_1418_2578 377
271 3300042007 Ga0439449_0031255 Ga0439449_0031255_164_1336 377
272 3300042012 Ga0439455_0008812 Ga0439455_0008812_756_1907 377
273 3300044712 Ga0453684_0114983 Ga0453684_0114983_826_1977 377
274 3300046473 Ga0495582_0119634 Ga0495582_0119634_184_1377 377
275 3300046475 Ga0495639_0005941 Ga0495639_0005941_1302_2495 377
276 3300046512 Ga0495610_0092200 Ga0495610_0092200_154_1305 377
277 3300046519 Ga0495632_0046309 Ga0495632_0046309_243_1394 377
278 3300046522 Ga0495643_0023064 Ga0495643_0023064_437_1588 377
279 3300046660 Ga0495625_0013071 Ga0495625_0013071_3206_4357 377
280 3300046681 Ga0495647_0000651 Ga0495647_0000651_4474_5667 377
281 3300046683 Ga0495658_0019751 Ga0495658_0019751_144_1337 377
282 3300046683 Ga0495658_0149212 Ga0495658_0149212_50_1201 377
283 3300047321 Ga0495676_0197936 Ga0495676_0197936_166_1359 377
284 3300047472 Ga0495686_0019436 Ga0495686_0019436_2036_3187 377
285 3300048905 Ga0496102_0015518 Ga0496102_0015518_2037_3188 377
286 3300048911 Ga0496108_0024755 Ga0496108_0024755_147_1298 377
287 3300049579 Ga0501043_0000023 Ga0501043_0000023_106255_107415 377
288 3300049580 Ga0501046_0000018 Ga0501046_0000018_113147_114307 377
289 3300049581 Ga0501047_0000020 Ga0501047_0000020_151956_153116 377
290 3300049582 Ga0501048_0002498 Ga0501048_0002498_921_2081 377
291 3300049824 Ga0501045_0016490 Ga0501045_0016490_1408_2568 377
292 3300050493 nmdc:mga0k408_22347_c2 nmdc:mga0k408_22347_c2_996_2147 377
293 3300050493 nmdc:mga0k408_3911_c1 nmdc:mga0k408_3911_c1_152_1303 377
294 3300050493 nmdc:mga0k408_8306_c1 nmdc:mga0k408_8306_c1_3649_4800 377
295 3300050494 nmdc:mga06z11_59157_c1 nmdc:mga06z11_59157_c1_19_1170 377
296 3300053086 Ga0500578_0000787 Ga0500578_0000787_30699_31850 377
297 3300053086 Ga0500578_0052977 Ga0500578_0052977_525_1676 377
298 3300053130 Ga0500642_0051534 Ga0500642_0051534_131_1282 377
299 3300053730 Ga0500645_002594 Ga0500645_002594_932_2083 377
300 3300003187 JGI25151J46595_10043938 JGI25151J46595_100439382 378
301 3300035695 Ga0373927_0006714 Ga0373927_0006714_2278_3474 378
302 3300045051 Ga0451576_0129993 Ga0451576_0129993_1165_2319 378
303 3300048909 Ga0496106_0262316 Ga0496106_0262316_169_1365 378
304 3300005459 Ga0068867_100202833 Ga0068867_1002028332 379
305 3300006195 Ga0075366_10001677 Ga0075366_100016779 379
306 3300042876 Ga0451577_0029690 Ga0451577_0029690_3753_4925 379
307 3300046501 Ga0495607_0042320 Ga0495607_0042320_439_1605 379
308 3300046507 Ga0495606_0111842 Ga0495606_0111842_352_1518 379
309 3300046513 Ga0495616_0076593 Ga0495616_0076593_242_1408 379
310 3300050493 nmdc:mga0k408_3661_c1 nmdc:mga0k408_3661_c1_1964_3136 379
311 3300005355 Ga0070671_100085945 Ga0070671_1000859452 380
312 3300005471 Ga0070698_100012253 Ga0070698_1000122534 380
313 3300005543 Ga0070672_100047976 Ga0070672_1000479762 380
314 3300005549 Ga0070704_100002235 Ga0070704_1000022356 380
315 3300005617 Ga0068859_100310053 Ga0068859_1003100532 380
316 3300005718 Ga0068866_10049708 Ga0068866_100497082 380
317 3300005985 Ga0081539_10009781 Ga0081539_100097814 380
318 3300006844 Ga0075428_100097524 Ga0075428_1000975242 380
319 3300006847 Ga0075431_100134649 Ga0075431_1001346493 380
320 3300006880 Ga0075429_100029191 Ga0075429_1000291912 380
321 3300006931 Ga0097620_100310035 Ga0097620_1003100351 380
322 3300009094 Ga0111539_10174383 Ga0111539_101743832 380
323 3300009147 Ga0114129_10047700 Ga0114129_100477007 380
324 3300013308 Ga0157375_10095972 Ga0157375_100959722 380
325 3300014968 Ga0157379_10114247 Ga0157379_101142473 380
326 3300025913 Ga0207695_10106135 Ga0207695_101061352 380
327 3300025919 Ga0207657_10140961 Ga0207657_101409612 380
328 3300028380 Ga0268265_10167125 Ga0268265_101671252 380
329 3300031730 Ga0307516_10110733 Ga0307516_101107333 380
330 3300042001 Ga0439441_004433 Ga0439441_004433_49_1209 380
331 3300042001 Ga0439441_007290 Ga0439441_007290_485_1636 380
332 3300046539 Ga0495621_0009375 Ga0495621_0009375_780_1931 380
333 3300048912 Ga0496109_0131220 Ga0496109_0131220_634_1815 380
334 3300050507 nmdc:mga05p37_250307_c1 nmdc:mga05p37_250307_c1_762_1955 380
335 3300050507 nmdc:mga05p37_5467_c1 nmdc:mga05p37_5467_c1_13390_14541 380
336 3300050508 nmdc:mga09592_525_c1 nmdc:mga09592_525_c1_3786_4937 380
337 3300050511 nmdc:mga08y16_75316_c1 nmdc:mga08y16_75316_c1_988_2139 380
338 iso_pu_bacteria 2939669807 2939669955 380
339 3300005328 Ga0070676_10003985 Ga0070676_100039853 381
340 3300005330 Ga0070690_100043276 Ga0070690_1000432762 381
341 3300005331 Ga0070670_100249694 Ga0070670_1002496941 381
342 3300005331 Ga0070670_100280279 Ga0070670_1002802791 381
343 3300005333 Ga0070677_10024764 Ga0070677_100247642 381
344 3300005335 Ga0070666_10061620 Ga0070666_100616202 381
345 3300005338 Ga0068868_100033556 Ga0068868_1000335563 381
346 3300005347 Ga0070668_100042341 Ga0070668_1000423413 381
347 3300005354 Ga0070675_100060146 Ga0070675_1000601463 381
348 3300005355 Ga0070671_100005456 Ga0070671_10000545611 381
349 3300005356 Ga0070674_100059240 Ga0070674_1000592402 381
350 3300005367 Ga0070667_100091829 Ga0070667_1000918292 381
351 3300005441 Ga0070700_100009928 Ga0070700_1000099284 381
352 3300005456 Ga0070678_100033732 Ga0070678_1000337321 381
353 3300005456 Ga0070678_100162985 Ga0070678_1001629852 381
354 3300005457 Ga0070662_100188529 Ga0070662_1001885292 381
355 3300005459 Ga0068867_100080552 Ga0068867_1000805522 381
356 3300005459 Ga0068867_100098413 Ga0068867_1000984131 381
357 3300005543 Ga0070672_100056213 Ga0070672_1000562134 381
358 3300005543 Ga0070672_100081645 Ga0070672_1000816452 381
359 3300005543 Ga0070672_100097015 Ga0070672_1000970151 381
360 3300005578 Ga0068854_100031641 Ga0068854_1000316412 381
361 3300005616 Ga0068852_100207156 Ga0068852_1002071562 381
362 3300005616 Ga0068852_100236606 Ga0068852_1002366062 381
363 3300005617 Ga0068859_100080523 Ga0068859_1000805233 381
364 3300005617 Ga0068859_100316770 Ga0068859_1003167702 381
365 3300005718 Ga0068866_10001767 Ga0068866_100017679 381
366 3300005719 Ga0068861_100142382 Ga0068861_1001423822 381
367 3300005841 Ga0068863_100114074 Ga0068863_1001140742 381
368 3300005842 Ga0068858_100143489 Ga0068858_1001434892 381
369 3300006237 Ga0097621_100123217 Ga0097621_1001232173 381
370 3300006358 Ga0068871_100086705 Ga0068871_1000867052 381
371 3300006358 Ga0068871_100196935 Ga0068871_1001969352 381
372 3300006844 Ga0075428_100001225 Ga0075428_1000012257 381
373 3300006880 Ga0075429_100029373 Ga0075429_1000293731 381
374 3300006881 Ga0068865_100185594 Ga0068865_1001855942 381
375 3300006931 Ga0097620_100080523 Ga0097620_1000805233 381
376 3300006931 Ga0097620_100316769 Ga0097620_1003167692 381
377 3300009094 Ga0111539_10053322 Ga0111539_100533222 381
378 3300009094 Ga0111539_10170262 Ga0111539_101702622 381
379 3300009098 Ga0105245_10084181 Ga0105245_100841813 381
380 3300009147 Ga0114129_10009453 Ga0114129_100094534 381
381 3300009148 Ga0105243_10016225 Ga0105243_100162252 381
382 3300009176 Ga0105242_10094021 Ga0105242_100940212 381
383 3300009177 Ga0105248_10017866 Ga0105248_100178662 381
384 3300009177 Ga0105248_10049621 Ga0105248_100496212 381
385 3300009177 Ga0105248_10183953 Ga0105248_101839532 381
386 3300009553 Ga0105249_10108229 Ga0105249_101082293 381
387 3300013296 Ga0157374_10287448 Ga0157374_102874482 381
388 3300013297 Ga0157378_10093736 Ga0157378_100937362 381
389 3300013308 Ga0157375_10003889 Ga0157375_100038893 381
390 3300025899 Ga0207642_10009742 Ga0207642_100097423 381
391 3300025903 Ga0207680_10107525 Ga0207680_101075252 381
392 3300025907 Ga0207645_10014014 Ga0207645_100140146 381
393 3300025918 Ga0207662_10014355 Ga0207662_100143553 381
394 3300025925 Ga0207650_10114180 Ga0207650_101141803 381
395 3300025926 Ga0207659_10017392 Ga0207659_100173922 381
396 3300025927 Ga0207687_10089341 Ga0207687_100893412 381
397 3300025931 Ga0207644_10024864 Ga0207644_100248643 381
398 3300025931 Ga0207644_10167079 Ga0207644_101670792 381
399 3300025933 Ga0207706_10037748 Ga0207706_100377483 381
400 3300025933 Ga0207706_10365038 Ga0207706_103650381 381
401 3300025934 Ga0207686_10086859 Ga0207686_100868592 381
402 3300025935 Ga0207709_10012911 Ga0207709_100129112 381
403 3300025937 Ga0207669_10052423 Ga0207669_100524232 381
404 3300025938 Ga0207704_10066390 Ga0207704_100663902 381
405 3300025940 Ga0207691_10011546 Ga0207691_1001154612 381
406 3300025940 Ga0207691_10051226 Ga0207691_100512264 381
407 3300025940 Ga0207691_10225604 Ga0207691_102256042 381
408 3300025941 Ga0207711_10007461 Ga0207711_100074613 381
409 3300025941 Ga0207711_10114492 Ga0207711_101144921 381
410 3300025942 Ga0207689_10094530 Ga0207689_100945301 381
411 3300025961 Ga0207712_10004221 Ga0207712_100042218 381
412 3300025981 Ga0207640_10062336 Ga0207640_100623362 381
413 3300025986 Ga0207658_10008305 Ga0207658_100083058 381
414 3300026075 Ga0207708_10028414 Ga0207708_100284145 381
415 3300026088 Ga0207641_10004639 Ga0207641_100046396 381
416 3300026089 Ga0207648_10063670 Ga0207648_100636702 381
417 3300026089 Ga0207648_10250198 Ga0207648_102501982 381
418 3300026118 Ga0207675_100048651 Ga0207675_1000486513 381
419 3300026121 Ga0207683_10205759 Ga0207683_102057592 381
420 3300026142 Ga0207698_10069098 Ga0207698_100690981 381
421 3300027907 Ga0207428_10051779 Ga0207428_100517792 381
422 3300031665 Ga0316575_10007395 Ga0316575_100073954 381
423 3300031691 Ga0316579_10035589 Ga0316579_100355892 381
424 3300032133 Ga0316583_10013543 Ga0316583_100135432 381
425 3300035113 Ga0373936_0038432 Ga0373936_0038432_700_1863 381
426 3300035692 Ga0373935_0069721 Ga0373935_0069721_908_2071 381
427 3300035695 Ga0373927_0013233 Ga0373927_0013233_2951_4123 381
428 3300036401 Ga0373937_0383215 Ga0373937_0383215_80_1243 381
429 3300036647 Ga0316582_0004577 Ga0316582_0004577_1599_2753 381
430 3300036712 Ga0316584_0181576 Ga0316584_0181576_213_1367 381
431 3300037068 Ga0373925_0043468 Ga0373925_0043468_765_1937 381
432 3300037068 Ga0373925_0161996 Ga0373925_0161996_110_1273 381
433 3300037588 Ga0316581_0002921 Ga0316581_0002921_603_1757 381
434 3300044684 Ga0466966_0098515 Ga0466966_0098515_346_1542 381
435 3300044693 Ga0466961_0099060 Ga0466961_0099060_89_1285 381
436 3300044719 Ga0466971_0022938 Ga0466971_0022938_588_1784 381
437 3300045049 Ga0466959_0020291 Ga0466959_0020291_1922_3118 381
438 3300046683 Ga0495658_0041560 Ga0495658_0041560_1102_2310 381
439 3300049589 Ga0501073_0039581 Ga0501073_0039581_555_1709 381
440 3300049742 Ga0501080_0105488 Ga0501080_0105488_975_2129 381
441 3300050507 nmdc:mga05p37_349_c1 nmdc:mga05p37_349_c1_21347_22540 381
442 3300050508 nmdc:mga09592_3199_c1 nmdc:mga09592_3199_c1_5919_7112 381
443 3300050508 nmdc:mga09592_43660_c1 nmdc:mga09592_43660_c1_123_1316 381
444 3300050509 nmdc:mga0qj67_33113_c1 nmdc:mga0qj67_33113_c1_170_1321 381
445 3300050510 nmdc:mga06r32_84807_c1 nmdc:mga06r32_84807_c1_252_1445 381
446 3300050511 nmdc:mga08y16_86836_c1 nmdc:mga08y16_86836_c1_1933_3126 381
447 3300053085 Ga0495619_0065552 Ga0495619_0065552_165_1328 381
448 3300061719 Ga0466962_0014620 Ga0466962_0014620_892_2088 381
449 3300005327 Ga0070658_10028554 Ga0070658_100285542 382
450 3300005329 Ga0070683_100007089 Ga0070683_1000070891 382
451 3300005330 Ga0070690_100000408 Ga0070690_10000040812 382
452 3300005334 Ga0068869_100000478 Ga0068869_10000047812 382
453 3300005336 Ga0070680_100000654 Ga0070680_10000065424 382
454 3300005338 Ga0068868_100000056 Ga0068868_10000005652 382
455 3300005339 Ga0070660_100106492 Ga0070660_1001064922 382
456 3300005340 Ga0070689_100000429 Ga0070689_10000042923 382
457 3300005341 Ga0070691_10000463 Ga0070691_100004634 382
458 3300005343 Ga0070687_100000418 Ga0070687_10000041813 382
459 3300005344 Ga0070661_100075262 Ga0070661_1000752622 382
460 3300005345 Ga0070692_10001960 Ga0070692_100019608 382
461 3300005366 Ga0070659_100084594 Ga0070659_1000845942 382
462 3300005438 Ga0070701_10001314 Ga0070701_100013143 382
463 3300005440 Ga0070705_100000855 Ga0070705_1000008556 382
464 3300005441 Ga0070700_100001470 Ga0070700_1000014704 382
465 3300005444 Ga0070694_100000452 Ga0070694_1000004524 382
466 3300005459 Ga0068867_100000623 Ga0068867_10000062312 382
467 3300005530 Ga0070679_100022808 Ga0070679_1000228085 382
468 3300005536 Ga0070697_100124956 Ga0070697_1001249562 382
469 3300005539 Ga0068853_100052361 Ga0068853_1000523613 382
470 3300005544 Ga0070686_100003488 Ga0070686_1000034886 382
471 3300005545 Ga0070695_100000414 Ga0070695_10000041411 382
472 3300005546 Ga0070696_100000012 Ga0070696_10000001220 382
473 3300005547 Ga0070693_100000222 Ga0070693_10000022211 382
474 3300005549 Ga0070704_100000233 Ga0070704_10000023314 382
475 3300005563 Ga0068855_100006214 Ga0068855_10000621412 382
476 3300005564 Ga0070664_100021750 Ga0070664_1000217501 382
477 3300005577 Ga0068857_100224021 Ga0068857_1002240211 382
478 3300005614 Ga0068856_100007697 Ga0068856_1000076972 382
479 3300005614 Ga0068856_100013314 Ga0068856_1000133149 382
480 3300005616 Ga0068852_100021127 Ga0068852_1000211275 382
481 3300005617 Ga0068859_100005934 Ga0068859_10000593412 382
482 3300005718 Ga0068866_10000392 Ga0068866_1000039220 382
483 3300005719 Ga0068861_100000033 Ga0068861_10000003314 382
484 3300005834 Ga0068851_10019315 Ga0068851_100193153 382
485 3300005840 Ga0068870_10080055 Ga0068870_100800552 382
486 3300005842 Ga0068858_100003471 Ga0068858_1000034716 382
487 3300005843 Ga0068860_100003755 Ga0068860_1000037556 382
488 3300005844 Ga0068862_100001281 Ga0068862_10000128112 382
489 3300006237 Ga0097621_100000801 Ga0097621_10000080110 382
490 3300006358 Ga0068871_100001405 Ga0068871_10000140514 382
491 3300006881 Ga0068865_100000629 Ga0068865_1000006294 382
492 3300006931 Ga0097620_100005934 Ga0097620_1000059343 382
493 3300009098 Ga0105245_10001181 Ga0105245_1000118113 382
494 3300009148 Ga0105243_10001329 Ga0105243_1000132912 382
495 3300009174 Ga0105241_10017607 Ga0105241_100176073 382
496 3300009176 Ga0105242_10002209 Ga0105242_1000220913 382
497 3300009553 Ga0105249_10001192 Ga0105249_1000119211 382
498 3300010375 Ga0105239_10023152 Ga0105239_100231527 382
499 3300013296 Ga0157374_10082868 Ga0157374_100828684 382
500 3300013297 Ga0157378_10000693 Ga0157378_1000069312 382
501 3300014969 Ga0157376_10002436 Ga0157376_1000243611 382
502 3300025904 Ga0207647_10020345 Ga0207647_100203453 382
503 3300025909 Ga0207705_10072390 Ga0207705_100723903 382
504 3300025911 Ga0207654_10018181 Ga0207654_100181813 382
505 3300025917 Ga0207660_10004807 Ga0207660_100048078 382
506 3300025918 Ga0207662_10000782 Ga0207662_100007824 382
507 3300025920 Ga0207649_10027765 Ga0207649_100277655 382
508 3300025921 Ga0207652_10072814 Ga0207652_100728142 382
509 3300025926 Ga0207659_10063691 Ga0207659_100636912 382
510 3300025932 Ga0207690_10094129 Ga0207690_100941292 382
511 3300025934 Ga0207686_10015450 Ga0207686_100154504 382
512 3300025935 Ga0207709_10003401 Ga0207709_100034013 382
513 3300025938 Ga0207704_10000370 Ga0207704_1000037023 382
514 3300025942 Ga0207689_10003609 Ga0207689_100036095 382
515 3300025945 Ga0207679_10134897 Ga0207679_101348972 382
516 3300025949 Ga0207667_10061993 Ga0207667_100619934 382
517 3300025981 Ga0207640_10009134 Ga0207640_100091344 382
518 3300026023 Ga0207677_10000768 Ga0207677_1000076811 382
519 3300026041 Ga0207639_10025204 Ga0207639_100252044 382
520 3300026041 Ga0207639_10040340 Ga0207639_100403402 382
521 3300026075 Ga0207708_10000617 Ga0207708_1000061714 382
522 3300026078 Ga0207702_10064993 Ga0207702_100649932 382
523 3300026089 Ga0207648_10000130 Ga0207648_1000013067 382
524 3300026089 Ga0207648_10126836 Ga0207648_101268362 382
525 3300026116 Ga0207674_10020685 Ga0207674_100206852 382
526 3300026118 Ga0207675_100001694 Ga0207675_10000169412 382
527 3300026118 Ga0207675_100109636 Ga0207675_1001096362 382
528 3300028380 Ga0268265_10003627 Ga0268265_1000362711 382
529 3300028381 Ga0268264_10000892 Ga0268264_1000089224 382
530 3300035691 Ga0373931_0101337 Ga0373931_0101337_383_1576 382
531 3300041459 Ga0451800_1606912 Ga0451800_1606912_310_1545 382
532 3300053161 Ga0500634_0000600 Ga0500634_0000600_7854_9068 382
533 3300005336 Ga0070680_100006576 Ga0070680_1000065762 383
534 3300005530 Ga0070679_100020566 Ga0070679_1000205664 383
535 3300005985 Ga0081539_10035756 Ga0081539_100357563 383
536 3300006846 Ga0075430_100251176 Ga0075430_1002511762 383
537 3300006880 Ga0075429_100178054 Ga0075429_1001780542 383
538 3300009147 Ga0114129_10268214 Ga0114129_102682142 383
539 3300025917 Ga0207660_10032183 Ga0207660_100321831 383
540 3300025928 Ga0207700_10033017 Ga0207700_100330173 383
541 3300050507 nmdc:mga05p37_46938_c1 nmdc:mga05p37_46938_c1_547_1707 383
542 3300050508 nmdc:mga09592_27185_c1 nmdc:mga09592_27185_c1_959_2119 383
543 3300050510 nmdc:mga06r32_349297_c1 nmdc:mga06r32_349297_c1_155_1315 383
544 3300005329 Ga0070683_100087297 Ga0070683_1000872973 384
545 3300005336 Ga0070680_100023434 Ga0070680_1000234347 384
546 3300005336 Ga0070680_100077300 Ga0070680_1000773002 384
547 3300005337 Ga0070682_100137549 Ga0070682_1001375492 384
548 3300005338 Ga0068868_100033283 Ga0068868_1000332832 384
549 3300005345 Ga0070692_10020544 Ga0070692_100205442 384
550 3300005353 Ga0070669_100008643 Ga0070669_1000086437 384
551 3300005354 Ga0070675_100004598 Ga0070675_10000459811 384
552 3300005355 Ga0070671_100046866 Ga0070671_1000468665 384
553 3300005366 Ga0070659_100008273 Ga0070659_1000082739 384
554 3300005441 Ga0070700_100000499 Ga0070700_10000049915 384
555 3300005457 Ga0070662_100044780 Ga0070662_1000447802 384
556 3300005458 Ga0070681_10009598 Ga0070681_100095985 384
557 3300005459 Ga0068867_100000816 Ga0068867_1000008168 384
558 3300005530 Ga0070679_100010847 Ga0070679_1000108473 384
559 3300005539 Ga0068853_100023858 Ga0068853_1000238583 384
560 3300005543 Ga0070672_100032941 Ga0070672_1000329414 384
561 3300005563 Ga0068855_100129357 Ga0068855_1001293572 384
562 3300005563 Ga0068855_100162772 Ga0068855_1001627721 384
563 3300005564 Ga0070664_100098882 Ga0070664_1000988822 384
564 3300005577 Ga0068857_100120434 Ga0068857_1001204341 384
565 3300005578 Ga0068854_100006996 Ga0068854_1000069969 384
566 3300005614 Ga0068856_100003093 Ga0068856_1000030935 384
567 3300005614 Ga0068856_100206184 Ga0068856_1002061842 384
568 3300005616 Ga0068852_100062389 Ga0068852_1000623893 384
569 3300005616 Ga0068852_100296836 Ga0068852_1002968361 384
570 3300005618 Ga0068864_100055591 Ga0068864_1000555913 384
571 3300005719 Ga0068861_100010234 Ga0068861_1000102345 384
572 3300005842 Ga0068858_100173220 Ga0068858_1001732201 384
573 3300005843 Ga0068860_100096000 Ga0068860_1000960003 384
574 3300005844 Ga0068862_100132045 Ga0068862_1001320452 384
575 3300006881 Ga0068865_100008959 Ga0068865_1000089595 384
576 3300009094 Ga0111539_10070517 Ga0111539_100705172 384
577 3300009098 Ga0105245_10263677 Ga0105245_102636772 384
578 3300009148 Ga0105243_10006779 Ga0105243_1000677910 384
579 3300009174 Ga0105241_10049461 Ga0105241_100494613 384
580 3300009177 Ga0105248_10125562 Ga0105248_101255623 384
581 3300010375 Ga0105239_10302553 Ga0105239_103025532 384
582 3300013296 Ga0157374_10005865 Ga0157374_100058652 384
583 3300013306 Ga0163162_10051681 Ga0163162_100516813 384
584 3300013306 Ga0163162_10071605 Ga0163162_100716053 384
585 3300013307 Ga0157372_10002828 Ga0157372_100028286 384
586 3300013307 Ga0157372_10019251 Ga0157372_100192512 384
587 3300014326 Ga0157380_10018722 Ga0157380_100187227 384
588 3300014745 Ga0157377_10037330 Ga0157377_100373302 384
589 3300014968 Ga0157379_10037900 Ga0157379_100379003 384
590 3300017792 Ga0163161_10023133 Ga0163161_100231333 384
591 3300025899 Ga0207642_10018667 Ga0207642_100186673 384
592 3300025907 Ga0207645_10029674 Ga0207645_100296743 384
593 3300025912 Ga0207707_10006002 Ga0207707_100060024 384
594 3300025919 Ga0207657_10016351 Ga0207657_100163513 384
595 3300025921 Ga0207652_10005271 Ga0207652_100052714 384
596 3300025923 Ga0207681_10001478 Ga0207681_1000147812 384
597 3300025923 Ga0207681_10015245 Ga0207681_100152455 384
598 3300025927 Ga0207687_10045063 Ga0207687_100450633 384
599 3300025931 Ga0207644_10008258 Ga0207644_100082589 384
600 3300025932 Ga0207690_10009822 Ga0207690_100098227 384
601 3300025933 Ga0207706_10031665 Ga0207706_100316652 384
602 3300025935 Ga0207709_10001580 Ga0207709_100015805 384
603 3300025938 Ga0207704_10002182 Ga0207704_100021825 384
604 3300025940 Ga0207691_10036114 Ga0207691_100361142 384
605 3300025941 Ga0207711_10063435 Ga0207711_100634352 384
606 3300025942 Ga0207689_10004291 Ga0207689_100042919 384
607 3300025949 Ga0207667_10081291 Ga0207667_100812913 384
608 3300026023 Ga0207677_10068482 Ga0207677_100684823 384
609 3300026035 Ga0207703_10037103 Ga0207703_100371033 384
610 3300026067 Ga0207678_10018317 Ga0207678_100183176 384
611 3300026078 Ga0207702_10004753 Ga0207702_100047537 384
612 3300026078 Ga0207702_10030713 Ga0207702_100307133 384
613 3300026089 Ga0207648_10002519 Ga0207648_1000251915 384
614 3300026089 Ga0207648_10045838 Ga0207648_100458384 384
615 3300026095 Ga0207676_10014293 Ga0207676_100142933 384
616 3300026116 Ga0207674_10051358 Ga0207674_100513583 384
617 3300026118 Ga0207675_100000857 Ga0207675_10000085711 384
618 3300026121 Ga0207683_10148771 Ga0207683_101487713 384
619 3300027665 Ga0209983_1004988 Ga0209983_10049882 384
620 3300027907 Ga0207428_10097111 Ga0207428_100971112 384
621 3300028380 Ga0268265_10005565 Ga0268265_100055657 384
622 3300031731 Ga0307405_10007502 Ga0307405_100075023 384
623 3300031911 Ga0307412_10065398 Ga0307412_100653982 384
624 3300031995 Ga0307409_100000086 Ga0307409_10000008633 384
625 3300032002 Ga0307416_100117705 Ga0307416_1001177052 384
626 3300035242 Ga0373962_0024180 Ga0373962_0024180_157_1371 384
627 3300035691 Ga0373931_0009283 Ga0373931_0009283_1043_2257 384
628 3300038996 Ga0242420_011280 Ga0242420_011280_316_1485 384
629 3300039437 Ga0436365_0038862 Ga0436365_0038862_1542_2714 384
630 3300042156 Ga0439446_0011224 Ga0439446_0011224_1159_2322 384
631 3300042436 Ga0439435_0012465 Ga0439435_0012465_566_1729 384
632 3300045051 Ga0451576_0135584 Ga0451576_0135584_1020_2234 384
633 3300045976 Ga0466967_0076090 Ga0466967_0076090_966_2129 384
634 3300046537 Ga0495598_0044033 Ga0495598_0044033_127_1290 384
635 3300048904 Ga0496101_0083959 Ga0496101_0083959_470_1684 384
636 3300048911 Ga0496108_0100478 Ga0496108_0100478_169_1383 384
637 3300048912 Ga0496109_0143497 Ga0496109_0143497_10_1224 384
638 3300048913 Ga0496110_0031132 Ga0496110_0031132_1001_2215 384
639 3300048916 Ga0496113_0031390 Ga0496113_0031390_1093_2307 384
640 3300048917 Ga0496114_0155721 Ga0496114_0155721_602_1816 384
641 3300048918 Ga0496115_0007123 Ga0496115_0007123_5729_6943 384
642 3300049570 Ga0501033_0009551 Ga0501033_0009551_1109_2284 384
643 3300049572 Ga0501036_0003867 Ga0501036_0003867_3282_4457 384
644 3300049574 Ga0501038_0012500 Ga0501038_0012500_3413_4588 384
645 3300049575 Ga0501039_0003349 Ga0501039_0003349_7242_8417 384
646 3300049576 Ga0501040_0000593 Ga0501040_0000593_2192_3367 384
647 3300049577 Ga0501041_0000034 Ga0501041_0000034_39743_40918 384
648 3300049578 Ga0501042_0001135 Ga0501042_0001135_11004_12179 384
649 3300049580 Ga0501046_0007125 Ga0501046_0007125_5255_6430 384
650 3300049582 Ga0501048_0006069 Ga0501048_0006069_6595_7770 384
651 3300049584 Ga0501068_0033554 Ga0501068_0033554_662_1837 384
652 3300049587 Ga0501071_0058042 Ga0501071_0058042_23_1198 384
653 3300049588 Ga0501072_0006856 Ga0501072_0006856_1935_3110 384
654 3300049592 Ga0501076_0001930 Ga0501076_0001930_12229_13404 384
655 3300049741 Ga0501079_0001432 Ga0501079_0001432_6767_7942 384
656 3300049743 Ga0501081_0004050 Ga0501081_0004050_3241_4416 384
657 3300050510 nmdc:mga06r32_52852_c1 nmdc:mga06r32_52852_c1_2690_3868 384
658 3300050511 nmdc:mga08y16_37237_c1 nmdc:mga08y16_37237_c1_1545_2708 384
659 3300050513 nmdc:mga0rr50_210015_c1 nmdc:mga0rr50_210015_c1_378_1556 384
660 3300054114 Ga0501084_0015576 Ga0501084_0015576_2075_3250 384
661 3300060353 Ga0501082_0025146 Ga0501082_0025146_3219_4394 384
662 3300061734 Ga0530510_0005240 Ga0530510_0005240_1966_3141 384
663 3300005435 Ga0070714_100120648 Ga0070714_1001206481 385
664 3300005436 Ga0070713_100000026 Ga0070713_10000002614 385
665 3300005458 Ga0070681_10000591 Ga0070681_1000059113 385
666 3300005467 Ga0070706_100013361 Ga0070706_1000133615 385
667 3300005530 Ga0070679_100110668 Ga0070679_1001106682 385
668 3300005536 Ga0070697_100006508 Ga0070697_1000065088 385
669 3300005563 Ga0068855_100358908 Ga0068855_1003589082 385
670 3300006846 Ga0075430_100000744 Ga0075430_1000007443 385
671 3300006871 Ga0075434_100000072 Ga0075434_10000007247 385
672 3300007076 Ga0075435_100002554 Ga0075435_1000025544 385
673 3300007076 Ga0075435_100160042 Ga0075435_1001600422 385
674 3300009094 Ga0111539_10269538 Ga0111539_102695383 385
675 3300009147 Ga0114129_10057183 Ga0114129_100571835 385
676 3300013104 Ga0157370_10002404 Ga0157370_100024043 385
677 3300014326 Ga0157380_10300573 Ga0157380_103005731 385
678 3300014969 Ga0157376_10003620 Ga0157376_100036208 385
679 3300025912 Ga0207707_10001629 Ga0207707_1000162911 385
680 3300025921 Ga0207652_10045778 Ga0207652_100457784 385
681 3300025928 Ga0207700_10000375 Ga0207700_1000037523 385
682 3300025929 Ga0207664_10036805 Ga0207664_100368052 385
683 3300025949 Ga0207667_10012582 Ga0207667_100125825 385
684 3300026078 Ga0207702_10098222 Ga0207702_100982222 385
685 3300027907 Ga0207428_10135074 Ga0207428_101350742 385
686 3300042437 Ga0439444_0000219 Ga0439444_0000219_3955_5133 385
687 3300042461 Ga0439460_0000400 Ga0439460_0000400_3689_4867 385
688 3300046528 Ga0495642_0020765 Ga0495642_0020765_1202_2368 385
689 3300049576 Ga0501040_0058683 Ga0501040_0058683_977_2155 385
690 3300049584 Ga0501068_0174237 Ga0501068_0174237_156_1331 385
691 3300049588 Ga0501072_0073752 Ga0501072_0073752_563_1729 385
692 3300050508 nmdc:mga09592_301692_c1 nmdc:mga09592_301692_c1_143_1318 385
693 3300050509 nmdc:mga0qj67_570_c1 nmdc:mga0qj67_570_c1_5957_7123 385
694 3300050510 nmdc:mga06r32_104794_c1 nmdc:mga06r32_104794_c1_801_1967 385
695 3300050512 nmdc:mga0n895_1603_c1 nmdc:mga0n895_1603_c1_10678_11856 385
696 3300050512 nmdc:mga0n895_267816_c1 nmdc:mga0n895_267816_c1_535_1719 385
697 3300050513 nmdc:mga0rr50_626_c1 nmdc:mga0rr50_626_c1_2767_3945 385
698 3300050514 nmdc:mga08x19_32882_c1 nmdc:mga08x19_32882_c1_1682_2860 385
699 3300050515 nmdc:mga0a205_99575_c1 nmdc:mga0a205_99575_c1_1259_2452 385
700 3300005293 Ga0065715_10026169 Ga0065715_100261693 386
701 3300005327 Ga0070658_10083502 Ga0070658_100835022 386
702 3300005328 Ga0070676_10002958 Ga0070676_100029589 386
703 3300005328 Ga0070676_10071763 Ga0070676_100717631 386
704 3300005331 Ga0070670_100006584 Ga0070670_1000065848 386
705 3300005333 Ga0070677_10000132 Ga0070677_1000013223 386
706 3300005334 Ga0068869_100028754 Ga0068869_1000287544 386
707 3300005335 Ga0070666_10002288 Ga0070666_100022888 386
708 3300005335 Ga0070666_10030816 Ga0070666_100308162 386
709 3300005335 Ga0070666_10181371 Ga0070666_101813711 386
710 3300005336 Ga0070680_100056068 Ga0070680_1000560683 386
711 3300005338 Ga0068868_100005576 Ga0068868_1000055766 386
712 3300005338 Ga0068868_100043949 Ga0068868_1000439494 386
713 3300005347 Ga0070668_100000394 Ga0070668_10000039415 386
714 3300005347 Ga0070668_100042616 Ga0070668_1000426164 386
715 3300005354 Ga0070675_100000331 Ga0070675_10000033130 386
716 3300005355 Ga0070671_100019005 Ga0070671_1000190054 386
717 3300005355 Ga0070671_100119784 Ga0070671_1001197842 386
718 3300005356 Ga0070674_100102619 Ga0070674_1001026192 386
719 3300005356 Ga0070674_100112724 Ga0070674_1001127243 386
720 3300005364 Ga0070673_100000864 Ga0070673_10000086416 386
721 3300005364 Ga0070673_100060353 Ga0070673_1000603533 386
722 3300005365 Ga0070688_100084572 Ga0070688_1000845722 386
723 3300005367 Ga0070667_100010248 Ga0070667_1000102484 386
724 3300005367 Ga0070667_100116327 Ga0070667_1001163271 386
725 3300005440 Ga0070705_100192981 Ga0070705_1001929811 386
726 3300005444 Ga0070694_100031467 Ga0070694_1000314674 386
727 3300005445 Ga0070708_100000244 Ga0070708_10000024433 386
728 3300005455 Ga0070663_100042005 Ga0070663_1000420052 386
729 3300005456 Ga0070678_100001058 Ga0070678_1000010584 386
730 3300005456 Ga0070678_100001348 Ga0070678_1000013484 386
731 3300005459 Ga0068867_100003590 Ga0068867_1000035904 386
732 3300005536 Ga0070697_100038739 Ga0070697_1000387392 386
733 3300005539 Ga0068853_100002757 Ga0068853_1000027571 386
734 3300005543 Ga0070672_100052637 Ga0070672_1000526372 386
735 3300005544 Ga0070686_100022128 Ga0070686_1000221282 386
736 3300005546 Ga0070696_100002873 Ga0070696_10000287310 386
737 3300005546 Ga0070696_100029845 Ga0070696_1000298455 386
738 3300005546 Ga0070696_100044653 Ga0070696_1000446534 386
739 3300005548 Ga0070665_100012901 Ga0070665_1000129015 386
740 3300005549 Ga0070704_100008012 Ga0070704_1000080124 386
741 3300005564 Ga0070664_100067479 Ga0070664_1000674793 386
742 3300005614 Ga0068856_100022222 Ga0068856_1000222226 386
743 3300005615 Ga0070702_100046926 Ga0070702_1000469262 386
744 3300005616 Ga0068852_100059635 Ga0068852_1000596352 386
745 3300005617 Ga0068859_100012677 Ga0068859_1000126779 386
746 3300005617 Ga0068859_100197894 Ga0068859_1001978942 386
747 3300005618 Ga0068864_100002228 Ga0068864_1000022282 386
748 3300005618 Ga0068864_100017374 Ga0068864_1000173745 386
749 3300005719 Ga0068861_100159755 Ga0068861_1001597552 386
750 3300005834 Ga0068851_10017527 Ga0068851_100175274 386
751 3300005840 Ga0068870_10016973 Ga0068870_100169733 386
752 3300005841 Ga0068863_100013029 Ga0068863_1000130293 386
753 3300005842 Ga0068858_100000612 Ga0068858_10000061219 386
754 3300005842 Ga0068858_100010466 Ga0068858_1000104669 386
755 3300005843 Ga0068860_100044323 Ga0068860_1000443235 386
756 3300005843 Ga0068860_100077813 Ga0068860_1000778134 386
757 3300005844 Ga0068862_100361584 Ga0068862_1003615841 386
758 3300006237 Ga0097621_100017589 Ga0097621_1000175891 386
759 3300006237 Ga0097621_100038903 Ga0097621_1000389032 386
760 3300006358 Ga0068871_100032604 Ga0068871_1000326043 386
761 3300006358 Ga0068871_100049131 Ga0068871_1000491314 386
762 3300006358 Ga0068871_100192975 Ga0068871_1001929751 386
763 3300006846 Ga0075430_100043796 Ga0075430_1000437963 386
764 3300006847 Ga0075431_100067720 Ga0075431_1000677201 386
765 3300006852 Ga0075433_10002752 Ga0075433_1000275214 386
766 3300006871 Ga0075434_100002297 Ga0075434_10000229716 386
767 3300006881 Ga0068865_100013757 Ga0068865_1000137576 386
768 3300006914 Ga0075436_100064732 Ga0075436_1000647322 386
769 3300006931 Ga0097620_100012677 Ga0097620_1000126779 386
770 3300006931 Ga0097620_100197907 Ga0097620_1001979072 386
771 3300007076 Ga0075435_100001177 Ga0075435_10000117716 386
772 3300009177 Ga0105248_10266796 Ga0105248_102667962 386
773 3300013104 Ga0157370_10050708 Ga0157370_100507082 386
774 3300013296 Ga0157374_10001736 Ga0157374_100017364 386
775 3300013297 Ga0157378_10004675 Ga0157378_100046753 386
776 3300013306 Ga0163162_10087391 Ga0163162_100873913 386
777 3300013307 Ga0157372_10011850 Ga0157372_100118503 386
778 3300013307 Ga0157372_10258427 Ga0157372_102584272 386
779 3300013308 Ga0157375_10013200 Ga0157375_100132007 386
780 3300013308 Ga0157375_10058150 Ga0157375_100581503 386
781 3300014325 Ga0163163_10178375 Ga0163163_101783753 386
782 3300014968 Ga0157379_10005162 Ga0157379_100051626 386
783 3300014968 Ga0157379_10019810 Ga0157379_100198103 386
784 3300014969 Ga0157376_10012494 Ga0157376_100124944 386
785 3300017792 Ga0163161_10019913 Ga0163161_100199132 386
786 3300025321 Ga0207656_10007341 Ga0207656_100073412 386
787 3300025893 Ga0207682_10000044 Ga0207682_1000004428 386
788 3300025907 Ga0207645_10000590 Ga0207645_100005902 386
789 3300025907 Ga0207645_10001566 Ga0207645_1000156613 386
790 3300025908 Ga0207643_10029280 Ga0207643_100292805 386
791 3300025909 Ga0207705_10069511 Ga0207705_100695114 386
792 3300025917 Ga0207660_10065721 Ga0207660_100657212 386
793 3300025917 Ga0207660_10185416 Ga0207660_101854162 386
794 3300025923 Ga0207681_10095094 Ga0207681_100950942 386
795 3300025926 Ga0207659_10002022 Ga0207659_100020222 386
796 3300025926 Ga0207659_10002849 Ga0207659_100028499 386
797 3300025931 Ga0207644_10004238 Ga0207644_100042388 386
798 3300025931 Ga0207644_10008540 Ga0207644_100085408 386
799 3300025937 Ga0207669_10132096 Ga0207669_101320962 386
800 3300025940 Ga0207691_10000022 Ga0207691_1000002237 386
801 3300025940 Ga0207691_10000224 Ga0207691_1000022416 386
802 3300025941 Ga0207711_10012405 Ga0207711_100124054 386
803 3300025942 Ga0207689_10039935 Ga0207689_100399352 386
804 3300025944 Ga0207661_10082231 Ga0207661_100822313 386
805 3300025960 Ga0207651_10013505 Ga0207651_100135052 386
806 3300025960 Ga0207651_10092471 Ga0207651_100924713 386
807 3300025972 Ga0207668_10016076 Ga0207668_100160764 386
808 3300025972 Ga0207668_10041154 Ga0207668_100411542 386
809 3300025972 Ga0207668_10041705 Ga0207668_100417053 386
810 3300025986 Ga0207658_10011567 Ga0207658_100115674 386
811 3300026023 Ga0207677_10084101 Ga0207677_100841013 386
812 3300026041 Ga0207639_10006189 Ga0207639_100061894 386
813 3300026067 Ga0207678_10021448 Ga0207678_100214484 386
814 3300026078 Ga0207702_10106709 Ga0207702_101067093 386
815 3300026088 Ga0207641_10010037 Ga0207641_100100374 386
816 3300026088 Ga0207641_10039034 Ga0207641_100390344 386
817 3300026089 Ga0207648_10000089 Ga0207648_1000008982 386
818 3300026089 Ga0207648_10003749 Ga0207648_100037496 386
819 3300026095 Ga0207676_10004846 Ga0207676_100048469 386
820 3300026121 Ga0207683_10000283 Ga0207683_1000028324 386
821 3300026121 Ga0207683_10001343 Ga0207683_100013436 386
822 3300026142 Ga0207698_10006776 Ga0207698_100067766 386
823 3300027471 Ga0209995_1000765 Ga0209995_10007651 386
824 3300028379 Ga0268266_10003808 Ga0268266_1000380814 386
825 3300028379 Ga0268266_10085660 Ga0268266_100856602 386
826 3300031238 Ga0265332_10001972 Ga0265332_100019723 386
827 3300031250 Ga0265331_10001617 Ga0265331_100016178 386
828 3300031712 Ga0265342_10011453 Ga0265342_100114532 386
829 3300032002 Ga0307416_100025400 Ga0307416_1000254002 386
830 3300034820 Ga0373959_0004801 Ga0373959_0004801_25_1218 386
831 3300035091 Ga0373951_0002478 Ga0373951_0002478_3032_4225 386
832 3300035112 Ga0373932_0002947 Ga0373932_0002947_2460_3653 386
833 3300035114 Ga0373939_0003489 Ga0373939_0003489_1458_2651 386
834 3300035115 Ga0373941_0012599 Ga0373941_0012599_968_2161 386
835 3300035118 Ga0373954_0000190 Ga0373954_0000190_6626_7795 386
836 3300035172 Ga0373955_0023682 Ga0373955_0023682_1670_2842 386
837 3300035207 Ga0373942_0002583 Ga0373942_0002583_2569_3738 386
838 3300035691 Ga0373931_0000211 Ga0373931_0000211_13613_14806 386
839 3300035691 Ga0373931_0010357 Ga0373931_0010357_3104_4276 386
840 3300036401 Ga0373937_0003543 Ga0373937_0003543_11269_12438 386
841 3300036401 Ga0373937_0085863 Ga0373937_0085863_337_1509 386
842 3300041486 Ga0451807_0803462 Ga0451807_0803462_1931_3103 386
843 3300042876 Ga0451577_0028262 Ga0451577_0028262_2768_3940 386
844 3300045051 Ga0451576_0000717 Ga0451576_0000717_60119_61291 386
845 3300046476 Ga0495662_0064117 Ga0495662_0064117_446_1615 386
846 3300046535 Ga0495586_0044286 Ga0495586_0044286_1123_2292 386
847 3300046537 Ga0495598_0014774 Ga0495598_0014774_261_1433 386
848 3300048911 Ga0496108_0196137 Ga0496108_0196137_126_1301 386
849 3300049569 Ga0501032_0159011 Ga0501032_0159011_146_1336 386
850 3300049570 Ga0501033_0066034 Ga0501033_0066034_569_1759 386
851 3300049577 Ga0501041_0063723 Ga0501041_0063723_50_1219 386
852 3300049578 Ga0501042_0150441 Ga0501042_0150441_229_1416 386
853 3300049580 Ga0501046_0022216 Ga0501046_0022216_3026_4216 386
854 3300049583 Ga0501067_0135554 Ga0501067_0135554_59_1234 386
855 3300049588 Ga0501072_0053645 Ga0501072_0053645_1061_2251 386
856 3300049592 Ga0501076_0002817 Ga0501076_0002817_523_1713 386
857 3300049741 Ga0501079_0059998 Ga0501079_0059998_273_1442 386
858 3300049742 Ga0501080_0066030 Ga0501080_0066030_339_1508 386
859 3300049743 Ga0501081_0005463 Ga0501081_0005463_6703_7872 386
860 3300049743 Ga0501081_0007324 Ga0501081_0007324_1353_2543 386
861 3300049824 Ga0501045_0004925 Ga0501045_0004925_1543_2733 386
862 3300050510 nmdc:mga06r32_238785_c1 nmdc:mga06r32_238785_c1_86_1258 386
863 3300050512 nmdc:mga0n895_173933_c1 nmdc:mga0n895_173933_c1_426_1688 386
864 3300050514 nmdc:mga08x19_117640_c1 nmdc:mga08x19_117640_c1_348_1517 386
865 3300050515 nmdc:mga0a205_75_c1 nmdc:mga0a205_75_c1_27244_28506 386
866 3300054114 Ga0501084_0033682 Ga0501084_0033682_2608_3798 386
867 3300054114 Ga0501084_0042749 Ga0501084_0042749_2036_3205 386
868 3300005335 Ga0070666_10000956 Ga0070666_100009568 387
869 3300005337 Ga0070682_100093297 Ga0070682_1000932971 387
870 3300005339 Ga0070660_100004428 Ga0070660_1000044288 387
871 3300005339 Ga0070660_100042189 Ga0070660_1000421893 387
872 3300005340 Ga0070689_100001046 Ga0070689_10000104610 387
873 3300005344 Ga0070661_100013155 Ga0070661_1000131552 387
874 3300005345 Ga0070692_10009740 Ga0070692_100097403 387
875 3300005353 Ga0070669_100085811 Ga0070669_1000858112 387
876 3300005354 Ga0070675_100071748 Ga0070675_1000717483 387
877 3300005355 Ga0070671_100008289 Ga0070671_1000082893 387
878 3300005356 Ga0070674_100022136 Ga0070674_1000221362 387
879 3300005364 Ga0070673_100000604 Ga0070673_10000060413 387
880 3300005365 Ga0070688_100000230 Ga0070688_10000023014 387
881 3300005366 Ga0070659_100003790 Ga0070659_1000037904 387
882 3300005366 Ga0070659_100023109 Ga0070659_1000231094 387
883 3300005366 Ga0070659_100095385 Ga0070659_1000953852 387
884 3300005435 Ga0070714_100054800 Ga0070714_1000548004 387
885 3300005436 Ga0070713_100015306 Ga0070713_1000153066 387
886 3300005436 Ga0070713_100015774 Ga0070713_1000157747 387
887 3300005437 Ga0070710_10003855 Ga0070710_100038552 387
888 3300005439 Ga0070711_100003823 Ga0070711_1000038232 387
889 3300005440 Ga0070705_100032917 Ga0070705_1000329172 387
890 3300005440 Ga0070705_100050606 Ga0070705_1000506062 387
891 3300005456 Ga0070678_100002956 Ga0070678_1000029562 387
892 3300005457 Ga0070662_100001081 Ga0070662_1000010814 387
893 3300005457 Ga0070662_100011777 Ga0070662_1000117774 387
894 3300005458 Ga0070681_10235524 Ga0070681_102355242 387
895 3300005459 Ga0068867_100039935 Ga0068867_1000399353 387
896 3300005466 Ga0070685_10001090 Ga0070685_100010906 387
897 3300005467 Ga0070706_100051853 Ga0070706_1000518532 387
898 3300005535 Ga0070684_100001615 Ga0070684_10000161511 387
899 3300005539 Ga0068853_100022134 Ga0068853_1000221341 387
900 3300005539 Ga0068853_100059584 Ga0068853_1000595842 387
901 3300005543 Ga0070672_100007832 Ga0070672_1000078322 387
902 3300005548 Ga0070665_100005917 Ga0070665_1000059178 387
903 3300005548 Ga0070665_100140576 Ga0070665_1001405763 387
904 3300005549 Ga0070704_100279965 Ga0070704_1002799651 387
905 3300005563 Ga0068855_100016816 Ga0068855_1000168165 387
906 3300005564 Ga0070664_100013471 Ga0070664_1000134714 387
907 3300005564 Ga0070664_100149220 Ga0070664_1001492202 387
908 3300005614 Ga0068856_100001379 Ga0068856_10000137920 387
909 3300005616 Ga0068852_100002691 Ga0068852_1000026912 387
910 3300005616 Ga0068852_100018064 Ga0068852_1000180644 387
911 3300005617 Ga0068859_100000264 Ga0068859_10000026435 387
912 3300005618 Ga0068864_100000916 Ga0068864_10000091617 387
913 3300006163 Ga0070715_10030822 Ga0070715_100308221 387
914 3300006173 Ga0070716_100003120 Ga0070716_1000031205 387
915 3300006175 Ga0070712_100000161 Ga0070712_10000016113 387
916 3300006237 Ga0097621_100009465 Ga0097621_1000094659 387
917 3300006358 Ga0068871_100085416 Ga0068871_1000854163 387
918 3300006844 Ga0075428_100067479 Ga0075428_1000674793 387
919 3300006847 Ga0075431_100095124 Ga0075431_1000951242 387
920 3300006931 Ga0097620_100000264 Ga0097620_10000026435 387
921 3300009147 Ga0114129_10066712 Ga0114129_100667125 387
922 3300009174 Ga0105241_10027447 Ga0105241_100274472 387
923 3300009174 Ga0105241_10042066 Ga0105241_100420661 387
924 3300009177 Ga0105248_10004100 Ga0105248_1000410014 387
925 3300009545 Ga0105237_10188996 Ga0105237_101889962 387
926 3300010375 Ga0105239_10271650 Ga0105239_102716502 387
927 3300010375 Ga0105239_10333231 Ga0105239_103332312 387
928 3300011119 Ga0105246_10007984 Ga0105246_100079845 387
929 3300013100 Ga0157373_10001932 Ga0157373_100019326 387
930 3300013100 Ga0157373_10003632 Ga0157373_100036322 387
931 3300013100 Ga0157373_10219848 Ga0157373_102198481 387
932 3300013102 Ga0157371_10000303 Ga0157371_1000030356 387
933 3300013102 Ga0157371_10095081 Ga0157371_100950811 387
934 3300013104 Ga0157370_10011858 Ga0157370_100118582 387
935 3300013104 Ga0157370_10016198 Ga0157370_100161982 387
936 3300013105 Ga0157369_10119962 Ga0157369_101199624 387
937 3300013296 Ga0157374_10000954 Ga0157374_100009549 387
938 3300013297 Ga0157378_10142923 Ga0157378_101429232 387
939 3300013307 Ga0157372_10008434 Ga0157372_100084348 387
940 3300013307 Ga0157372_10097839 Ga0157372_100978393 387
941 3300013307 Ga0157372_10404695 Ga0157372_104046952 387
942 3300013308 Ga0157375_10001655 Ga0157375_1000165512 387
943 3300013308 Ga0157375_10225102 Ga0157375_102251022 387
944 3300014325 Ga0163163_10000225 Ga0163163_1000022543 387
945 3300014968 Ga0157379_10001851 Ga0157379_1000185114 387
946 3300017792 Ga0163161_10028638 Ga0163161_100286382 387
947 3300025898 Ga0207692_10019407 Ga0207692_100194074 387
948 3300025903 Ga0207680_10000757 Ga0207680_100007572 387
949 3300025907 Ga0207645_10011786 Ga0207645_100117865 387
950 3300025907 Ga0207645_10020128 Ga0207645_100201283 387
951 3300025910 Ga0207684_10062819 Ga0207684_100628193 387
952 3300025911 Ga0207654_10040723 Ga0207654_100407232 387
953 3300025912 Ga0207707_10116682 Ga0207707_101166823 387
954 3300025912 Ga0207707_10140668 Ga0207707_101406682 387
955 3300025913 Ga0207695_10058138 Ga0207695_100581382 387
956 3300025915 Ga0207693_10000075 Ga0207693_1000007576 387
957 3300025915 Ga0207693_10066228 Ga0207693_100662284 387
958 3300025916 Ga0207663_10005149 Ga0207663_100051495 387
959 3300025916 Ga0207663_10099085 Ga0207663_100990852 387
960 3300025917 Ga0207660_10098596 Ga0207660_100985962 387
961 3300025918 Ga0207662_10020257 Ga0207662_100202572 387
962 3300025919 Ga0207657_10000160 Ga0207657_1000016059 387
963 3300025919 Ga0207657_10001114 Ga0207657_100011148 387
964 3300025919 Ga0207657_10010217 Ga0207657_100102179 387
965 3300025919 Ga0207657_10041179 Ga0207657_100411792 387
966 3300025919 Ga0207657_10115206 Ga0207657_101152062 387
967 3300025920 Ga0207649_10011309 Ga0207649_100113094 387
968 3300025920 Ga0207649_10090977 Ga0207649_100909772 387
969 3300025927 Ga0207687_10059098 Ga0207687_100590984 387
970 3300025928 Ga0207700_10001042 Ga0207700_100010429 387
971 3300025928 Ga0207700_10054627 Ga0207700_100546272 387
972 3300025929 Ga0207664_10106868 Ga0207664_101068682 387
973 3300025929 Ga0207664_10234165 Ga0207664_102341652 387
974 3300025931 Ga0207644_10004260 Ga0207644_100042603 387
975 3300025931 Ga0207644_10007845 Ga0207644_100078452 387
976 3300025932 Ga0207690_10028675 Ga0207690_100286752 387
977 3300025933 Ga0207706_10000023 Ga0207706_10000023121 387
978 3300025933 Ga0207706_10012342 Ga0207706_100123428 387
979 3300025934 Ga0207686_10002631 Ga0207686_100026317 387
980 3300025936 Ga0207670_10008559 Ga0207670_100085594 387
981 3300025937 Ga0207669_10005538 Ga0207669_100055384 387
982 3300025939 Ga0207665_10039585 Ga0207665_100395852 387
983 3300025940 Ga0207691_10008031 Ga0207691_100080312 387
984 3300025941 Ga0207711_10000092 Ga0207711_1000009256 387
985 3300025942 Ga0207689_10008652 Ga0207689_100086523 387
986 3300025945 Ga0207679_10010809 Ga0207679_100108093 387
987 3300025945 Ga0207679_10106268 Ga0207679_101062682 387
988 3300025949 Ga0207667_10026382 Ga0207667_100263823 387
989 3300025949 Ga0207667_10186021 Ga0207667_101860212 387
990 3300025960 Ga0207651_10000135 Ga0207651_1000013514 387
991 3300025986 Ga0207658_10001652 Ga0207658_1000165215 387
992 3300026023 Ga0207677_10011737 Ga0207677_100117372 387
993 3300026035 Ga0207703_10000820 Ga0207703_1000082012 387
994 3300026041 Ga0207639_10003328 Ga0207639_100033284 387
995 3300026078 Ga0207702_10004347 Ga0207702_1000434710 387
996 3300026078 Ga0207702_10011508 Ga0207702_100115085 387
997 3300026088 Ga0207641_10004870 Ga0207641_100048707 387
998 3300026095 Ga0207676_10000097 Ga0207676_1000009744 387
999 3300026116 Ga0207674_10000236 Ga0207674_100002363 387
1000 3300026116 Ga0207674_10007783 Ga0207674_100077835 387
1001 3300026121 Ga0207683_10003069 Ga0207683_100030695 387
1002 3300026121 Ga0207683_10223045 Ga0207683_102230451 387
1003 3300026142 Ga0207698_10021518 Ga0207698_100215182 387
1004 3300028379 Ga0268266_10011396 Ga0268266_100113968 387
1005 3300028381 Ga0268264_10023671 Ga0268264_100236712 387
1006 3300031548 Ga0307408_100018326 Ga0307408_1000183265 387
1007 3300031731 Ga0307405_10001503 Ga0307405_100015033 387
1008 3300031824 Ga0307413_10006139 Ga0307413_100061391 387
1009 3300031852 Ga0307410_10011320 Ga0307410_100113203 387
1010 3300031901 Ga0307406_10015337 Ga0307406_100153373 387
1011 3300031903 Ga0307407_10000312 Ga0307407_100003124 387
1012 3300031995 Ga0307409_100004420 Ga0307409_1000044203 387
1013 3300032002 Ga0307416_100006561 Ga0307416_1000065612 387
1014 3300032005 Ga0307411_10000630 Ga0307411_100006304 387
1015 3300032126 Ga0307415_100001036 Ga0307415_10000103611 387
1016 3300035086 Ga0373934_0001247 Ga0373934_0001247_4044_5234 387
1017 3300035111 Ga0373923_0002361 Ga0373923_0002361_874_2064 387
1018 3300035113 Ga0373936_0024397 Ga0373936_0024397_430_1620 387
1019 3300035113 Ga0373936_0027944 Ga0373936_0027944_709_1899 387
1020 3300035117 Ga0373953_0015475 Ga0373953_0015475_469_1659 387
1021 3300035118 Ga0373954_0002677 Ga0373954_0002677_589_1779 387
1022 3300035118 Ga0373954_0026208 Ga0373954_0026208_1310_2500 387
1023 3300035120 Ga0373957_0015384 Ga0373957_0015384_1427_2617 387
1024 3300035170 Ga0373943_0017634 Ga0373943_0017634_166_1356 387
1025 3300035170 Ga0373943_0050248 Ga0373943_0050248_544_1734 387
1026 3300035172 Ga0373955_0000975 Ga0373955_0000975_1489_2679 387
1027 3300035692 Ga0373935_0010631 Ga0373935_0010631_922_2112 387
1028 3300035692 Ga0373935_0039213 Ga0373935_0039213_1099_2289 387
1029 3300035724 Ga0373933_0001198 Ga0373933_0001198_4652_5842 387
1030 3300035725 Ga0373947_0025742 Ga0373947_0025742_1348_2538 387
1031 3300035725 Ga0373947_0030345 Ga0373947_0030345_782_1972 387
1032 3300035725 Ga0373947_0069821 Ga0373947_0069821_132_1322 387
1033 3300036401 Ga0373937_0002537 Ga0373937_0002537_2576_3766 387
1034 3300036401 Ga0373937_0024061 Ga0373937_0024061_423_1613 387
1035 3300036401 Ga0373937_0109042 Ga0373937_0109042_1311_2510 387
1036 3300037068 Ga0373925_0020666 Ga0373925_0020666_2385_3575 387
1037 3300037068 Ga0373925_0032450 Ga0373925_0032450_2517_3731 387
1038 3300037466 Ga0395898_0039327 Ga0395898_0039327_3046_4230 387
1039 3300045051 Ga0451576_0268556 Ga0451576_0268556_148_1398 387
1040 3300046454 Ga0495592_0005643 Ga0495592_0005643_6883_8112 387
1041 3300046459 Ga0495629_0017686 Ga0495629_0017686_1554_2744 387
1042 3300046463 Ga0495653_0183975 Ga0495653_0183975_138_1328 387
1043 3300046472 Ga0495580_0032991 Ga0495580_0032991_1341_2531 387
1044 3300046473 Ga0495582_0017872 Ga0495582_0017872_2405_3595 387
1045 3300046476 Ga0495662_0074210 Ga0495662_0074210_402_1592 387
1046 3300046511 Ga0495608_0005998 Ga0495608_0005998_3758_4987 387
1047 3300046516 Ga0495628_0020679 Ga0495628_0020679_3759_4988 387
1048 3300046526 Ga0495666_0076535 Ga0495666_0076535_134_1315 387
1049 3300046529 Ga0495652_0164752 Ga0495652_0164752_489_1679 387
1050 3300046533 Ga0495640_0150735 Ga0495640_0150735_161_1351 387
1051 3300046535 Ga0495586_0001577 Ga0495586_0001577_4478_5707 387
1052 3300046535 Ga0495586_0123956 Ga0495586_0123956_150_1340 387
1053 3300046559 Ga0495667_0037862 Ga0495667_0037862_334_1515 387
1054 3300046642 Ga0495634_0031516 Ga0495634_0031516_1132_2361 387
1055 3300046663 Ga0495635_0003031 Ga0495635_0003031_1119_2309 387
1056 3300046664 Ga0495659_0007805 Ga0495659_0007805_1283_2473 387
1057 3300046679 Ga0495623_0025917 Ga0495623_0025917_700_1890 387
1058 3300046681 Ga0495647_0044756 Ga0495647_0044756_262_1452 387
1059 3300046683 Ga0495658_0013973 Ga0495658_0013973_830_2059 387
1060 3300046683 Ga0495658_0119361 Ga0495658_0119361_157_1347 387
1061 3300046689 Ga0495613_0011703 Ga0495613_0011703_863_2053 387
1062 3300046689 Ga0495613_0023120 Ga0495613_0023120_534_1763 387
1063 3300046809 Ga0495600_0034611 Ga0495600_0034611_644_1825 387
1064 3300046809 Ga0495600_0148896 Ga0495600_0148896_288_1478 387
1065 3300047315 Ga0495581_0002924 Ga0495581_0002924_7340_8530 387
1066 3300047317 Ga0495604_0039016 Ga0495604_0039016_1638_2828 387
1067 3300047322 Ga0495680_0001182 Ga0495680_0001182_24889_26118 387
1068 3300047471 Ga0495684_0004189 Ga0495684_0004189_10049_11239 387
1069 3300047673 Ga0495593_0052353 Ga0495593_0052353_311_1501 387
1070 3300048088 Ga0495602_0054880 Ga0495602_0054880_1709_2899 387
1071 3300048903 Ga0496100_0081464 Ga0496100_0081464_286_1476 387
1072 3300048905 Ga0496102_0063871 Ga0496102_0063871_830_2041 387
1073 3300048905 Ga0496102_0092383 Ga0496102_0092383_1234_2424 387
1074 3300048907 Ga0496104_0000979 Ga0496104_0000979_21333_22523 387
1075 3300048908 Ga0496105_0004778 Ga0496105_0004778_2134_3324 387
1076 3300048909 Ga0496106_0003978 Ga0496106_0003978_464_1675 387
1077 3300048912 Ga0496109_0002675 Ga0496109_0002675_10282_11472 387
1078 3300048913 Ga0496110_0175682 Ga0496110_0175682_515_1705 387
1079 3300048915 Ga0496112_0002483 Ga0496112_0002483_6364_7554 387
1080 3300048917 Ga0496114_0079674 Ga0496114_0079674_190_1380 387
1081 3300048918 Ga0496115_0016973 Ga0496115_0016973_3545_4735 387
1082 3300049587 Ga0501071_0068028 Ga0501071_0068028_559_1734 387
1083 3300049742 Ga0501080_0256342 Ga0501080_0256342_103_1278 387
1084 3300049743 Ga0501081_0055997 Ga0501081_0055997_642_1832 387
1085 3300050510 nmdc:mga06r32_20725_c1 nmdc:mga06r32_20725_c1_1620_2795 387
1086 3300053084 Ga0495595_0087452 Ga0495595_0087452_286_1476 387
1087 3300053085 Ga0495619_0003146 Ga0495619_0003146_1662_2852 387
1088 3300005335 Ga0070666_10007688 Ga0070666_100076887 388
1089 3300005344 Ga0070661_100004644 Ga0070661_1000046446 388
1090 3300005367 Ga0070667_100010007 Ga0070667_1000100072 388
1091 3300005456 Ga0070678_100000982 Ga0070678_10000098216 388
1092 3300005548 Ga0070665_100003667 Ga0070665_10000366715 388
1093 3300005548 Ga0070665_100148142 Ga0070665_1001481422 388
1094 3300005563 Ga0068855_100079076 Ga0068855_1000790763 388
1095 3300005564 Ga0070664_100021935 Ga0070664_1000219354 388
1096 3300005578 Ga0068854_100013191 Ga0068854_1000131912 388
1097 3300005616 Ga0068852_100039269 Ga0068852_1000392692 388
1098 3300006175 Ga0070712_100039945 Ga0070712_1000399452 388
1099 3300006237 Ga0097621_100084754 Ga0097621_1000847542 388
1100 3300009551 Ga0105238_10235083 Ga0105238_102350832 388
1101 3300013307 Ga0157372_10071584 Ga0157372_100715842 388
1102 3300013307 Ga0157372_10154108 Ga0157372_101541082 388
1103 3300025903 Ga0207680_10068690 Ga0207680_100686903 388
1104 3300025909 Ga0207705_10029785 Ga0207705_100297852 388
1105 3300025915 Ga0207693_10051893 Ga0207693_100518932 388
1106 3300025931 Ga0207644_10161287 Ga0207644_101612872 388
1107 3300025940 Ga0207691_10034393 Ga0207691_100343932 388
1108 3300025945 Ga0207679_10021666 Ga0207679_100216662 388
1109 3300025949 Ga0207667_10025154 Ga0207667_100251544 388
1110 3300025981 Ga0207640_10016844 Ga0207640_100168442 388
1111 3300026023 Ga0207677_10062984 Ga0207677_100629843 388
1112 3300026089 Ga0207648_10006200 Ga0207648_1000620010 388
1113 3300026116 Ga0207674_10179580 Ga0207674_101795802 388
1114 3300028379 Ga0268266_10028877 Ga0268266_100288772 388
1115 3300028800 Ga0265338_10001649 Ga0265338_1000164921 388
1116 3300035170 Ga0373943_0023852 Ga0373943_0023852_115_1323 388
1117 3300035725 Ga0373947_0133146 Ga0373947_0133146_352_1560 388
1118 3300046472 Ga0495580_0028421 Ga0495580_0028421_2690_3880 388
1119 3300048906 Ga0496103_0060462 Ga0496103_0060462_1143_2324 388
1120 iso_pu_bacteria 2818991436 2819542252 388
1121 3300049577 Ga0501041_0017326 Ga0501041_0017326_2618_3805 389
1122 3300049580 Ga0501046_0049469 Ga0501046_0049469_1283_2470 389
1123 3300006048 Ga0075363_100010665 Ga0075363_1000106655 391
1124 3300006177 Ga0075362_10050760 Ga0075362_100507602 391
1125 3300006353 Ga0075370_10040878 Ga0075370_100408783 391
1126 3300026088 Ga0207641_10180077 Ga0207641_101800773 391
1127 3300027866 Ga0209813_10003834 Ga0209813_100038343 391
1128 3300035692 Ga0373935_0006447 Ga0373935_0006447_4098_5429 391
1129 3300050489 nmdc:mga03683_28632_c1 nmdc:mga03683_28632_c1_773_1987 391
1130 3300050495 nmdc:mga04h51_19898_c1 nmdc:mga04h51_19898_c1_553_1767 391
1131 3300050496 nmdc:mga07m45_95219_c1 nmdc:mga07m45_95219_c1_161_1375 391
1132 3300002737 JGI25162J39368_1000023 JGI25162J39368_1000023191 392
1133 3300003214 JGI25165J46597_1000030 JGI25165J46597_1000030109 392
1134 3300003751 Ga0055538_1000017 Ga0055538_1000017191 392
1135 3300003752 Ga0055539_1000022 Ga0055539_1000022191 392
1136 3300003756 Ga0055533_1000030 Ga0055533_1000030191 392
1137 3300003759 Ga0055525_1000034 Ga0055525_1000034191 392
1138 3300003841 Ga0055541_1000015 Ga0055541_1000015191 392
1139 3300015265 Ga0182005_1000134 Ga0182005_100013457 392
1140 3300025207 Ga0209760_103086 Ga0209760_1030862 392
1141 3300025224 Ga0209784_100034 Ga0209784_100034109 392
1142 3300025225 Ga0209566_100038 Ga0209566_100038190 392
1143 3300025226 Ga0209674_100056 Ga0209674_100056109 392
1144 3300025230 Ga0209563_100057 Ga0209563_100057190 392
1145 3300025231 Ga0207427_101302 Ga0207427_1013024 392
1146 3300025233 Ga0209437_100071 Ga0209437_100071190 392
1147 3300025253 Ga0209677_100035 Ga0209677_100035109 392
1148 3300025261 Ga0209233_1000094 Ga0209233_1000094190 392
1149 3300046454 Ga0495592_0015266 Ga0495592_0015266_3749_4927 392
1150 3300046462 Ga0495651_0054004 Ga0495651_0054004_42_1220 392
1151 3300046463 Ga0495653_0029078 Ga0495653_0029078_83_1261 392
1152 3300046511 Ga0495608_0024512 Ga0495608_0024512_800_1978 392
1153 3300046514 Ga0495618_0004023 Ga0495618_0004023_3650_4828 392
1154 3300046516 Ga0495628_0012137 Ga0495628_0012137_1703_2881 392
1155 3300046529 Ga0495652_0015115 Ga0495652_0015115_4550_5728 392
1156 3300046543 Ga0495645_0077557 Ga0495645_0077557_154_1332 392
1157 3300046675 Ga0495657_0038956 Ga0495657_0038956_1528_2706 392
1158 3300046678 Ga0495599_0000548 Ga0495599_0000548_3945_5123 392
1159 3300046680 Ga0495646_0063817 Ga0495646_0063817_625_1803 392
1160 3300046690 Ga0495624_0031322 Ga0495624_0031322_58_1236 392
1161 3300046809 Ga0495600_0000693 Ga0495600_0000693_14351_15529 392
1162 3300047317 Ga0495604_0033075 Ga0495604_0033075_599_1777 392
1163 3300048088 Ga0495602_0067075 Ga0495602_0067075_697_1875 392
1164 3300053077 Ga0495601_0039865 Ga0495601_0039865_696_1874 392
1165 3300053141 Ga0500574_005427 Ga0500574_005427_1214_2392 392

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

66

417

0.86

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

120

245

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o4s-assembly1.cif.gz_A crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution 0.9392 8 392
5wmh-assembly2.cif.gz_C arabidopsis thaliana prephenate aminotransferase 0.9377 7 390
1o4s-assembly1.cif.gz_A crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution 0.9368 8 392
2o0r-assembly1.cif.gz_B the three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis 0.9333 8 388
2z61-assembly1.cif.gz_A-2 crystal structure of mj0684 from methanococcus jannaschii reveals its similarity in the active site to kynurenine aminotransferases 0.9321 8 390
ID Description Score Start End Superfamily
1xi9B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9565 291 391 3.90.1150.10
4cvqB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9523 300 391 3.90.1150.10
1v2eB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9512 47 288 3.40.640.10
af_A0A1D6I5Q5_168_402_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9491 49 286 3.40.640.10
af_Q2FZL1_278_379_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9463 289 387 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A4D4JWV6-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9835 9 392 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A497PRW2-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9832 294 391 GO:0006520
GO:0008483
AF-A0A2W4ZWD8-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9739 144 388 GO:0006520
GO:0008483
GO:0009058
GO:0016829
GO:0030170
AF-A0A4D4JWV6-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.966 9 392 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A7S7SJI4-F1-model_v4 Pyridoxal phosphate-dependent aminotransferase 0.9654 5 392 GO:0006520
GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
95.44 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map