F490947

General Info

Members Datasets Scaffolds Average Seq Length
1156 308 1149 399

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0038551|Ga0501033_0038551_26_1048
Length 340
Sequence MKGDLQDNMMESPDFVDPVHGVPVFSLYGEQRRPTDASMDTFEVLLVDMQDLGCRIYTFITTLLYVMEAAAKHGKAVWVLDRPNPAGRPVEGLTLLPGWESFVGAGPMPMRHGLTLGELGRWFMARFNLDLEYRVIEMEGWTPETAPGFGWPIGERSWINPSPNAPNLSMARAYAGTVMLEGTTLSEGRGTTRPLELFGAPDIDARAVIETMQALAPQWLEGCRLREIWFQPTFHKHVGALCHGVQIHVDDPAYDHEAFKPWRLQALGFKAIRTLYPDYPLWRDFPYEYVFDRLAIDVINGGPGLREWVDDPAATAGDLDALVRPDEAAWEEERKPFLLY

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
3 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
4 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
5 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
6 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
7 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
226 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
227 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
228 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
229 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
230 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
247 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
248 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
249 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
253 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
254 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
255 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
256 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
287 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
288 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
299 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
300 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
301 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
302 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
305 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
306 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
307 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
308 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.09
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.33
Nodule 0
Rhizoplane 4.24
Rhizosphere 89.88
Stem 0
Stem Tuber 0.09
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000204 3300001904 Bacteria 10683
2 JGI24752J21851_1000134 3300001976 Bacteria 10103
3 JGI24752J21851_1001734 3300001976 Bacteria 2924
4 JGI24740J21852_10001901 3300001979 Bacteria 9572
5 JGI24740J21852_10003677 3300001979 Bacteria 6678
6 JGI24740J21852_10003883 3300001979 Bacteria 6485
7 JGI24740J21852_10016439 3300001979 Bacteria 2675
8 JGI24739J22299_10001515 3300001989 Bacteria 8773
9 JGI24739J22299_10006709 3300001989 Bacteria 4334
10 JGI24739J22299_10006823 3300001989 Bacteria 4297
11 JGI24737J22298_10000012 3300001990 Bacteria 50552
12 JGI24737J22298_10003238 3300001990 Bacteria 5776
13 JGI24737J22298_10020525 3300001990 Bacteria 2109
14 JGI24737J22298_10037075 3300001990 Bacteria 1504
15 JGI24735J21928_10005661 3300002067 Bacteria 4132
16 JGI24735J21928_10020786 3300002067 Bacteria 2009
17 JGI24735J21928_10031467 3300002067 Bacteria 1573
18 JGI24738J21930_10000187 3300002075 Bacteria 16135
19 JGI24738J21930_10004127 3300002075 Bacteria 3581
20 JGI24738J21930_10007600 3300002075 Bacteria 2493
21 JGI24744J21845_10003924 3300002077 Bacteria 3065
22 JGI25150J39212_1000369 3300002774 Bacteria 21665
23 JGI25165J46597_1000089 3300003214 Bacteria 169547
24 JGI25153J46596_10000002 3300003215 Bacteria 653569
25 JGI25153J46596_10000124 3300003215 Bacteria 86430
26 Ga0055525_1000051 3300003759 Bacteria 240942
27 Ga0055526_1002872 3300003771 Bacteria 11347
28 Ga0055526_1007101 3300003771 Bacteria 5909
29 Ga0055537_1001186 3300003773 Bacteria 11112
30 Ga0055537_1002563 3300003773 Bacteria 5984
31 Ga0055524_1000169 3300003775 Bacteria 74567
32 Ga0055530_10000798 3300003791 Bacteria 26169
33 Ga0055540_1001358 3300003792 Bacteria 14676
34 Ga0055531_10000008 3300003794 Bacteria 222269
35 Ga0055531_10017823 3300003794 Bacteria 2971
36 Ga0065165_1005865 3300005262 Bacteria 6677
37 Ga0065165_1013339 3300005262 Bacteria 3274
38 Ga0065707_10082739 3300005295 Bacteria 12386
39 Ga0070658_10000001 3300005327 Bacteria 856789
40 Ga0070658_10000131 3300005327 Bacteria 66294
41 Ga0070658_10002242 3300005327 Bacteria 16214
42 Ga0070658_10011705 3300005327 Bacteria 7038
43 Ga0070658_10015514 3300005327 Bacteria 6093
44 Ga0070658_10036983 3300005327 Bacteria 3933
45 Ga0070658_10037923 3300005327 Bacteria 3886
46 Ga0070658_10059343 3300005327 Bacteria 3115
47 Ga0070658_10148374 3300005327 Bacteria 1962
48 Ga0070658_10170823 3300005327 Bacteria 1826
49 Ga0070658_10332552 3300005327 Bacteria 1298
50 Ga0070676_10006189 3300005328 Bacteria 6388
51 Ga0070676_10053580 3300005328 Bacteria 2377
52 Ga0070683_100018131 3300005329 Bacteria 6230
53 Ga0070683_100036381 3300005329 Bacteria 4504
54 Ga0070683_100082919 3300005329 Bacteria 3003
55 Ga0070683_100092882 3300005329 Bacteria 2834
56 Ga0070683_100155740 3300005329 Bacteria 2167
57 Ga0070690_100007230 3300005330 Bacteria 6353
58 Ga0070670_100003243 3300005331 Bacteria 13435
59 Ga0070670_100004708 3300005331 Bacteria 11450
60 Ga0070670_100015577 3300005331 Bacteria 6530
61 Ga0070670_100037311 3300005331 Bacteria 4181
62 Ga0070670_100048352 3300005331 Bacteria 3661
63 Ga0070670_100064356 3300005331 Bacteria 3147
64 Ga0070670_100135742 3300005331 Bacteria 2126
65 Ga0070670_100163640 3300005331 Bacteria 1929
66 Ga0070677_10000985 3300005333 Bacteria 9196
67 Ga0070677_10017914 3300005333 Bacteria 2543
68 Ga0068869_100016586 3300005334 Bacteria 4967
69 Ga0068869_100069511 3300005334 Bacteria 2604
70 Ga0070666_10000163 3300005335 Bacteria 45399
71 Ga0070666_10001646 3300005335 Bacteria 13611
72 Ga0070666_10001840 3300005335 Bacteria 12925
73 Ga0070666_10012632 3300005335 Bacteria 5334
74 Ga0070666_10019786 3300005335 Bacteria 4348
75 Ga0070680_100000070 3300005336 Bacteria 54377
76 Ga0070680_100001652 3300005336 Bacteria 16299
77 Ga0070680_100002890 3300005336 Bacteria 12768
78 Ga0070680_100024633 3300005336 Bacteria 4809
79 Ga0070682_100021219 3300005337 Bacteria 3829
80 Ga0070682_100031361 3300005337 Bacteria 3214
81 Ga0070682_100142457 3300005337 Bacteria 1636
82 Ga0068868_100001374 3300005338 Bacteria 16758
83 Ga0068868_100027559 3300005338 Bacteria 4335
84 Ga0070660_100000262 3300005339 Bacteria 34906
85 Ga0070660_100000263 3300005339 Bacteria 34745
86 Ga0070660_100008438 3300005339 Bacteria 7204
87 Ga0070660_100010347 3300005339 Bacteria 6589
88 Ga0070660_100012874 3300005339 Bacteria 5984
89 Ga0070660_100014609 3300005339 Bacteria 5663
90 Ga0070660_100026484 3300005339 Bacteria 4317
91 Ga0070660_100036411 3300005339 Bacteria 3728
92 Ga0070660_100038784 3300005339 Bacteria 3618
93 Ga0070660_100069321 3300005339 Bacteria 2750
94 Ga0070660_100100650 3300005339 Bacteria 2289
95 Ga0070660_100154216 3300005339 Bacteria 1848
96 Ga0070660_100162273 3300005339 Bacteria 1801
97 Ga0070660_100203435 3300005339 Bacteria 1606
98 Ga0070660_100287208 3300005339 Bacteria 1347
99 Ga0070660_100291557 3300005339 Bacteria 1336
100 Ga0070691_10000431 3300005341 Bacteria 15478
101 Ga0070691_10046760 3300005341 Bacteria 2056
102 Ga0070661_100000075 3300005344 Bacteria 79164
103 Ga0070661_100052269 3300005344 Bacteria 2990
104 Ga0070661_100084953 3300005344 Bacteria 2338
105 Ga0070661_100109442 3300005344 Bacteria 2062
106 Ga0070661_100114310 3300005344 Bacteria 2018
107 Ga0070661_100115221 3300005344 Bacteria 2010
108 Ga0070661_100130591 3300005344 Bacteria 1886
109 Ga0070661_100145762 3300005344 Bacteria 1787
110 Ga0070661_100176764 3300005344 Bacteria 1623
111 Ga0070692_10015372 3300005345 Bacteria 3621
112 Ga0070692_10032014 3300005345 Bacteria 2641
113 Ga0070668_100134533 3300005347 Bacteria 1987
114 Ga0070669_100001378 3300005353 Bacteria 17537
115 Ga0070669_100011709 3300005353 Bacteria 6221
116 Ga0070669_100017953 3300005353 Bacteria 5053
117 Ga0070669_100021670 3300005353 Bacteria 4593
118 Ga0070675_100000964 3300005354 Bacteria 20575
119 Ga0070675_100002994 3300005354 Bacteria 12765
120 Ga0070675_100035449 3300005354 Bacteria 4054
121 Ga0070675_100083822 3300005354 Bacteria 2661
122 Ga0070675_100165806 3300005354 Bacteria 1902
123 Ga0070671_100001992 3300005355 Bacteria 15685
124 Ga0070671_100004930 3300005355 Bacteria 10617
125 Ga0070671_100019434 3300005355 Bacteria 5528
126 Ga0070671_100022088 3300005355 Bacteria 5198
127 Ga0070671_100042041 3300005355 Bacteria 3799
128 Ga0070671_100045542 3300005355 Bacteria 3647
129 Ga0070671_100081705 3300005355 Bacteria 2702
130 Ga0070674_100010858 3300005356 Bacteria 5523
131 Ga0070674_100018622 3300005356 Bacteria 4395
132 Ga0070674_100045140 3300005356 Bacteria 3010
133 Ga0070674_100080848 3300005356 Bacteria 2321
134 Ga0070674_100140966 3300005356 Bacteria 1809
135 Ga0070674_100260700 3300005356 Bacteria 1365
136 Ga0070673_100000127 3300005364 Bacteria 35521
137 Ga0070673_100000346 3300005364 Bacteria 24441
138 Ga0070673_100037965 3300005364 Bacteria 3674
139 Ga0070673_100041374 3300005364 Bacteria 3544
140 Ga0070673_100043157 3300005364 Bacteria 3482
141 Ga0070673_100120393 3300005364 Bacteria 2189
142 Ga0070673_100121514 3300005364 Bacteria 2179
143 Ga0070673_100164717 3300005364 Bacteria 1888
144 Ga0070673_100306083 3300005364 Bacteria 1400
145 Ga0070659_100000126 3300005366 Bacteria 57730
146 Ga0070659_100005873 3300005366 Bacteria 8844
147 Ga0070659_100005905 3300005366 Bacteria 8820
148 Ga0070659_100010692 3300005366 Bacteria 6761
149 Ga0070659_100015960 3300005366 Bacteria 5632
150 Ga0070659_100016116 3300005366 Bacteria 5608
151 Ga0070659_100025309 3300005366 Bacteria 4556
152 Ga0070659_100034947 3300005366 Bacteria 3911
153 Ga0070659_100036446 3300005366 Bacteria 3835
154 Ga0070659_100089112 3300005366 Bacteria 2471
155 Ga0070659_100193955 3300005366 Bacteria 1670
156 Ga0070667_100002025 3300005367 Bacteria 17950
157 Ga0070667_100002154 3300005367 Bacteria 17347
158 Ga0070667_100002178 3300005367 Bacteria 17241
159 Ga0070667_100002351 3300005367 Bacteria 16564
160 Ga0070667_100003812 3300005367 Bacteria 12822
161 Ga0070667_100013959 3300005367 Bacteria 6640
162 Ga0070667_100042088 3300005367 Bacteria 3832
163 Ga0070667_100051581 3300005367 Bacteria 3469
164 Ga0070667_100092512 3300005367 Bacteria 2602
165 Ga0070667_100154401 3300005367 Bacteria 2018
166 Ga0070667_100274999 3300005367 Bacteria 1511
167 Ga0070709_10134677 3300005434 Bacteria 1691
168 Ga0070714_100038119 3300005435 Bacteria 4042
169 Ga0070714_100075350 3300005435 Bacteria 2927
170 Ga0070713_100046327 3300005436 Bacteria 3567
171 Ga0070663_100006940 3300005455 Bacteria 6859
172 Ga0070663_100030080 3300005455 Bacteria 3718
173 Ga0070663_100117013 3300005455 Bacteria 2010
174 Ga0070663_100161597 3300005455 Bacteria 1724
175 Ga0070678_100000917 3300005456 Bacteria 15137
176 Ga0070678_100003221 3300005456 Bacteria 9062
177 Ga0070678_100006076 3300005456 Bacteria 7045
178 Ga0070678_100081233 3300005456 Bacteria 2457
179 Ga0070662_100000121 3300005457 Bacteria 43769
180 Ga0070662_100000425 3300005457 Bacteria 25023
181 Ga0070662_100009105 3300005457 Bacteria 6481
182 Ga0070662_100021540 3300005457 Bacteria 4402
183 Ga0070662_100032279 3300005457 Bacteria 3680
184 Ga0070662_100068687 3300005457 Bacteria 2606
185 Ga0070662_100075828 3300005457 Bacteria 2491
186 Ga0070662_100139919 3300005457 Bacteria 1874
187 Ga0070662_100155841 3300005457 Bacteria 1783
188 Ga0070681_10064765 3300005458 Bacteria 3625
189 Ga0068867_100000685 3300005459 Bacteria 22470
190 Ga0068867_100066622 3300005459 Bacteria 2683
191 Ga0068867_100092610 3300005459 Bacteria 2296
192 Ga0070679_100032580 3300005530 Bacteria 5156
193 Ga0070679_100183328 3300005530 Bacteria 2065
194 Ga0070679_100259859 3300005530 Bacteria 1692
195 Ga0070684_100007635 3300005535 Bacteria 8431
196 Ga0070684_100008726 3300005535 Bacteria 7946
197 Ga0070684_100024137 3300005535 Bacteria 5098
198 Ga0070684_100068726 3300005535 Bacteria 3114
199 Ga0068853_100000078 3300005539 Bacteria 67253
200 Ga0068853_100001625 3300005539 Bacteria 16423
201 Ga0068853_100009059 3300005539 Bacteria 8014
202 Ga0068853_100011409 3300005539 Bacteria 7218
203 Ga0068853_100029489 3300005539 Bacteria 4626
204 Ga0068853_100065252 3300005539 Bacteria 3159
205 Ga0068853_100066823 3300005539 Bacteria 3123
206 Ga0068853_100164621 3300005539 Bacteria 2003
207 Ga0068853_100219300 3300005539 Bacteria 1737
208 Ga0070672_100002073 3300005543 Bacteria 12622
209 Ga0070672_100002995 3300005543 Bacteria 10885
210 Ga0070672_100007816 3300005543 Bacteria 7295
211 Ga0070672_100283805 3300005543 Bacteria 1400
212 Ga0070686_100017039 3300005544 Bacteria 4239
213 Ga0070696_100025621 3300005546 Bacteria 4010
214 Ga0070693_100000558 3300005547 Bacteria 16479
215 Ga0070693_100035832 3300005547 Bacteria 2754
216 Ga0070693_100069748 3300005547 Bacteria 2067
217 Ga0070665_100009838 3300005548 Bacteria 9665
218 Ga0070665_100012511 3300005548 Bacteria 8550
219 Ga0070665_100015258 3300005548 Bacteria 7713
220 Ga0070665_100102986 3300005548 Bacteria 2858
221 Ga0070665_100121277 3300005548 Bacteria 2616
222 Ga0068855_100000353 3300005563 Bacteria 56776
223 Ga0068855_100004251 3300005563 Bacteria 17491
224 Ga0068855_100004652 3300005563 Bacteria 16752
225 Ga0068855_100040481 3300005563 Bacteria 5531
226 Ga0068855_100112308 3300005563 Bacteria 3127
227 Ga0070664_100000320 3300005564 Bacteria 34880
228 Ga0070664_100002277 3300005564 Bacteria 15441
229 Ga0070664_100016176 3300005564 Bacteria 6113
230 Ga0070664_100023243 3300005564 Bacteria 5119
231 Ga0070664_100034632 3300005564 Bacteria 4236
232 Ga0070664_100036722 3300005564 Bacteria 4116
233 Ga0070664_100053291 3300005564 Bacteria 3428
234 Ga0070664_100094538 3300005564 Bacteria 2592
235 Ga0070664_100106544 3300005564 Bacteria 2442
236 Ga0070664_100161888 3300005564 Bacteria 1980
237 Ga0070664_100170200 3300005564 Bacteria 1932
238 Ga0070664_100172313 3300005564 Bacteria 1920
239 Ga0070664_100180013 3300005564 Bacteria 1878
240 Ga0070664_100228061 3300005564 Bacteria 1669
241 Ga0070664_100239642 3300005564 Bacteria 1628
242 Ga0068857_100010961 3300005577 Bacteria 7889
243 Ga0068857_100015547 3300005577 Bacteria 6649
244 Ga0068857_100017720 3300005577 Bacteria 6245
245 Ga0068857_100020953 3300005577 Bacteria 5751
246 Ga0068857_100021228 3300005577 Bacteria 5714
247 Ga0068857_100030725 3300005577 Bacteria 4745
248 Ga0068857_100043834 3300005577 Bacteria 3968
249 Ga0068857_100133252 3300005577 Bacteria 2242
250 Ga0068857_100162546 3300005577 Bacteria 2026
251 Ga0068854_100005938 3300005578 Bacteria 7735
252 Ga0068854_100012058 3300005578 Bacteria 5650
253 Ga0068854_100017334 3300005578 Bacteria 4819
254 Ga0068854_100040410 3300005578 Bacteria 3291
255 Ga0068854_100051213 3300005578 Bacteria 2957
256 Ga0068854_100067252 3300005578 Bacteria 2610
257 Ga0068856_100000766 3300005614 Bacteria 34886
258 Ga0068856_100037197 3300005614 Bacteria 4775
259 Ga0068856_100055675 3300005614 Bacteria 3903
260 Ga0068856_100096580 3300005614 Bacteria 2943
261 Ga0068852_100000220 3300005616 Bacteria 38681
262 Ga0068852_100002645 3300005616 Bacteria 12376
263 Ga0068852_100012017 3300005616 Bacteria 6550
264 Ga0068852_100021602 3300005616 Bacteria 5144
265 Ga0068852_100034942 3300005616 Bacteria 4187
266 Ga0068852_100036693 3300005616 Bacteria 4104
267 Ga0068852_100060119 3300005616 Bacteria 3298
268 Ga0068852_100060933 3300005616 Bacteria 3277
269 Ga0068852_100121904 3300005616 Bacteria 2389
270 Ga0068852_100146684 3300005616 Bacteria 2189
271 Ga0068852_100309868 3300005616 Bacteria 1530
272 Ga0068859_100000377 3300005617 Bacteria 44438
273 Ga0068859_100088510 3300005617 Bacteria 3146
274 Ga0068859_100125351 3300005617 Bacteria 2637
275 Ga0068859_100209034 3300005617 Bacteria 2038
276 Ga0068864_100000074 3300005618 Bacteria 109458
277 Ga0068864_100000603 3300005618 Bacteria 30476
278 Ga0068864_100002441 3300005618 Bacteria 15364
279 Ga0068864_100003170 3300005618 Bacteria 13603
280 Ga0068864_100010084 3300005618 Bacteria 7803
281 Ga0068864_100129423 3300005618 Bacteria 2266
282 Ga0068864_100190696 3300005618 Bacteria 1879
283 Ga0068864_100276651 3300005618 Bacteria 1566
284 Ga0068864_100341218 3300005618 Bacteria 1412
285 Ga0068866_10006749 3300005718 Bacteria 4786
286 Ga0068861_100000052 3300005719 Bacteria 54577
287 Ga0068851_10002715 3300005834 Bacteria 7792
288 Ga0068851_10016003 3300005834 Bacteria 3582
289 Ga0068851_10107706 3300005834 Bacteria 1485
290 Ga0068851_10116478 3300005834 Bacteria 1432
291 Ga0068863_100000616 3300005841 Bacteria 36095
292 Ga0068863_100001194 3300005841 Bacteria 25934
293 Ga0068863_100006484 3300005841 Bacteria 11474
294 Ga0068863_100039617 3300005841 Bacteria 4482
295 Ga0068863_100057290 3300005841 Bacteria 3688
296 Ga0068863_100057731 3300005841 Bacteria 3673
297 Ga0068858_100002501 3300005842 Bacteria 18543
298 Ga0068858_100004194 3300005842 Bacteria 14189
299 Ga0068858_100007187 3300005842 Bacteria 10794
300 Ga0068858_100011689 3300005842 Bacteria 8278
301 Ga0068858_100043176 3300005842 Bacteria 4180
302 Ga0068858_100052923 3300005842 Bacteria 3756
303 Ga0068860_100005052 3300005843 Bacteria 13425
304 Ga0068860_100027918 3300005843 Bacteria 5434
305 Ga0068860_100035745 3300005843 Bacteria 4764
306 Ga0068860_100066587 3300005843 Bacteria 3421
307 Ga0068860_100145270 3300005843 Bacteria 2282
308 Ga0068860_100148559 3300005843 Bacteria 2256
309 Ga0068862_100000595 3300005844 Bacteria 37638
310 Ga0068862_100024987 3300005844 Bacteria 5015
311 Ga0068862_100031271 3300005844 Bacteria 4492
312 Ga0068862_100057454 3300005844 Bacteria 3337
313 Ga0068862_100068178 3300005844 Bacteria 3068
314 Ga0068862_100173455 3300005844 Bacteria 1931
315 Ga0081539_10014654 3300005985 Bacteria 5773
316 Ga0070717_10012393 3300006028 Bacteria 6501
317 Ga0070716_100115650 3300006173 Bacteria 1670
318 Ga0097621_100059125 3300006237 Bacteria 3137
319 Ga0097621_100071552 3300006237 Bacteria 2866
320 Ga0068871_100073384 3300006358 Bacteria 2821
321 Ga0068871_100118774 3300006358 Bacteria 2231
322 Ga0075433_10074006 3300006852 Bacteria 2997
323 Ga0068865_100000906 3300006881 Bacteria 16799
324 Ga0068865_100040177 3300006881 Bacteria 3177
325 Ga0075436_100136922 3300006914 Bacteria 1720
326 Ga0097620_100000377 3300006931 Bacteria 44438
327 Ga0097620_100088518 3300006931 Bacteria 3146
328 Ga0097620_100125348 3300006931 Bacteria 2637
329 Ga0097620_100209026 3300006931 Bacteria 2038
330 Ga0105240_10283093 3300009093 Bacteria 1904
331 Ga0105240_10384025 3300009093 Bacteria 1585
332 Ga0105245_10000999 3300009098 Bacteria 25691
333 Ga0105245_10028278 3300009098 Bacteria 4943
334 Ga0105245_10048004 3300009098 Bacteria 3818
335 Ga0105245_10068217 3300009098 Bacteria 3222
336 Ga0105243_10000760 3300009148 Bacteria 30911
337 Ga0105241_10106930 3300009174 Bacteria 2234
338 Ga0105241_10107990 3300009174 Bacteria 2224
339 Ga0105248_10001134 3300009177 Bacteria 29643
340 Ga0105248_10001155 3300009177 Bacteria 29459
341 Ga0105248_10001411 3300009177 Bacteria 26840
342 Ga0105248_10002104 3300009177 Bacteria 22059
343 Ga0105248_10002869 3300009177 Bacteria 19137
344 Ga0105248_10003908 3300009177 Bacteria 16478
345 Ga0105248_10006429 3300009177 Bacteria 12892
346 Ga0105248_10018999 3300009177 Bacteria 7598
347 Ga0105248_10190955 3300009177 Bacteria 2308
348 Ga0105248_10300818 3300009177 Bacteria 1806
349 Ga0105248_10335097 3300009177 Bacteria 1704
350 Ga0105248_10344580 3300009177 Bacteria 1677
351 Ga0105237_10005608 3300009545 Bacteria 14148
352 Ga0105237_10017538 3300009545 Bacteria 7420
353 Ga0105237_10124915 3300009545 Bacteria 2567
354 Ga0105238_10009274 3300009551 Bacteria 9848
355 Ga0105238_10060518 3300009551 Bacteria 3791
356 Ga0105238_10089791 3300009551 Bacteria 3060
357 Ga0105238_10172137 3300009551 Bacteria 2141
358 Ga0105249_10061274 3300009553 Bacteria 3452
359 Ga0105249_10105961 3300009553 Bacteria 2651
360 Ga0105239_10469098 3300010375 Bacteria 1429
361 Ga0157373_10010168 3300013100 Bacteria 6932
362 Ga0157373_10057318 3300013100 Bacteria 2763
363 Ga0157371_10001324 3300013102 Bacteria 26007
364 Ga0157371_10028899 3300013102 Bacteria 4014
365 Ga0157371_10035952 3300013102 Bacteria 3548
366 Ga0157371_10081025 3300013102 Bacteria 2298
367 Ga0157371_10081105 3300013102 Bacteria 2297
368 Ga0157371_10119059 3300013102 Bacteria 1877
369 Ga0157371_10143590 3300013102 Bacteria 1701
370 Ga0157370_10023591 3300013104 Bacteria 6106
371 Ga0157370_10040390 3300013104 Bacteria 4504
372 Ga0157370_10123634 3300013104 Bacteria 2416
373 Ga0157370_10126399 3300013104 Bacteria 2386
374 Ga0157369_10071524 3300013105 Bacteria 3723
375 Ga0157369_10083267 3300013105 Bacteria 3422
376 Ga0157369_10124943 3300013105 Bacteria 2729
377 Ga0157369_10143452 3300013105 Bacteria 2526
378 Ga0157369_10179370 3300013105 Bacteria 2229
379 Ga0157369_10247385 3300013105 Bacteria 1862
380 Ga0157374_10004257 3300013296 Bacteria 12033
381 Ga0157374_10030163 3300013296 Bacteria 4921
382 Ga0157374_10116718 3300013296 Bacteria 2572
383 Ga0157378_10002366 3300013297 Bacteria 16749
384 Ga0157378_10247061 3300013297 Bacteria 1707
385 Ga0163162_10000645 3300013306 Bacteria 32309
386 Ga0163162_10018201 3300013306 Bacteria 6881
387 Ga0157372_10013118 3300013307 Bacteria 8840
388 Ga0157372_10170384 3300013307 Bacteria 2519
389 Ga0157372_10211251 3300013307 Bacteria 2249
390 Ga0157372_10268022 3300013307 Bacteria 1984
391 Ga0157375_10013824 3300013308 Bacteria 7194
392 Ga0157375_10021664 3300013308 Bacteria 5899
393 Ga0157375_10185817 3300013308 Bacteria 2232
394 Ga0157375_10281649 3300013308 Bacteria 1825
395 Ga0163163_10000058 3300014325 Bacteria 123478
396 Ga0163163_10000219 3300014325 Bacteria 59481
397 Ga0163163_10083214 3300014325 Bacteria 3205
398 Ga0157380_10054733 3300014326 Bacteria 3167
399 Ga0157377_10008557 3300014745 Bacteria 4993
400 Ga0157379_10001782 3300014968 Bacteria 17776
401 Ga0157379_10002142 3300014968 Bacteria 16378
402 Ga0157379_10026764 3300014968 Bacteria 5134
403 Ga0157379_10057142 3300014968 Bacteria 3487
404 Ga0157379_10288321 3300014968 Bacteria 1495
405 Ga0157376_10143398 3300014969 Bacteria 2145
406 Ga0163161_10005004 3300017792 Bacteria 9219
407 Ga0163161_10031062 3300017792 Bacteria 3804
408 Ga0163161_10107941 3300017792 Bacteria 2078
409 Ga0206353_11220810 3300020082 Bacteria 6693
410 Ga0213874_10023184 3300021377 Bacteria 1729
411 Ga0213875_10002708 3300021388 Bacteria 10466
412 Ga0209563_100019 3300025230 Bacteria 697828
413 Ga0207425_1000022 3300025245 Bacteria 355305
414 Ga0209129_1001190 3300025258 Bacteria 14977
415 Ga0209233_1000154 3300025261 Bacteria 169616
416 Ga0209565_1000012 3300025263 Bacteria 606500
417 Ga0209565_1000100 3300025263 Bacteria 130380
418 Ga0209673_1001550 3300025273 Bacteria 20759
419 Ga0209025_1000326 3300025294 Bacteria 106087
420 Ga0209564_1009092 3300025295 Bacteria 4785
421 Ga0209758_1000001 3300025297 Bacteria 1981790
422 Ga0209758_1000004 3300025297 Bacteria 1375322
423 Ga0209758_1007537 3300025297 Bacteria 7365
424 Ga0209050_1000001 3300025298 Bacteria 3563507
425 Ga0209050_1000026 3300025298 Bacteria 499134
426 Ga0209050_1005310 3300025298 Bacteria 8180
427 Ga0209050_1012889 3300025298 Bacteria 3782
428 Ga0209256_1000012 3300025299 Bacteria 790371
429 Ga0207426_1010279 3300025302 Bacteria 3641
430 Ga0209051_1000303 3300025303 Bacteria 77630
431 Ga0209257_1000009 3300025304 Bacteria 1205047
432 Ga0209257_1003103 3300025304 Bacteria 14882
433 Ga0207697_10000069 3300025315 Bacteria 43897
434 Ga0207697_10003868 3300025315 Bacteria 7302
435 Ga0207697_10007569 3300025315 Bacteria 4830
436 Ga0207697_10021713 3300025315 Bacteria 2629
437 Ga0207656_10008101 3300025321 Bacteria 3855
438 Ga0207656_10013560 3300025321 Bacteria 3119
439 Ga0207682_10001708 3300025893 Bacteria 10045
440 Ga0207682_10001728 3300025893 Bacteria 10014
441 Ga0207682_10008218 3300025893 Bacteria 4137
442 Ga0207688_10001449 3300025901 Bacteria 12417
443 Ga0207688_10041320 3300025901 Bacteria 2565
444 Ga0207688_10100321 3300025901 Bacteria 1671
445 Ga0207680_10003653 3300025903 Bacteria 7231
446 Ga0207680_10005316 3300025903 Bacteria 6148
447 Ga0207680_10005472 3300025903 Bacteria 6069
448 Ga0207680_10013886 3300025903 Bacteria 4151
449 Ga0207680_10025541 3300025903 Bacteria 3260
450 Ga0207647_10000312 3300025904 Bacteria 40325
451 Ga0207647_10000409 3300025904 Bacteria 35287
452 Ga0207647_10001506 3300025904 Bacteria 17914
453 Ga0207647_10003939 3300025904 Bacteria 11083
454 Ga0207647_10005647 3300025904 Bacteria 9137
455 Ga0207647_10005861 3300025904 Bacteria 8956
456 Ga0207647_10010884 3300025904 Bacteria 6401
457 Ga0207647_10019759 3300025904 Bacteria 4525
458 Ga0207699_10144966 3300025906 Bacteria 1565
459 Ga0207645_10029183 3300025907 Bacteria 3556
460 Ga0207645_10036726 3300025907 Bacteria 3146
461 Ga0207645_10056547 3300025907 Bacteria 2505
462 Ga0207645_10071094 3300025907 Bacteria 2227
463 Ga0207643_10089020 3300025908 Bacteria 1797
464 Ga0207705_10000074 3300025909 Bacteria 123863
465 Ga0207705_10000574 3300025909 Bacteria 30782
466 Ga0207705_10000743 3300025909 Bacteria 26871
467 Ga0207705_10003103 3300025909 Bacteria 12670
468 Ga0207705_10005576 3300025909 Bacteria 9406
469 Ga0207705_10006159 3300025909 Bacteria 8921
470 Ga0207705_10006875 3300025909 Bacteria 8409
471 Ga0207705_10009217 3300025909 Bacteria 7186
472 Ga0207705_10009834 3300025909 Bacteria 6961
473 Ga0207705_10010738 3300025909 Bacteria 6649
474 Ga0207705_10013823 3300025909 Bacteria 5822
475 Ga0207705_10018553 3300025909 Bacteria 4973
476 Ga0207705_10082465 3300025909 Bacteria 2345
477 Ga0207705_10094339 3300025909 Bacteria 2194
478 Ga0207705_10135174 3300025909 Bacteria 1837
479 Ga0207705_10148980 3300025909 Bacteria 1752
480 Ga0207705_10168653 3300025909 Bacteria 1647
481 Ga0207684_10205521 3300025910 Bacteria 1699
482 Ga0207654_10000760 3300025911 Bacteria 17822
483 Ga0207707_10049236 3300025912 Bacteria 3670
484 Ga0207707_10159020 3300025912 Bacteria 1976
485 Ga0207707_10176691 3300025912 Bacteria 1865
486 Ga0207695_10002974 3300025913 Bacteria 24437
487 Ga0207695_10081714 3300025913 Bacteria 3269
488 Ga0207671_10001453 3300025914 Bacteria 27348
489 Ga0207693_10074032 3300025915 Bacteria 2667
490 Ga0207660_10000062 3300025917 Bacteria 56397
491 Ga0207660_10001388 3300025917 Bacteria 16269
492 Ga0207660_10010629 3300025917 Bacteria 5980
493 Ga0207660_10017515 3300025917 Bacteria 4761
494 Ga0207660_10017624 3300025917 Bacteria 4747
495 Ga0207660_10071876 3300025917 Bacteria 2518
496 Ga0207657_10000126 3300025919 Bacteria 76430
497 Ga0207657_10000812 3300025919 Bacteria 32998
498 Ga0207657_10001861 3300025919 Bacteria 22807
499 Ga0207657_10002719 3300025919 Bacteria 19039
500 Ga0207657_10005989 3300025919 Bacteria 12657
501 Ga0207657_10006959 3300025919 Bacteria 11648
502 Ga0207657_10008170 3300025919 Bacteria 10663
503 Ga0207657_10010039 3300025919 Bacteria 9471
504 Ga0207657_10012372 3300025919 Bacteria 8430
505 Ga0207657_10013435 3300025919 Bacteria 8033
506 Ga0207657_10017920 3300025919 Bacteria 6776
507 Ga0207657_10019353 3300025919 Bacteria 6468
508 Ga0207657_10046038 3300025919 Bacteria 3822
509 Ga0207657_10062177 3300025919 Bacteria 3198
510 Ga0207657_10113864 3300025919 Bacteria 2231
511 Ga0207657_10142925 3300025919 Bacteria 1954
512 Ga0207657_10252443 3300025919 Bacteria 1405
513 Ga0207649_10002090 3300025920 Bacteria 11333
514 Ga0207649_10004360 3300025920 Bacteria 7680
515 Ga0207649_10011806 3300025920 Bacteria 4831
516 Ga0207649_10017116 3300025920 Bacteria 4104
517 Ga0207649_10023791 3300025920 Bacteria 3552
518 Ga0207649_10025348 3300025920 Bacteria 3456
519 Ga0207649_10074043 3300025920 Bacteria 2184
520 Ga0207649_10075593 3300025920 Bacteria 2165
521 Ga0207649_10119108 3300025920 Bacteria 1777
522 Ga0207652_10035557 3300025921 Bacteria 4206
523 Ga0207652_10221832 3300025921 Bacteria 1703
524 Ga0207681_10010471 3300025923 Bacteria 5675
525 Ga0207681_10034104 3300025923 Bacteria 3344
526 Ga0207681_10041891 3300025923 Bacteria 3055
527 Ga0207694_10001845 3300025924 Bacteria 17646
528 Ga0207694_10002982 3300025924 Bacteria 13581
529 Ga0207694_10004235 3300025924 Bacteria 11232
530 Ga0207650_10001800 3300025925 Bacteria 15148
531 Ga0207650_10002425 3300025925 Bacteria 12988
532 Ga0207650_10016148 3300025925 Bacteria 5213
533 Ga0207650_10018523 3300025925 Bacteria 4886
534 Ga0207650_10040083 3300025925 Bacteria 3426
535 Ga0207650_10046658 3300025925 Bacteria 3191
536 Ga0207650_10060278 3300025925 Bacteria 2832
537 Ga0207650_10096080 3300025925 Bacteria 2272
538 Ga0207650_10214308 3300025925 Bacteria 1547
539 Ga0207659_10001227 3300025926 Bacteria 15347
540 Ga0207659_10002381 3300025926 Bacteria 11196
541 Ga0207659_10035215 3300025926 Bacteria 3459
542 Ga0207659_10072649 3300025926 Bacteria 2516
543 Ga0207659_10256216 3300025926 Bacteria 1422
544 Ga0207687_10000687 3300025927 Bacteria 22819
545 Ga0207687_10017705 3300025927 Bacteria 4695
546 Ga0207687_10223548 3300025927 Bacteria 1484
547 Ga0207700_10161606 3300025928 Bacteria 1861
548 Ga0207664_10043279 3300025929 Bacteria 3520
549 Ga0207664_10052071 3300025929 Bacteria 3236
550 Ga0207664_10151491 3300025929 Bacteria 1970
551 Ga0207644_10001011 3300025931 Bacteria 17978
552 Ga0207644_10001939 3300025931 Bacteria 13429
553 Ga0207644_10002879 3300025931 Bacteria 11088
554 Ga0207644_10004377 3300025931 Bacteria 9166
555 Ga0207644_10008224 3300025931 Bacteria 6833
556 Ga0207644_10009448 3300025931 Bacteria 6403
557 Ga0207644_10010174 3300025931 Bacteria 6197
558 Ga0207644_10085471 3300025931 Bacteria 2340
559 Ga0207644_10142554 3300025931 Bacteria 1846
560 Ga0207644_10151961 3300025931 Bacteria 1792
561 Ga0207690_10000106 3300025932 Bacteria 67786
562 Ga0207690_10005414 3300025932 Bacteria 7520
563 Ga0207690_10006717 3300025932 Bacteria 6817
564 Ga0207690_10007320 3300025932 Bacteria 6552
565 Ga0207690_10025831 3300025932 Bacteria 3692
566 Ga0207690_10039855 3300025932 Bacteria 3067
567 Ga0207690_10064208 3300025932 Bacteria 2506
568 Ga0207690_10158516 3300025932 Bacteria 1685
569 Ga0207690_10174206 3300025932 Bacteria 1614
570 Ga0207706_10000151 3300025933 Bacteria 76455
571 Ga0207706_10000582 3300025933 Bacteria 38878
572 Ga0207706_10000742 3300025933 Bacteria 33946
573 Ga0207706_10000815 3300025933 Bacteria 32373
574 Ga0207706_10000893 3300025933 Bacteria 30622
575 Ga0207706_10004043 3300025933 Bacteria 13878
576 Ga0207706_10004755 3300025933 Bacteria 12716
577 Ga0207706_10011556 3300025933 Bacteria 8040
578 Ga0207706_10018841 3300025933 Bacteria 6207
579 Ga0207706_10029506 3300025933 Bacteria 4896
580 Ga0207706_10036685 3300025933 Bacteria 4354
581 Ga0207706_10106322 3300025933 Bacteria 2469
582 Ga0207706_10121138 3300025933 Bacteria 2300
583 Ga0207706_10122690 3300025933 Bacteria 2285
584 Ga0207706_10189432 3300025933 Bacteria 1806
585 Ga0207706_10271033 3300025933 Bacteria 1481
586 Ga0207686_10021648 3300025934 Bacteria 3694
587 Ga0207709_10000031 3300025935 Bacteria 329046
588 Ga0207670_10044495 3300025936 Bacteria 2937
589 Ga0207669_10003676 3300025937 Bacteria 6664
590 Ga0207669_10007846 3300025937 Bacteria 4971
591 Ga0207669_10011368 3300025937 Bacteria 4329
592 Ga0207669_10067080 3300025937 Bacteria 2234
593 Ga0207669_10069083 3300025937 Bacteria 2209
594 Ga0207669_10115997 3300025937 Bacteria 1806
595 Ga0207704_10161157 3300025938 Bacteria 1596
596 Ga0207691_10000820 3300025940 Bacteria 30962
597 Ga0207691_10003021 3300025940 Bacteria 16419
598 Ga0207691_10005345 3300025940 Bacteria 12394
599 Ga0207691_10013135 3300025940 Bacteria 7928
600 Ga0207691_10016397 3300025940 Bacteria 7034
601 Ga0207691_10049284 3300025940 Bacteria 3858
602 Ga0207691_10105143 3300025940 Bacteria 2515
603 Ga0207711_10000450 3300025941 Bacteria 42929
604 Ga0207711_10001274 3300025941 Bacteria 23890
605 Ga0207711_10002455 3300025941 Bacteria 16539
606 Ga0207711_10004315 3300025941 Bacteria 12151
607 Ga0207711_10005389 3300025941 Bacteria 10822
608 Ga0207711_10007890 3300025941 Bacteria 8902
609 Ga0207711_10015675 3300025941 Bacteria 6286
610 Ga0207711_10025536 3300025941 Bacteria 4955
611 Ga0207711_10224805 3300025941 Bacteria 1718
612 Ga0207711_10237347 3300025941 Bacteria 1671
613 Ga0207689_10000388 3300025942 Bacteria 41360
614 Ga0207689_10077167 3300025942 Bacteria 2739
615 Ga0207661_10006589 3300025944 Bacteria 8212
616 Ga0207661_10006764 3300025944 Bacteria 8119
617 Ga0207661_10027389 3300025944 Bacteria 4353
618 Ga0207661_10035301 3300025944 Bacteria 3895
619 Ga0207679_10000167 3300025945 Bacteria 54388
620 Ga0207679_10004636 3300025945 Bacteria 8556
621 Ga0207679_10016605 3300025945 Bacteria 4892
622 Ga0207679_10035466 3300025945 Bacteria 3529
623 Ga0207679_10037171 3300025945 Bacteria 3459
624 Ga0207679_10056175 3300025945 Bacteria 2905
625 Ga0207679_10076122 3300025945 Bacteria 2549
626 Ga0207679_10081055 3300025945 Bacteria 2480
627 Ga0207679_10095616 3300025945 Bacteria 2310
628 Ga0207667_10000237 3300025949 Bacteria 77017
629 Ga0207667_10003576 3300025949 Bacteria 19204
630 Ga0207667_10022584 3300025949 Bacteria 6944
631 Ga0207667_10051033 3300025949 Bacteria 4362
632 Ga0207667_10053776 3300025949 Bacteria 4236
633 Ga0207667_10067383 3300025949 Bacteria 3729
634 Ga0207667_10080575 3300025949 Bacteria 3373
635 Ga0207667_10136532 3300025949 Bacteria 2525
636 Ga0207667_10148246 3300025949 Bacteria 2415
637 Ga0207651_10003831 3300025960 Bacteria 7457
638 Ga0207651_10020635 3300025960 Bacteria 3982
639 Ga0207651_10025830 3300025960 Bacteria 3657
640 Ga0207651_10029501 3300025960 Bacteria 3476
641 Ga0207651_10047323 3300025960 Bacteria 2899
642 Ga0207651_10291324 3300025960 Bacteria 1353
643 Ga0207712_10002542 3300025961 Bacteria 11728
644 Ga0207712_10056741 3300025961 Bacteria 2760
645 Ga0207712_10073355 3300025961 Bacteria 2468
646 Ga0207712_10150990 3300025961 Bacteria 1794
647 Ga0207668_10000362 3300025972 Bacteria 29058
648 Ga0207668_10079800 3300025972 Bacteria 2368
649 Ga0207668_10096484 3300025972 Bacteria 2185
650 Ga0207668_10109205 3300025972 Bacteria 2072
651 Ga0207640_10006679 3300025981 Bacteria 6339
652 Ga0207640_10021570 3300025981 Bacteria 3842
653 Ga0207640_10026683 3300025981 Bacteria 3510
654 Ga0207640_10051244 3300025981 Bacteria 2682
655 Ga0207640_10064855 3300025981 Bacteria 2434
656 Ga0207640_10101642 3300025981 Bacteria 2018
657 Ga0207658_10001885 3300025986 Bacteria 15696
658 Ga0207658_10002626 3300025986 Bacteria 13045
659 Ga0207658_10005502 3300025986 Bacteria 8682
660 Ga0207658_10007523 3300025986 Bacteria 7419
661 Ga0207658_10008648 3300025986 Bacteria 6921
662 Ga0207658_10017392 3300025986 Bacteria 4953
663 Ga0207658_10083122 3300025986 Bacteria 2460
664 Ga0207658_10217536 3300025986 Bacteria 1605
665 Ga0207677_10000890 3300026023 Bacteria 16790
666 Ga0207677_10033219 3300026023 Bacteria 3326
667 Ga0207677_10247075 3300026023 Bacteria 1447
668 Ga0207703_10001242 3300026035 Bacteria 23876
669 Ga0207703_10003017 3300026035 Bacteria 14263
670 Ga0207703_10003143 3300026035 Bacteria 13934
671 Ga0207703_10003171 3300026035 Bacteria 13857
672 Ga0207703_10034880 3300026035 Bacteria 3995
673 Ga0207703_10061441 3300026035 Bacteria 3076
674 Ga0207639_10000509 3300026041 Bacteria 26911
675 Ga0207639_10001073 3300026041 Bacteria 18534
676 Ga0207639_10024630 3300026041 Bacteria 4358
677 Ga0207639_10066528 3300026041 Bacteria 2801
678 Ga0207639_10075182 3300026041 Bacteria 2656
679 Ga0207639_10106783 3300026041 Bacteria 2273
680 Ga0207678_10000558 3300026067 Bacteria 34014
681 Ga0207678_10001651 3300026067 Bacteria 20438
682 Ga0207678_10004380 3300026067 Bacteria 12699
683 Ga0207678_10005870 3300026067 Bacteria 10947
684 Ga0207678_10012999 3300026067 Bacteria 7305
685 Ga0207678_10015200 3300026067 Bacteria 6770
686 Ga0207678_10021224 3300026067 Bacteria 5693
687 Ga0207678_10026043 3300026067 Bacteria 5103
688 Ga0207678_10141017 3300026067 Bacteria 2057
689 Ga0207708_10053110 3300026075 Bacteria 3087
690 Ga0207702_10001108 3300026078 Bacteria 27539
691 Ga0207702_10002614 3300026078 Bacteria 16915
692 Ga0207702_10006029 3300026078 Bacteria 10519
693 Ga0207702_10011636 3300026078 Bacteria 7330
694 Ga0207702_10017292 3300026078 Bacteria 5967
695 Ga0207641_10000188 3300026088 Bacteria 86532
696 Ga0207641_10013048 3300026088 Bacteria 6815
697 Ga0207641_10017696 3300026088 Bacteria 5837
698 Ga0207641_10021113 3300026088 Bacteria 5352
699 Ga0207641_10028079 3300026088 Bacteria 4647
700 Ga0207641_10051781 3300026088 Bacteria 3477
701 Ga0207641_10059168 3300026088 Bacteria 3262
702 Ga0207641_10062051 3300026088 Bacteria 3188
703 Ga0207641_10163222 3300026088 Bacteria 2027
704 Ga0207648_10001699 3300026089 Bacteria 24068
705 Ga0207648_10005192 3300026089 Bacteria 13188
706 Ga0207648_10005560 3300026089 Bacteria 12686
707 Ga0207648_10027203 3300026089 Bacteria 5079
708 Ga0207648_10032335 3300026089 Bacteria 4620
709 Ga0207648_10087242 3300026089 Bacteria 2723
710 Ga0207648_10141939 3300026089 Bacteria 2117
711 Ga0207676_10000552 3300026095 Bacteria 31180
712 Ga0207676_10007129 3300026095 Bacteria 7918
713 Ga0207676_10007407 3300026095 Bacteria 7783
714 Ga0207676_10009850 3300026095 Bacteria 6797
715 Ga0207676_10016612 3300026095 Bacteria 5330
716 Ga0207676_10148591 3300026095 Bacteria 2015
717 Ga0207674_10000464 3300026116 Bacteria 53168
718 Ga0207674_10001910 3300026116 Bacteria 26443
719 Ga0207674_10002680 3300026116 Bacteria 22216
720 Ga0207674_10002972 3300026116 Bacteria 21049
721 Ga0207674_10005871 3300026116 Bacteria 14554
722 Ga0207674_10007257 3300026116 Bacteria 12920
723 Ga0207674_10014126 3300026116 Bacteria 8823
724 Ga0207674_10019167 3300026116 Bacteria 7418
725 Ga0207674_10026101 3300026116 Bacteria 6215
726 Ga0207674_10036469 3300026116 Bacteria 5122
727 Ga0207674_10054374 3300026116 Bacteria 4076
728 Ga0207674_10070503 3300026116 Bacteria 3514
729 Ga0207675_100000035 3300026118 Bacteria 95190
730 Ga0207675_100012446 3300026118 Bacteria 7950
731 Ga0207675_100037070 3300026118 Bacteria 4549
732 Ga0207683_10000086 3300026121 Bacteria 73510
733 Ga0207683_10007896 3300026121 Bacteria 9102
734 Ga0207683_10014803 3300026121 Bacteria 6639
735 Ga0207683_10043489 3300026121 Bacteria 3926
736 Ga0207683_10046328 3300026121 Bacteria 3805
737 Ga0207683_10133954 3300026121 Bacteria 2230
738 Ga0207698_10000493 3300026142 Bacteria 23044
739 Ga0207698_10004319 3300026142 Bacteria 8649
740 Ga0207698_10006415 3300026142 Bacteria 7339
741 Ga0207698_10014487 3300026142 Bacteria 5244
742 Ga0207698_10018689 3300026142 Bacteria 4729
743 Ga0207698_10024240 3300026142 Bacteria 4255
744 Ga0207698_10031286 3300026142 Bacteria 3839
745 Ga0207698_10056050 3300026142 Bacteria 3041
746 Ga0207698_10091979 3300026142 Bacteria 2485
747 Ga0207698_10259070 3300026142 Bacteria 1597
748 Ga0209974_10004727 3300027876 Bacteria 4835
749 Ga0268266_10000002 3300028379 Bacteria 3059047
750 Ga0268266_10000133 3300028379 Bacteria 143210
751 Ga0268266_10001014 3300028379 Bacteria 35389
752 Ga0268266_10006563 3300028379 Bacteria 10636
753 Ga0268266_10010106 3300028379 Bacteria 8274
754 Ga0268266_10028395 3300028379 Bacteria 4756
755 Ga0268266_10121433 3300028379 Bacteria 2325
756 Ga0268266_10358563 3300028379 Bacteria 1371
757 Ga0268265_10000954 3300028380 Bacteria 26564
758 Ga0268265_10007440 3300028380 Bacteria 7396
759 Ga0268265_10015414 3300028380 Bacteria 5231
760 Ga0268265_10019797 3300028380 Bacteria 4685
761 Ga0268265_10023018 3300028380 Bacteria 4387
762 Ga0268265_10027288 3300028380 Bacteria 4074
763 Ga0268265_10040453 3300028380 Bacteria 3443
764 Ga0268265_10175907 3300028380 Bacteria 1834
765 Ga0268264_10007437 3300028381 Bacteria 9143
766 Ga0268264_10007642 3300028381 Bacteria 9010
767 Ga0268264_10011662 3300028381 Bacteria 7247
768 Ga0268264_10018096 3300028381 Bacteria 5763
769 Ga0268264_10025023 3300028381 Bacteria 4878
770 Ga0268264_10145883 3300028381 Bacteria 2116
771 Ga0307517_10022129 3300028786 Bacteria 7981
772 Ga0307408_100020632 3300031548 Bacteria 4450
773 Ga0307408_100029269 3300031548 Bacteria 3814
774 Ga0307408_100070697 3300031548 Bacteria 2578
775 Ga0307408_100072148 3300031548 Bacteria 2555
776 Ga0307408_100162247 3300031548 Bacteria 1776
777 Ga0307508_10000499 3300031616 Bacteria 47166
778 Ga0307508_10077394 3300031616 Bacteria 2905
779 Ga0307405_10000810 3300031731 Bacteria 12300
780 Ga0307405_10003330 3300031731 Bacteria 7358
781 Ga0307405_10004515 3300031731 Bacteria 6589
782 Ga0307405_10011919 3300031731 Bacteria 4578
783 Ga0307405_10012672 3300031731 Bacteria 4474
784 Ga0307405_10022655 3300031731 Bacteria 3555
785 Ga0307405_10028738 3300031731 Bacteria 3242
786 Ga0307413_10001408 3300031824 Bacteria 9086
787 Ga0307413_10001829 3300031824 Bacteria 8363
788 Ga0307413_10007746 3300031824 Bacteria 5013
789 Ga0307413_10010843 3300031824 Bacteria 4446
790 Ga0307413_10010849 3300031824 Bacteria 4445
791 Ga0307413_10025302 3300031824 Bacteria 3252
792 Ga0307413_10026568 3300031824 Bacteria 3192
793 Ga0307413_10031776 3300031824 Bacteria 2983
794 Ga0307413_10052678 3300031824 Bacteria 2459
795 Ga0307413_10065741 3300031824 Bacteria 2259
796 Ga0307413_10126421 3300031824 Bacteria 1742
797 Ga0307410_10004701 3300031852 Bacteria 7102
798 Ga0307410_10006694 3300031852 Bacteria 6242
799 Ga0307410_10011898 3300031852 Bacteria 5002
800 Ga0307410_10014908 3300031852 Bacteria 4592
801 Ga0307410_10021007 3300031852 Bacteria 4007
802 Ga0307410_10031807 3300031852 Bacteria 3390
803 Ga0307406_10003823 3300031901 Bacteria 8194
804 Ga0307406_10035895 3300031901 Bacteria 3052
805 Ga0307406_10049302 3300031901 Bacteria 2664
806 Ga0307406_10061342 3300031901 Bacteria 2428
807 Ga0307406_10064882 3300031901 Bacteria 2371
808 Ga0307406_10146227 3300031901 Bacteria 1680
809 Ga0307407_10003813 3300031903 Bacteria 6276
810 Ga0307407_10005872 3300031903 Bacteria 5383
811 Ga0307407_10006615 3300031903 Bacteria 5174
812 Ga0307407_10010480 3300031903 Bacteria 4374
813 Ga0307407_10035324 3300031903 Bacteria 2745
814 Ga0307407_10036078 3300031903 Bacteria 2721
815 Ga0307407_10056561 3300031903 Bacteria 2272
816 Ga0307407_10101143 3300031903 Bacteria 1789
817 Ga0307412_10002208 3300031911 Bacteria 10800
818 Ga0307412_10006342 3300031911 Bacteria 6681
819 Ga0307412_10060561 3300031911 Bacteria 2541
820 Ga0307412_10103587 3300031911 Bacteria 2017
821 Ga0307412_10116250 3300031911 Bacteria 1918
822 Ga0307412_10123251 3300031911 Bacteria 1870
823 Ga0307412_10184934 3300031911 Bacteria 1570
824 Ga0307412_10210383 3300031911 Bacteria 1483
825 Ga0307412_10232113 3300031911 Bacteria 1421
826 Ga0307409_100008259 3300031995 Bacteria 6306
827 Ga0307409_100017064 3300031995 Bacteria 4826
828 Ga0307409_100017250 3300031995 Bacteria 4806
829 Ga0307409_100063700 3300031995 Bacteria 2892
830 Ga0307409_100078094 3300031995 Bacteria 2662
831 Ga0307409_100101005 3300031995 Bacteria 2392
832 Ga0307409_100134166 3300031995 Bacteria 2121
833 Ga0307409_100246497 3300031995 Bacteria 1630
834 Ga0307409_100249018 3300031995 Bacteria 1623
835 Ga0307409_100289491 3300031995 Bacteria 1518
836 Ga0307416_100005123 3300032002 Bacteria 8002
837 Ga0307416_100006146 3300032002 Bacteria 7484
838 Ga0307416_100008540 3300032002 Bacteria 6619
839 Ga0307416_100010725 3300032002 Bacteria 6070
840 Ga0307416_100010869 3300032002 Bacteria 6036
841 Ga0307416_100021440 3300032002 Bacteria 4638
842 Ga0307416_100021913 3300032002 Bacteria 4599
843 Ga0307416_100028112 3300032002 Bacteria 4177
844 Ga0307416_100037260 3300032002 Bacteria 3740
845 Ga0307416_100066153 3300032002 Bacteria 2974
846 Ga0307416_100117277 3300032002 Bacteria 2363
847 Ga0307416_100237675 3300032002 Bacteria 1762
848 Ga0307414_10000856 3300032004 Bacteria 15517
849 Ga0307414_10010603 3300032004 Bacteria 5358
850 Ga0307414_10011201 3300032004 Bacteria 5248
851 Ga0307414_10011701 3300032004 Bacteria 5157
852 Ga0307414_10012439 3300032004 Bacteria 5031
853 Ga0307414_10021481 3300032004 Bacteria 4051
854 Ga0307414_10031891 3300032004 Bacteria 3462
855 Ga0307414_10031994 3300032004 Bacteria 3458
856 Ga0307414_10061779 3300032004 Bacteria 2655
857 Ga0307414_10066624 3300032004 Bacteria 2575
858 Ga0307414_10070226 3300032004 Bacteria 2521
859 Ga0307414_10083310 3300032004 Bacteria 2348
860 Ga0307414_10088681 3300032004 Bacteria 2290
861 Ga0307414_10098416 3300032004 Bacteria 2194
862 Ga0307414_10124984 3300032004 Bacteria 1985
863 Ga0307411_10003532 3300032005 Bacteria 7276
864 Ga0307411_10005956 3300032005 Bacteria 6057
865 Ga0307411_10016186 3300032005 Bacteria 4217
866 Ga0307411_10017613 3300032005 Bacteria 4077
867 Ga0307411_10019525 3300032005 Bacteria 3916
868 Ga0307411_10039933 3300032005 Bacteria 2973
869 Ga0307411_10073659 3300032005 Bacteria 2324
870 Ga0307411_10210302 3300032005 Bacteria 1501
871 Ga0307411_10252922 3300032005 Bacteria 1386
872 Ga0307415_100001716 3300032126 Bacteria 10655
873 Ga0307415_100004095 3300032126 Bacteria 7524
874 Ga0307415_100007285 3300032126 Bacteria 6041
875 Ga0307415_100009011 3300032126 Bacteria 5566
876 Ga0307415_100043324 3300032126 Bacteria 3002
877 Ga0307415_100055691 3300032126 Bacteria 2707
878 Ga0307415_100073719 3300032126 Bacteria 2409
879 Ga0307415_100078344 3300032126 Bacteria 2350
880 Ga0307415_100103509 3300032126 Bacteria 2095
881 Ga0307415_100277142 3300032126 Bacteria 1377
882 Ga0307510_10010060 3300033180 Bacteria 11242
883 Ga0307510_10110132 3300033180 Bacteria 2500
884 Ga0373923_0053644 3300035111 Bacteria 1696
885 Ga0373946_0050404 3300035171 Bacteria 1739
886 Ga0373955_0006497 3300035172 Bacteria 5328
887 Ga0373942_0017415 3300035207 Bacteria 1771
888 Ga0373935_0037248 3300035692 Bacteria 3043
889 Ga0373933_0043740 3300035724 Bacteria 2651
890 Ga0395899_0000641 3300037312 Bacteria 36112
891 Ga0395899_0005952 3300037312 Bacteria 9473
892 Ga0395899_0006615 3300037312 Bacteria 8982
893 Ga0395899_0013219 3300037312 Bacteria 6314
894 Ga0395899_0018106 3300037312 Bacteria 5360
895 Ga0395899_0019896 3300037312 Bacteria 5092
896 Ga0395899_0020346 3300037312 Bacteria 5033
897 Ga0395899_0023752 3300037312 Bacteria 4640
898 Ga0395899_0040536 3300037312 Bacteria 3482
899 Ga0395899_0069751 3300037312 Bacteria 2573
900 Ga0395899_0084721 3300037312 Bacteria 2304
901 Ga0395899_0096607 3300037312 Bacteria 2136
902 Ga0395900_0001028 3300037418 Bacteria 35775
903 Ga0395900_0001928 3300037418 Bacteria 23514
904 Ga0395900_0003172 3300037418 Bacteria 17828
905 Ga0395900_0004666 3300037418 Bacteria 14459
906 Ga0395900_0015093 3300037418 Bacteria 7874
907 Ga0395900_0020769 3300037418 Bacteria 6712
908 Ga0395900_0028291 3300037418 Bacteria 5741
909 Ga0395900_0032546 3300037418 Bacteria 5362
910 Ga0395900_0048836 3300037418 Bacteria 4358
911 Ga0395900_0050064 3300037418 Bacteria 4303
912 Ga0395900_0057577 3300037418 Bacteria 4001
913 Ga0395900_0063348 3300037418 Bacteria 3801
914 Ga0395900_0081198 3300037418 Bacteria 3331
915 Ga0395900_0093689 3300037418 Bacteria 3085
916 Ga0395900_0097749 3300037418 Bacteria 3016
917 Ga0395900_0100630 3300037418 Bacteria 2969
918 Ga0395900_0150611 3300037418 Bacteria 2376
919 Ga0395900_0197339 3300037418 Bacteria 2038
920 Ga0395900_0201804 3300037418 Bacteria 2011
921 Ga0395900_0340968 3300037418 Bacteria 1474
922 Ga0395898_0000245 3300037466 Bacteria 136315
923 Ga0395898_0004414 3300037466 Bacteria 15392
924 Ga0395898_0005895 3300037466 Bacteria 13172
925 Ga0395898_0007385 3300037466 Bacteria 11661
926 Ga0395898_0050800 3300037466 Bacteria 4056
927 Ga0395898_0056938 3300037466 Bacteria 3809
928 Ga0395898_0066068 3300037466 Bacteria 3506
929 Ga0395898_0068169 3300037466 Bacteria 3443
930 Ga0395898_0152847 3300037466 Bacteria 2208
931 Ga0395898_0159423 3300037466 Bacteria 2158
932 Ga0395898_0185651 3300037466 Bacteria 1987
933 Ga0395898_0209294 3300037466 Bacteria 1860
934 Ga0395905_0000006 3300037471 Bacteria 549428
935 Ga0395905_0001020 3300037471 Bacteria 35732
936 Ga0395905_0001152 3300037471 Bacteria 33092
937 Ga0395905_0001766 3300037471 Bacteria 25131
938 Ga0395905_0004363 3300037471 Bacteria 14727
939 Ga0395905_0005317 3300037471 Bacteria 13160
940 Ga0395905_0006534 3300037471 Bacteria 11725
941 Ga0395905_0015776 3300037471 Bacteria 7176
942 Ga0395905_0021112 3300037471 Bacteria 6166
943 Ga0395905_0023088 3300037471 Bacteria 5880
944 Ga0395905_0024548 3300037471 Bacteria 5688
945 Ga0395905_0025599 3300037471 Bacteria 5564
946 Ga0395905_0027001 3300037471 Bacteria 5414
947 Ga0395905_0027364 3300037471 Bacteria 5377
948 Ga0395905_0036942 3300037471 Bacteria 4589
949 Ga0395905_0037702 3300037471 Bacteria 4537
950 Ga0395905_0037948 3300037471 Bacteria 4521
951 Ga0395905_0038845 3300037471 Bacteria 4465
952 Ga0395905_0047477 3300037471 Bacteria 4024
953 Ga0395905_0058917 3300037471 Bacteria 3590
954 Ga0395905_0063035 3300037471 Bacteria 3468
955 Ga0395905_0063624 3300037471 Bacteria 3451
956 Ga0395905_0064287 3300037471 Bacteria 3433
957 Ga0395905_0067251 3300037471 Bacteria 3356
958 Ga0395905_0068441 3300037471 Bacteria 3325
959 Ga0395905_0072518 3300037471 Bacteria 3228
960 Ga0395905_0084846 3300037471 Bacteria 2968
961 Ga0395905_0087425 3300037471 Bacteria 2922
962 Ga0395905_0117794 3300037471 Bacteria 2496
963 Ga0395905_0130452 3300037471 Bacteria 2364
964 Ga0395905_0139458 3300037471 Bacteria 2281
965 Ga0395905_0242147 3300037471 Bacteria 1685
966 Ga0436364_1250193 3300037853 Bacteria 30695
967 Ga0395901_0000243 3300038443 Bacteria 68039
968 Ga0395901_0002842 3300038443 Bacteria 17486
969 Ga0395901_0003563 3300038443 Bacteria 15700
970 Ga0395901_0003794 3300038443 Bacteria 15221
971 Ga0395901_0005053 3300038443 Bacteria 13322
972 Ga0395901_0008059 3300038443 Bacteria 10639
973 Ga0395901_0011358 3300038443 Bacteria 9024
974 Ga0395901_0012473 3300038443 Bacteria 8624
975 Ga0395901_0020664 3300038443 Bacteria 6738
976 Ga0395901_0040067 3300038443 Bacteria 4850
977 Ga0395901_0063585 3300038443 Bacteria 3841
978 Ga0395901_0086555 3300038443 Bacteria 3277
979 Ga0395901_0124457 3300038443 Bacteria 2709
980 Ga0395901_0124598 3300038443 Bacteria 2707
981 Ga0395901_0128344 3300038443 Bacteria 2665
982 Ga0395901_0145798 3300038443 Bacteria 2488
983 Ga0395901_0176696 3300038443 Bacteria 2239
984 Ga0436365_0615625 3300039437 Bacteria 10749
985 Ga0436365_1555050 3300039437 Bacteria 2191
986 Ga0436363_0944510 3300039450 Bacteria 2488
987 Ga0439461_0000932 3300041410 Bacteria 4365
988 Ga0439465_0000351 3300041413 Bacteria 13240
989 Ga0439431_0000130 3300041997 Bacteria 13345
990 Ga0439448_0001434 3300042005 Bacteria 6167
991 Ga0439432_031606 3300042006 Bacteria 1711
992 Ga0439462_0001118 3300042015 Bacteria 5811
993 Ga0450920_008758 3300042122 Bacteria 1854
994 Ga0439458_0000638 3300042157 Bacteria 9059
995 Ga0439464_0000723 3300042439 Bacteria 7174
996 Ga0466966_0046832 3300044684 Bacteria 2759
997 Ga0466966_0062699 3300044684 Bacteria 2343
998 Ga0466966_0076106 3300044684 Bacteria 2096
999 Ga0466966_0082687 3300044684 Bacteria 1998
1000 Ga0466961_0026566 3300044693 Bacteria 3721
1001 Ga0466961_0034296 3300044693 Bacteria 3258
1002 Ga0466963_0014751 3300044694 Bacteria 4823
1003 Ga0466963_0025349 3300044694 Bacteria 3782
1004 Ga0466963_0038889 3300044694 Bacteria 3113
1005 Ga0466963_0061362 3300044694 Bacteria 2513
1006 Ga0466963_0065477 3300044694 Bacteria 2436
1007 Ga0466963_0086441 3300044694 Bacteria 2131
1008 Ga0466964_0009075 3300044706 Bacteria 3740
1009 Ga0466971_0030220 3300044719 Bacteria 2424
1010 Ga0466971_0051086 3300044719 Bacteria 1861
1011 Ga0466968_0016043 3300044735 Bacteria 2977
1012 Ga0466970_0006659 3300044765 Bacteria 5777
1013 Ga0466970_0027530 3300044765 Bacteria 2983
1014 Ga0466957_0002002 3300044842 Bacteria 10849
1015 Ga0466957_0014747 3300044842 Bacteria 4552
1016 Ga0466957_0023627 3300044842 Bacteria 3635
1017 Ga0466957_0142980 3300044842 Bacteria 1542
1018 Ga0466959_0057575 3300045049 Bacteria 2833
1019 Ga0466959_0058451 3300045049 Bacteria 2808
1020 Ga0466959_0099430 3300045049 Bacteria 2083
1021 Ga0466959_0229494 3300045049 Bacteria 1285
1022 Ga0466958_0115627 3300045836 Bacteria 1676
1023 Ga0466967_0007458 3300045976 Bacteria 7892
1024 Ga0466967_0012455 3300045976 Bacteria 6506
1025 Ga0466967_0017135 3300045976 Bacteria 5740
1026 Ga0466967_0017312 3300045976 Bacteria 5716
1027 Ga0466967_0026767 3300045976 Bacteria 4784
1028 Ga0466967_0177696 3300045976 Bacteria 2006
1029 Ga0466967_0270429 3300045976 Bacteria 1628
1030 Ga0466967_0289001 3300045976 Bacteria 1574
1031 Ga0466967_0317056 3300045976 Bacteria 1503
1032 Ga0495617_025474 3300046452 Bacteria 1994
1033 Ga0495638_0002342 3300046460 Bacteria 15549
1034 Ga0495650_0000340 3300046471 Bacteria 83278
1035 Ga0495596_0017490 3300046500 Bacteria 2966
1036 Ga0495583_0020766 3300046506 Bacteria 3392
1037 Ga0495606_0000824 3300046507 Bacteria 47072
1038 Ga0495616_0024734 3300046513 Bacteria 3217
1039 Ga0495643_0036583 3300046522 Bacteria 2696
1040 Ga0495643_0048920 3300046522 Bacteria 2282
1041 Ga0495648_0029152 3300046524 Bacteria 3667
1042 Ga0495663_0001232 3300046525 Bacteria 8177
1043 Ga0495598_0003510 3300046537 Bacteria 3340
1044 Ga0495621_0000183 3300046539 Bacteria 14351
1045 Ga0495621_0001723 3300046539 Bacteria 5728
1046 Ga0495621_0027488 3300046539 Bacteria 1927
1047 Ga0495597_0020830 3300046542 Bacteria 3050
1048 Ga0495633_0013919 3300046558 Bacteria 4218
1049 Ga0495633_0036509 3300046558 Bacteria 2354
1050 Ga0495668_0000007 3300046616 Bacteria 552902
1051 Ga0495668_0029811 3300046616 Bacteria 3083
1052 Ga0495668_0033221 3300046616 Bacteria 2899
1053 Ga0495625_0001479 3300046660 Bacteria 28402
1054 Ga0495623_0124397 3300046679 Bacteria 1549
1055 Ga0495669_0000881 3300046684 Bacteria 12642
1056 Ga0495669_0001006 3300046684 Bacteria 11765
1057 Ga0495669_0001211 3300046684 Bacteria 10738
1058 Ga0495669_0001860 3300046684 Bacteria 8656
1059 Ga0495669_0007020 3300046684 Bacteria 4714
1060 Ga0495669_0013492 3300046684 Bacteria 3483
1061 Ga0495669_0038335 3300046684 Bacteria 2122
1062 Ga0495670_0000007 3300046691 Bacteria 247088
1063 Ga0495670_0003182 3300046691 Bacteria 8080
1064 Ga0495670_0004459 3300046691 Bacteria 6872
1065 Ga0495670_0005394 3300046691 Bacteria 6283
1066 Ga0495600_0020783 3300046809 Bacteria 4200
1067 Ga0495660_0081352 3300046810 Bacteria 1698
1068 Ga0495686_0156578 3300047472 Bacteria 1334
1069 Ga0495602_0033640 3300048088 Bacteria 4806
1070 Ga0496100_0024844 3300048903 Bacteria 3660
1071 Ga0496100_0084526 3300048903 Bacteria 2151
1072 Ga0496101_0015261 3300048904 Bacteria 5172
1073 Ga0496101_0044620 3300048904 Bacteria 3172
1074 Ga0496102_0020373 3300048905 Bacteria 5861
1075 Ga0496102_0085007 3300048905 Bacteria 2921
1076 Ga0496102_0152634 3300048905 Bacteria 2171
1077 Ga0496104_0081963 3300048907 Bacteria 3077
1078 Ga0496106_0001125 3300048909 Bacteria 19791
1079 Ga0496107_0002167 3300048910 Bacteria 12611
1080 Ga0496107_0012994 3300048910 Bacteria 5817
1081 Ga0496107_0020747 3300048910 Bacteria 4643
1082 Ga0496107_0051032 3300048910 Bacteria 2983
1083 Ga0496107_0190499 3300048910 Bacteria 1524
1084 Ga0496108_0001354 3300048911 Bacteria 19266
1085 Ga0496108_0002672 3300048911 Bacteria 14278
1086 Ga0496108_0029707 3300048911 Bacteria 4529
1087 Ga0496108_0058688 3300048911 Bacteria 3235
1088 Ga0496108_0064742 3300048911 Bacteria 3080
1089 Ga0496109_0003600 3300048912 Bacteria 12942
1090 Ga0496109_0020802 3300048912 Bacteria 5796
1091 Ga0496109_0033166 3300048912 Bacteria 4644
1092 Ga0496109_0055444 3300048912 Bacteria 3616
1093 Ga0496109_0319624 3300048912 Bacteria 1465
1094 Ga0496110_0020205 3300048913 Bacteria 5620
1095 Ga0496110_0032724 3300048913 Bacteria 4494
1096 Ga0496110_0032846 3300048913 Bacteria 4486
1097 Ga0496110_0063110 3300048913 Bacteria 3273
1098 Ga0496111_0006954 3300048914 Bacteria 7384
1099 Ga0496111_0017467 3300048914 Bacteria 4961
1100 Ga0496111_0077057 3300048914 Bacteria 2430
1101 Ga0496111_0081316 3300048914 Bacteria 2365
1102 Ga0496111_0111180 3300048914 Bacteria 2018
1103 Ga0496112_0007974 3300048915 Bacteria 9444
1104 Ga0496112_0012936 3300048915 Bacteria 7689
1105 Ga0496112_0024097 3300048915 Bacteria 5824
1106 Ga0496112_0035942 3300048915 Bacteria 4828
1107 Ga0496112_0044416 3300048915 Bacteria 4353
1108 Ga0496112_0060275 3300048915 Bacteria 3739
1109 Ga0496112_0090646 3300048915 Bacteria 3026
1110 Ga0496112_0209917 3300048915 Bacteria 1905
1111 Ga0496113_0032771 3300048916 Bacteria 3777
1112 Ga0496113_0038849 3300048916 Bacteria 3501
1113 Ga0496113_0133064 3300048916 Bacteria 1953
1114 Ga0496113_0204986 3300048916 Bacteria 1568
1115 Ga0496114_0014304 3300048917 Bacteria 6366
1116 Ga0496115_0000359 3300048918 Bacteria 38095
1117 Ga0496115_0000865 3300048918 Bacteria 22016
1118 Ga0496121_0000367 3300048924 Bacteria 92745
1119 Ga0496121_0050942 3300048924 Bacteria 3492
1120 Ga0496124_0000186 3300048927 Bacteria 123307
1121 Ga0501033_0038551 3300049570 Bacteria 3572
1122 Ga0501037_0035730 3300049573 Bacteria 3662
1123 Ga0501047_0215548 3300049581 Bacteria 1777
1124 Ga0501070_0091840 3300049586 Bacteria 2513
1125 Ga0501202_002050 3300049652 Bacteria 3334
1126 Ga0501224_001726 3300049664 Bacteria 2928
1127 Ga0501249_003742 3300049679 Bacteria 3064
1128 Ga0501080_0160205 3300049742 Bacteria 2079
1129 Ga0501268_003129 3300049765 Bacteria 2242
1130 Ga0501044_0001038 3300049823 Bacteria 33410
1131 nmdc:mga0k408_68948_c1 3300050493 Bacteria 2063
1132 nmdc:mga07m45_8_c1 3300050496 Bacteria 214050
1133 nmdc:mga06r32_4867_c1 3300050510 Bacteria 12092
1134 nmdc:mga08y16_41936_c1 3300050511 Bacteria 4793
1135 nmdc:mga0n895_410933_c1 3300050512 Bacteria 1368
1136 nmdc:mga0a205_822_c1 3300050515 Bacteria 25262
1137 Ga0500643_013357 3300053087 Bacteria 2902
1138 Ga0500643_025968 3300053087 Bacteria 1840
1139 Ga0500566_0009109 3300053094 Bacteria 5869
1140 Ga0500556_0009220 3300053104 Bacteria 2864
1141 Ga0500595_001453 3300053119 Bacteria 12624
1142 Ga0500568_0035458 3300053139 Bacteria 2035
1143 Ga0500616_0000737 3300053153 Bacteria 37796
1144 Ga0500616_0037917 3300053153 Bacteria 2607
1145 Ga0500645_001211 3300053730 Bacteria 13658
1146 Ga0500596_002339 3300053735 Bacteria 3748
1147 Ga0500587_000551 3300053739 Bacteria 4613
1148 Ga0466962_0002076 3300061719 Bacteria 9478
1149 Ga0466962_0007379 3300061719 Bacteria 5275

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0038551 Ga0501033_0038551_26_1048 339
2 3300044694 Ga0466963_0086441 Ga0466963_0086441_1044_2087 346
3 3300046542 Ga0495597_0020830 Ga0495597_0020830_562_1713 363
4 3300037418 Ga0395900_0048836 Ga0395900_0048836_3202_4302 366
5 3300044693 Ga0466961_0034296 Ga0466961_0034296_2089_3195 367
6 3300045976 Ga0466967_0317056 Ga0466967_0317056_366_1490 374
7 3300045976 Ga0466967_0177696 Ga0466967_0177696_830_1960 376
8 3300026041 Ga0207639_10001073 Ga0207639_1000107321 385
9 3300005455 Ga0070663_100117013 Ga0070663_1001170132 388
10 3300026067 Ga0207678_10026043 Ga0207678_100260434 388
11 iso_pu_bacteria 2599185354 2600202554 394
12 iso_pu_bacteria 2643221622 2644126887 394
13 iso_pu_bacteria 2751185897 2753764344 394
14 iso_pu_bacteria 2879163058 2879166739 394
15 iso_pu_bacteria 2928968154 2928971699 394
16 iso_pu_bacteria 8057101203 8057103762 394
17 3300005367 Ga0070667_100002154 Ga0070667_1000021545 395
18 3300005367 Ga0070667_100154401 Ga0070667_1001544012 395
19 3300005547 Ga0070693_100035832 Ga0070693_1000358323 395
20 3300005616 Ga0068852_100309868 Ga0068852_1003098682 395
21 3300005834 Ga0068851_10002715 Ga0068851_100027152 395
22 3300005843 Ga0068860_100148559 Ga0068860_1001485592 395
23 3300009177 Ga0105248_10003908 Ga0105248_100039087 395
24 3300013102 Ga0157371_10028899 Ga0157371_100288994 395
25 3300014968 Ga0157379_10026764 Ga0157379_100267644 395
26 3300025321 Ga0207656_10013560 Ga0207656_100135603 395
27 3300025933 Ga0207706_10036685 Ga0207706_100366854 395
28 3300025941 Ga0207711_10004315 Ga0207711_100043153 395
29 3300025981 Ga0207640_10051244 Ga0207640_100512442 395
30 3300025986 Ga0207658_10007523 Ga0207658_100075236 395
31 3300026089 Ga0207648_10141939 Ga0207648_101419392 395
32 3300028381 Ga0268264_10145883 Ga0268264_101458832 395
33 3300048910 Ga0496107_0051032 Ga0496107_0051032_258_1463 395
34 3300048912 Ga0496109_0319624 Ga0496109_0319624_48_1238 395
35 3300049742 Ga0501080_0160205 Ga0501080_0160205_568_1767 395
36 iso_pu_bacteria 2885427238 2885428327 395
37 3300005539 Ga0068853_100164621 Ga0068853_1001646212 396
38 3300026067 Ga0207678_10001651 Ga0207678_1000165110 396
39 3300005327 Ga0070658_10002242 Ga0070658_1000224218 397
40 3300005339 Ga0070660_100000262 Ga0070660_10000026236 397
41 3300005339 Ga0070660_100287208 Ga0070660_1002872081 397
42 3300005345 Ga0070692_10032014 Ga0070692_100320143 397
43 3300005354 Ga0070675_100083822 Ga0070675_1000838221 397
44 3300005364 Ga0070673_100043157 Ga0070673_1000431572 397
45 3300005366 Ga0070659_100015960 Ga0070659_1000159603 397
46 3300005366 Ga0070659_100089112 Ga0070659_1000891122 397
47 3300005457 Ga0070662_100000425 Ga0070662_1000004251 397
48 3300005530 Ga0070679_100183328 Ga0070679_1001833282 397
49 3300005563 Ga0068855_100000353 Ga0068855_1000003536 397
50 3300013104 Ga0157370_10123634 Ga0157370_101236343 397
51 3300025909 Ga0207705_10000574 Ga0207705_100005744 397
52 3300025909 Ga0207705_10010738 Ga0207705_100107383 397
53 3300025917 Ga0207660_10071876 Ga0207660_100718763 397
54 3300025919 Ga0207657_10000812 Ga0207657_100008124 397
55 3300025919 Ga0207657_10046038 Ga0207657_100460384 397
56 3300025923 Ga0207681_10034104 Ga0207681_100341043 397
57 3300025926 Ga0207659_10072649 Ga0207659_100726493 397
58 3300025933 Ga0207706_10000582 Ga0207706_1000058237 397
59 3300025933 Ga0207706_10122690 Ga0207706_101226902 397
60 3300025944 Ga0207661_10035301 Ga0207661_100353013 397
61 3300025949 Ga0207667_10000237 Ga0207667_1000023727 397
62 3300026067 Ga0207678_10021224 Ga0207678_100212244 397
63 3300031731 Ga0307405_10000810 Ga0307405_100008106 397
64 3300031995 Ga0307409_100063700 Ga0307409_1000637003 397
65 3300037418 Ga0395900_0050064 Ga0395900_0050064_2278_3474 397
66 3300037418 Ga0395900_0081198 Ga0395900_0081198_1165_2361 397
67 3300037466 Ga0395898_0007385 Ga0395898_0007385_1280_2476 397
68 3300037471 Ga0395905_0068441 Ga0395905_0068441_197_1393 397
69 3300037471 Ga0395905_0087425 Ga0395905_0087425_359_1555 397
70 3300038443 Ga0395901_0086555 Ga0395901_0086555_181_1377 397
71 3300042006 Ga0439432_031606 Ga0439432_031606_249_1454 397
72 3300048915 Ga0496112_0209917 Ga0496112_0209917_183_1379 397
73 3300053119 Ga0500595_001453 Ga0500595_001453_4647_5840 397
74 3300001976 JGI24752J21851_1001734 JGI24752J21851_10017342 398
75 3300001979 JGI24740J21852_10001901 JGI24740J21852_100019013 398
76 3300001979 JGI24740J21852_10003677 JGI24740J21852_100036775 398
77 3300001979 JGI24740J21852_10003883 JGI24740J21852_100038832 398
78 3300001979 JGI24740J21852_10016439 JGI24740J21852_100164392 398
79 3300001989 JGI24739J22299_10001515 JGI24739J22299_100015154 398
80 3300001989 JGI24739J22299_10006709 JGI24739J22299_100067093 398
81 3300001990 JGI24737J22298_10000012 JGI24737J22298_1000001215 398
82 3300001990 JGI24737J22298_10020525 JGI24737J22298_100205252 398
83 3300001990 JGI24737J22298_10037075 JGI24737J22298_100370752 398
84 3300002067 JGI24735J21928_10020786 JGI24735J21928_100207862 398
85 3300002067 JGI24735J21928_10031467 JGI24735J21928_100314672 398
86 3300002075 JGI24738J21930_10004127 JGI24738J21930_100041272 398
87 3300002075 JGI24738J21930_10007600 JGI24738J21930_100076002 398
88 3300002077 JGI24744J21845_10003924 JGI24744J21845_100039243 398
89 3300002774 JGI25150J39212_1000369 JGI25150J39212_100036911 398
90 3300003214 JGI25165J46597_1000089 JGI25165J46597_100008962 398
91 3300003215 JGI25153J46596_10000002 JGI25153J46596_10000002522 398
92 3300003215 JGI25153J46596_10000124 JGI25153J46596_1000012414 398
93 3300003759 Ga0055525_1000051 Ga0055525_100005126 398
94 3300003771 Ga0055526_1002872 Ga0055526_100287210 398
95 3300003771 Ga0055526_1007101 Ga0055526_10071015 398
96 3300003773 Ga0055537_1001186 Ga0055537_10011866 398
97 3300003773 Ga0055537_1002563 Ga0055537_10025635 398
98 3300003775 Ga0055524_1000169 Ga0055524_10001696 398
99 3300003791 Ga0055530_10000798 Ga0055530_100007988 398
100 3300003792 Ga0055540_1001358 Ga0055540_10013582 398
101 3300003794 Ga0055531_10000008 Ga0055531_1000000892 398
102 3300003794 Ga0055531_10017823 Ga0055531_100178233 398
103 3300005262 Ga0065165_1005865 Ga0065165_10058655 398
104 3300005262 Ga0065165_1013339 Ga0065165_10133393 398
105 3300005295 Ga0065707_10082739 Ga0065707_100827395 398
106 3300005327 Ga0070658_10000001 Ga0070658_10000001662 398
107 3300005327 Ga0070658_10000131 Ga0070658_1000013124 398
108 3300005327 Ga0070658_10011705 Ga0070658_100117054 398
109 3300005327 Ga0070658_10015514 Ga0070658_100155144 398
110 3300005327 Ga0070658_10037923 Ga0070658_100379232 398
111 3300005327 Ga0070658_10059343 Ga0070658_100593433 398
112 3300005327 Ga0070658_10148374 Ga0070658_101483741 398
113 3300005327 Ga0070658_10170823 Ga0070658_101708232 398
114 3300005327 Ga0070658_10332552 Ga0070658_103325521 398
115 3300005328 Ga0070676_10006189 Ga0070676_100061892 398
116 3300005328 Ga0070676_10053580 Ga0070676_100535802 398
117 3300005329 Ga0070683_100018131 Ga0070683_1000181312 398
118 3300005329 Ga0070683_100036381 Ga0070683_1000363813 398
119 3300005329 Ga0070683_100082919 Ga0070683_1000829193 398
120 3300005329 Ga0070683_100092882 Ga0070683_1000928822 398
121 3300005329 Ga0070683_100155740 Ga0070683_1001557402 398
122 3300005330 Ga0070690_100007230 Ga0070690_1000072303 398
123 3300005331 Ga0070670_100003243 Ga0070670_1000032436 398
124 3300005331 Ga0070670_100004708 Ga0070670_1000047086 398
125 3300005331 Ga0070670_100015577 Ga0070670_1000155773 398
126 3300005331 Ga0070670_100037311 Ga0070670_1000373114 398
127 3300005331 Ga0070670_100048352 Ga0070670_1000483523 398
128 3300005331 Ga0070670_100064356 Ga0070670_1000643562 398
129 3300005331 Ga0070670_100135742 Ga0070670_1001357421 398
130 3300005331 Ga0070670_100163640 Ga0070670_1001636402 398
131 3300005333 Ga0070677_10000985 Ga0070677_100009857 398
132 3300005333 Ga0070677_10017914 Ga0070677_100179143 398
133 3300005334 Ga0068869_100016586 Ga0068869_1000165863 398
134 3300005334 Ga0068869_100069511 Ga0068869_1000695112 398
135 3300005335 Ga0070666_10000163 Ga0070666_1000016327 398
136 3300005335 Ga0070666_10001646 Ga0070666_100016465 398
137 3300005335 Ga0070666_10001840 Ga0070666_1000184011 398
138 3300005335 Ga0070666_10012632 Ga0070666_100126323 398
139 3300005335 Ga0070666_10019786 Ga0070666_100197864 398
140 3300005336 Ga0070680_100000070 Ga0070680_10000007026 398
141 3300005336 Ga0070680_100001652 Ga0070680_1000016524 398
142 3300005336 Ga0070680_100002890 Ga0070680_1000028906 398
143 3300005336 Ga0070680_100024633 Ga0070680_1000246333 398
144 3300005337 Ga0070682_100021219 Ga0070682_1000212193 398
145 3300005337 Ga0070682_100031361 Ga0070682_1000313613 398
146 3300005337 Ga0070682_100142457 Ga0070682_1001424572 398
147 3300005338 Ga0068868_100001374 Ga0068868_1000013747 398
148 3300005338 Ga0068868_100027559 Ga0068868_1000275594 398
149 3300005339 Ga0070660_100000263 Ga0070660_10000026317 398
150 3300005339 Ga0070660_100008438 Ga0070660_1000084385 398
151 3300005339 Ga0070660_100010347 Ga0070660_1000103473 398
152 3300005339 Ga0070660_100012874 Ga0070660_1000128742 398
153 3300005339 Ga0070660_100014609 Ga0070660_1000146093 398
154 3300005339 Ga0070660_100026484 Ga0070660_1000264843 398
155 3300005339 Ga0070660_100036411 Ga0070660_1000364112 398
156 3300005339 Ga0070660_100038784 Ga0070660_1000387843 398
157 3300005339 Ga0070660_100069321 Ga0070660_1000693212 398
158 3300005339 Ga0070660_100100650 Ga0070660_1001006501 398
159 3300005339 Ga0070660_100162273 Ga0070660_1001622732 398
160 3300005339 Ga0070660_100203435 Ga0070660_1002034352 398
161 3300005339 Ga0070660_100291557 Ga0070660_1002915571 398
162 3300005341 Ga0070691_10000431 Ga0070691_100004317 398
163 3300005341 Ga0070691_10046760 Ga0070691_100467602 398
164 3300005344 Ga0070661_100000075 Ga0070661_10000007560 398
165 3300005344 Ga0070661_100052269 Ga0070661_1000522691 398
166 3300005344 Ga0070661_100084953 Ga0070661_1000849532 398
167 3300005344 Ga0070661_100109442 Ga0070661_1001094422 398
168 3300005344 Ga0070661_100114310 Ga0070661_1001143101 398
169 3300005344 Ga0070661_100115221 Ga0070661_1001152212 398
170 3300005344 Ga0070661_100130591 Ga0070661_1001305912 398
171 3300005344 Ga0070661_100176764 Ga0070661_1001767642 398
172 3300005345 Ga0070692_10015372 Ga0070692_100153723 398
173 3300005347 Ga0070668_100134533 Ga0070668_1001345332 398
174 3300005353 Ga0070669_100001378 Ga0070669_1000013784 398
175 3300005353 Ga0070669_100011709 Ga0070669_1000117094 398
176 3300005353 Ga0070669_100017953 Ga0070669_1000179534 398
177 3300005354 Ga0070675_100000964 Ga0070675_10000096422 398
178 3300005354 Ga0070675_100002994 Ga0070675_1000029949 398
179 3300005354 Ga0070675_100035449 Ga0070675_1000354493 398
180 3300005354 Ga0070675_100165806 Ga0070675_1001658061 398
181 3300005355 Ga0070671_100001992 Ga0070671_1000019926 398
182 3300005355 Ga0070671_100004930 Ga0070671_10000493012 398
183 3300005355 Ga0070671_100019434 Ga0070671_1000194344 398
184 3300005355 Ga0070671_100022088 Ga0070671_1000220882 398
185 3300005355 Ga0070671_100042041 Ga0070671_1000420412 398
186 3300005355 Ga0070671_100045542 Ga0070671_1000455423 398
187 3300005355 Ga0070671_100081705 Ga0070671_1000817051 398
188 3300005356 Ga0070674_100010858 Ga0070674_1000108584 398
189 3300005356 Ga0070674_100018622 Ga0070674_1000186224 398
190 3300005356 Ga0070674_100045140 Ga0070674_1000451402 398
191 3300005356 Ga0070674_100080848 Ga0070674_1000808483 398
192 3300005356 Ga0070674_100140966 Ga0070674_1001409662 398
193 3300005356 Ga0070674_100260700 Ga0070674_1002607001 398
194 3300005364 Ga0070673_100000127 Ga0070673_10000012715 398
195 3300005364 Ga0070673_100000346 Ga0070673_1000003464 398
196 3300005364 Ga0070673_100037965 Ga0070673_1000379651 398
197 3300005364 Ga0070673_100041374 Ga0070673_1000413743 398
198 3300005364 Ga0070673_100120393 Ga0070673_1001203931 398
199 3300005364 Ga0070673_100121514 Ga0070673_1001215142 398
200 3300005364 Ga0070673_100164717 Ga0070673_1001647171 398
201 3300005364 Ga0070673_100306083 Ga0070673_1003060832 398
202 3300005366 Ga0070659_100000126 Ga0070659_10000012630 398
203 3300005366 Ga0070659_100005873 Ga0070659_1000058736 398
204 3300005366 Ga0070659_100005905 Ga0070659_1000059053 398
205 3300005366 Ga0070659_100010692 Ga0070659_1000106923 398
206 3300005366 Ga0070659_100016116 Ga0070659_1000161162 398
207 3300005366 Ga0070659_100025309 Ga0070659_1000253093 398
208 3300005366 Ga0070659_100034947 Ga0070659_1000349473 398
209 3300005366 Ga0070659_100036446 Ga0070659_1000364463 398
210 3300005366 Ga0070659_100193955 Ga0070659_1001939552 398
211 3300005367 Ga0070667_100002025 Ga0070667_1000020254 398
212 3300005367 Ga0070667_100002178 Ga0070667_1000021786 398
213 3300005367 Ga0070667_100002351 Ga0070667_10000235110 398
214 3300005367 Ga0070667_100003812 Ga0070667_1000038126 398
215 3300005367 Ga0070667_100013959 Ga0070667_1000139593 398
216 3300005367 Ga0070667_100042088 Ga0070667_1000420883 398
217 3300005367 Ga0070667_100051581 Ga0070667_1000515812 398
218 3300005367 Ga0070667_100092512 Ga0070667_1000925122 398
219 3300005367 Ga0070667_100274999 Ga0070667_1002749991 398
220 3300005434 Ga0070709_10134677 Ga0070709_101346772 398
221 3300005435 Ga0070714_100038119 Ga0070714_1000381193 398
222 3300005435 Ga0070714_100075350 Ga0070714_1000753503 398
223 3300005436 Ga0070713_100046327 Ga0070713_1000463274 398
224 3300005455 Ga0070663_100006940 Ga0070663_1000069404 398
225 3300005455 Ga0070663_100030080 Ga0070663_1000300803 398
226 3300005455 Ga0070663_100161597 Ga0070663_1001615971 398
227 3300005456 Ga0070678_100000917 Ga0070678_1000009173 398
228 3300005456 Ga0070678_100003221 Ga0070678_1000032216 398
229 3300005456 Ga0070678_100006076 Ga0070678_1000060769 398
230 3300005456 Ga0070678_100081233 Ga0070678_1000812332 398
231 3300005457 Ga0070662_100000121 Ga0070662_10000012126 398
232 3300005457 Ga0070662_100009105 Ga0070662_1000091056 398
233 3300005457 Ga0070662_100021540 Ga0070662_1000215403 398
234 3300005457 Ga0070662_100032279 Ga0070662_1000322792 398
235 3300005457 Ga0070662_100068687 Ga0070662_1000686873 398
236 3300005457 Ga0070662_100075828 Ga0070662_1000758282 398
237 3300005457 Ga0070662_100139919 Ga0070662_1001399192 398
238 3300005457 Ga0070662_100155841 Ga0070662_1001558412 398
239 3300005458 Ga0070681_10064765 Ga0070681_100647653 398
240 3300005459 Ga0068867_100000685 Ga0068867_10000068517 398
241 3300005459 Ga0068867_100066622 Ga0068867_1000666222 398
242 3300005459 Ga0068867_100092610 Ga0068867_1000926102 398
243 3300005530 Ga0070679_100032580 Ga0070679_1000325805 398
244 3300005530 Ga0070679_100259859 Ga0070679_1002598592 398
245 3300005535 Ga0070684_100007635 Ga0070684_1000076353 398
246 3300005535 Ga0070684_100008726 Ga0070684_1000087263 398
247 3300005535 Ga0070684_100024137 Ga0070684_1000241373 398
248 3300005535 Ga0070684_100068726 Ga0070684_1000687263 398
249 3300005539 Ga0068853_100000078 Ga0068853_10000007824 398
250 3300005539 Ga0068853_100001625 Ga0068853_1000016256 398
251 3300005539 Ga0068853_100009059 Ga0068853_1000090599 398
252 3300005539 Ga0068853_100011409 Ga0068853_1000114096 398
253 3300005539 Ga0068853_100029489 Ga0068853_1000294892 398
254 3300005539 Ga0068853_100065252 Ga0068853_1000652523 398
255 3300005539 Ga0068853_100066823 Ga0068853_1000668233 398
256 3300005539 Ga0068853_100219300 Ga0068853_1002193002 398
257 3300005543 Ga0070672_100002073 Ga0070672_1000020733 398
258 3300005543 Ga0070672_100002995 Ga0070672_10000299510 398
259 3300005543 Ga0070672_100007816 Ga0070672_1000078163 398
260 3300005543 Ga0070672_100283805 Ga0070672_1002838051 398
261 3300005544 Ga0070686_100017039 Ga0070686_1000170395 398
262 3300005546 Ga0070696_100025621 Ga0070696_1000256213 398
263 3300005547 Ga0070693_100000558 Ga0070693_10000055813 398
264 3300005547 Ga0070693_100069748 Ga0070693_1000697481 398
265 3300005548 Ga0070665_100009838 Ga0070665_1000098386 398
266 3300005548 Ga0070665_100012511 Ga0070665_1000125115 398
267 3300005548 Ga0070665_100015258 Ga0070665_1000152583 398
268 3300005548 Ga0070665_100102986 Ga0070665_1001029862 398
269 3300005548 Ga0070665_100121277 Ga0070665_1001212772 398
270 3300005563 Ga0068855_100004251 Ga0068855_1000042516 398
271 3300005563 Ga0068855_100004652 Ga0068855_1000046522 398
272 3300005563 Ga0068855_100040481 Ga0068855_1000404812 398
273 3300005563 Ga0068855_100112308 Ga0068855_1001123084 398
274 3300005564 Ga0070664_100000320 Ga0070664_10000032025 398
275 3300005564 Ga0070664_100002277 Ga0070664_1000022775 398
276 3300005564 Ga0070664_100016176 Ga0070664_1000161763 398
277 3300005564 Ga0070664_100023243 Ga0070664_1000232435 398
278 3300005564 Ga0070664_100034632 Ga0070664_1000346322 398
279 3300005564 Ga0070664_100036722 Ga0070664_1000367223 398
280 3300005564 Ga0070664_100053291 Ga0070664_1000532912 398
281 3300005564 Ga0070664_100094538 Ga0070664_1000945382 398
282 3300005564 Ga0070664_100106544 Ga0070664_1001065443 398
283 3300005564 Ga0070664_100161888 Ga0070664_1001618882 398
284 3300005564 Ga0070664_100170200 Ga0070664_1001702003 398
285 3300005564 Ga0070664_100172313 Ga0070664_1001723132 398
286 3300005564 Ga0070664_100228061 Ga0070664_1002280611 398
287 3300005564 Ga0070664_100239642 Ga0070664_1002396422 398
288 3300005577 Ga0068857_100010961 Ga0068857_1000109614 398
289 3300005577 Ga0068857_100015547 Ga0068857_1000155473 398
290 3300005577 Ga0068857_100017720 Ga0068857_1000177203 398
291 3300005577 Ga0068857_100020953 Ga0068857_1000209534 398
292 3300005577 Ga0068857_100021228 Ga0068857_1000212282 398
293 3300005577 Ga0068857_100030725 Ga0068857_1000307254 398
294 3300005577 Ga0068857_100043834 Ga0068857_1000438343 398
295 3300005577 Ga0068857_100133252 Ga0068857_1001332522 398
296 3300005577 Ga0068857_100162546 Ga0068857_1001625462 398
297 3300005578 Ga0068854_100005938 Ga0068854_1000059385 398
298 3300005578 Ga0068854_100012058 Ga0068854_1000120581 398
299 3300005578 Ga0068854_100017334 Ga0068854_1000173342 398
300 3300005578 Ga0068854_100040410 Ga0068854_1000404103 398
301 3300005578 Ga0068854_100051213 Ga0068854_1000512132 398
302 3300005578 Ga0068854_100067252 Ga0068854_1000672523 398
303 3300005614 Ga0068856_100000766 Ga0068856_10000076617 398
304 3300005614 Ga0068856_100037197 Ga0068856_1000371971 398
305 3300005614 Ga0068856_100055675 Ga0068856_1000556753 398
306 3300005614 Ga0068856_100096580 Ga0068856_1000965802 398
307 3300005616 Ga0068852_100000220 Ga0068852_10000022021 398
308 3300005616 Ga0068852_100002645 Ga0068852_10000264510 398
309 3300005616 Ga0068852_100012017 Ga0068852_1000120172 398
310 3300005616 Ga0068852_100021602 Ga0068852_1000216026 398
311 3300005616 Ga0068852_100034942 Ga0068852_1000349422 398
312 3300005616 Ga0068852_100036693 Ga0068852_1000366934 398
313 3300005616 Ga0068852_100060119 Ga0068852_1000601194 398
314 3300005616 Ga0068852_100060933 Ga0068852_1000609333 398
315 3300005616 Ga0068852_100121904 Ga0068852_1001219041 398
316 3300005616 Ga0068852_100146684 Ga0068852_1001466842 398
317 3300005617 Ga0068859_100000377 Ga0068859_10000037733 398
318 3300005617 Ga0068859_100088510 Ga0068859_1000885102 398
319 3300005617 Ga0068859_100125351 Ga0068859_1001253512 398
320 3300005617 Ga0068859_100209034 Ga0068859_1002090343 398
321 3300005618 Ga0068864_100000074 Ga0068864_10000007446 398
322 3300005618 Ga0068864_100000603 Ga0068864_10000060329 398
323 3300005618 Ga0068864_100002441 Ga0068864_1000024417 398
324 3300005618 Ga0068864_100003170 Ga0068864_1000031704 398
325 3300005618 Ga0068864_100010084 Ga0068864_1000100846 398
326 3300005618 Ga0068864_100129423 Ga0068864_1001294231 398
327 3300005618 Ga0068864_100190696 Ga0068864_1001906962 398
328 3300005618 Ga0068864_100276651 Ga0068864_1002766512 398
329 3300005618 Ga0068864_100341218 Ga0068864_1003412181 398
330 3300005718 Ga0068866_10006749 Ga0068866_100067494 398
331 3300005719 Ga0068861_100000052 Ga0068861_1000000526 398
332 3300005834 Ga0068851_10016003 Ga0068851_100160033 398
333 3300005834 Ga0068851_10107706 Ga0068851_101077062 398
334 3300005834 Ga0068851_10116478 Ga0068851_101164782 398
335 3300005841 Ga0068863_100000616 Ga0068863_10000061621 398
336 3300005841 Ga0068863_100001194 Ga0068863_10000119420 398
337 3300005841 Ga0068863_100006484 Ga0068863_10000648414 398
338 3300005841 Ga0068863_100039617 Ga0068863_1000396174 398
339 3300005841 Ga0068863_100057290 Ga0068863_1000572903 398
340 3300005841 Ga0068863_100057731 Ga0068863_1000577313 398
341 3300005842 Ga0068858_100002501 Ga0068858_10000250117 398
342 3300005842 Ga0068858_100004194 Ga0068858_1000041945 398
343 3300005842 Ga0068858_100007187 Ga0068858_1000071879 398
344 3300005842 Ga0068858_100011689 Ga0068858_1000116898 398
345 3300005842 Ga0068858_100043176 Ga0068858_1000431763 398
346 3300005842 Ga0068858_100052923 Ga0068858_1000529233 398
347 3300005843 Ga0068860_100005052 Ga0068860_1000050523 398
348 3300005843 Ga0068860_100027918 Ga0068860_1000279181 398
349 3300005843 Ga0068860_100035745 Ga0068860_1000357452 398
350 3300005843 Ga0068860_100066587 Ga0068860_1000665872 398
351 3300005843 Ga0068860_100145270 Ga0068860_1001452702 398
352 3300005844 Ga0068862_100024987 Ga0068862_1000249873 398
353 3300005844 Ga0068862_100031271 Ga0068862_1000312712 398
354 3300005844 Ga0068862_100057454 Ga0068862_1000574542 398
355 3300005844 Ga0068862_100068178 Ga0068862_1000681783 398
356 3300005844 Ga0068862_100173455 Ga0068862_1001734552 398
357 3300005985 Ga0081539_10014654 Ga0081539_100146542 398
358 3300006028 Ga0070717_10012393 Ga0070717_100123931 398
359 3300006173 Ga0070716_100115650 Ga0070716_1001156502 398
360 3300006237 Ga0097621_100059125 Ga0097621_1000591253 398
361 3300006237 Ga0097621_100071552 Ga0097621_1000715524 398
362 3300006358 Ga0068871_100073384 Ga0068871_1000733842 398
363 3300006358 Ga0068871_100118774 Ga0068871_1001187742 398
364 3300006852 Ga0075433_10074006 Ga0075433_100740062 398
365 3300006881 Ga0068865_100000906 Ga0068865_10000090615 398
366 3300006881 Ga0068865_100040177 Ga0068865_1000401771 398
367 3300006931 Ga0097620_100000377 Ga0097620_10000037733 398
368 3300006931 Ga0097620_100088518 Ga0097620_1000885182 398
369 3300006931 Ga0097620_100125348 Ga0097620_1001253482 398
370 3300006931 Ga0097620_100209026 Ga0097620_1002090263 398
371 3300009093 Ga0105240_10283093 Ga0105240_102830932 398
372 3300009093 Ga0105240_10384025 Ga0105240_103840251 398
373 3300009098 Ga0105245_10000999 Ga0105245_1000099914 398
374 3300009098 Ga0105245_10028278 Ga0105245_100282785 398
375 3300009098 Ga0105245_10048004 Ga0105245_100480042 398
376 3300009098 Ga0105245_10068217 Ga0105245_100682172 398
377 3300009148 Ga0105243_10000760 Ga0105243_1000076012 398
378 3300009174 Ga0105241_10106930 Ga0105241_101069302 398
379 3300009174 Ga0105241_10107990 Ga0105241_101079901 398
380 3300009177 Ga0105248_10001134 Ga0105248_1000113418 398
381 3300009177 Ga0105248_10001155 Ga0105248_1000115524 398
382 3300009177 Ga0105248_10001411 Ga0105248_1000141111 398
383 3300009177 Ga0105248_10002104 Ga0105248_1000210422 398
384 3300009177 Ga0105248_10002869 Ga0105248_100028697 398
385 3300009177 Ga0105248_10006429 Ga0105248_1000642911 398
386 3300009177 Ga0105248_10018999 Ga0105248_100189995 398
387 3300009177 Ga0105248_10190955 Ga0105248_101909552 398
388 3300009177 Ga0105248_10300818 Ga0105248_103008181 398
389 3300009177 Ga0105248_10335097 Ga0105248_103350972 398
390 3300009177 Ga0105248_10344580 Ga0105248_103445802 398
391 3300009545 Ga0105237_10005608 Ga0105237_100056083 398
392 3300009545 Ga0105237_10017538 Ga0105237_100175386 398
393 3300009551 Ga0105238_10009274 Ga0105238_1000927410 398
394 3300009551 Ga0105238_10060518 Ga0105238_100605182 398
395 3300009551 Ga0105238_10089791 Ga0105238_100897913 398
396 3300009551 Ga0105238_10172137 Ga0105238_101721373 398
397 3300009553 Ga0105249_10105961 Ga0105249_101059612 398
398 3300010375 Ga0105239_10469098 Ga0105239_104690982 398
399 3300013100 Ga0157373_10010168 Ga0157373_100101683 398
400 3300013100 Ga0157373_10057318 Ga0157373_100573182 398
401 3300013102 Ga0157371_10001324 Ga0157371_1000132410 398
402 3300013102 Ga0157371_10035952 Ga0157371_100359523 398
403 3300013102 Ga0157371_10081025 Ga0157371_100810253 398
404 3300013102 Ga0157371_10081105 Ga0157371_100811053 398
405 3300013102 Ga0157371_10119059 Ga0157371_101190592 398
406 3300013102 Ga0157371_10143590 Ga0157371_101435902 398
407 3300013104 Ga0157370_10023591 Ga0157370_100235915 398
408 3300013104 Ga0157370_10126399 Ga0157370_101263991 398
409 3300013105 Ga0157369_10071524 Ga0157369_100715244 398
410 3300013105 Ga0157369_10083267 Ga0157369_100832672 398
411 3300013105 Ga0157369_10124943 Ga0157369_101249432 398
412 3300013105 Ga0157369_10143452 Ga0157369_101434522 398
413 3300013105 Ga0157369_10247385 Ga0157369_102473851 398
414 3300013296 Ga0157374_10004257 Ga0157374_100042576 398
415 3300013296 Ga0157374_10030163 Ga0157374_100301632 398
416 3300013296 Ga0157374_10116718 Ga0157374_101167183 398
417 3300013297 Ga0157378_10002366 Ga0157378_100023664 398
418 3300013297 Ga0157378_10247061 Ga0157378_102470611 398
419 3300013306 Ga0163162_10000645 Ga0163162_1000064517 398
420 3300013306 Ga0163162_10018201 Ga0163162_100182013 398
421 3300013307 Ga0157372_10013118 Ga0157372_100131184 398
422 3300013307 Ga0157372_10170384 Ga0157372_101703841 398
423 3300013307 Ga0157372_10211251 Ga0157372_102112512 398
424 3300013307 Ga0157372_10268022 Ga0157372_102680222 398
425 3300013308 Ga0157375_10013824 Ga0157375_100138246 398
426 3300013308 Ga0157375_10021664 Ga0157375_100216645 398
427 3300013308 Ga0157375_10185817 Ga0157375_101858172 398
428 3300013308 Ga0157375_10281649 Ga0157375_102816491 398
429 3300014325 Ga0163163_10000058 Ga0163163_1000005861 398
430 3300014325 Ga0163163_10000219 Ga0163163_1000021922 398
431 3300014325 Ga0163163_10083214 Ga0163163_100832143 398
432 3300014326 Ga0157380_10054733 Ga0157380_100547332 398
433 3300014745 Ga0157377_10008557 Ga0157377_100085573 398
434 3300014968 Ga0157379_10001782 Ga0157379_1000178213 398
435 3300014968 Ga0157379_10002142 Ga0157379_1000214213 398
436 3300014968 Ga0157379_10057142 Ga0157379_100571422 398
437 3300014968 Ga0157379_10288321 Ga0157379_102883211 398
438 3300014969 Ga0157376_10143398 Ga0157376_101433983 398
439 3300017792 Ga0163161_10005004 Ga0163161_100050043 398
440 3300017792 Ga0163161_10031062 Ga0163161_100310623 398
441 3300017792 Ga0163161_10107941 Ga0163161_101079412 398
442 3300020082 Ga0206353_11220810 Ga0206353_112208105 398
443 3300021377 Ga0213874_10023184 Ga0213874_100231842 398
444 3300021388 Ga0213875_10002708 Ga0213875_100027087 398
445 3300025230 Ga0209563_100019 Ga0209563_100019480 398
446 3300025245 Ga0207425_1000022 Ga0207425_100002236 398
447 3300025258 Ga0209129_1001190 Ga0209129_10011904 398
448 3300025261 Ga0209233_1000154 Ga0209233_100015491 398
449 3300025263 Ga0209565_1000012 Ga0209565_1000012104 398
450 3300025263 Ga0209565_1000100 Ga0209565_10001004 398
451 3300025273 Ga0209673_1001550 Ga0209673_100155017 398
452 3300025294 Ga0209025_1000326 Ga0209025_100032617 398
453 3300025295 Ga0209564_1009092 Ga0209564_10090924 398
454 3300025297 Ga0209758_1000001 Ga0209758_10000011319 398
455 3300025297 Ga0209758_1000004 Ga0209758_1000004663 398
456 3300025297 Ga0209758_1007537 Ga0209758_10075376 398
457 3300025298 Ga0209050_1000001 Ga0209050_10000012627 398
458 3300025298 Ga0209050_1000026 Ga0209050_100002690 398
459 3300025298 Ga0209050_1005310 Ga0209050_10053103 398
460 3300025298 Ga0209050_1012889 Ga0209050_10128892 398
461 3300025299 Ga0209256_1000012 Ga0209256_1000012295 398
462 3300025302 Ga0207426_1010279 Ga0207426_10102792 398
463 3300025303 Ga0209051_1000303 Ga0209051_100030314 398
464 3300025304 Ga0209257_1000009 Ga0209257_100000990 398
465 3300025304 Ga0209257_1003103 Ga0209257_10031032 398
466 3300025315 Ga0207697_10000069 Ga0207697_1000006910 398
467 3300025315 Ga0207697_10003868 Ga0207697_100038686 398
468 3300025315 Ga0207697_10007569 Ga0207697_100075694 398
469 3300025315 Ga0207697_10021713 Ga0207697_100217133 398
470 3300025321 Ga0207656_10008101 Ga0207656_100081013 398
471 3300025893 Ga0207682_10001708 Ga0207682_100017082 398
472 3300025893 Ga0207682_10001728 Ga0207682_100017287 398
473 3300025893 Ga0207682_10008218 Ga0207682_100082182 398
474 3300025901 Ga0207688_10001449 Ga0207688_1000144910 398
475 3300025901 Ga0207688_10041320 Ga0207688_100413202 398
476 3300025901 Ga0207688_10100321 Ga0207688_101003212 398
477 3300025903 Ga0207680_10003653 Ga0207680_100036535 398
478 3300025903 Ga0207680_10005316 Ga0207680_100053166 398
479 3300025903 Ga0207680_10005472 Ga0207680_100054725 398
480 3300025903 Ga0207680_10013886 Ga0207680_100138863 398
481 3300025903 Ga0207680_10025541 Ga0207680_100255413 398
482 3300025904 Ga0207647_10000409 Ga0207647_100004093 398
483 3300025904 Ga0207647_10001506 Ga0207647_100015069 398
484 3300025904 Ga0207647_10003939 Ga0207647_1000393910 398
485 3300025904 Ga0207647_10005647 Ga0207647_1000564710 398
486 3300025904 Ga0207647_10005861 Ga0207647_1000586110 398
487 3300025904 Ga0207647_10010884 Ga0207647_100108845 398
488 3300025904 Ga0207647_10019759 Ga0207647_100197594 398
489 3300025906 Ga0207699_10144966 Ga0207699_101449662 398
490 3300025907 Ga0207645_10029183 Ga0207645_100291833 398
491 3300025907 Ga0207645_10036726 Ga0207645_100367262 398
492 3300025907 Ga0207645_10056547 Ga0207645_100565472 398
493 3300025907 Ga0207645_10071094 Ga0207645_100710941 398
494 3300025908 Ga0207643_10089020 Ga0207643_100890202 398
495 3300025909 Ga0207705_10000074 Ga0207705_1000007481 398
496 3300025909 Ga0207705_10000743 Ga0207705_1000074314 398
497 3300025909 Ga0207705_10003103 Ga0207705_100031033 398
498 3300025909 Ga0207705_10005576 Ga0207705_100055763 398
499 3300025909 Ga0207705_10006159 Ga0207705_100061595 398
500 3300025909 Ga0207705_10006875 Ga0207705_100068753 398
501 3300025909 Ga0207705_10009217 Ga0207705_100092172 398
502 3300025909 Ga0207705_10009834 Ga0207705_100098347 398
503 3300025909 Ga0207705_10013823 Ga0207705_100138233 398
504 3300025909 Ga0207705_10018553 Ga0207705_100185534 398
505 3300025909 Ga0207705_10082465 Ga0207705_100824651 398
506 3300025909 Ga0207705_10094339 Ga0207705_100943392 398
507 3300025909 Ga0207705_10135174 Ga0207705_101351742 398
508 3300025909 Ga0207705_10148980 Ga0207705_101489802 398
509 3300025909 Ga0207705_10168653 Ga0207705_101686532 398
510 3300025910 Ga0207684_10205521 Ga0207684_102055212 398
511 3300025912 Ga0207707_10049236 Ga0207707_100492363 398
512 3300025912 Ga0207707_10159020 Ga0207707_101590202 398
513 3300025912 Ga0207707_10176691 Ga0207707_101766912 398
514 3300025913 Ga0207695_10081714 Ga0207695_100817143 398
515 3300025915 Ga0207693_10074032 Ga0207693_100740323 398
516 3300025917 Ga0207660_10000062 Ga0207660_1000006225 398
517 3300025917 Ga0207660_10001388 Ga0207660_100013883 398
518 3300025917 Ga0207660_10010629 Ga0207660_100106293 398
519 3300025917 Ga0207660_10017515 Ga0207660_100175155 398
520 3300025917 Ga0207660_10017624 Ga0207660_100176243 398
521 3300025919 Ga0207657_10000126 Ga0207657_1000012655 398
522 3300025919 Ga0207657_10001861 Ga0207657_1000186125 398
523 3300025919 Ga0207657_10002719 Ga0207657_100027196 398
524 3300025919 Ga0207657_10005989 Ga0207657_1000598910 398
525 3300025919 Ga0207657_10006959 Ga0207657_1000695910 398
526 3300025919 Ga0207657_10008170 Ga0207657_1000817012 398
527 3300025919 Ga0207657_10010039 Ga0207657_100100397 398
528 3300025919 Ga0207657_10012372 Ga0207657_100123729 398
529 3300025919 Ga0207657_10013435 Ga0207657_100134352 398
530 3300025919 Ga0207657_10017920 Ga0207657_100179206 398
531 3300025919 Ga0207657_10019353 Ga0207657_100193533 398
532 3300025919 Ga0207657_10113864 Ga0207657_101138642 398
533 3300025919 Ga0207657_10142925 Ga0207657_101429252 398
534 3300025919 Ga0207657_10252443 Ga0207657_102524431 398
535 3300025920 Ga0207649_10002090 Ga0207649_100020908 398
536 3300025920 Ga0207649_10004360 Ga0207649_100043604 398
537 3300025920 Ga0207649_10011806 Ga0207649_100118065 398
538 3300025920 Ga0207649_10017116 Ga0207649_100171165 398
539 3300025920 Ga0207649_10023791 Ga0207649_100237913 398
540 3300025920 Ga0207649_10025348 Ga0207649_100253482 398
541 3300025920 Ga0207649_10074043 Ga0207649_100740432 398
542 3300025920 Ga0207649_10075593 Ga0207649_100755932 398
543 3300025920 Ga0207649_10119108 Ga0207649_101191082 398
544 3300025921 Ga0207652_10035557 Ga0207652_100355573 398
545 3300025921 Ga0207652_10221832 Ga0207652_102218322 398
546 3300025923 Ga0207681_10010471 Ga0207681_100104712 398
547 3300025923 Ga0207681_10041891 Ga0207681_100418914 398
548 3300025924 Ga0207694_10002982 Ga0207694_1000298217 398
549 3300025924 Ga0207694_10004235 Ga0207694_100042357 398
550 3300025925 Ga0207650_10001800 Ga0207650_100018003 398
551 3300025925 Ga0207650_10002425 Ga0207650_100024256 398
552 3300025925 Ga0207650_10016148 Ga0207650_100161484 398
553 3300025925 Ga0207650_10018523 Ga0207650_100185232 398
554 3300025925 Ga0207650_10040083 Ga0207650_100400833 398
555 3300025925 Ga0207650_10046658 Ga0207650_100466583 398
556 3300025925 Ga0207650_10060278 Ga0207650_100602782 398
557 3300025925 Ga0207650_10096080 Ga0207650_100960803 398
558 3300025925 Ga0207650_10214308 Ga0207650_102143082 398
559 3300025926 Ga0207659_10001227 Ga0207659_100012277 398
560 3300025926 Ga0207659_10002381 Ga0207659_100023817 398
561 3300025926 Ga0207659_10035215 Ga0207659_100352153 398
562 3300025926 Ga0207659_10256216 Ga0207659_102562162 398
563 3300025927 Ga0207687_10000687 Ga0207687_100006874 398
564 3300025927 Ga0207687_10017705 Ga0207687_100177052 398
565 3300025927 Ga0207687_10223548 Ga0207687_102235482 398
566 3300025928 Ga0207700_10161606 Ga0207700_101616062 398
567 3300025929 Ga0207664_10043279 Ga0207664_100432793 398
568 3300025929 Ga0207664_10052071 Ga0207664_100520712 398
569 3300025929 Ga0207664_10151491 Ga0207664_101514911 398
570 3300025931 Ga0207644_10001011 Ga0207644_1000101111 398
571 3300025931 Ga0207644_10001939 Ga0207644_1000193915 398
572 3300025931 Ga0207644_10002879 Ga0207644_1000287910 398
573 3300025931 Ga0207644_10004377 Ga0207644_100043776 398
574 3300025931 Ga0207644_10008224 Ga0207644_100082245 398
575 3300025931 Ga0207644_10009448 Ga0207644_100094484 398
576 3300025931 Ga0207644_10010174 Ga0207644_100101745 398
577 3300025931 Ga0207644_10085471 Ga0207644_100854712 398
578 3300025931 Ga0207644_10142554 Ga0207644_101425542 398
579 3300025931 Ga0207644_10151961 Ga0207644_101519612 398
580 3300025932 Ga0207690_10000106 Ga0207690_100001065 398
581 3300025932 Ga0207690_10005414 Ga0207690_100054143 398
582 3300025932 Ga0207690_10006717 Ga0207690_100067173 398
583 3300025932 Ga0207690_10007320 Ga0207690_100073204 398
584 3300025932 Ga0207690_10025831 Ga0207690_100258314 398
585 3300025932 Ga0207690_10039855 Ga0207690_100398553 398
586 3300025932 Ga0207690_10064208 Ga0207690_100642082 398
587 3300025932 Ga0207690_10158516 Ga0207690_101585162 398
588 3300025932 Ga0207690_10174206 Ga0207690_101742062 398
589 3300025933 Ga0207706_10000151 Ga0207706_1000015124 398
590 3300025933 Ga0207706_10000742 Ga0207706_1000074216 398
591 3300025933 Ga0207706_10000815 Ga0207706_1000081519 398
592 3300025933 Ga0207706_10000893 Ga0207706_100008931 398
593 3300025933 Ga0207706_10004043 Ga0207706_100040434 398
594 3300025933 Ga0207706_10004755 Ga0207706_100047553 398
595 3300025933 Ga0207706_10011556 Ga0207706_100115566 398
596 3300025933 Ga0207706_10018841 Ga0207706_100188413 398
597 3300025933 Ga0207706_10106322 Ga0207706_101063223 398
598 3300025933 Ga0207706_10121138 Ga0207706_101211382 398
599 3300025933 Ga0207706_10189432 Ga0207706_101894322 398
600 3300025933 Ga0207706_10271033 Ga0207706_102710332 398
601 3300025934 Ga0207686_10021648 Ga0207686_100216482 398
602 3300025935 Ga0207709_10000031 Ga0207709_1000003167 398
603 3300025936 Ga0207670_10044495 Ga0207670_100444952 398
604 3300025937 Ga0207669_10003676 Ga0207669_100036763 398
605 3300025937 Ga0207669_10007846 Ga0207669_100078462 398
606 3300025937 Ga0207669_10011368 Ga0207669_100113682 398
607 3300025937 Ga0207669_10067080 Ga0207669_100670803 398
608 3300025937 Ga0207669_10069083 Ga0207669_100690832 398
609 3300025937 Ga0207669_10115997 Ga0207669_101159972 398
610 3300025938 Ga0207704_10161157 Ga0207704_101611572 398
611 3300025940 Ga0207691_10000820 Ga0207691_1000082011 398
612 3300025940 Ga0207691_10003021 Ga0207691_1000302113 398
613 3300025940 Ga0207691_10005345 Ga0207691_100053453 398
614 3300025940 Ga0207691_10013135 Ga0207691_100131353 398
615 3300025940 Ga0207691_10016397 Ga0207691_100163972 398
616 3300025940 Ga0207691_10049284 Ga0207691_100492842 398
617 3300025940 Ga0207691_10105143 Ga0207691_101051432 398
618 3300025941 Ga0207711_10000450 Ga0207711_100004504 398
619 3300025941 Ga0207711_10001274 Ga0207711_1000127413 398
620 3300025941 Ga0207711_10002455 Ga0207711_100024557 398
621 3300025941 Ga0207711_10005389 Ga0207711_100053891 398
622 3300025941 Ga0207711_10007890 Ga0207711_100078905 398
623 3300025941 Ga0207711_10015675 Ga0207711_100156754 398
624 3300025941 Ga0207711_10025536 Ga0207711_100255365 398
625 3300025941 Ga0207711_10224805 Ga0207711_102248052 398
626 3300025941 Ga0207711_10237347 Ga0207711_102373472 398
627 3300025942 Ga0207689_10000388 Ga0207689_1000038810 398
628 3300025942 Ga0207689_10077167 Ga0207689_100771674 398
629 3300025944 Ga0207661_10006589 Ga0207661_100065895 398
630 3300025944 Ga0207661_10006764 Ga0207661_100067642 398
631 3300025944 Ga0207661_10027389 Ga0207661_100273893 398
632 3300025945 Ga0207679_10000167 Ga0207679_100001678 398
633 3300025945 Ga0207679_10004636 Ga0207679_100046366 398
634 3300025945 Ga0207679_10016605 Ga0207679_100166055 398
635 3300025945 Ga0207679_10035466 Ga0207679_100354663 398
636 3300025945 Ga0207679_10037171 Ga0207679_100371712 398
637 3300025945 Ga0207679_10056175 Ga0207679_100561753 398
638 3300025945 Ga0207679_10076122 Ga0207679_100761222 398
639 3300025945 Ga0207679_10081055 Ga0207679_100810553 398
640 3300025945 Ga0207679_10095616 Ga0207679_100956161 398
641 3300025949 Ga0207667_10003576 Ga0207667_100035765 398
642 3300025949 Ga0207667_10022584 Ga0207667_100225845 398
643 3300025949 Ga0207667_10051033 Ga0207667_100510331 398
644 3300025949 Ga0207667_10053776 Ga0207667_100537763 398
645 3300025949 Ga0207667_10067383 Ga0207667_100673834 398
646 3300025949 Ga0207667_10080575 Ga0207667_100805753 398
647 3300025949 Ga0207667_10136532 Ga0207667_101365322 398
648 3300025949 Ga0207667_10148246 Ga0207667_101482462 398
649 3300025960 Ga0207651_10003831 Ga0207651_100038314 398
650 3300025960 Ga0207651_10020635 Ga0207651_100206353 398
651 3300025960 Ga0207651_10025830 Ga0207651_100258303 398
652 3300025960 Ga0207651_10029501 Ga0207651_100295014 398
653 3300025960 Ga0207651_10047323 Ga0207651_100473232 398
654 3300025960 Ga0207651_10291324 Ga0207651_102913241 398
655 3300025961 Ga0207712_10002542 Ga0207712_100025423 398
656 3300025961 Ga0207712_10056741 Ga0207712_100567413 398
657 3300025961 Ga0207712_10073355 Ga0207712_100733554 398
658 3300025972 Ga0207668_10000362 Ga0207668_1000036218 398
659 3300025972 Ga0207668_10079800 Ga0207668_100798003 398
660 3300025972 Ga0207668_10096484 Ga0207668_100964842 398
661 3300025972 Ga0207668_10109205 Ga0207668_101092052 398
662 3300025981 Ga0207640_10006679 Ga0207640_100066794 398
663 3300025981 Ga0207640_10021570 Ga0207640_100215703 398
664 3300025981 Ga0207640_10064855 Ga0207640_100648553 398
665 3300025981 Ga0207640_10101642 Ga0207640_101016422 398
666 3300025986 Ga0207658_10001885 Ga0207658_1000188512 398
667 3300025986 Ga0207658_10002626 Ga0207658_100026262 398
668 3300025986 Ga0207658_10005502 Ga0207658_100055024 398
669 3300025986 Ga0207658_10008648 Ga0207658_100086486 398
670 3300025986 Ga0207658_10017392 Ga0207658_100173923 398
671 3300025986 Ga0207658_10083122 Ga0207658_100831222 398
672 3300025986 Ga0207658_10217536 Ga0207658_102175362 398
673 3300026023 Ga0207677_10000890 Ga0207677_1000089011 398
674 3300026023 Ga0207677_10033219 Ga0207677_100332193 398
675 3300026023 Ga0207677_10247075 Ga0207677_102470751 398
676 3300026035 Ga0207703_10001242 Ga0207703_1000124215 398
677 3300026035 Ga0207703_10003017 Ga0207703_1000301712 398
678 3300026035 Ga0207703_10003143 Ga0207703_100031437 398
679 3300026035 Ga0207703_10003171 Ga0207703_100031719 398
680 3300026035 Ga0207703_10034880 Ga0207703_100348803 398
681 3300026035 Ga0207703_10061441 Ga0207703_100614413 398
682 3300026041 Ga0207639_10000509 Ga0207639_1000050916 398
683 3300026041 Ga0207639_10024630 Ga0207639_100246303 398
684 3300026041 Ga0207639_10066528 Ga0207639_100665282 398
685 3300026041 Ga0207639_10075182 Ga0207639_100751822 398
686 3300026067 Ga0207678_10000558 Ga0207678_1000055843 398
687 3300026067 Ga0207678_10004380 Ga0207678_100043808 398
688 3300026067 Ga0207678_10005870 Ga0207678_100058709 398
689 3300026067 Ga0207678_10012999 Ga0207678_100129995 398
690 3300026067 Ga0207678_10015200 Ga0207678_100152006 398
691 3300026067 Ga0207678_10141017 Ga0207678_101410172 398
692 3300026075 Ga0207708_10053110 Ga0207708_100531103 398
693 3300026078 Ga0207702_10002614 Ga0207702_100026148 398
694 3300026078 Ga0207702_10006029 Ga0207702_100060298 398
695 3300026078 Ga0207702_10011636 Ga0207702_100116362 398
696 3300026078 Ga0207702_10017292 Ga0207702_100172922 398
697 3300026088 Ga0207641_10000188 Ga0207641_1000018870 398
698 3300026088 Ga0207641_10013048 Ga0207641_100130483 398
699 3300026088 Ga0207641_10017696 Ga0207641_100176965 398
700 3300026088 Ga0207641_10021113 Ga0207641_100211132 398
701 3300026088 Ga0207641_10028079 Ga0207641_100280792 398
702 3300026088 Ga0207641_10051781 Ga0207641_100517814 398
703 3300026088 Ga0207641_10059168 Ga0207641_100591682 398
704 3300026088 Ga0207641_10062051 Ga0207641_100620513 398
705 3300026088 Ga0207641_10163222 Ga0207641_101632222 398
706 3300026089 Ga0207648_10001699 Ga0207648_1000169913 398
707 3300026089 Ga0207648_10005192 Ga0207648_1000519216 398
708 3300026089 Ga0207648_10005560 Ga0207648_100055603 398
709 3300026089 Ga0207648_10027203 Ga0207648_100272034 398
710 3300026089 Ga0207648_10032335 Ga0207648_100323353 398
711 3300026089 Ga0207648_10087242 Ga0207648_100872422 398
712 3300026095 Ga0207676_10000552 Ga0207676_100005524 398
713 3300026095 Ga0207676_10007129 Ga0207676_100071299 398
714 3300026095 Ga0207676_10007407 Ga0207676_100074076 398
715 3300026095 Ga0207676_10009850 Ga0207676_100098505 398
716 3300026095 Ga0207676_10016612 Ga0207676_100166126 398
717 3300026095 Ga0207676_10148591 Ga0207676_101485911 398
718 3300026116 Ga0207674_10000464 Ga0207674_1000046441 398
719 3300026116 Ga0207674_10001910 Ga0207674_100019105 398
720 3300026116 Ga0207674_10002680 Ga0207674_1000268013 398
721 3300026116 Ga0207674_10002972 Ga0207674_100029723 398
722 3300026116 Ga0207674_10005871 Ga0207674_100058718 398
723 3300026116 Ga0207674_10007257 Ga0207674_100072573 398
724 3300026116 Ga0207674_10014126 Ga0207674_100141268 398
725 3300026116 Ga0207674_10019167 Ga0207674_100191671 398
726 3300026116 Ga0207674_10026101 Ga0207674_100261015 398
727 3300026116 Ga0207674_10036469 Ga0207674_100364694 398
728 3300026116 Ga0207674_10054374 Ga0207674_100543744 398
729 3300026116 Ga0207674_10070503 Ga0207674_100705033 398
730 3300026118 Ga0207675_100000035 Ga0207675_10000003523 398
731 3300026118 Ga0207675_100012446 Ga0207675_1000124467 398
732 3300026118 Ga0207675_100037070 Ga0207675_1000370704 398
733 3300026121 Ga0207683_10000086 Ga0207683_1000008679 398
734 3300026121 Ga0207683_10007896 Ga0207683_100078961 398
735 3300026121 Ga0207683_10014803 Ga0207683_100148032 398
736 3300026121 Ga0207683_10043489 Ga0207683_100434892 398
737 3300026121 Ga0207683_10046328 Ga0207683_100463282 398
738 3300026121 Ga0207683_10133954 Ga0207683_101339542 398
739 3300026142 Ga0207698_10000493 Ga0207698_1000049321 398
740 3300026142 Ga0207698_10004319 Ga0207698_100043192 398
741 3300026142 Ga0207698_10006415 Ga0207698_100064156 398
742 3300026142 Ga0207698_10014487 Ga0207698_100144874 398
743 3300026142 Ga0207698_10018689 Ga0207698_100186893 398
744 3300026142 Ga0207698_10024240 Ga0207698_100242401 398
745 3300026142 Ga0207698_10031286 Ga0207698_100312863 398
746 3300026142 Ga0207698_10056050 Ga0207698_100560503 398
747 3300026142 Ga0207698_10091979 Ga0207698_100919792 398
748 3300026142 Ga0207698_10259070 Ga0207698_102590702 398
749 3300028379 Ga0268266_10000002 Ga0268266_100000022568 398
750 3300028379 Ga0268266_10000133 Ga0268266_1000013321 398
751 3300028379 Ga0268266_10001014 Ga0268266_100010143 398
752 3300028379 Ga0268266_10006563 Ga0268266_100065633 398
753 3300028379 Ga0268266_10010106 Ga0268266_100101064 398
754 3300028379 Ga0268266_10028395 Ga0268266_100283952 398
755 3300028379 Ga0268266_10121433 Ga0268266_101214333 398
756 3300028379 Ga0268266_10358563 Ga0268266_103585632 398
757 3300028380 Ga0268265_10007440 Ga0268265_100074402 398
758 3300028380 Ga0268265_10015414 Ga0268265_100154144 398
759 3300028380 Ga0268265_10019797 Ga0268265_100197973 398
760 3300028380 Ga0268265_10023018 Ga0268265_100230184 398
761 3300028380 Ga0268265_10027288 Ga0268265_100272883 398
762 3300028380 Ga0268265_10040453 Ga0268265_100404534 398
763 3300028380 Ga0268265_10175907 Ga0268265_101759072 398
764 3300028381 Ga0268264_10007437 Ga0268264_100074375 398
765 3300028381 Ga0268264_10007642 Ga0268264_1000764210 398
766 3300028381 Ga0268264_10011662 Ga0268264_100116624 398
767 3300028381 Ga0268264_10018096 Ga0268264_100180966 398
768 3300028381 Ga0268264_10025023 Ga0268264_100250232 398
769 3300028786 Ga0307517_10022129 Ga0307517_100221292 398
770 3300031548 Ga0307408_100020632 Ga0307408_1000206324 398
771 3300031548 Ga0307408_100029269 Ga0307408_1000292693 398
772 3300031548 Ga0307408_100070697 Ga0307408_1000706972 398
773 3300031548 Ga0307408_100072148 Ga0307408_1000721482 398
774 3300031548 Ga0307408_100162247 Ga0307408_1001622472 398
775 3300031616 Ga0307508_10000499 Ga0307508_1000049929 398
776 3300031616 Ga0307508_10077394 Ga0307508_100773943 398
777 3300031731 Ga0307405_10003330 Ga0307405_100033303 398
778 3300031731 Ga0307405_10004515 Ga0307405_100045154 398
779 3300031731 Ga0307405_10012672 Ga0307405_100126723 398
780 3300031731 Ga0307405_10022655 Ga0307405_100226553 398
781 3300031824 Ga0307413_10001408 Ga0307413_100014084 398
782 3300031824 Ga0307413_10001829 Ga0307413_100018293 398
783 3300031824 Ga0307413_10007746 Ga0307413_100077464 398
784 3300031824 Ga0307413_10010843 Ga0307413_100108432 398
785 3300031824 Ga0307413_10010849 Ga0307413_100108494 398
786 3300031824 Ga0307413_10025302 Ga0307413_100253023 398
787 3300031824 Ga0307413_10026568 Ga0307413_100265683 398
788 3300031824 Ga0307413_10031776 Ga0307413_100317762 398
789 3300031852 Ga0307410_10004701 Ga0307410_100047013 398
790 3300031852 Ga0307410_10006694 Ga0307410_100066942 398
791 3300031852 Ga0307410_10011898 Ga0307410_100118985 398
792 3300031852 Ga0307410_10021007 Ga0307410_100210071 398
793 3300031852 Ga0307410_10031807 Ga0307410_100318072 398
794 3300031901 Ga0307406_10003823 Ga0307406_100038234 398
795 3300031901 Ga0307406_10035895 Ga0307406_100358953 398
796 3300031901 Ga0307406_10049302 Ga0307406_100493022 398
797 3300031901 Ga0307406_10061342 Ga0307406_100613422 398
798 3300031901 Ga0307406_10064882 Ga0307406_100648822 398
799 3300031901 Ga0307406_10146227 Ga0307406_101462272 398
800 3300031903 Ga0307407_10003813 Ga0307407_100038133 398
801 3300031903 Ga0307407_10006615 Ga0307407_100066154 398
802 3300031903 Ga0307407_10010480 Ga0307407_100104805 398
803 3300031903 Ga0307407_10035324 Ga0307407_100353243 398
804 3300031903 Ga0307407_10056561 Ga0307407_100565612 398
805 3300031903 Ga0307407_10101143 Ga0307407_101011432 398
806 3300031911 Ga0307412_10002208 Ga0307412_100022082 398
807 3300031911 Ga0307412_10006342 Ga0307412_100063424 398
808 3300031911 Ga0307412_10060561 Ga0307412_100605612 398
809 3300031911 Ga0307412_10103587 Ga0307412_101035871 398
810 3300031911 Ga0307412_10116250 Ga0307412_101162502 398
811 3300031911 Ga0307412_10123251 Ga0307412_101232512 398
812 3300031911 Ga0307412_10210383 Ga0307412_102103832 398
813 3300031995 Ga0307409_100008259 Ga0307409_1000082596 398
814 3300031995 Ga0307409_100017064 Ga0307409_1000170643 398
815 3300031995 Ga0307409_100017250 Ga0307409_1000172504 398
816 3300031995 Ga0307409_100078094 Ga0307409_1000780943 398
817 3300031995 Ga0307409_100101005 Ga0307409_1001010052 398
818 3300031995 Ga0307409_100134166 Ga0307409_1001341662 398
819 3300031995 Ga0307409_100246497 Ga0307409_1002464972 398
820 3300031995 Ga0307409_100249018 Ga0307409_1002490182 398
821 3300031995 Ga0307409_100289491 Ga0307409_1002894912 398
822 3300032002 Ga0307416_100005123 Ga0307416_1000051237 398
823 3300032002 Ga0307416_100006146 Ga0307416_1000061463 398
824 3300032002 Ga0307416_100008540 Ga0307416_1000085407 398
825 3300032002 Ga0307416_100010725 Ga0307416_1000107252 398
826 3300032002 Ga0307416_100010869 Ga0307416_1000108695 398
827 3300032002 Ga0307416_100021440 Ga0307416_1000214404 398
828 3300032002 Ga0307416_100028112 Ga0307416_1000281123 398
829 3300032002 Ga0307416_100037260 Ga0307416_1000372604 398
830 3300032002 Ga0307416_100066153 Ga0307416_1000661532 398
831 3300032002 Ga0307416_100117277 Ga0307416_1001172772 398
832 3300032002 Ga0307416_100237675 Ga0307416_1002376752 398
833 3300032004 Ga0307414_10000856 Ga0307414_100008566 398
834 3300032004 Ga0307414_10011201 Ga0307414_100112012 398
835 3300032004 Ga0307414_10012439 Ga0307414_100124392 398
836 3300032004 Ga0307414_10031891 Ga0307414_100318914 398
837 3300032004 Ga0307414_10031994 Ga0307414_100319943 398
838 3300032004 Ga0307414_10061779 Ga0307414_100617792 398
839 3300032004 Ga0307414_10070226 Ga0307414_100702262 398
840 3300032004 Ga0307414_10083310 Ga0307414_100833103 398
841 3300032004 Ga0307414_10088681 Ga0307414_100886813 398
842 3300032004 Ga0307414_10098416 Ga0307414_100984162 398
843 3300032005 Ga0307411_10003532 Ga0307411_100035322 398
844 3300032005 Ga0307411_10005956 Ga0307411_100059565 398
845 3300032005 Ga0307411_10016186 Ga0307411_100161861 398
846 3300032005 Ga0307411_10039933 Ga0307411_100399331 398
847 3300032005 Ga0307411_10073659 Ga0307411_100736592 398
848 3300032005 Ga0307411_10210302 Ga0307411_102103021 398
849 3300032005 Ga0307411_10252922 Ga0307411_102529221 398
850 3300032126 Ga0307415_100001716 Ga0307415_1000017168 398
851 3300032126 Ga0307415_100004095 Ga0307415_1000040953 398
852 3300032126 Ga0307415_100007285 Ga0307415_1000072856 398
853 3300032126 Ga0307415_100009011 Ga0307415_1000090114 398
854 3300032126 Ga0307415_100043324 Ga0307415_1000433242 398
855 3300032126 Ga0307415_100055691 Ga0307415_1000556913 398
856 3300032126 Ga0307415_100078344 Ga0307415_1000783442 398
857 3300032126 Ga0307415_100103509 Ga0307415_1001035092 398
858 3300033180 Ga0307510_10010060 Ga0307510_100100603 398
859 3300033180 Ga0307510_10110132 Ga0307510_101101323 398
860 3300035111 Ga0373923_0053644 Ga0373923_0053644_326_1525 398
861 3300035171 Ga0373946_0050404 Ga0373946_0050404_379_1578 398
862 3300035172 Ga0373955_0006497 Ga0373955_0006497_2464_3663 398
863 3300035207 Ga0373942_0017415 Ga0373942_0017415_105_1304 398
864 3300035692 Ga0373935_0037248 Ga0373935_0037248_19_1218 398
865 3300035724 Ga0373933_0043740 Ga0373933_0043740_475_1674 398
866 3300037312 Ga0395899_0000641 Ga0395899_0000641_3465_4664 398
867 3300037312 Ga0395899_0005952 Ga0395899_0005952_1104_2303 398
868 3300037312 Ga0395899_0006615 Ga0395899_0006615_3380_4579 398
869 3300037312 Ga0395899_0013219 Ga0395899_0013219_4412_5611 398
870 3300037312 Ga0395899_0018106 Ga0395899_0018106_374_1573 398
871 3300037312 Ga0395899_0019896 Ga0395899_0019896_1042_2241 398
872 3300037312 Ga0395899_0020346 Ga0395899_0020346_513_1712 398
873 3300037312 Ga0395899_0023752 Ga0395899_0023752_1669_2868 398
874 3300037312 Ga0395899_0040536 Ga0395899_0040536_1676_2875 398
875 3300037312 Ga0395899_0069751 Ga0395899_0069751_871_2070 398
876 3300037312 Ga0395899_0084721 Ga0395899_0084721_1042_2241 398
877 3300037312 Ga0395899_0096607 Ga0395899_0096607_670_1869 398
878 3300037418 Ga0395900_0001028 Ga0395900_0001028_7185_8384 398
879 3300037418 Ga0395900_0001928 Ga0395900_0001928_13238_14437 398
880 3300037418 Ga0395900_0003172 Ga0395900_0003172_938_2137 398
881 3300037418 Ga0395900_0004666 Ga0395900_0004666_4792_5991 398
882 3300037418 Ga0395900_0015093 Ga0395900_0015093_3615_4814 398
883 3300037418 Ga0395900_0020769 Ga0395900_0020769_796_1995 398
884 3300037418 Ga0395900_0028291 Ga0395900_0028291_2169_3368 398
885 3300037418 Ga0395900_0032546 Ga0395900_0032546_2655_3854 398
886 3300037418 Ga0395900_0057577 Ga0395900_0057577_2531_3730 398
887 3300037418 Ga0395900_0063348 Ga0395900_0063348_129_1328 398
888 3300037418 Ga0395900_0093689 Ga0395900_0093689_1657_2856 398
889 3300037418 Ga0395900_0097749 Ga0395900_0097749_159_1358 398
890 3300037418 Ga0395900_0100630 Ga0395900_0100630_1644_2843 398
891 3300037418 Ga0395900_0150611 Ga0395900_0150611_1104_2303 398
892 3300037418 Ga0395900_0197339 Ga0395900_0197339_628_1827 398
893 3300037418 Ga0395900_0201804 Ga0395900_0201804_774_1973 398
894 3300037418 Ga0395900_0340968 Ga0395900_0340968_25_1224 398
895 3300037466 Ga0395898_0000245 Ga0395898_0000245_16201_17400 398
896 3300037466 Ga0395898_0004414 Ga0395898_0004414_11336_12535 398
897 3300037466 Ga0395898_0005895 Ga0395898_0005895_9230_10429 398
898 3300037466 Ga0395898_0050800 Ga0395898_0050800_1541_2740 398
899 3300037466 Ga0395898_0056938 Ga0395898_0056938_2148_3347 398
900 3300037466 Ga0395898_0066068 Ga0395898_0066068_1463_2662 398
901 3300037466 Ga0395898_0068169 Ga0395898_0068169_111_1310 398
902 3300037466 Ga0395898_0152847 Ga0395898_0152847_848_2047 398
903 3300037466 Ga0395898_0159423 Ga0395898_0159423_87_1286 398
904 3300037466 Ga0395898_0185651 Ga0395898_0185651_50_1249 398
905 3300037466 Ga0395898_0209294 Ga0395898_0209294_163_1362 398
906 3300037471 Ga0395905_0000006 Ga0395905_0000006_96265_97464 398
907 3300037471 Ga0395905_0001020 Ga0395905_0001020_18573_19772 398
908 3300037471 Ga0395905_0001152 Ga0395905_0001152_18903_20102 398
909 3300037471 Ga0395905_0001766 Ga0395905_0001766_11524_12723 398
910 3300037471 Ga0395905_0004363 Ga0395905_0004363_2389_3588 398
911 3300037471 Ga0395905_0005317 Ga0395905_0005317_2572_3771 398
912 3300037471 Ga0395905_0006534 Ga0395905_0006534_8344_9543 398
913 3300037471 Ga0395905_0015776 Ga0395905_0015776_843_2042 398
914 3300037471 Ga0395905_0021112 Ga0395905_0021112_872_2071 398
915 3300037471 Ga0395905_0023088 Ga0395905_0023088_1668_2867 398
916 3300037471 Ga0395905_0024548 Ga0395905_0024548_1596_2795 398
917 3300037471 Ga0395905_0025599 Ga0395905_0025599_3326_4525 398
918 3300037471 Ga0395905_0027001 Ga0395905_0027001_3070_4269 398
919 3300037471 Ga0395905_0027364 Ga0395905_0027364_3820_5019 398
920 3300037471 Ga0395905_0036942 Ga0395905_0036942_3318_4517 398
921 3300037471 Ga0395905_0037702 Ga0395905_0037702_2172_3371 398
922 3300037471 Ga0395905_0037948 Ga0395905_0037948_2603_3802 398
923 3300037471 Ga0395905_0038845 Ga0395905_0038845_542_1741 398
924 3300037471 Ga0395905_0047477 Ga0395905_0047477_1257_2456 398
925 3300037471 Ga0395905_0058917 Ga0395905_0058917_1885_3084 398
926 3300037471 Ga0395905_0063035 Ga0395905_0063035_2065_3264 398
927 3300037471 Ga0395905_0063624 Ga0395905_0063624_163_1362 398
928 3300037471 Ga0395905_0064287 Ga0395905_0064287_1670_2869 398
929 3300037471 Ga0395905_0067251 Ga0395905_0067251_2132_3331 398
930 3300037471 Ga0395905_0072518 Ga0395905_0072518_166_1365 398
931 3300037471 Ga0395905_0084846 Ga0395905_0084846_826_2022 398
932 3300037471 Ga0395905_0117794 Ga0395905_0117794_321_1520 398
933 3300037471 Ga0395905_0130452 Ga0395905_0130452_135_1334 398
934 3300037471 Ga0395905_0139458 Ga0395905_0139458_674_1873 398
935 3300037471 Ga0395905_0242147 Ga0395905_0242147_451_1650 398
936 3300037853 Ga0436364_1250193 Ga0436364_1250193_15622_16824 398
937 3300038443 Ga0395901_0000243 Ga0395901_0000243_6154_7353 398
938 3300038443 Ga0395901_0002842 Ga0395901_0002842_15382_16581 398
939 3300038443 Ga0395901_0003563 Ga0395901_0003563_12575_13774 398
940 3300038443 Ga0395901_0003794 Ga0395901_0003794_1445_2644 398
941 3300038443 Ga0395901_0005053 Ga0395901_0005053_2828_4027 398
942 3300038443 Ga0395901_0008059 Ga0395901_0008059_183_1382 398
943 3300038443 Ga0395901_0011358 Ga0395901_0011358_2002_3201 398
944 3300038443 Ga0395901_0012473 Ga0395901_0012473_5976_7184 398
945 3300038443 Ga0395901_0020664 Ga0395901_0020664_1327_2526 398
946 3300038443 Ga0395901_0040067 Ga0395901_0040067_3257_4456 398
947 3300038443 Ga0395901_0063585 Ga0395901_0063585_1776_2975 398
948 3300038443 Ga0395901_0124457 Ga0395901_0124457_211_1410 398
949 3300038443 Ga0395901_0124598 Ga0395901_0124598_796_1995 398
950 3300038443 Ga0395901_0128344 Ga0395901_0128344_1450_2649 398
951 3300038443 Ga0395901_0145798 Ga0395901_0145798_687_1886 398
952 3300038443 Ga0395901_0176696 Ga0395901_0176696_993_2192 398
953 3300039437 Ga0436365_0615625 Ga0436365_0615625_7198_8397 398
954 3300039437 Ga0436365_1555050 Ga0436365_1555050_375_1571 398
955 3300039450 Ga0436363_0944510 Ga0436363_0944510_741_1940 398
956 3300041410 Ga0439461_0000932 Ga0439461_0000932_2411_3607 398
957 3300041413 Ga0439465_0000351 Ga0439465_0000351_8095_9291 398
958 3300041997 Ga0439431_0000130 Ga0439431_0000130_7453_8649 398
959 3300042005 Ga0439448_0001434 Ga0439448_0001434_4786_5985 398
960 3300042015 Ga0439462_0001118 Ga0439462_0001118_657_1853 398
961 3300042122 Ga0450920_008758 Ga0450920_008758_77_1276 398
962 3300042157 Ga0439458_0000638 Ga0439458_0000638_7430_8629 398
963 3300042439 Ga0439464_0000723 Ga0439464_0000723_5407_6606 398
964 3300044684 Ga0466966_0046832 Ga0466966_0046832_1217_2416 398
965 3300044684 Ga0466966_0062699 Ga0466966_0062699_611_1813 398
966 3300044684 Ga0466966_0076106 Ga0466966_0076106_292_1497 398
967 3300044684 Ga0466966_0082687 Ga0466966_0082687_579_1778 398
968 3300044693 Ga0466961_0026566 Ga0466961_0026566_1822_3021 398
969 3300044694 Ga0466963_0014751 Ga0466963_0014751_3193_4392 398
970 3300044694 Ga0466963_0025349 Ga0466963_0025349_449_1648 398
971 3300044694 Ga0466963_0038889 Ga0466963_0038889_1740_2939 398
972 3300044694 Ga0466963_0061362 Ga0466963_0061362_580_1779 398
973 3300044694 Ga0466963_0065477 Ga0466963_0065477_1069_2268 398
974 3300044706 Ga0466964_0009075 Ga0466964_0009075_1707_2909 398
975 3300044719 Ga0466971_0030220 Ga0466971_0030220_711_1913 398
976 3300044719 Ga0466971_0051086 Ga0466971_0051086_400_1599 398
977 3300044735 Ga0466968_0016043 Ga0466968_0016043_1700_2902 398
978 3300044765 Ga0466970_0006659 Ga0466970_0006659_1493_2695 398
979 3300044765 Ga0466970_0027530 Ga0466970_0027530_748_1947 398
980 3300044842 Ga0466957_0002002 Ga0466957_0002002_4213_5418 398
981 3300044842 Ga0466957_0014747 Ga0466957_0014747_955_2154 398
982 3300044842 Ga0466957_0023627 Ga0466957_0023627_1286_2488 398
983 3300044842 Ga0466957_0142980 Ga0466957_0142980_244_1446 398
984 3300045049 Ga0466959_0057575 Ga0466959_0057575_1545_2750 398
985 3300045049 Ga0466959_0058451 Ga0466959_0058451_513_1715 398
986 3300045049 Ga0466959_0099430 Ga0466959_0099430_770_1972 398
987 3300045049 Ga0466959_0229494 Ga0466959_0229494_35_1234 398
988 3300045836 Ga0466958_0115627 Ga0466958_0115627_74_1273 398
989 3300045976 Ga0466967_0007458 Ga0466967_0007458_3063_4262 398
990 3300045976 Ga0466967_0012455 Ga0466967_0012455_2090_3295 398
991 3300045976 Ga0466967_0017135 Ga0466967_0017135_1933_3132 398
992 3300045976 Ga0466967_0017312 Ga0466967_0017312_4218_5417 398
993 3300045976 Ga0466967_0026767 Ga0466967_0026767_1106_2308 398
994 3300045976 Ga0466967_0270429 Ga0466967_0270429_192_1391 398
995 3300045976 Ga0466967_0289001 Ga0466967_0289001_47_1246 398
996 3300046452 Ga0495617_025474 Ga0495617_025474_284_1480 398
997 3300046460 Ga0495638_0002342 Ga0495638_0002342_4101_5297 398
998 3300046471 Ga0495650_0000340 Ga0495650_0000340_40139_41335 398
999 3300046500 Ga0495596_0017490 Ga0495596_0017490_548_1744 398
1000 3300046506 Ga0495583_0020766 Ga0495583_0020766_1009_2205 398
1001 3300046507 Ga0495606_0000824 Ga0495606_0000824_23243_24439 398
1002 3300046513 Ga0495616_0024734 Ga0495616_0024734_814_2010 398
1003 3300046522 Ga0495643_0036583 Ga0495643_0036583_701_1897 398
1004 3300046522 Ga0495643_0048920 Ga0495643_0048920_754_1953 398
1005 3300046524 Ga0495648_0029152 Ga0495648_0029152_957_2156 398
1006 3300046537 Ga0495598_0003510 Ga0495598_0003510_341_1540 398
1007 3300046539 Ga0495621_0000183 Ga0495621_0000183_10058_11257 398
1008 3300046539 Ga0495621_0001723 Ga0495621_0001723_2081_3280 398
1009 3300046539 Ga0495621_0027488 Ga0495621_0027488_418_1614 398
1010 3300046558 Ga0495633_0013919 Ga0495633_0013919_2323_3522 398
1011 3300046558 Ga0495633_0036509 Ga0495633_0036509_677_1873 398
1012 3300046616 Ga0495668_0000007 Ga0495668_0000007_220916_222112 398
1013 3300046616 Ga0495668_0029811 Ga0495668_0029811_1374_2573 398
1014 3300046616 Ga0495668_0033221 Ga0495668_0033221_136_1335 398
1015 3300046660 Ga0495625_0001479 Ga0495625_0001479_7890_9086 398
1016 3300046679 Ga0495623_0124397 Ga0495623_0124397_293_1492 398
1017 3300046684 Ga0495669_0000881 Ga0495669_0000881_766_2034 398
1018 3300046684 Ga0495669_0001006 Ga0495669_0001006_7372_8571 398
1019 3300046684 Ga0495669_0001211 Ga0495669_0001211_8411_9682 398
1020 3300046684 Ga0495669_0001860 Ga0495669_0001860_6048_7247 398
1021 3300046684 Ga0495669_0013492 Ga0495669_0013492_1553_2752 398
1022 3300046684 Ga0495669_0038335 Ga0495669_0038335_215_1414 398
1023 3300046691 Ga0495670_0000007 Ga0495670_0000007_173511_174707 398
1024 3300046691 Ga0495670_0003182 Ga0495670_0003182_6215_7414 398
1025 3300046691 Ga0495670_0004459 Ga0495670_0004459_118_1314 398
1026 3300046691 Ga0495670_0005394 Ga0495670_0005394_2762_3961 398
1027 3300046809 Ga0495600_0020783 Ga0495600_0020783_1301_2497 398
1028 3300046810 Ga0495660_0081352 Ga0495660_0081352_397_1668 398
1029 3300047472 Ga0495686_0156578 Ga0495686_0156578_89_1285 398
1030 3300048088 Ga0495602_0033640 Ga0495602_0033640_839_2038 398
1031 3300048903 Ga0496100_0024844 Ga0496100_0024844_411_1610 398
1032 3300048903 Ga0496100_0084526 Ga0496100_0084526_744_1943 398
1033 3300048904 Ga0496101_0015261 Ga0496101_0015261_3111_4310 398
1034 3300048904 Ga0496101_0044620 Ga0496101_0044620_527_1726 398
1035 3300048905 Ga0496102_0020373 Ga0496102_0020373_1593_2792 398
1036 3300048905 Ga0496102_0085007 Ga0496102_0085007_1096_2295 398
1037 3300048905 Ga0496102_0152634 Ga0496102_0152634_826_2022 398
1038 3300048907 Ga0496104_0081963 Ga0496104_0081963_1008_2207 398
1039 3300048909 Ga0496106_0001125 Ga0496106_0001125_12120_13319 398
1040 3300048910 Ga0496107_0002167 Ga0496107_0002167_10789_11988 398
1041 3300048910 Ga0496107_0012994 Ga0496107_0012994_742_1941 398
1042 3300048910 Ga0496107_0020747 Ga0496107_0020747_2170_3369 398
1043 3300048910 Ga0496107_0190499 Ga0496107_0190499_136_1347 398
1044 3300048911 Ga0496108_0001354 Ga0496108_0001354_2780_3979 398
1045 3300048911 Ga0496108_0002672 Ga0496108_0002672_266_1465 398
1046 3300048911 Ga0496108_0029707 Ga0496108_0029707_1557_2756 398
1047 3300048911 Ga0496108_0058688 Ga0496108_0058688_966_2165 398
1048 3300048911 Ga0496108_0064742 Ga0496108_0064742_703_1902 398
1049 3300048912 Ga0496109_0003600 Ga0496109_0003600_9090_10289 398
1050 3300048912 Ga0496109_0020802 Ga0496109_0020802_2892_4091 398
1051 3300048912 Ga0496109_0033166 Ga0496109_0033166_688_1887 398
1052 3300048912 Ga0496109_0055444 Ga0496109_0055444_743_1945 398
1053 3300048913 Ga0496110_0020205 Ga0496110_0020205_2362_3561 398
1054 3300048913 Ga0496110_0032724 Ga0496110_0032724_383_1582 398
1055 3300048913 Ga0496110_0032846 Ga0496110_0032846_510_1709 398
1056 3300048913 Ga0496110_0063110 Ga0496110_0063110_1619_2818 398
1057 3300048914 Ga0496111_0006954 Ga0496111_0006954_3507_4706 398
1058 3300048914 Ga0496111_0017467 Ga0496111_0017467_623_1822 398
1059 3300048914 Ga0496111_0077057 Ga0496111_0077057_109_1308 398
1060 3300048914 Ga0496111_0081316 Ga0496111_0081316_991_2193 398
1061 3300048914 Ga0496111_0111180 Ga0496111_0111180_447_1646 398
1062 3300048915 Ga0496112_0007974 Ga0496112_0007974_6024_7223 398
1063 3300048915 Ga0496112_0012936 Ga0496112_0012936_5596_6795 398
1064 3300048915 Ga0496112_0024097 Ga0496112_0024097_1380_2579 398
1065 3300048915 Ga0496112_0035942 Ga0496112_0035942_960_2159 398
1066 3300048915 Ga0496112_0044416 Ga0496112_0044416_745_1944 398
1067 3300048915 Ga0496112_0060275 Ga0496112_0060275_538_1737 398
1068 3300048915 Ga0496112_0090646 Ga0496112_0090646_1466_2665 398
1069 3300048916 Ga0496113_0032771 Ga0496113_0032771_888_2087 398
1070 3300048916 Ga0496113_0038849 Ga0496113_0038849_458_1657 398
1071 3300048916 Ga0496113_0133064 Ga0496113_0133064_404_1603 398
1072 3300048916 Ga0496113_0204986 Ga0496113_0204986_196_1395 398
1073 3300048917 Ga0496114_0014304 Ga0496114_0014304_2843_4042 398
1074 3300048918 Ga0496115_0000359 Ga0496115_0000359_22983_24179 398
1075 3300048918 Ga0496115_0000865 Ga0496115_0000865_16890_18089 398
1076 3300048924 Ga0496121_0000367 Ga0496121_0000367_70717_71913 398
1077 3300048924 Ga0496121_0050942 Ga0496121_0050942_1433_2629 398
1078 3300048927 Ga0496124_0000186 Ga0496124_0000186_78662_79858 398
1079 3300049573 Ga0501037_0035730 Ga0501037_0035730_1947_3149 398
1080 3300049581 Ga0501047_0215548 Ga0501047_0215548_15_1211 398
1081 3300049586 Ga0501070_0091840 Ga0501070_0091840_1030_2229 398
1082 3300049652 Ga0501202_002050 Ga0501202_002050_402_1601 398
1083 3300049664 Ga0501224_001726 Ga0501224_001726_364_1563 398
1084 3300049679 Ga0501249_003742 Ga0501249_003742_1326_2525 398
1085 3300049765 Ga0501268_003129 Ga0501268_003129_1010_2209 398
1086 3300049823 Ga0501044_0001038 Ga0501044_0001038_8470_9672 398
1087 3300050493 nmdc:mga0k408_68948_c1 nmdc:mga0k408_68948_c1_129_1328 398
1088 3300050496 nmdc:mga07m45_8_c1 nmdc:mga07m45_8_c1_110962_112161 398
1089 3300050511 nmdc:mga08y16_41936_c1 nmdc:mga08y16_41936_c1_3572_4771 398
1090 3300050512 nmdc:mga0n895_410933_c1 nmdc:mga0n895_410933_c1_20_1216 398
1091 3300050515 nmdc:mga0a205_822_c1 nmdc:mga0a205_822_c1_7482_8693 398
1092 3300053087 Ga0500643_013357 Ga0500643_013357_710_1918 398
1093 3300053087 Ga0500643_025968 Ga0500643_025968_82_1278 398
1094 3300053094 Ga0500566_0009109 Ga0500566_0009109_907_2103 398
1095 3300053104 Ga0500556_0009220 Ga0500556_0009220_377_1573 398
1096 3300053139 Ga0500568_0035458 Ga0500568_0035458_168_1364 398
1097 3300053153 Ga0500616_0000737 Ga0500616_0000737_11142_12338 398
1098 3300053153 Ga0500616_0037917 Ga0500616_0037917_457_1653 398
1099 3300053730 Ga0500645_001211 Ga0500645_001211_5298_6494 398
1100 3300053735 Ga0500596_002339 Ga0500596_002339_1393_2589 398
1101 3300053739 Ga0500587_000551 Ga0500587_000551_3384_4580 398
1102 3300061719 Ga0466962_0002076 Ga0466962_0002076_6083_7288 398
1103 3300061719 Ga0466962_0007379 Ga0466962_0007379_2939_4141 398
1104 3300001904 JGI24736J21556_1000204 JGI24736J21556_100020411 399
1105 3300001976 JGI24752J21851_1000134 JGI24752J21851_10001348 399
1106 3300001989 JGI24739J22299_10006823 JGI24739J22299_100068234 399
1107 3300001990 JGI24737J22298_10003238 JGI24737J22298_100032384 399
1108 3300002067 JGI24735J21928_10005661 JGI24735J21928_100056612 399
1109 3300002075 JGI24738J21930_10000187 JGI24738J21930_100001878 399
1110 3300005327 Ga0070658_10036983 Ga0070658_100369833 399
1111 3300005339 Ga0070660_100154216 Ga0070660_1001542162 399
1112 3300005344 Ga0070661_100145762 Ga0070661_1001457622 399
1113 3300005353 Ga0070669_100021670 Ga0070669_1000216703 399
1114 3300005564 Ga0070664_100180013 Ga0070664_1001800132 399
1115 3300005844 Ga0068862_100000595 Ga0068862_10000059522 399
1116 3300006914 Ga0075436_100136922 Ga0075436_1001369221 399
1117 3300009545 Ga0105237_10124915 Ga0105237_101249152 399
1118 3300009553 Ga0105249_10061274 Ga0105249_100612742 399
1119 3300013104 Ga0157370_10040390 Ga0157370_100403902 399
1120 3300013105 Ga0157369_10179370 Ga0157369_101793702 399
1121 3300025904 Ga0207647_10000312 Ga0207647_1000031237 399
1122 3300025911 Ga0207654_10000760 Ga0207654_100007607 399
1123 3300025913 Ga0207695_10002974 Ga0207695_100029742 399
1124 3300025914 Ga0207671_10001453 Ga0207671_1000145322 399
1125 3300025919 Ga0207657_10062177 Ga0207657_100621773 399
1126 3300025924 Ga0207694_10001845 Ga0207694_1000184512 399
1127 3300025933 Ga0207706_10029506 Ga0207706_100295063 399
1128 3300025961 Ga0207712_10150990 Ga0207712_101509901 399
1129 3300025981 Ga0207640_10026683 Ga0207640_100266832 399
1130 3300026041 Ga0207639_10106783 Ga0207639_101067833 399
1131 3300026078 Ga0207702_10001108 Ga0207702_100011083 399
1132 3300027876 Ga0209974_10004727 Ga0209974_100047274 399
1133 3300028380 Ga0268265_10000954 Ga0268265_1000095411 399
1134 3300031731 Ga0307405_10011919 Ga0307405_100119193 399
1135 3300031731 Ga0307405_10028738 Ga0307405_100287383 399
1136 3300031824 Ga0307413_10052678 Ga0307413_100526782 399
1137 3300031824 Ga0307413_10065741 Ga0307413_100657412 399
1138 3300031824 Ga0307413_10126421 Ga0307413_101264212 399
1139 3300031852 Ga0307410_10014908 Ga0307410_100149083 399
1140 3300031903 Ga0307407_10005872 Ga0307407_100058723 399
1141 3300031903 Ga0307407_10036078 Ga0307407_100360782 399
1142 3300031911 Ga0307412_10184934 Ga0307412_101849342 399
1143 3300031911 Ga0307412_10232113 Ga0307412_102321132 399
1144 3300032002 Ga0307416_100021913 Ga0307416_1000219133 399
1145 3300032004 Ga0307414_10010603 Ga0307414_100106034 399
1146 3300032004 Ga0307414_10011701 Ga0307414_100117014 399
1147 3300032004 Ga0307414_10021481 Ga0307414_100214814 399
1148 3300032004 Ga0307414_10066624 Ga0307414_100666242 399
1149 3300032004 Ga0307414_10124984 Ga0307414_101249842 399
1150 3300032005 Ga0307411_10017613 Ga0307411_100176134 399
1151 3300032005 Ga0307411_10019525 Ga0307411_100195252 399
1152 3300032126 Ga0307415_100073719 Ga0307415_1000737193 399
1153 3300032126 Ga0307415_100277142 Ga0307415_1002771421 399
1154 3300046525 Ga0495663_0001232 Ga0495663_0001232_1734_2933 399
1155 3300046684 Ga0495669_0007020 Ga0495669_0007020_1760_2959 399
1156 3300050510 nmdc:mga06r32_4867_c1 nmdc:mga06r32_4867_c1_741_1949 399

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07075

NamZ_N

Exo-beta-N-acetylmuramidase NamZ, N-terminal

1

169

0.97

PF20732

NamZ_C

Exo-beta-N-acetylmuramidase NamZ, C-terminal

172

340

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k05-assembly1.cif.gz_A crystal structure of a duf1343 family protein (bf0371) from bacteroides fragilis nctc 9343 at 1.65 a resolution 0.8756 2 399
4k05-assembly1.cif.gz_A crystal structure of a duf1343 family protein (bf0371) from bacteroides fragilis nctc 9343 at 1.65 a resolution 0.8605 2 399
4jja-assembly1.cif.gz_A crystal structure of a duf1343 family protein (bf0379) from bacteroides fragilis nctc 9343 at 1.30 a resolution 0.8529 2 399
4jja-assembly1.cif.gz_A crystal structure of a duf1343 family protein (bf0379) from bacteroides fragilis nctc 9343 at 1.30 a resolution 0.8372 2 399
4fos-assembly1.cif.gz_A crystal structure of shikimate dehydrogenase (aroe) q237a mutant from helicobacter pylori in complex with shikimate 0.586 9 195
ID Description Score Start End Superfamily
4k05B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein PF07075, DUF1343 0.8797 2 220 3.40.50.12170
4k05B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein PF07075, DUF1343 0.7986 2 220 3.40.50.12170
4k05B02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7692 221 381 3.90.1150.140
4k05B02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.751 221 381 3.90.1150.140
af_Q57865_1_131_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.5917 22 201 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2N2UQ91-F1-model_v4 ribose-phosphate diphosphokinase (EC 2.7.6.1) 0.9732 2 399 GO:0000287
GO:0002189
GO:0004749
GO:0005524
GO:0005737
GO:0006015
GO:0006164
GO:0009156
GO:0016301
AF-A0A7Y4XVE3-F1-model_v4 DUF1343 domain-containing protein 0.9712 1 200 GO:0033922
AF-A0A2N2UQ91-F1-model_v4 ribose-phosphate diphosphokinase (EC 2.7.6.1) 0.9684 2 399 GO:0000287
GO:0002189
GO:0004749
GO:0005524
GO:0005737
GO:0006015
GO:0006164
GO:0009156
GO:0016301
AF-A0A351A0J2-F1-model_v4 DUF1343 domain-containing protein 0.9676 2 319 GO:0033922
AF-A0A7V8ZMX7-F1-model_v4 DUF1343 domain-containing protein 0.9672 1 240 GO:0033922

Feature Viewer

pLDDT pTM Quality
85.77 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map