F490918

General Info

Members Datasets Scaffolds Average Seq Length
1155 613 2310 104

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10173674|Ga0081455_101736742
Length 111
Sequence MTSPLEQKKIKIAGPSVVTANRTWDGAVIYRTAAKDWSTDLSQAAIVRVNDDARALLAESVADDVGAIGAYIAPVEVSDDGKIKPGNLREQIRRSGVTIDLPTQIGLPVQV

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
91 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
125 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
126 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
127 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
128 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300023224 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 Metagenome Unclassified
131 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
132 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
203 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
204 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
205 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
206 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
212 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
213 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
214 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
233 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
234 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
238 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
239 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
256 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
257 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
258 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
259 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
260 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
261 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
262 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
263 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
264 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
265 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
266 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
267 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
268 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
269 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
270 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
271 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
272 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
273 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
274 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
275 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
276 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
277 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
278 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
279 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
280 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
281 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
282 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
296 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
297 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
298 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
299 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
300 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
301 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
302 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
303 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
304 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
305 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
311 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
312 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
313 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
316 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
317 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
318 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
319 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
320 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
321 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
322 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
325 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
326 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
327 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
328 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
329 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
330 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
331 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
332 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
333 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
334 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
335 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
339 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
340 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
341 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
342 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
343 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
344 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
345 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
346 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
347 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
348 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
349 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
350 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
351 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
352 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
353 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
354 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
355 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
356 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
357 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
358 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
359 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
360 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
361 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
362 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
363 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
364 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
365 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
366 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
367 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
368 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
369 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
370 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
371 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
372 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
373 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
374 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
375 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
376 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
377 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
378 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
379 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
380 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
381 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
382 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
383 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
384 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
385 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
386 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
387 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
388 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
389 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
390 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
391 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
392 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
393 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
394 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
395 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
400 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
401 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
402 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
403 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
404 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
405 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
406 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
407 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
408 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
409 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
410 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
411 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
412 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
413 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
414 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
415 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
416 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
417 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
418 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
419 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
420 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
421 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
422 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
423 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
424 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
425 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
426 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
427 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
428 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
429 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
430 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
431 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
432 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
433 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
434 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
435 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
436 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
437 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
438 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
439 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
440 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
441 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
442 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
443 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
444 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
445 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
446 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
447 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
448 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
449 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
450 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
451 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
452 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
453 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
454 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
455 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
456 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
457 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
458 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
459 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
460 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
461 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
462 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
463 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
464 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
465 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
466 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
467 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
468 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
469 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
470 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
471 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
472 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
473 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
474 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
475 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
476 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
477 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
478 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
479 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
480 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
481 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
482 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
483 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
484 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
485 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
486 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
487 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
488 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
489 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
490 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
491 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
492 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
493 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
494 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
495 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
496 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
497 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
498 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
499 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
500 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
501 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
502 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
503 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
504 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
505 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
506 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
507 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
508 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
509 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
510 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
511 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
512 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
513 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
514 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
515 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
516 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
517 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
518 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
519 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
520 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
521 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
522 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
523 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
524 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
525 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
526 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
527 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
528 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
529 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
530 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
531 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
532 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
533 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
534 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
535 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
536 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
537 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
538 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
539 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
540 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
541 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
542 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
543 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
544 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
545 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
546 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
547 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
548 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
549 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
550 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
551 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
552 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
553 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
554 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
555 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
556 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
557 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
558 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
559 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
560 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
561 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
562 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
563 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
564 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
565 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
566 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
567 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
568 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
569 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
570 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
571 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
572 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
573 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
574 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
575 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
576 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
577 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
578 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
579 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
580 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
581 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
582 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
583 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
584 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
585 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
586 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
587 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
588 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
589 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
590 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
591 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
592 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
593 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
594 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
595 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
596 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
597 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
598 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
599 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
600 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
601 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
602 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
603 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
604 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
605 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
606 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
607 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
608 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
609 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
610 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
611 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
612 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
613 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.54
Metatranscriptomes 0.17
Isolates 14.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.93
Nodule 12.29
Rhizoplane 7.36
Rhizosphere 56.36
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10173674 3300005937 Bacteria 1638
2 LJQas_1013109 3300000549 Bacteria 977
3 JGI24737J22298_10006499 3300001990 Bacteria 3991
4 JGI24735J21928_10019922 3300002067 Bacteria 2059
5 JGI24735J21928_10212446 3300002067 Bacteria 562
6 JGI24738J21930_10019905 3300002075 Bacteria 1397
7 JGI24738J21930_10124708 3300002075 Bacteria 561
8 JGI24033J26618_1053361 3300002155 Bacteria 584
9 JGI25153J46596_10001390 3300003215 Bacteria 14494
10 JGI25153J46596_10002696 3300003215 Bacteria 10122
11 JGI25153J46596_10003859 3300003215 Bacteria 8243
12 JGI25153J46596_10020441 3300003215 Bacteria 2503
13 JGI25160J50197_1002392 3300003354 Bacteria 8749
14 JGI25404J52841_10033269 3300003659 Bacteria 1099
15 Ga0055539_1001720 3300003752 Bacteria 3833
16 Ga0055529_1027473 3300003763 Bacteria 701
17 Ga0055526_1104461 3300003771 Bacteria 515
18 Ga0055531_10003707 3300003794 Bacteria 9611
19 Ga0055543_1079601 3300004625 Bacteria 506
20 Ga0065165_1003638 3300005262 Bacteria 10535
21 Ga0065165_1024512 3300005262 Bacteria 2024
22 Ga0065712_10536602 3300005290 Bacteria 626
23 Ga0070658_10878140 3300005327 Bacteria 779
24 Ga0070676_11056465 3300005328 Bacteria 612
25 Ga0070676_11313137 3300005328 Bacteria 553
26 Ga0070683_100025330 3300005329 Bacteria 5327
27 Ga0070683_100865744 3300005329 Bacteria 867
28 Ga0070670_100055651 3300005331 Bacteria 3396
29 Ga0068869_100163644 3300005334 Bacteria 1733
30 Ga0068869_100350804 3300005334 Bacteria 1203
31 Ga0070666_10181967 3300005335 Bacteria 1474
32 Ga0070666_10331454 3300005335 Bacteria 1087
33 Ga0070666_10422991 3300005335 Bacteria 960
34 Ga0070680_100028590 3300005336 Bacteria 4472
35 Ga0070680_100363103 3300005336 Bacteria 1232
36 Ga0070682_100218969 3300005337 Bacteria 1353
37 Ga0070682_100652971 3300005337 Bacteria 838
38 Ga0070682_101076986 3300005337 Bacteria 672
39 Ga0068868_100017643 3300005338 Bacteria 5322
40 Ga0068868_100740246 3300005338 Bacteria 882
41 Ga0068868_100947948 3300005338 Bacteria 785
42 Ga0070660_100201906 3300005339 Bacteria 1613
43 Ga0070660_100935065 3300005339 Bacteria 732
44 Ga0070689_100499769 3300005340 Bacteria 1042
45 Ga0070661_100416118 3300005344 Bacteria 1065
46 Ga0070661_100512360 3300005344 Bacteria 961
47 Ga0070661_100981450 3300005344 Bacteria 700
48 Ga0070692_10359834 3300005345 Bacteria 907
49 Ga0070668_100084326 3300005347 Bacteria 2495
50 Ga0070668_100211842 3300005347 Bacteria 1594
51 Ga0070668_100685543 3300005347 Bacteria 903
52 Ga0070668_101426098 3300005347 Bacteria 632
53 Ga0070668_102082679 3300005347 Bacteria 524
54 Ga0070669_100466617 3300005353 Bacteria 1043
55 Ga0070669_100566424 3300005353 Bacteria 949
56 Ga0070675_100514555 3300005354 Bacteria 1080
57 Ga0070675_101670178 3300005354 Bacteria 588
58 Ga0070675_101795717 3300005354 Bacteria 566
59 Ga0070675_102169297 3300005354 Bacteria 512
60 Ga0070671_100642425 3300005355 Bacteria 918
61 Ga0070674_100782225 3300005356 Bacteria 823
62 Ga0070673_101477395 3300005364 Bacteria 641
63 Ga0070673_102113052 3300005364 Bacteria 535
64 Ga0070667_100524191 3300005367 Bacteria 1088
65 Ga0070667_100845781 3300005367 Bacteria 851
66 Ga0070667_100941738 3300005367 Bacteria 805
67 Ga0070709_10000375 3300005434 Bacteria 27523
68 Ga0070709_10009548 3300005434 Bacteria 5354
69 Ga0070714_100047429 3300005435 Bacteria 3649
70 Ga0070714_100161943 3300005435 Bacteria 2025
71 Ga0070714_101989943 3300005435 Bacteria 567
72 Ga0070713_100061380 3300005436 Bacteria 3144
73 Ga0070713_100108259 3300005436 Bacteria 2419
74 Ga0070713_100159215 3300005436 Bacteria 2014
75 Ga0070713_100179267 3300005436 Bacteria 1903
76 Ga0070710_10000275 3300005437 Bacteria 24270
77 Ga0070710_10010323 3300005437 Bacteria 4586
78 Ga0070710_10048124 3300005437 Bacteria 2381
79 Ga0070710_11042584 3300005437 Bacteria 598
80 Ga0070701_10215404 3300005438 Bacteria 1143
81 Ga0070701_10611640 3300005438 Bacteria 723
82 Ga0070711_100006414 3300005439 Bacteria 7094
83 Ga0070711_100012405 3300005439 Bacteria 5323
84 Ga0070711_100031039 3300005439 Bacteria 3543
85 Ga0070700_100632785 3300005441 Bacteria 842
86 Ga0070663_100056230 3300005455 Bacteria 2819
87 Ga0070663_100847116 3300005455 Bacteria 787
88 Ga0070663_100964815 3300005455 Bacteria 739
89 Ga0070663_101204035 3300005455 Bacteria 666
90 Ga0070663_101398573 3300005455 Bacteria 620
91 Ga0070663_101816014 3300005455 Bacteria 547
92 Ga0070678_102194918 3300005456 Bacteria 524
93 Ga0070662_100262735 3300005457 Bacteria 1391
94 Ga0070662_100286317 3300005457 Bacteria 1335
95 Ga0070662_100835789 3300005457 Bacteria 784
96 Ga0070681_10077381 3300005458 Bacteria 3285
97 Ga0070681_10083478 3300005458 Bacteria 3148
98 Ga0068867_101388401 3300005459 Bacteria 651
99 Ga0070685_11173029 3300005466 Bacteria 583
100 Ga0070685_11288246 3300005466 Bacteria 558
101 Ga0070679_100039917 3300005530 Bacteria 4666
102 Ga0070679_100434699 3300005530 Bacteria 1257
103 Ga0070679_101406501 3300005530 Bacteria 644
104 Ga0070684_100012084 3300005535 Bacteria 6904
105 Ga0070684_100633947 3300005535 Bacteria 994
106 Ga0068853_100145219 3300005539 Bacteria 2132
107 Ga0068853_100184016 3300005539 Bacteria 1895
108 Ga0068853_100222490 3300005539 Bacteria 1724
109 Ga0068853_100411183 3300005539 Bacteria 1268
110 Ga0068853_100581536 3300005539 Bacteria 1063
111 Ga0068853_100888133 3300005539 Bacteria 856
112 Ga0070672_100508626 3300005543 Bacteria 1043
113 Ga0070686_101442585 3300005544 Bacteria 579
114 Ga0070693_100137993 3300005547 Bacteria 1531
115 Ga0070693_100560893 3300005547 Bacteria 819
116 Ga0070665_100043079 3300005548 Bacteria 4537
117 Ga0070665_100076636 3300005548 Bacteria 3350
118 Ga0070665_100144262 3300005548 Bacteria 2384
119 Ga0070665_101269524 3300005548 Bacteria 747
120 Ga0068855_100022264 3300005563 Bacteria 7593
121 Ga0068855_100032650 3300005563 Bacteria 6215
122 Ga0068855_100504151 3300005563 Bacteria 1315
123 Ga0068855_100905337 3300005563 Bacteria 932
124 Ga0068855_101958389 3300005563 Bacteria 593
125 Ga0070664_101304144 3300005564 Bacteria 686
126 Ga0070664_101518657 3300005564 Bacteria 634
127 Ga0068857_100015131 3300005577 Bacteria 6734
128 Ga0068857_101653182 3300005577 Bacteria 626
129 Ga0068857_102032301 3300005577 Bacteria 564
130 Ga0068854_100094223 3300005578 Bacteria 2233
131 Ga0068854_100787893 3300005578 Bacteria 828
132 Ga0068854_100919635 3300005578 Bacteria 770
133 Ga0068854_101347315 3300005578 Bacteria 644
134 Ga0068854_101783430 3300005578 Bacteria 564
135 Ga0068856_100051263 3300005614 Bacteria 4069
136 Ga0068856_100248794 3300005614 Bacteria 1793
137 Ga0068856_101074074 3300005614 Bacteria 823
138 Ga0068856_101079199 3300005614 Bacteria 820
139 Ga0068852_100141894 3300005616 Bacteria 2224
140 Ga0068852_100335389 3300005616 Bacteria 1472
141 Ga0068852_100739188 3300005616 Bacteria 996
142 Ga0068852_100947886 3300005616 Bacteria 879
143 Ga0068852_101578735 3300005616 Bacteria 678
144 Ga0068859_100716532 3300005617 Bacteria 1091
145 Ga0068864_100751494 3300005618 Bacteria 956
146 Ga0068866_10367814 3300005718 Bacteria 918
147 Ga0068866_10908821 3300005718 Bacteria 620
148 Ga0068861_100388885 3300005719 Bacteria 1234
149 Ga0068861_102233186 3300005719 Bacteria 549
150 Ga0068851_11044641 3300005834 Bacteria 517
151 Ga0068863_101206429 3300005841 Bacteria 763
152 Ga0068863_102438177 3300005841 Bacteria 533
153 Ga0068858_100278870 3300005842 Bacteria 1591
154 Ga0068858_101166827 3300005842 Bacteria 757
155 Ga0068858_101672213 3300005842 Bacteria 628
156 Ga0068858_102468586 3300005842 Bacteria 513
157 Ga0068860_101430726 3300005843 Bacteria 713
158 Ga0068860_101501236 3300005843 Bacteria 695
159 Ga0068862_100541426 3300005844 Bacteria 1110
160 Ga0068862_100592134 3300005844 Bacteria 1064
161 Ga0068862_100593488 3300005844 Bacteria 1062
162 Ga0081540_1001275 3300005983 Bacteria 21968
163 Ga0081540_1023738 3300005983 Bacteria 3577
164 Ga0081539_10020815 3300005985 Bacteria 4411
165 Ga0081539_10230483 3300005985 Bacteria 836
166 Ga0070717_10061154 3300006028 Bacteria 3120
167 Ga0070717_10324252 3300006028 Bacteria 1373
168 Ga0070717_10756156 3300006028 Bacteria 884
169 Ga0075365_10120219 3300006038 Bacteria 1811
170 Ga0075365_10148633 3300006038 Bacteria 1629
171 Ga0075365_10150418 3300006038 Bacteria 1619
172 Ga0075365_10154768 3300006038 Bacteria 1595
173 Ga0075365_10536388 3300006038 Bacteria 827
174 Ga0075368_10000838 3300006042 Bacteria 9496
175 Ga0075368_10001639 3300006042 Bacteria 7182
176 Ga0075368_10170099 3300006042 Bacteria 916
177 Ga0075363_100009411 3300006048 Bacteria 4593
178 Ga0075363_100302276 3300006048 Bacteria 929
179 Ga0075363_100553947 3300006048 Bacteria 686
180 Ga0075363_100982277 3300006048 Bacteria 520
181 Ga0075364_10128150 3300006051 Bacteria 1702
182 Ga0075364_10485675 3300006051 Bacteria 844
183 Ga0075364_10742082 3300006051 Bacteria 670
184 Ga0070715_10063040 3300006163 Bacteria 1633
185 Ga0070716_100012144 3300006173 Bacteria 4357
186 Ga0070716_101088412 3300006173 Bacteria 637
187 Ga0070712_100079181 3300006175 Bacteria 2374
188 Ga0070712_100107849 3300006175 Bacteria 2073
189 Ga0070712_100121246 3300006175 Bacteria 1967
190 Ga0070712_100202978 3300006175 Bacteria 1558
191 Ga0070712_101014354 3300006175 Bacteria 718
192 Ga0075362_10042194 3300006177 Bacteria 2015
193 Ga0075362_10150176 3300006177 Bacteria 1117
194 Ga0075362_10167070 3300006177 Bacteria 1061
195 Ga0075367_10077749 3300006178 Bacteria 2003
196 Ga0075367_10129471 3300006178 Bacteria 1559
197 Ga0075367_10172200 3300006178 Bacteria 1348
198 Ga0075367_10346154 3300006178 Bacteria 938
199 Ga0075367_10746461 3300006178 Bacteria 623
200 Ga0075369_10015750 3300006186 Bacteria 3039
201 Ga0075369_10077278 3300006186 Bacteria 1472
202 Ga0075369_10104856 3300006186 Bacteria 1270
203 Ga0075369_10109164 3300006186 Bacteria 1246
204 Ga0075366_10009092 3300006195 Bacteria 5540
205 Ga0075366_10084812 3300006195 Bacteria 1894
206 Ga0075366_10366157 3300006195 Bacteria 885
207 Ga0097621_100473854 3300006237 Bacteria 1131
208 Ga0075370_10083443 3300006353 Bacteria 1838
209 Ga0075370_10099134 3300006353 Bacteria 1685
210 Ga0075370_10188880 3300006353 Bacteria 1213
211 Ga0075370_10217076 3300006353 Bacteria 1130
212 Ga0075370_10518817 3300006353 Bacteria 720
213 Ga0075370_10687856 3300006353 Bacteria 622
214 Ga0075370_10792221 3300006353 Bacteria 578
215 Ga0068865_100106352 3300006881 Bacteria 2062
216 Ga0068865_100134925 3300006881 Bacteria 1853
217 Ga0068865_100486408 3300006881 Bacteria 1027
218 Ga0068865_101049462 3300006881 Bacteria 716
219 Ga0068865_101634796 3300006881 Bacteria 580
220 Ga0097620_100716527 3300006931 Bacteria 1091
221 Ga0099825_1035725 3300006941 Bacteria 1757
222 Ga0099823_1033450 3300006944 Bacteria 4128
223 Ga0099794_10310580 3300007265 Bacteria 817
224 Ga0099795_10420302 3300007788 Bacteria 611
225 Ga0105240_10005310 3300009093 Bacteria 19223
226 Ga0105240_10029763 3300009093 Bacteria 7106
227 Ga0105240_10092127 3300009093 Bacteria 3701
228 Ga0105240_11067433 3300009093 Bacteria 861
229 Ga0111539_10419589 3300009094 Bacteria 1558
230 Ga0105245_10144713 3300009098 Bacteria 2242
231 Ga0105245_10453572 3300009098 Bacteria 1291
232 Ga0105245_10869902 3300009098 Bacteria 942
233 Ga0105245_11055864 3300009098 Bacteria 858
234 Ga0105247_10107152 3300009101 Bacteria 1794
235 Ga0105247_11708364 3300009101 Bacteria 521
236 Ga0105243_10274852 3300009148 Bacteria 1514
237 Ga0105243_11121110 3300009148 Bacteria 796
238 Ga0105243_11372652 3300009148 Bacteria 726
239 Ga0105243_11716263 3300009148 Bacteria 657
240 Ga0105243_11874069 3300009148 Bacteria 632
241 Ga0105243_12640293 3300009148 Bacteria 542
242 Ga0105241_10173482 3300009174 Bacteria 1783
243 Ga0105241_10918119 3300009174 Bacteria 814
244 Ga0105241_11059685 3300009174 Bacteria 761
245 Ga0105241_12288879 3300009174 Bacteria 537
246 Ga0105242_10291632 3300009176 Bacteria 1486
247 Ga0105248_10184583 3300009177 Bacteria 2350
248 Ga0105248_11036153 3300009177 Bacteria 927
249 Ga0105248_11617383 3300009177 Bacteria 734
250 Ga0105248_11934715 3300009177 Bacteria 669
251 Ga0105248_11953603 3300009177 Bacteria 666
252 Ga0105237_10052970 3300009545 Bacteria 4071
253 Ga0105237_10055134 3300009545 Bacteria 3982
254 Ga0105237_10115363 3300009545 Bacteria 2679
255 Ga0105237_10380433 3300009545 Bacteria 1416
256 Ga0105237_11676315 3300009545 Bacteria 643
257 Ga0105237_11734707 3300009545 Bacteria 632
258 Ga0105238_10096450 3300009551 Bacteria 2943
259 Ga0105238_11991246 3300009551 Bacteria 614
260 Ga0105249_10350366 3300009553 Bacteria 1496
261 Ga0105249_10990339 3300009553 Bacteria 909
262 Ga0105249_11143085 3300009553 Bacteria 849
263 Ga0105249_11851787 3300009553 Bacteria 676
264 Ga0099796_10022044 3300010159 Bacteria 1971
265 Ga0099796_10067417 3300010159 Bacteria 1283
266 Ga0099796_10255364 3300010159 Bacteria 729
267 Ga0105239_10019285 3300010375 Bacteria 7532
268 Ga0105239_10271510 3300010375 Bacteria 1907
269 Ga0105239_10527690 3300010375 Bacteria 1343
270 Ga0105239_10715804 3300010375 Bacteria 1145
271 Ga0105239_11314257 3300010375 Bacteria 834
272 Ga0105239_11528042 3300010375 Bacteria 772
273 Ga0105239_11724026 3300010375 Bacteria 725
274 Ga0105239_12171892 3300010375 Bacteria 645
275 Ga0105239_13250119 3300010375 Bacteria 529
276 Ga0105246_10045131 3300011119 Bacteria 2999
277 Ga0105246_10790338 3300011119 Bacteria 841
278 Ga0105246_11405721 3300011119 Bacteria 651
279 Ga0105246_11633627 3300011119 Bacteria 610
280 Ga0157370_11749053 3300013104 Bacteria 558
281 Ga0157369_10087077 3300013105 Bacteria 3335
282 Ga0157369_10922613 3300013105 Bacteria 895
283 Ga0157374_10624053 3300013296 Bacteria 1089
284 Ga0157374_10999916 3300013296 Bacteria 855
285 Ga0157378_10023539 3300013297 Bacteria 5418
286 Ga0157378_10551974 3300013297 Bacteria 1157
287 Ga0163162_10101682 3300013306 Bacteria 2967
288 Ga0163162_10456872 3300013306 Bacteria 1409
289 Ga0163162_10760946 3300013306 Bacteria 1087
290 Ga0163162_10886257 3300013306 Bacteria 1006
291 Ga0163162_11106090 3300013306 Bacteria 898
292 Ga0163162_11619985 3300013306 Bacteria 738
293 Ga0157372_10147969 3300013307 Bacteria 2709
294 Ga0157375_10415757 3300013308 Bacteria 1511
295 Ga0163163_10171873 3300014325 Bacteria 2214
296 Ga0163163_10179618 3300014325 Bacteria 2163
297 Ga0163163_10417607 3300014325 Bacteria 1400
298 Ga0163163_11592400 3300014325 Bacteria 714
299 Ga0157380_11622522 3300014326 Bacteria 703
300 Ga0182008_10367720 3300014497 Bacteria 766
301 Ga0157379_10075681 3300014968 Bacteria 3014
302 Ga0157379_10946410 3300014968 Bacteria 819
303 Ga0157376_10901405 3300014969 Bacteria 902
304 Ga0182005_1148057 3300015265 Bacteria 682
305 Ga0163161_10401870 3300017792 Bacteria 1099
306 Ga0163161_10546167 3300017792 Bacteria 949
307 Ga0163161_12041113 3300017792 Bacteria 510
308 Ga0206356_11101795 3300020070 Bacteria 711
309 Ga0206350_11568595 3300020080 Bacteria 794
310 Ga0214544_1000011 3300021320 Bacteria 262952
311 Ga0214542_1000009 3300021321 Bacteria 262861
312 Ga0214545_1000007 3300021324 Bacteria 262984
313 Ga0214543_1000020 3300021327 Bacteria 262861
314 Ga0213873_10007009 3300021358 Bacteria 2241
315 Ga0213876_10001785 3300021384 Bacteria 13035
316 Ga0213876_10271545 3300021384 Bacteria 901
317 Ga0213876_10793367 3300021384 Bacteria 504
318 Ga0224575_103461 3300023224 Bacteria 855
319 Ga0228598_1021839 3300024227 Bacteria 1260
320 Ga0209563_100662 3300025230 Bacteria 10988
321 Ga0209677_102831 3300025253 Bacteria 6134
322 Ga0209148_1001000 3300025254 Bacteria 18034
323 Ga0209455_1014091 3300025272 Bacteria 1825
324 Ga0209455_1052029 3300025272 Bacteria 569
325 Ga0209673_1057707 3300025273 Bacteria 987
326 Ga0209564_1002110 3300025295 Bacteria 16929
327 Ga0209564_1074784 3300025295 Bacteria 687
328 Ga0209758_1000206 3300025297 Bacteria 130177
329 Ga0209758_1001109 3300025297 Bacteria 34763
330 Ga0209758_1001267 3300025297 Bacteria 31294
331 Ga0209758_1001347 3300025297 Bacteria 29637
332 Ga0209758_1003015 3300025297 Bacteria 16099
333 Ga0209758_1046625 3300025297 Bacteria 1560
334 Ga0209758_1051293 3300025297 Bacteria 1437
335 Ga0209758_1066050 3300025297 Bacteria 1164
336 Ga0209256_1009375 3300025299 Bacteria 4306
337 Ga0209256_1025126 3300025299 Bacteria 1741
338 Ga0209256_1040740 3300025299 Bacteria 1184
339 Ga0209256_1092325 3300025299 Bacteria 641
340 Ga0207426_1000799 3300025302 Bacteria 34123
341 Ga0207426_1001011 3300025302 Bacteria 27245
342 Ga0207426_1016058 3300025302 Bacteria 2699
343 Ga0207426_1062557 3300025302 Bacteria 1065
344 Ga0209051_1057036 3300025303 Bacteria 1254
345 Ga0209257_1000394 3300025304 Bacteria 86654
346 Ga0209257_1073716 3300025304 Bacteria 893
347 Ga0207697_10040925 3300025315 Bacteria 1903
348 Ga0207697_10516397 3300025315 Bacteria 527
349 Ga0207656_10144332 3300025321 Bacteria 1124
350 Ga0207692_10000229 3300025898 Bacteria 19004
351 Ga0207692_10017900 3300025898 Bacteria 3170
352 Ga0207692_10022882 3300025898 Bacteria 2882
353 Ga0207642_10488223 3300025899 Bacteria 752
354 Ga0207642_11101092 3300025899 Bacteria 514
355 Ga0207710_10270099 3300025900 Bacteria 854
356 Ga0207688_10080948 3300025901 Bacteria 1854
357 Ga0207688_10085817 3300025901 Bacteria 1803
358 Ga0207680_10332906 3300025903 Bacteria 1064
359 Ga0207647_10000666 3300025904 Bacteria 26819
360 Ga0207647_10030786 3300025904 Bacteria 3459
361 Ga0207647_10436727 3300025904 Bacteria 735
362 Ga0207647_10646773 3300025904 Bacteria 580
363 Ga0207685_10383428 3300025905 Bacteria 717
364 Ga0207699_10000242 3300025906 Bacteria 30591
365 Ga0207699_10028744 3300025906 Bacteria 3093
366 Ga0207699_10992302 3300025906 Bacteria 621
367 Ga0207645_10286533 3300025907 Bacteria 1095
368 Ga0207643_10139004 3300025908 Bacteria 1450
369 Ga0207705_10326558 3300025909 Bacteria 1179
370 Ga0207654_10096744 3300025911 Bacteria 1811
371 Ga0207654_10431646 3300025911 Bacteria 921
372 Ga0207707_10045519 3300025912 Bacteria 3823
373 Ga0207707_10096707 3300025912 Bacteria 2580
374 Ga0207695_10000006 3300025913 Bacteria 1135309
375 Ga0207695_11047133 3300025913 Bacteria 696
376 Ga0207671_10031050 3300025914 Bacteria 3983
377 Ga0207671_10072946 3300025914 Bacteria 2563
378 Ga0207671_10317470 3300025914 Bacteria 1233
379 Ga0207671_10424265 3300025914 Bacteria 1058
380 Ga0207671_10855664 3300025914 Bacteria 720
381 Ga0207671_11073666 3300025914 Bacteria 633
382 Ga0207693_10019358 3300025915 Bacteria 5415
383 Ga0207693_10030703 3300025915 Bacteria 4245
384 Ga0207693_10078755 3300025915 Bacteria 2579
385 Ga0207693_10145064 3300025915 Bacteria 1867
386 Ga0207693_10558348 3300025915 Bacteria 893
387 Ga0207663_10010554 3300025916 Bacteria 4923
388 Ga0207663_10020883 3300025916 Bacteria 3717
389 Ga0207663_10028190 3300025916 Bacteria 3284
390 Ga0207663_10050487 3300025916 Bacteria 2585
391 Ga0207663_10489033 3300025916 Bacteria 954
392 Ga0207660_10064743 3300025917 Bacteria 2639
393 Ga0207660_10097345 3300025917 Bacteria 2192
394 Ga0207660_11211818 3300025917 Bacteria 614
395 Ga0207657_10304852 3300025919 Bacteria 1261
396 Ga0207657_10463605 3300025919 Bacteria 994
397 Ga0207649_10669358 3300025920 Bacteria 803
398 Ga0207649_10994823 3300025920 Bacteria 660
399 Ga0207649_11044015 3300025920 Bacteria 644
400 Ga0207652_10302653 3300025921 Bacteria 1443
401 Ga0207652_11387261 3300025921 Bacteria 606
402 Ga0207681_10279959 3300025923 Bacteria 1313
403 Ga0207681_10700305 3300025923 Bacteria 842
404 Ga0207694_10026352 3300025924 Bacteria 4422
405 Ga0207694_10581024 3300025924 Bacteria 942
406 Ga0207650_10155963 3300025925 Bacteria 1805
407 Ga0207659_11001280 3300025926 Bacteria 719
408 Ga0207687_10015530 3300025927 Bacteria 4994
409 Ga0207687_10374910 3300025927 Bacteria 1164
410 Ga0207687_11184652 3300025927 Bacteria 656
411 Ga0207700_10024263 3300025928 Bacteria 4195
412 Ga0207700_10090867 3300025928 Bacteria 2411
413 Ga0207700_10785940 3300025928 Bacteria 851
414 Ga0207700_11916042 3300025928 Bacteria 519
415 Ga0207664_10347792 3300025929 Bacteria 1312
416 Ga0207664_10440266 3300025929 Bacteria 1162
417 Ga0207664_10523687 3300025929 Bacteria 1062
418 Ga0207644_10084782 3300025931 Bacteria 2349
419 Ga0207706_10024351 3300025933 Bacteria 5427
420 Ga0207706_10166211 3300025933 Bacteria 1939
421 Ga0207706_11253479 3300025933 Bacteria 614
422 Ga0207686_10203590 3300025934 Bacteria 1419
423 Ga0207709_10322478 3300025935 Bacteria 1157
424 Ga0207709_11308508 3300025935 Bacteria 599
425 Ga0207709_11651221 3300025935 Bacteria 532
426 Ga0207669_10567335 3300025937 Bacteria 918
427 Ga0207669_11111475 3300025937 Bacteria 667
428 Ga0207704_10488886 3300025938 Bacteria 990
429 Ga0207704_11016289 3300025938 Bacteria 702
430 Ga0207665_10009934 3300025939 Bacteria 6245
431 Ga0207665_10029272 3300025939 Bacteria 3641
432 Ga0207665_10198073 3300025939 Bacteria 1462
433 Ga0207691_10041304 3300025940 Bacteria 4259
434 Ga0207711_10107052 3300025941 Bacteria 2482
435 Ga0207711_10471297 3300025941 Bacteria 1169
436 Ga0207711_10964760 3300025941 Bacteria 791
437 Ga0207689_10199543 3300025942 Bacteria 1651
438 Ga0207689_10297792 3300025942 Bacteria 1337
439 Ga0207679_10373457 3300025945 Bacteria 1248
440 Ga0207679_10952536 3300025945 Bacteria 786
441 Ga0207679_12062900 3300025945 Bacteria 518
442 Ga0207667_10020145 3300025949 Bacteria 7426
443 Ga0207667_10026155 3300025949 Bacteria 6380
444 Ga0207667_10553523 3300025949 Bacteria 1163
445 Ga0207667_10893107 3300025949 Bacteria 881
446 Ga0207667_11363590 3300025949 Bacteria 684
447 Ga0207651_11179231 3300025960 Bacteria 687
448 Ga0207712_10537328 3300025961 Bacteria 1004
449 Ga0207712_11740821 3300025961 Bacteria 559
450 Ga0207668_10044853 3300025972 Bacteria 3011
451 Ga0207668_10098525 3300025972 Bacteria 2166
452 Ga0207640_10003411 3300025981 Bacteria 8553
453 Ga0207640_10314746 3300025981 Bacteria 1244
454 Ga0207640_10768331 3300025981 Bacteria 832
455 Ga0207640_10785565 3300025981 Bacteria 824
456 Ga0207640_12178109 3300025981 Bacteria 503
457 Ga0207658_10484606 3300025986 Bacteria 1099
458 Ga0207677_10105238 3300026023 Bacteria 2087
459 Ga0207677_10200525 3300026023 Bacteria 1586
460 Ga0207677_11183897 3300026023 Bacteria 699
461 Ga0207703_10167720 3300026035 Bacteria 1928
462 Ga0207703_10635946 3300026035 Bacteria 1011
463 Ga0207703_11293637 3300026035 Bacteria 701
464 Ga0207639_10007946 3300026041 Bacteria 7248
465 Ga0207639_10634740 3300026041 Bacteria 987
466 Ga0207639_11671874 3300026041 Bacteria 597
467 Ga0207678_10072189 3300026067 Bacteria 2958
468 Ga0207678_10139159 3300026067 Bacteria 2071
469 Ga0207678_10189576 3300026067 Bacteria 1757
470 Ga0207678_10261273 3300026067 Bacteria 1484
471 Ga0207678_10370810 3300026067 Bacteria 1236
472 Ga0207678_10519886 3300026067 Bacteria 1039
473 Ga0207678_11982649 3300026067 Bacteria 507
474 Ga0207702_10094732 3300026078 Bacteria 2621
475 Ga0207702_10215699 3300026078 Bacteria 1786
476 Ga0207702_10694345 3300026078 Bacteria 1003
477 Ga0207702_10882907 3300026078 Bacteria 886
478 Ga0207641_10189800 3300026088 Bacteria 1888
479 Ga0207648_10310066 3300026089 Bacteria 1416
480 Ga0207648_10480900 3300026089 Bacteria 1134
481 Ga0207648_11012023 3300026089 Bacteria 778
482 Ga0207676_11060082 3300026095 Bacteria 800
483 Ga0207674_10151209 3300026116 Bacteria 2279
484 Ga0207674_10536929 3300026116 Bacteria 1130
485 Ga0207675_100319399 3300026118 Bacteria 1516
486 Ga0207683_10239285 3300026121 Bacteria 1656
487 Ga0207683_10258732 3300026121 Bacteria 1589
488 Ga0207683_11287893 3300026121 Bacteria 677
489 Ga0207698_10009622 3300026142 Bacteria 6172
490 Ga0207698_10117597 3300026142 Bacteria 2243
491 Ga0207698_10194042 3300026142 Bacteria 1812
492 Ga0207698_10678094 3300026142 Bacteria 1024
493 Ga0207698_11643708 3300026142 Bacteria 658
494 Ga0207698_12268144 3300026142 Bacteria 555
495 Ga0209389_1000034 3300027296 Bacteria 127289
496 Ga0209389_1000039 3300027296 Bacteria 124545
497 Ga0209589_1000038 3300027357 Bacteria 127285
498 Ga0209489_100023 3300027361 Bacteria 198829
499 Ga0209489_100087 3300027361 Bacteria 124545
500 Ga0209700_100090 3300027363 Bacteria 124545
501 Ga0209179_1141654 3300027512 Bacteria 537
502 Ga0209813_10002337 3300027866 Bacteria 4347
503 Ga0209813_10208643 3300027866 Bacteria 726
504 Ga0268266_10107532 3300028379 Bacteria 2467
505 Ga0268266_10150605 3300028379 Bacteria 2096
506 Ga0268266_10202279 3300028379 Bacteria 1818
507 Ga0268266_10500186 3300028379 Bacteria 1160
508 Ga0268265_10040061 3300028380 Bacteria 3457
509 Ga0268265_10285384 3300028380 Bacteria 1479
510 Ga0268264_11432346 3300028381 Bacteria 701
511 Ga0307517_10188478 3300028786 Bacteria 1315
512 Ga0265330_10052981 3300031235 Bacteria 1776
513 Ga0265330_10062358 3300031235 Bacteria 1621
514 Ga0265330_10064703 3300031235 Bacteria 1588
515 Ga0265332_10064212 3300031238 Bacteria 1568
516 Ga0265328_10037603 3300031239 Bacteria 1787
517 Ga0265328_10054793 3300031239 Bacteria 1464
518 Ga0265325_10016362 3300031241 Bacteria 4148
519 Ga0265340_10011726 3300031247 Bacteria 4650
520 Ga0265340_10517798 3300031247 Bacteria 525
521 Ga0265339_10091647 3300031249 Bacteria 1592
522 Ga0265339_10125098 3300031249 Bacteria 1318
523 Ga0265339_10141105 3300031249 Bacteria 1226
524 Ga0265339_10234071 3300031249 Bacteria 894
525 Ga0265331_10139281 3300031250 Bacteria 1104
526 Ga0265331_10145463 3300031250 Bacteria 1077
527 Ga0265331_10259707 3300031250 Bacteria 779
528 Ga0265331_10337385 3300031250 Bacteria 675
529 Ga0265316_10354726 3300031344 Bacteria 1061
530 Ga0265316_10387372 3300031344 Bacteria 1008
531 Ga0265316_10448345 3300031344 Bacteria 925
532 Ga0265316_10471349 3300031344 Bacteria 899
533 Ga0307509_10139692 3300031507 Bacteria 2361
534 Ga0265313_10080822 3300031595 Bacteria 1477
535 Ga0307508_10352242 3300031616 Bacteria 1064
536 Ga0307508_10724455 3300031616 Bacteria 606
537 Ga0265314_10010709 3300031711 Bacteria 7631
538 Ga0265342_10004756 3300031712 Bacteria 10556
539 Ga0265342_10124830 3300031712 Bacteria 1446
540 Ga0307516_10578230 3300031730 Bacteria 777
541 Ga0307405_10694911 3300031731 Bacteria 842
542 Ga0307405_11905850 3300031731 Bacteria 530
543 Ga0307413_11719328 3300031824 Bacteria 560
544 Ga0307406_12058479 3300031901 Bacteria 511
545 Ga0307416_101588531 3300032002 Bacteria 759
546 Ga0307414_10966732 3300032004 Bacteria 783
547 Ga0307414_11118879 3300032004 Bacteria 728
548 Ga0307415_100186945 3300032126 Bacteria 1631
549 Ga0307415_101108416 3300032126 Bacteria 741
550 Ga0307415_101744653 3300032126 Bacteria 601
551 Ga0307507_10335433 3300033179 Bacteria 900
552 Ga0307510_10029008 3300033180 Bacteria 6305
553 Ga0307510_10543663 3300033180 Bacteria 607
554 Ga0373944_0027117 3300035089 Bacteria 1697
555 Ga0373923_0039597 3300035111 Bacteria 1936
556 Ga0373936_0013718 3300035113 Bacteria 3092
557 Ga0373936_0027229 3300035113 Bacteria 2242
558 Ga0373939_0140823 3300035114 Bacteria 870
559 Ga0373941_0265208 3300035115 Bacteria 675
560 Ga0373945_0001999 3300035116 Bacteria 6335
561 Ga0373954_0242302 3300035118 Bacteria 887
562 Ga0373943_0012127 3300035170 Bacteria 3882
563 Ga0373955_0010034 3300035172 Bacteria 4458
564 Ga0373962_0129060 3300035242 Bacteria 812
565 Ga0373931_0238478 3300035691 Bacteria 1101
566 Ga0373931_0530921 3300035691 Bacteria 762
567 Ga0373935_0000800 3300035692 Bacteria 16796
568 Ga0373935_0614187 3300035692 Bacteria 796
569 Ga0373927_0000666 3300035695 Bacteria 26107
570 Ga0373933_0566854 3300035724 Bacteria 745
571 Ga0373937_0015543 3300036401 Bacteria 6735
572 Ga0373937_0062254 3300036401 Bacteria 3430
573 Ga0373937_1173716 3300036401 Bacteria 716
574 Ga0373925_0008568 3300037068 Bacteria 7453
575 Ga0373925_1375616 3300037068 Bacteria 578
576 Ga0395900_0001340 3300037418 Bacteria 29756
577 Ga0395900_1182787 3300037418 Bacteria 680
578 Ga0395898_0005324 3300037466 Bacteria 13909
579 Ga0395898_1445006 3300037466 Bacteria 615
580 Ga0395905_0006516 3300037471 Bacteria 11740
581 Ga0395905_0323135 3300037471 Bacteria 1433
582 Ga0395905_0837332 3300037471 Bacteria 823
583 Ga0395905_1133897 3300037471 Bacteria 685
584 Ga0395905_1377442 3300037471 Bacteria 609
585 Ga0395901_0007542 3300038443 Bacteria 10989
586 Ga0395901_0289239 3300038443 Bacteria 1701
587 Ga0395901_1373431 3300038443 Bacteria 666
588 Ga0436365_0165598 3300039437 Bacteria 761
589 Ga0436365_0657145 3300039437 Bacteria 1328
590 Ga0436365_0801580 3300039437 Bacteria 1759
591 Ga0436365_1544802 3300039437 Bacteria 6693
592 Ga0436365_1727831 3300039437 Bacteria 813
593 Ga0436360_1050844 3300039438 Bacteria 581
594 Ga0436363_0139435 3300039450 Bacteria 2067
595 Ga0436363_0465325 3300039450 Bacteria 1029
596 Ga0436363_0783763 3300039450 Unclassified 566
597 Ga0436362_1167635 3300039453 Bacteria 539
598 Ga0436362_1295510 3300039453 Bacteria 3402
599 Ga0451791_1866899 3300041451 Bacteria 1104
600 Ga0451793_0234425 3300041452 Bacteria 530
601 Ga0451797_0114101 3300041453 Bacteria 653
602 Ga0451795_0118586 3300041456 Bacteria 967
603 Ga0451802_2074404 3300041460 Bacteria 882
604 Ga0451807_0956237 3300041486 Bacteria 830
605 Ga0451807_2333451 3300041486 Bacteria 662
606 Ga0451835_0181475 3300041492 Bacteria 812
607 Ga0451845_0824977 3300041501 Bacteria 947
608 Ga0451849_0844733 3300041505 Bacteria 548
609 Ga0451843_1376612 3300041509 Bacteria 703
610 Ga0451855_0055418 3300041511 Bacteria 765
611 Ga0451853_1565872 3300041512 Bacteria 1121
612 Ga0451853_3946027 3300041512 Bacteria 716
613 Ga0439459_0025420 3300042438 Bacteria 1169
614 Ga0466969_0149159 3300044656 Bacteria 1078
615 Ga0466972_0088356 3300044658 Bacteria 1471
616 Ga0466965_0700870 3300044683 Bacteria 581
617 Ga0466966_0013642 3300044684 Bacteria 5376
618 Ga0466966_0249136 3300044684 Bacteria 1070
619 Ga0466961_0000558 3300044693 Bacteria 23735
620 Ga0466963_0125044 3300044694 Bacteria 1772
621 Ga0466971_0062059 3300044719 Bacteria 1691
622 Ga0466971_0412983 3300044719 Bacteria 659
623 Ga0466968_0573845 3300044735 Bacteria 568
624 Ga0466960_0086941 3300044901 Bacteria 1586
625 Ga0466960_0088135 3300044901 Bacteria 1577
626 Ga0466959_0150201 3300045049 Bacteria 1642
627 Ga0466959_0293594 3300045049 Bacteria 1114
628 Ga0466967_0397288 3300045976 Bacteria 1341
629 Ga0495617_218053 3300046452 Bacteria 593
630 Ga0495592_0024886 3300046454 Bacteria 4549
631 Ga0495592_0768892 3300046454 Bacteria 574
632 Ga0495603_0000206 3300046455 Bacteria 30433
633 Ga0495603_0105026 3300046455 Bacteria 1648
634 Ga0495590_0136332 3300046457 Bacteria 884
635 Ga0495629_0000338 3300046459 Bacteria 40007
636 Ga0495629_0002176 3300046459 Bacteria 15139
637 Ga0495638_0003637 3300046460 Bacteria 12027
638 Ga0495641_0005602 3300046461 Bacteria 8407
639 Ga0495651_0044341 3300046462 Bacteria 3448
640 Ga0495651_0155119 3300046462 Bacteria 1646
641 Ga0495651_0397649 3300046462 Bacteria 900
642 Ga0495653_0112657 3300046463 Bacteria 1952
643 Ga0495580_0003372 3300046472 Bacteria 13653
644 Ga0495582_0000423 3300046473 Bacteria 23085
645 Ga0495582_0220606 3300046473 Bacteria 1085
646 Ga0495605_0077839 3300046474 Bacteria 1555
647 Ga0495605_0192928 3300046474 Bacteria 890
648 Ga0495639_0000039 3300046475 Bacteria 57380
649 Ga0495639_0330787 3300046475 Bacteria 763
650 Ga0495639_0606631 3300046475 Bacteria 563
651 Ga0495662_0004133 3300046476 Bacteria 7314
652 Ga0495664_0000847 3300046477 Bacteria 15732
653 Ga0495664_0111135 3300046477 Bacteria 1654
654 Ga0495584_0283649 3300046491 Bacteria 841
655 Ga0495584_0488166 3300046491 Bacteria 627
656 Ga0495594_0006206 3300046499 Bacteria 6145
657 Ga0495594_0503997 3300046499 Bacteria 687
658 Ga0495596_0197978 3300046500 Bacteria 781
659 Ga0495596_0374919 3300046500 Bacteria 554
660 Ga0495607_0249394 3300046501 Bacteria 855
661 Ga0495583_0138794 3300046506 Bacteria 1013
662 Ga0495606_0005948 3300046507 Bacteria 11450
663 Ga0495606_0105646 3300046507 Bacteria 1706
664 Ga0495606_0123928 3300046507 Bacteria 1543
665 Ga0495608_0332238 3300046511 Bacteria 937
666 Ga0495610_0043333 3300046512 Bacteria 2243
667 Ga0495610_0342266 3300046512 Bacteria 565
668 Ga0495616_0038082 3300046513 Bacteria 2471
669 Ga0495616_0132259 3300046513 Bacteria 1142
670 Ga0495618_0081765 3300046514 Bacteria 2063
671 Ga0495618_0114807 3300046514 Bacteria 1724
672 Ga0495620_0022772 3300046515 Bacteria 3010
673 Ga0495620_0110632 3300046515 Bacteria 1089
674 Ga0495620_0216518 3300046515 Bacteria 734
675 Ga0495628_0020083 3300046516 Bacteria 5514
676 Ga0495628_0321728 3300046516 Bacteria 1141
677 Ga0495630_0002808 3300046517 Bacteria 12078
678 Ga0495631_0198376 3300046518 Bacteria 858
679 Ga0495631_0313464 3300046518 Bacteria 667
680 Ga0495632_0150242 3300046519 Bacteria 1077
681 Ga0495632_0264694 3300046519 Bacteria 768
682 Ga0495643_0123112 3300046522 Bacteria 1308
683 Ga0495643_0248761 3300046522 Bacteria 830
684 Ga0495643_0284270 3300046522 Bacteria 760
685 Ga0495648_0018514 3300046524 Bacteria 4926
686 Ga0495648_0077660 3300046524 Bacteria 1902
687 Ga0495666_0028687 3300046526 Bacteria 2738
688 Ga0495666_0392084 3300046526 Bacteria 624
689 Ga0495652_0424179 3300046529 Bacteria 937
690 Ga0495652_0975551 3300046529 Bacteria 555
691 Ga0495654_0213818 3300046530 Bacteria 819
692 Ga0495665_0316575 3300046531 Bacteria 797
693 Ga0495640_0034933 3300046533 Bacteria 3560
694 Ga0495640_0035609 3300046533 Bacteria 3522
695 Ga0495609_0109965 3300046538 Bacteria 1190
696 Ga0495597_0031555 3300046542 Bacteria 2410
697 Ga0495597_0068663 3300046542 Bacteria 1531
698 Ga0495622_0013395 3300046557 Bacteria 3803
699 Ga0495622_0058693 3300046557 Bacteria 1782
700 Ga0495667_0006278 3300046559 Bacteria 8060
701 Ga0495668_0105757 3300046616 Bacteria 1539
702 Ga0495634_0000776 3300046642 Bacteria 30917
703 Ga0495634_0045232 3300046642 Bacteria 2977
704 Ga0495634_0117832 3300046642 Bacteria 1703
705 Ga0495611_0204822 3300046648 Bacteria 919
706 Ga0495625_0130144 3300046660 Bacteria 1705
707 Ga0495625_0344503 3300046660 Bacteria 943
708 Ga0495635_0001246 3300046663 Bacteria 17055
709 Ga0495635_0156040 3300046663 Bacteria 1553
710 Ga0495588_0002998 3300046674 Bacteria 7298
711 Ga0495588_0013921 3300046674 Bacteria 3841
712 Ga0495657_0004548 3300046675 Bacteria 11084
713 Ga0495657_0163833 3300046675 Bacteria 1374
714 Ga0495657_0202761 3300046675 Bacteria 1208
715 Ga0495657_0495180 3300046675 Bacteria 713
716 Ga0495599_0314930 3300046678 Bacteria 943
717 Ga0495623_0116717 3300046679 Bacteria 1612
718 Ga0495623_0321274 3300046679 Bacteria 850
719 Ga0495623_0338090 3300046679 Bacteria 823
720 Ga0495646_0202724 3300046680 Bacteria 1080
721 Ga0495646_0275801 3300046680 Bacteria 894
722 Ga0495647_0001044 3300046681 Bacteria 8440
723 Ga0495658_0000687 3300046683 Bacteria 18301
724 Ga0495669_0234087 3300046684 Bacteria 881
725 Ga0495613_0001857 3300046689 Bacteria 16088
726 Ga0495613_0011844 3300046689 Bacteria 6481
727 Ga0495624_0003908 3300046690 Bacteria 10982
728 Ga0495649_0077025 3300046694 Bacteria 1785
729 Ga0495649_0284591 3300046694 Bacteria 844
730 Ga0495649_0593727 3300046694 Bacteria 546
731 Ga0495589_0095970 3300046794 Bacteria 1438
732 Ga0495600_0008582 3300046809 Bacteria 6284
733 Ga0495600_0187212 3300046809 Bacteria 1332
734 Ga0495600_0238802 3300046809 Bacteria 1158
735 Ga0495600_0630139 3300046809 Bacteria 650
736 Ga0495660_0156750 3300046810 Bacteria 1120
737 Ga0495660_0284086 3300046810 Bacteria 756
738 Ga0495581_0000006 3300047315 Bacteria 77433
739 Ga0495581_0146908 3300047315 Bacteria 1376
740 Ga0495604_0014161 3300047317 Bacteria 6357
741 Ga0495674_0002636 3300047319 Bacteria 17455
742 Ga0495672_0272711 3300047320 Bacteria 812
743 Ga0495676_0045171 3300047321 Bacteria 3588
744 Ga0495680_0074399 3300047322 Bacteria 2580
745 Ga0495680_0278081 3300047322 Bacteria 1180
746 Ga0495683_0045400 3300047323 Bacteria 2208
747 Ga0495683_0199158 3300047323 Bacteria 904
748 Ga0495687_075690 3300047443 Bacteria 1334
749 Ga0495687_223117 3300047443 Bacteria 581
750 Ga0495677_0316880 3300047445 Bacteria 614
751 Ga0495673_0036359 3300047469 Bacteria 2260
752 Ga0495684_0053162 3300047471 Bacteria 3090
753 Ga0495684_0554012 3300047471 Bacteria 782
754 Ga0495686_0318563 3300047472 Bacteria 853
755 Ga0495686_0362894 3300047472 Bacteria 785
756 Ga0495593_0000032 3300047673 Bacteria 58862
757 Ga0495602_0138950 3300048088 Bacteria 1926
758 Ga0495614_0031476 3300048089 Bacteria 2283
759 Ga0495614_0343850 3300048089 Bacteria 694
760 Ga0495626_0080213 3300048091 Bacteria 1451
761 Ga0496100_0098042 3300048903 Bacteria 2014
762 Ga0496100_0208245 3300048903 Bacteria 1429
763 Ga0496100_0238632 3300048903 Bacteria 1340
764 Ga0496100_0391004 3300048903 Bacteria 1057
765 Ga0496100_0721687 3300048903 Bacteria 778
766 Ga0496101_0031612 3300048904 Bacteria 3723
767 Ga0496101_0035824 3300048904 Bacteria 3511
768 Ga0496101_0146357 3300048904 Bacteria 1804
769 Ga0496101_0350188 3300048904 Bacteria 1161
770 Ga0496101_0357722 3300048904 Bacteria 1148
771 Ga0496101_0404754 3300048904 Bacteria 1075
772 Ga0496101_0536457 3300048904 Bacteria 925
773 Ga0496101_0822489 3300048904 Bacteria 732
774 Ga0496102_0006237 3300048905 Bacteria 10164
775 Ga0496102_0156191 3300048905 Bacteria 2144
776 Ga0496102_0277617 3300048905 Bacteria 1579
777 Ga0496102_0849158 3300048905 Bacteria 835
778 Ga0496103_0014126 3300048906 Bacteria 4740
779 Ga0496103_0934490 3300048906 Bacteria 542
780 Ga0496104_0024484 3300048907 Bacteria 5553
781 Ga0496104_0047099 3300048907 Bacteria 4063
782 Ga0496104_0283464 3300048907 Bacteria 1570
783 Ga0496104_0354234 3300048907 Bacteria 1380
784 Ga0496104_0390401 3300048907 Bacteria 1304
785 Ga0496104_1130082 3300048907 Bacteria 687
786 Ga0496105_0108566 3300048908 Bacteria 2291
787 Ga0496105_0117313 3300048908 Bacteria 2195
788 Ga0496105_0125438 3300048908 Bacteria 2116
789 Ga0496105_1289912 3300048908 Bacteria 534
790 Ga0496106_0056082 3300048909 Bacteria 2978
791 Ga0496106_0081865 3300048909 Bacteria 2481
792 Ga0496106_0175282 3300048909 Bacteria 1701
793 Ga0496106_0580283 3300048909 Bacteria 899
794 Ga0496106_0808172 3300048909 Bacteria 744
795 Ga0496106_1509940 3300048909 Bacteria 517
796 Ga0496107_0040809 3300048910 Bacteria 3332
797 Ga0496107_0234497 3300048910 Bacteria 1365
798 Ga0496107_0509866 3300048910 Bacteria 892
799 Ga0496107_0833102 3300048910 Bacteria 674
800 Ga0496108_0008957 3300048911 Bacteria 8110
801 Ga0496108_0146647 3300048911 Bacteria 2035
802 Ga0496108_0424225 3300048911 Bacteria 1162
803 Ga0496108_0436706 3300048911 Bacteria 1143
804 Ga0496109_0020552 3300048912 Bacteria 5831
805 Ga0496109_0069711 3300048912 Bacteria 3225
806 Ga0496109_0592670 3300048912 Bacteria 1044
807 Ga0496109_0612735 3300048912 Bacteria 1025
808 Ga0496110_0051284 3300048913 Bacteria 3625
809 Ga0496110_0257806 3300048913 Bacteria 1587
810 Ga0496110_0301193 3300048913 Bacteria 1460
811 Ga0496110_0316974 3300048913 Bacteria 1420
812 Ga0496110_0355092 3300048913 Bacteria 1335
813 Ga0496110_0549553 3300048913 Bacteria 1050
814 Ga0496110_0747888 3300048913 Bacteria 881
815 Ga0496111_0327383 3300048914 Bacteria 1134
816 Ga0496111_0426511 3300048914 Bacteria 979
817 Ga0496111_0458900 3300048914 Bacteria 940
818 Ga0496111_0631743 3300048914 Bacteria 782
819 Ga0496112_0000029 3300048915 Bacteria 122291
820 Ga0496112_0054801 3300048915 Bacteria 3918
821 Ga0496112_0070474 3300048915 Bacteria 3455
822 Ga0496112_0124542 3300048915 Bacteria 2548
823 Ga0496112_0451914 3300048915 Bacteria 1222
824 Ga0496112_0510875 3300048915 Bacteria 1137
825 Ga0496113_0096906 3300048916 Bacteria 2281
826 Ga0496113_0305377 3300048916 Bacteria 1274
827 Ga0496113_0620375 3300048916 Bacteria 865
828 Ga0496113_0841429 3300048916 Bacteria 727
829 Ga0496113_0963187 3300048916 Bacteria 673
830 Ga0496114_0021565 3300048917 Bacteria 5241
831 Ga0496114_0295797 3300048917 Bacteria 1429
832 Ga0496114_0392840 3300048917 Bacteria 1228
833 Ga0496115_0063385 3300048918 Bacteria 2982
834 Ga0496115_0149336 3300048918 Bacteria 1929
835 Ga0496115_0215610 3300048918 Bacteria 1585
836 Ga0496115_0274747 3300048918 Bacteria 1384
837 Ga0496115_0298016 3300048918 Bacteria 1321
838 Ga0496115_0779387 3300048918 Bacteria 746
839 Ga0496116_0063414 3300048919 Bacteria 2381
840 Ga0496117_0063496 3300048920 Bacteria 2524
841 Ga0496117_0176090 3300048920 Bacteria 1236
842 Ga0496117_0263275 3300048920 Bacteria 933
843 Ga0496118_0061109 3300048921 Bacteria 2792
844 Ga0496118_0210262 3300048921 Bacteria 1142
845 Ga0496119_0004759 3300048922 Bacteria 13336
846 Ga0496119_0162193 3300048922 Bacteria 1187
847 Ga0496119_0506767 3300048922 Bacteria 561
848 Ga0496120_0011234 3300048923 Bacteria 6174
849 Ga0496120_0278911 3300048923 Bacteria 773
850 Ga0496120_0483551 3300048923 Bacteria 534
851 Ga0496121_0067065 3300048924 Bacteria 2909
852 Ga0496121_0076862 3300048924 Bacteria 2661
853 Ga0496121_0109120 3300048924 Bacteria 2115
854 Ga0496121_0233292 3300048924 Bacteria 1287
855 Ga0496121_0298971 3300048924 Bacteria 1093
856 Ga0496122_0349071 3300048925 Bacteria 773
857 Ga0496123_0245719 3300048926 Bacteria 886
858 Ga0496124_0199891 3300048927 Bacteria 1521
859 Ga0496124_0237878 3300048927 Bacteria 1356
860 Ga0496124_0783328 3300048927 Bacteria 593
861 Ga0496125_0074304 3300048928 Bacteria 2636
862 Ga0496125_0239845 3300048928 Bacteria 1152
863 Ga0496125_0413741 3300048928 Bacteria 784
864 Ga0496126_0021452 3300048929 Bacteria 6307
865 Ga0496126_0067946 3300048929 Bacteria 3183
866 Ga0496126_0269263 3300048929 Bacteria 1414
867 Ga0496126_0320161 3300048929 Bacteria 1275
868 Ga0496126_0400598 3300048929 Bacteria 1113
869 Ga0496126_0462816 3300048929 Bacteria 1019
870 Ga0496126_0905477 3300048929 Bacteria 668
871 Ga0495682_0050610 3300049460 Bacteria 1511
872 Ga0495682_0319092 3300049460 Bacteria 548
873 Ga0501067_0049759 3300049583 Bacteria 2322
874 Ga0501076_0363520 3300049592 Bacteria 1189
875 nmdc:mga03683_150490_c1 3300050489 Bacteria 1050
876 nmdc:mga03683_199845_c1 3300050489 Bacteria 917
877 nmdc:mga03683_252943_c1 3300050489 Bacteria 819
878 nmdc:mga03n38_30594_c1 3300050490 Bacteria 2265
879 nmdc:mga03n38_504504_c1 3300050490 Bacteria 679
880 nmdc:mga00v17_205784_c1 3300050491 Bacteria 1273
881 nmdc:mga00v17_433927_c1 3300050491 Bacteria 853
882 nmdc:mga00v17_51191_c1 3300050491 Bacteria 2511
883 nmdc:mga00v17_552923_c1 3300050491 Bacteria 744
884 nmdc:mga0yw44_165693_c1 3300050492 Bacteria 1449
885 nmdc:mga0yw44_290032_c1 3300050492 Bacteria 1095
886 nmdc:mga0yw44_314787_c1 3300050492 Bacteria 1050
887 nmdc:mga0yw44_430470_c1 3300050492 Bacteria 894
888 nmdc:mga0yw44_489999_c1 3300050492 Bacteria 834
889 nmdc:mga0yw44_52059_c2 3300050492 Bacteria 1713
890 nmdc:mga0yw44_89419_c1 3300050492 Bacteria 1943
891 nmdc:mga0k408_193427_c1 3300050493 Bacteria 1214
892 nmdc:mga0k408_351600_c1 3300050493 Bacteria 878
893 nmdc:mga0k408_535205_c1 3300050493 Bacteria 693
894 nmdc:mga0k408_85455_c1 3300050493 Bacteria 1852
895 nmdc:mga06z11_110142_c1 3300050494 Bacteria 1523
896 nmdc:mga06z11_145484_c1 3300050494 Bacteria 1343
897 nmdc:mga06z11_594653_c1 3300050494 Bacteria 673
898 nmdc:mga06z11_803530_c1 3300050494 Bacteria 573
899 nmdc:mga06z11_869202_c1 3300050494 Bacteria 549
900 nmdc:mga06z11_98777_c1 3300050494 Bacteria 1598
901 nmdc:mga04h51_239456_c1 3300050495 Bacteria 724
902 nmdc:mga04h51_30802_c1 3300050495 Bacteria 1691
903 nmdc:mga07m45_107885_c1 3300050496 Bacteria 1602
904 nmdc:mga07m45_148537_c1 3300050496 Bacteria 1359
905 nmdc:mga07m45_157563_c1 3300050496 Bacteria 1318
906 nmdc:mga07m45_276925_c1 3300050496 Bacteria 976
907 nmdc:mga07m45_360449_c1 3300050496 Bacteria 845
908 nmdc:mga07m45_511601_c1 3300050496 Bacteria 695
909 nmdc:mga08x19_555763_c1 3300050514 Bacteria 812
910 nmdc:mga0sz30_117318_c1 3300050516 Bacteria 1169
911 nmdc:mga0sz30_423468_c1 3300050516 Bacteria 597
912 nmdc:mga0sz30_46487_c1 3300050516 Bacteria 1833
913 nmdc:mga0sz30_56744_c1 3300050516 Bacteria 1668
914 nmdc:mga0sz30_57816_c1 3300050516 Bacteria 1653
915 Ga0495601_0399700 3300053077 Bacteria 891
916 Ga0495601_0479505 3300053077 Bacteria 803
917 Ga0495612_0063222 3300053078 Bacteria 1535
918 Ga0500635_0052270 3300053080 Bacteria 1403
919 Ga0500635_0104445 3300053080 Bacteria 1046
920 Ga0495655_0036092 3300053083 Bacteria 1234
921 Ga0495655_0228197 3300053083 Bacteria 619
922 Ga0495655_0318806 3300053083 Bacteria 538
923 Ga0495655_0331075 3300053083 Bacteria 529
924 Ga0495619_0521281 3300053085 Bacteria 816
925 Ga0500578_0089840 3300053086 Bacteria 1950
926 Ga0500644_0416289 3300053088 Bacteria 587
927 Ga0500647_0152105 3300053091 Bacteria 1079
928 Ga0500647_0258320 3300053091 Bacteria 762
929 Ga0500647_0292036 3300053091 Bacteria 700
930 Ga0500651_0161790 3300053093 Bacteria 1338
931 Ga0500651_0221522 3300053093 Bacteria 1109
932 Ga0500566_0000270 3300053094 Bacteria 27957
933 Ga0500566_0000780 3300053094 Bacteria 18033
934 Ga0500640_000397 3300053095 Bacteria 10423
935 Ga0500641_0220012 3300053096 Bacteria 805
936 Ga0500648_205690 3300053097 Bacteria 983
937 Ga0500650_0098641 3300053098 Bacteria 1368
938 Ga0500556_0011510 3300053104 Bacteria 2621
939 Ga0500557_000079 3300053105 Bacteria 34903
940 Ga0500562_017834 3300053108 Bacteria 1832
941 Ga0500569_106447 3300053109 Bacteria 923
942 Ga0500572_001115 3300053111 Bacteria 7839
943 Ga0500572_001993 3300053111 Bacteria 5096
944 Ga0500591_054386 3300053115 Bacteria 1867
945 Ga0500595_133684 3300053119 Bacteria 697
946 Ga0500595_184201 3300053119 Bacteria 578
947 Ga0500608_006525 3300053122 Bacteria 4758
948 Ga0500608_290587 3300053122 Bacteria 613
949 Ga0500614_003198 3300053123 Bacteria 3550
950 Ga0500642_0000084 3300053130 Bacteria 49191
951 Ga0500642_0129229 3300053130 Bacteria 1183
952 Ga0500655_026358 3300053133 Bacteria 1106
953 Ga0500658_0094183 3300053134 Bacteria 1299
954 Ga0500658_0219063 3300053134 Bacteria 872
955 Ga0500559_0000775 3300053136 Bacteria 20935
956 Ga0500559_0001813 3300053136 Bacteria 11672
957 Ga0500559_0187609 3300053136 Bacteria 974
958 Ga0500568_0141164 3300053139 Bacteria 893
959 Ga0500590_174738 3300053148 Bacteria 940
960 Ga0500603_000151 3300053150 Bacteria 17010
961 Ga0500603_071439 3300053150 Bacteria 989
962 Ga0500604_0076153 3300053151 Bacteria 1078
963 Ga0500604_0205667 3300053151 Bacteria 677
964 Ga0500616_0023318 3300053153 Bacteria 3448
965 Ga0500622_0017062 3300053156 Bacteria 3870
966 Ga0500630_003510 3300053159 Bacteria 7582
967 Ga0500633_0219779 3300053160 Bacteria 709
968 Ga0500638_004618 3300053162 Bacteria 5344
969 Ga0500638_139274 3300053162 Bacteria 1091
970 Ga0500639_000065 3300053163 Bacteria 48250
971 Ga0500639_166687 3300053163 Bacteria 994
972 Ga0500639_322199 3300053163 Bacteria 565
973 Ga0500637_0140051 3300053178 Bacteria 1400
974 Ga0500649_056880 3300053722 Bacteria 1636
975 Ga0500576_021808 3300053725 Bacteria 2923
976 Ga0500611_199520 3300053727 Bacteria 566
977 Ga0500625_072389 3300053729 Bacteria 1529
978 Ga0500645_046585 3300053730 Bacteria 1272
979 Ga0500609_002762 3300053731 Bacteria 2499
980 Ga0500656_005804 3300053732 Bacteria 1232
981 Ga0500552_001347 3300053733 Bacteria 2342
982 Ga0500596_000494 3300053735 Bacteria 7393
983 Ga0500596_003534 3300053735 Bacteria 2956
984 Ga0500596_030737 3300053735 Bacteria 832
985 Ga0500599_000973 3300053736 Bacteria 3206
986 Ga0500601_000768 3300053737 Bacteria 4109
987 Ga0500601_026213 3300053737 Bacteria 682
988 Ga0500661_018802 3300055283 Bacteria 1231
989 Ga0500661_040852 3300055283 Bacteria 822
990 Ga0530510_0333709 3300061734 Bacteria 1138
991 2507505993 2507262055 Bacteria 8048963
992 2508540181 2508501009 Bacteria 7784016
993 2508696255 2508501042 Bacteria 8719808
994 2511397332 2511231028 Bacteria 8046582
995 2513624904 2513237092 Bacteria 8341956
996 2513638263 2513237094 Bacteria 8789602
997 2513649101 2513237095 Bacteria 8976980
998 2513716255 2513237104 Bacteria 10034502
999 2513877176 2513237139 Bacteria 8737671
1000 2514014545 2513237161 Bacteria 8871253
1001 2515628464 2515154112 Bacteria 8294334
1002 2517103183 2517093001 Bacteria 9002274
1003 2524440763 2524023205 Bacteria 8918781
1004 2528850758 2528768022 Bacteria 10457665
1005 2617347876 2617270735 Bacteria 9163226
1006 2617374798 2617270741 Bacteria 8201522
1007 2745076004 2744054633 Bacteria 8678936
1008 2793061473 2791355196 Bacteria 7323613
1009 2805916225 2802429603 Bacteria 8777136
1010 2818240492 2816332527 Bacteria 8933356
1011 2824666901 2824661429 Bacteria 9877870
1012 2824674079 2824671348 Bacteria 8369588
1013 2824683879 2824679649 Bacteria 8248951
1014 2824690745 2824687955 Bacteria 8360029
1015 2824704227 2824696289 Bacteria 8335049
1016 2824710968 2824704595 Bacteria 9667483
1017 2824737927 2824732956 Bacteria 7810675
1018 2824752192 2824746037 Bacteria 7911610
1019 2824760342 2824753945 Bacteria 9787441
1020 2824772490 2824763712 Bacteria 9792355
1021 2824776347 2824773399 Bacteria 8360218
1022 2838125014 2838122688 Bacteria 8803140
1023 2841945753 2841941048 Bacteria 8688029
1024 2841956852 2841949485 Bacteria 8680857
1025 2841973588 2841966195 Bacteria 8673214
1026 2841981934 2841974524 Bacteria 8931498
1027 2841989476 2841983080 Bacteria 8395090
1028 2842044461 2842038055 Bacteria 8002051
1029 2842051550 2842045827 Bacteria 8006841
1030 2844316335 2844315083 Bacteria 8138177
1031 2847939365 2847930680 Bacteria 9342022
1032 2847941121 2847939898 Bacteria 8606328
1033 2849082107 2849076700 Bacteria 7039503
1034 2874596270 2874590934 Bacteria 8299676
1035 2874622548 2874620515 Bacteria 8290088
1036 2874633461 2874628541 Bacteria 8630250
1037 2874650257 2874645413 Bacteria 8214782
1038 2876763658 2876761206 Bacteria 10111113
1039 2876776735 2876771140 Bacteria 8287509
1040 2876824525 2876818435 Bacteria 8274608
1041 2879080872 2879074833 Bacteria 8279565
1042 2879087038 2879083081 Bacteria 8587928
1043 2879104369 2879099564 Bacteria 10442239
1044 2879133717 2879127579 Bacteria 8294491
1045 2879148219 2879142872 Bacteria 8267021
1046 2881669756 2881665667 Bacteria 8175609
1047 2885367826 2885366525 Bacteria 8326213
1048 2885412976 2885409591 Bacteria 9235467
1049 2888387167 2888378607 Bacteria 9652610
1050 2888389858 2888388044 Bacteria 7304136
1051 2903728331 2903727486 Bacteria 8281579
1052 2904671445 2904666416 Bacteria 8226587
1053 2904719737 2904711408 Bacteria 9771557
1054 2906606471 2906602504 Bacteria 8295279
1055 2906631364 2906626472 Bacteria 8826946
1056 2906646708 2906643746 Bacteria 8722424
1057 2908777280 2908775508 Bacteria 8092255
1058 2922389447 2922386360 Bacteria 7017218
1059 2922398436 2922393267 Bacteria 8285685
1060 2929622136 2929615660 Bacteria 9193770
1061 2929630219 2929624759 Bacteria 9339455
1062 2932787859 2932784394 Bacteria 9704911
1063 2932795977 2932794094 Bacteria 7915132
1064 2932807554 2932801729 Bacteria 7987968
1065 2932817583 2932809354 Bacteria 9135765
1066 2932826257 2932818245 Bacteria 9955613
1067 2932835113 2932828146 Bacteria 9745859
1068 2933584248 2933577622 Bacteria 9116884
1069 2935614418 2935608549 Bacteria 8203142
1070 2935620491 2935616580 Bacteria 9032984
1071 2935640813 2935638405 Bacteria 10015038
1072 2935649447 2935648319 Bacteria 8801166
1073 2935657781 2935656913 Bacteria 8965014
1074 2935670316 2935665750 Bacteria 9571747
1075 2935679746 2935675223 Bacteria 9928132
1076 2935687315 2935684952 Bacteria 9590419
1077 2935696714 2935694250 Bacteria 9291695
1078 2935709194 2935703347 Bacteria 10242284
1079 2935718774 2935713505 Bacteria 9608509
1080 2935728426 2935722832 Bacteria 9608746
1081 2935736977 2935732158 Bacteria 9706831
1082 2935746020 2935741537 Bacteria 9707219
1083 2935753281 2935750917 Bacteria 9590372
1084 2935766326 2935760218 Bacteria 9817913
1085 2935770285 2935769743 Bacteria 7878163
1086 2935777688 2935777560 Bacteria 8077691
1087 2935786662 2935785616 Bacteria 7962367
1088 2935794716 2935793552 Bacteria 8012592
1089 2935809008 2935801545 Bacteria 9301974
1090 2935813813 2935810662 Bacteria 9401221
1091 2935826636 2935819856 Bacteria 8261050
1092 2935832320 2935827899 Bacteria 10038562
1093 2935844025 2935837841 Bacteria 9454360
1094 2935851070 2935847175 Bacteria 8228321
1095 2935862817 2935855204 Bacteria 9035059
1096 2935864560 2935864058 Bacteria 9784707
1097 2935875088 2935873716 Bacteria 9632195
1098 2935890232 2935883170 Bacteria 7964738
1099 2935913120 2935908558 Bacteria 8568796
1100 2935922542 2935916978 Bacteria 9113783
1101 2935930955 2935926038 Bacteria 8601059
1102 2935939711 2935934488 Bacteria 8602579
1103 2935946660 2935942939 Bacteria 8599779
1104 2935956139 2935951376 Bacteria 8602333
1105 2935965045 2935959822 Bacteria 7869783
1106 2935972932 2935967501 Bacteria 8603075
1107 2935978152 2935975950 Bacteria 8347125
1108 2935985724 2935984226 Bacteria 8302647
1109 2935999293 2935992306 Bacteria 9802711
1110 2936005848 2936002035 Bacteria 9362176
1111 2936012000 2936011229 Bacteria 8801034
1112 2936020919 2936019824 Bacteria 8804134
1113 2936029293 2936028420 Bacteria 8965941
1114 2936039369 2936037263 Bacteria 9446081
1115 2936048383 2936046547 Bacteria 8903709
1116 2936056506 2936055302 Bacteria 8785755
1117 2940559194 2940556831 Bacteria 9590747
1118 2941534518 2941531003 Bacteria 7653939
1119 2941541888 2941538514 Bacteria 9402094
1120 3005491142 3005483717 Bacteria 7877331
1121 3005510983 3005506211 Bacteria 6943378
1122 3005591828 3005587118 Bacteria 7794411
1123 3005595946 3005594810 Bacteria 8716512
1124 3005719138 3005718088 Bacteria 8283608
1125 8006931475 8006926726 Bacteria 6749210
1126 8016517188 8016511872 Bacteria 9921665
1127 8016527056 8016522445 Bacteria 8156687
1128 8016545347 8016539877 Bacteria 8155419
1129 8016556740 8016548790 Bacteria 8155074
1130 8016570435 8016566248 Bacteria 8158151
1131 8016582967 8016575299 Bacteria 8154085
1132 8016585333 8016583857 Bacteria 10421953
1133 8016602745 8016595262 Bacteria 8149947
1134 8016605604 8016603502 Bacteria 8731218
1135 8016624052 8016622563 Bacteria 7999408
1136 8016634814 8016630954 Bacteria 9217207
1137 8017059400 8017057580 Bacteria 10023680
1138 8019531956 8019530166 Bacteria 8155624
1139 8019539582 8019538911 Bacteria 7872763
1140 8019551075 8019547302 Bacteria 7996444
1141 8019576218 8019576017 Bacteria 10049540
1142 8019594094 8019586578 Bacteria 10212056
1143 8019607470 8019597564 Bacteria 10041141
1144 8019611040 8019608314 Bacteria 10042931
1145 8019621890 8019619141 Bacteria 9218857
1146 8019631433 8019629233 Bacteria 8687553
1147 8019651328 8019648815 Bacteria 10014479
1148 8019668246 8019659431 Bacteria 8577854
1149 8019677699 8019668869 Bacteria 8791617
1150 8019687243 8019678201 Bacteria 8863603
1151 8019693225 8019687851 Bacteria 8712826
1152 8055743613 8055742211 Bacteria 9226248
1153 8056681587 8056681323 Bacteria 8472857
1154 8056692936 8056689827 Bacteria 6712655
1155 8056974080 8056967851 Bacteria 9038162
1156 Ga0081455_10173674
1157 LJQas_1013109
1158 JGI24737J22298_10006499
1159 JGI24735J21928_10019922
1160 JGI24735J21928_10212446
1161 JGI24738J21930_10019905
1162 JGI24738J21930_10124708
1163 JGI24033J26618_1053361
1164 JGI25153J46596_10001390
1165 JGI25153J46596_10002696
1166 JGI25153J46596_10003859
1167 JGI25153J46596_10020441
1168 JGI25160J50197_1002392
1169 JGI25404J52841_10033269
1170 Ga0055539_1001720
1171 Ga0055529_1027473
1172 Ga0055526_1104461
1173 Ga0055531_10003707
1174 Ga0055543_1079601
1175 Ga0065165_1003638
1176 Ga0065165_1024512
1177 Ga0065712_10536602
1178 Ga0070658_10878140
1179 Ga0070676_11056465
1180 Ga0070676_11313137
1181 Ga0070683_100025330
1182 Ga0070683_100865744
1183 Ga0070670_100055651
1184 Ga0068869_100163644
1185 Ga0068869_100350804
1186 Ga0070666_10181967
1187 Ga0070666_10331454
1188 Ga0070666_10422991
1189 Ga0070680_100028590
1190 Ga0070680_100363103
1191 Ga0070682_100218969
1192 Ga0070682_100652971
1193 Ga0070682_101076986
1194 Ga0068868_100017643
1195 Ga0068868_100740246
1196 Ga0068868_100947948
1197 Ga0070660_100201906
1198 Ga0070660_100935065
1199 Ga0070689_100499769
1200 Ga0070661_100416118
1201 Ga0070661_100512360
1202 Ga0070661_100981450
1203 Ga0070692_10359834
1204 Ga0070668_100084326
1205 Ga0070668_100211842
1206 Ga0070668_100685543
1207 Ga0070668_101426098
1208 Ga0070668_102082679
1209 Ga0070669_100466617
1210 Ga0070669_100566424
1211 Ga0070675_100514555
1212 Ga0070675_101670178
1213 Ga0070675_101795717
1214 Ga0070675_102169297
1215 Ga0070671_100642425
1216 Ga0070674_100782225
1217 Ga0070673_101477395
1218 Ga0070673_102113052
1219 Ga0070667_100524191
1220 Ga0070667_100845781
1221 Ga0070667_100941738
1222 Ga0070709_10000375
1223 Ga0070709_10009548
1224 Ga0070714_100047429
1225 Ga0070714_100161943
1226 Ga0070714_101989943
1227 Ga0070713_100061380
1228 Ga0070713_100108259
1229 Ga0070713_100159215
1230 Ga0070713_100179267
1231 Ga0070710_10000275
1232 Ga0070710_10010323
1233 Ga0070710_10048124
1234 Ga0070710_11042584
1235 Ga0070701_10215404
1236 Ga0070701_10611640
1237 Ga0070711_100006414
1238 Ga0070711_100012405
1239 Ga0070711_100031039
1240 Ga0070700_100632785
1241 Ga0070663_100056230
1242 Ga0070663_100847116
1243 Ga0070663_100964815
1244 Ga0070663_101204035
1245 Ga0070663_101398573
1246 Ga0070663_101816014
1247 Ga0070678_102194918
1248 Ga0070662_100262735
1249 Ga0070662_100286317
1250 Ga0070662_100835789
1251 Ga0070681_10077381
1252 Ga0070681_10083478
1253 Ga0068867_101388401
1254 Ga0070685_11173029
1255 Ga0070685_11288246
1256 Ga0070679_100039917
1257 Ga0070679_100434699
1258 Ga0070679_101406501
1259 Ga0070684_100012084
1260 Ga0070684_100633947
1261 Ga0068853_100145219
1262 Ga0068853_100184016
1263 Ga0068853_100222490
1264 Ga0068853_100411183
1265 Ga0068853_100581536
1266 Ga0068853_100888133
1267 Ga0070672_100508626
1268 Ga0070686_101442585
1269 Ga0070693_100137993
1270 Ga0070693_100560893
1271 Ga0070665_100043079
1272 Ga0070665_100076636
1273 Ga0070665_100144262
1274 Ga0070665_101269524
1275 Ga0068855_100022264
1276 Ga0068855_100032650
1277 Ga0068855_100504151
1278 Ga0068855_100905337
1279 Ga0068855_101958389
1280 Ga0070664_101304144
1281 Ga0070664_101518657
1282 Ga0068857_100015131
1283 Ga0068857_101653182
1284 Ga0068857_102032301
1285 Ga0068854_100094223
1286 Ga0068854_100787893
1287 Ga0068854_100919635
1288 Ga0068854_101347315
1289 Ga0068854_101783430
1290 Ga0068856_100051263
1291 Ga0068856_100248794
1292 Ga0068856_101074074
1293 Ga0068856_101079199
1294 Ga0068852_100141894
1295 Ga0068852_100335389
1296 Ga0068852_100739188
1297 Ga0068852_100947886
1298 Ga0068852_101578735
1299 Ga0068859_100716532
1300 Ga0068864_100751494
1301 Ga0068866_10367814
1302 Ga0068866_10908821
1303 Ga0068861_100388885
1304 Ga0068861_102233186
1305 Ga0068851_11044641
1306 Ga0068863_101206429
1307 Ga0068863_102438177
1308 Ga0068858_100278870
1309 Ga0068858_101166827
1310 Ga0068858_101672213
1311 Ga0068858_102468586
1312 Ga0068860_101430726
1313 Ga0068860_101501236
1314 Ga0068862_100541426
1315 Ga0068862_100592134
1316 Ga0068862_100593488
1317 Ga0081540_1001275
1318 Ga0081540_1023738
1319 Ga0081539_10020815
1320 Ga0081539_10230483
1321 Ga0070717_10061154
1322 Ga0070717_10324252
1323 Ga0070717_10756156
1324 Ga0075365_10120219
1325 Ga0075365_10148633
1326 Ga0075365_10150418
1327 Ga0075365_10154768
1328 Ga0075365_10536388
1329 Ga0075368_10000838
1330 Ga0075368_10001639
1331 Ga0075368_10170099
1332 Ga0075363_100009411
1333 Ga0075363_100302276
1334 Ga0075363_100553947
1335 Ga0075363_100982277
1336 Ga0075364_10128150
1337 Ga0075364_10485675
1338 Ga0075364_10742082
1339 Ga0070715_10063040
1340 Ga0070716_100012144
1341 Ga0070716_101088412
1342 Ga0070712_100079181
1343 Ga0070712_100107849
1344 Ga0070712_100121246
1345 Ga0070712_100202978
1346 Ga0070712_101014354
1347 Ga0075362_10042194
1348 Ga0075362_10150176
1349 Ga0075362_10167070
1350 Ga0075367_10077749
1351 Ga0075367_10129471
1352 Ga0075367_10172200
1353 Ga0075367_10346154
1354 Ga0075367_10746461
1355 Ga0075369_10015750
1356 Ga0075369_10077278
1357 Ga0075369_10104856
1358 Ga0075369_10109164
1359 Ga0075366_10009092
1360 Ga0075366_10084812
1361 Ga0075366_10366157
1362 Ga0097621_100473854
1363 Ga0075370_10083443
1364 Ga0075370_10099134
1365 Ga0075370_10188880
1366 Ga0075370_10217076
1367 Ga0075370_10518817
1368 Ga0075370_10687856
1369 Ga0075370_10792221
1370 Ga0068865_100106352
1371 Ga0068865_100134925
1372 Ga0068865_100486408
1373 Ga0068865_101049462
1374 Ga0068865_101634796
1375 Ga0097620_100716527
1376 Ga0099825_1035725
1377 Ga0099823_1033450
1378 Ga0099794_10310580
1379 Ga0099795_10420302
1380 Ga0105240_10005310
1381 Ga0105240_10029763
1382 Ga0105240_10092127
1383 Ga0105240_11067433
1384 Ga0111539_10419589
1385 Ga0105245_10144713
1386 Ga0105245_10453572
1387 Ga0105245_10869902
1388 Ga0105245_11055864
1389 Ga0105247_10107152
1390 Ga0105247_11708364
1391 Ga0105243_10274852
1392 Ga0105243_11121110
1393 Ga0105243_11372652
1394 Ga0105243_11716263
1395 Ga0105243_11874069
1396 Ga0105243_12640293
1397 Ga0105241_10173482
1398 Ga0105241_10918119
1399 Ga0105241_11059685
1400 Ga0105241_12288879
1401 Ga0105242_10291632
1402 Ga0105248_10184583
1403 Ga0105248_11036153
1404 Ga0105248_11617383
1405 Ga0105248_11934715
1406 Ga0105248_11953603
1407 Ga0105237_10052970
1408 Ga0105237_10055134
1409 Ga0105237_10115363
1410 Ga0105237_10380433
1411 Ga0105237_11676315
1412 Ga0105237_11734707
1413 Ga0105238_10096450
1414 Ga0105238_11991246
1415 Ga0105249_10350366
1416 Ga0105249_10990339
1417 Ga0105249_11143085
1418 Ga0105249_11851787
1419 Ga0099796_10022044
1420 Ga0099796_10067417
1421 Ga0099796_10255364
1422 Ga0105239_10019285
1423 Ga0105239_10271510
1424 Ga0105239_10527690
1425 Ga0105239_10715804
1426 Ga0105239_11314257
1427 Ga0105239_11528042
1428 Ga0105239_11724026
1429 Ga0105239_12171892
1430 Ga0105239_13250119
1431 Ga0105246_10045131
1432 Ga0105246_10790338
1433 Ga0105246_11405721
1434 Ga0105246_11633627
1435 Ga0157370_11749053
1436 Ga0157369_10087077
1437 Ga0157369_10922613
1438 Ga0157374_10624053
1439 Ga0157374_10999916
1440 Ga0157378_10023539
1441 Ga0157378_10551974
1442 Ga0163162_10101682
1443 Ga0163162_10456872
1444 Ga0163162_10760946
1445 Ga0163162_10886257
1446 Ga0163162_11106090
1447 Ga0163162_11619985
1448 Ga0157372_10147969
1449 Ga0157375_10415757
1450 Ga0163163_10171873
1451 Ga0163163_10179618
1452 Ga0163163_10417607
1453 Ga0163163_11592400
1454 Ga0157380_11622522
1455 Ga0182008_10367720
1456 Ga0157379_10075681
1457 Ga0157379_10946410
1458 Ga0157376_10901405
1459 Ga0182005_1148057
1460 Ga0163161_10401870
1461 Ga0163161_10546167
1462 Ga0163161_12041113
1463 Ga0206356_11101795
1464 Ga0206350_11568595
1465 Ga0214544_1000011
1466 Ga0214542_1000009
1467 Ga0214545_1000007
1468 Ga0214543_1000020
1469 Ga0213873_10007009
1470 Ga0213876_10001785
1471 Ga0213876_10271545
1472 Ga0213876_10793367
1473 Ga0224575_103461
1474 Ga0228598_1021839
1475 Ga0209563_100662
1476 Ga0209677_102831
1477 Ga0209148_1001000
1478 Ga0209455_1014091
1479 Ga0209455_1052029
1480 Ga0209673_1057707
1481 Ga0209564_1002110
1482 Ga0209564_1074784
1483 Ga0209758_1000206
1484 Ga0209758_1001109
1485 Ga0209758_1001267
1486 Ga0209758_1001347
1487 Ga0209758_1003015
1488 Ga0209758_1046625
1489 Ga0209758_1051293
1490 Ga0209758_1066050
1491 Ga0209256_1009375
1492 Ga0209256_1025126
1493 Ga0209256_1040740
1494 Ga0209256_1092325
1495 Ga0207426_1000799
1496 Ga0207426_1001011
1497 Ga0207426_1016058
1498 Ga0207426_1062557
1499 Ga0209051_1057036
1500 Ga0209257_1000394
1501 Ga0209257_1073716
1502 Ga0207697_10040925
1503 Ga0207697_10516397
1504 Ga0207656_10144332
1505 Ga0207692_10000229
1506 Ga0207692_10017900
1507 Ga0207692_10022882
1508 Ga0207642_10488223
1509 Ga0207642_11101092
1510 Ga0207710_10270099
1511 Ga0207688_10080948
1512 Ga0207688_10085817
1513 Ga0207680_10332906
1514 Ga0207647_10000666
1515 Ga0207647_10030786
1516 Ga0207647_10436727
1517 Ga0207647_10646773
1518 Ga0207685_10383428
1519 Ga0207699_10000242
1520 Ga0207699_10028744
1521 Ga0207699_10992302
1522 Ga0207645_10286533
1523 Ga0207643_10139004
1524 Ga0207705_10326558
1525 Ga0207654_10096744
1526 Ga0207654_10431646
1527 Ga0207707_10045519
1528 Ga0207707_10096707
1529 Ga0207695_10000006
1530 Ga0207695_11047133
1531 Ga0207671_10031050
1532 Ga0207671_10072946
1533 Ga0207671_10317470
1534 Ga0207671_10424265
1535 Ga0207671_10855664
1536 Ga0207671_11073666
1537 Ga0207693_10019358
1538 Ga0207693_10030703
1539 Ga0207693_10078755
1540 Ga0207693_10145064
1541 Ga0207693_10558348
1542 Ga0207663_10010554
1543 Ga0207663_10020883
1544 Ga0207663_10028190
1545 Ga0207663_10050487
1546 Ga0207663_10489033
1547 Ga0207660_10064743
1548 Ga0207660_10097345
1549 Ga0207660_11211818
1550 Ga0207657_10304852
1551 Ga0207657_10463605
1552 Ga0207649_10669358
1553 Ga0207649_10994823
1554 Ga0207649_11044015
1555 Ga0207652_10302653
1556 Ga0207652_11387261
1557 Ga0207681_10279959
1558 Ga0207681_10700305
1559 Ga0207694_10026352
1560 Ga0207694_10581024
1561 Ga0207650_10155963
1562 Ga0207659_11001280
1563 Ga0207687_10015530
1564 Ga0207687_10374910
1565 Ga0207687_11184652
1566 Ga0207700_10024263
1567 Ga0207700_10090867
1568 Ga0207700_10785940
1569 Ga0207700_11916042
1570 Ga0207664_10347792
1571 Ga0207664_10440266
1572 Ga0207664_10523687
1573 Ga0207644_10084782
1574 Ga0207706_10024351
1575 Ga0207706_10166211
1576 Ga0207706_11253479
1577 Ga0207686_10203590
1578 Ga0207709_10322478
1579 Ga0207709_11308508
1580 Ga0207709_11651221
1581 Ga0207669_10567335
1582 Ga0207669_11111475
1583 Ga0207704_10488886
1584 Ga0207704_11016289
1585 Ga0207665_10009934
1586 Ga0207665_10029272
1587 Ga0207665_10198073
1588 Ga0207691_10041304
1589 Ga0207711_10107052
1590 Ga0207711_10471297
1591 Ga0207711_10964760
1592 Ga0207689_10199543
1593 Ga0207689_10297792
1594 Ga0207679_10373457
1595 Ga0207679_10952536
1596 Ga0207679_12062900
1597 Ga0207667_10020145
1598 Ga0207667_10026155
1599 Ga0207667_10553523
1600 Ga0207667_10893107
1601 Ga0207667_11363590
1602 Ga0207651_11179231
1603 Ga0207712_10537328
1604 Ga0207712_11740821
1605 Ga0207668_10044853
1606 Ga0207668_10098525
1607 Ga0207640_10003411
1608 Ga0207640_10314746
1609 Ga0207640_10768331
1610 Ga0207640_10785565
1611 Ga0207640_12178109
1612 Ga0207658_10484606
1613 Ga0207677_10105238
1614 Ga0207677_10200525
1615 Ga0207677_11183897
1616 Ga0207703_10167720
1617 Ga0207703_10635946
1618 Ga0207703_11293637
1619 Ga0207639_10007946
1620 Ga0207639_10634740
1621 Ga0207639_11671874
1622 Ga0207678_10072189
1623 Ga0207678_10139159
1624 Ga0207678_10189576
1625 Ga0207678_10261273
1626 Ga0207678_10370810
1627 Ga0207678_10519886
1628 Ga0207678_11982649
1629 Ga0207702_10094732
1630 Ga0207702_10215699
1631 Ga0207702_10694345
1632 Ga0207702_10882907
1633 Ga0207641_10189800
1634 Ga0207648_10310066
1635 Ga0207648_10480900
1636 Ga0207648_11012023
1637 Ga0207676_11060082
1638 Ga0207674_10151209
1639 Ga0207674_10536929
1640 Ga0207675_100319399
1641 Ga0207683_10239285
1642 Ga0207683_10258732
1643 Ga0207683_11287893
1644 Ga0207698_10009622
1645 Ga0207698_10117597
1646 Ga0207698_10194042
1647 Ga0207698_10678094
1648 Ga0207698_11643708
1649 Ga0207698_12268144
1650 Ga0209389_1000034
1651 Ga0209389_1000039
1652 Ga0209589_1000038
1653 Ga0209489_100023
1654 Ga0209489_100087
1655 Ga0209700_100090
1656 Ga0209179_1141654
1657 Ga0209813_10002337
1658 Ga0209813_10208643
1659 Ga0268266_10107532
1660 Ga0268266_10150605
1661 Ga0268266_10202279
1662 Ga0268266_10500186
1663 Ga0268265_10040061
1664 Ga0268265_10285384
1665 Ga0268264_11432346
1666 Ga0307517_10188478
1667 Ga0265330_10052981
1668 Ga0265330_10062358
1669 Ga0265330_10064703
1670 Ga0265332_10064212
1671 Ga0265328_10037603
1672 Ga0265328_10054793
1673 Ga0265325_10016362
1674 Ga0265340_10011726
1675 Ga0265340_10517798
1676 Ga0265339_10091647
1677 Ga0265339_10125098
1678 Ga0265339_10141105
1679 Ga0265339_10234071
1680 Ga0265331_10139281
1681 Ga0265331_10145463
1682 Ga0265331_10259707
1683 Ga0265331_10337385
1684 Ga0265316_10354726
1685 Ga0265316_10387372
1686 Ga0265316_10448345
1687 Ga0265316_10471349
1688 Ga0307509_10139692
1689 Ga0265313_10080822
1690 Ga0307508_10352242
1691 Ga0307508_10724455
1692 Ga0265314_10010709
1693 Ga0265342_10004756
1694 Ga0265342_10124830
1695 Ga0307516_10578230
1696 Ga0307405_10694911
1697 Ga0307405_11905850
1698 Ga0307413_11719328
1699 Ga0307406_12058479
1700 Ga0307416_101588531
1701 Ga0307414_10966732
1702 Ga0307414_11118879
1703 Ga0307415_100186945
1704 Ga0307415_101108416
1705 Ga0307415_101744653
1706 Ga0307507_10335433
1707 Ga0307510_10029008
1708 Ga0307510_10543663
1709 Ga0373944_0027117
1710 Ga0373923_0039597
1711 Ga0373936_0013718
1712 Ga0373936_0027229
1713 Ga0373939_0140823
1714 Ga0373941_0265208
1715 Ga0373945_0001999
1716 Ga0373954_0242302
1717 Ga0373943_0012127
1718 Ga0373955_0010034
1719 Ga0373962_0129060
1720 Ga0373931_0238478
1721 Ga0373931_0530921
1722 Ga0373935_0000800
1723 Ga0373935_0614187
1724 Ga0373927_0000666
1725 Ga0373933_0566854
1726 Ga0373937_0015543
1727 Ga0373937_0062254
1728 Ga0373937_1173716
1729 Ga0373925_0008568
1730 Ga0373925_1375616
1731 Ga0395900_0001340
1732 Ga0395900_1182787
1733 Ga0395898_0005324
1734 Ga0395898_1445006
1735 Ga0395905_0006516
1736 Ga0395905_0323135
1737 Ga0395905_0837332
1738 Ga0395905_1133897
1739 Ga0395905_1377442
1740 Ga0395901_0007542
1741 Ga0395901_0289239
1742 Ga0395901_1373431
1743 Ga0436365_0165598
1744 Ga0436365_0657145
1745 Ga0436365_0801580
1746 Ga0436365_1544802
1747 Ga0436365_1727831
1748 Ga0436360_1050844
1749 Ga0436363_0139435
1750 Ga0436363_0465325
1751 Ga0436363_0783763
1752 Ga0436362_1167635
1753 Ga0436362_1295510
1754 Ga0451791_1866899
1755 Ga0451793_0234425
1756 Ga0451797_0114101
1757 Ga0451795_0118586
1758 Ga0451802_2074404
1759 Ga0451807_0956237
1760 Ga0451807_2333451
1761 Ga0451835_0181475
1762 Ga0451845_0824977
1763 Ga0451849_0844733
1764 Ga0451843_1376612
1765 Ga0451855_0055418
1766 Ga0451853_1565872
1767 Ga0451853_3946027
1768 Ga0439459_0025420
1769 Ga0466969_0149159
1770 Ga0466972_0088356
1771 Ga0466965_0700870
1772 Ga0466966_0013642
1773 Ga0466966_0249136
1774 Ga0466961_0000558
1775 Ga0466963_0125044
1776 Ga0466971_0062059
1777 Ga0466971_0412983
1778 Ga0466968_0573845
1779 Ga0466960_0086941
1780 Ga0466960_0088135
1781 Ga0466959_0150201
1782 Ga0466959_0293594
1783 Ga0466967_0397288
1784 Ga0495617_218053
1785 Ga0495592_0024886
1786 Ga0495592_0768892
1787 Ga0495603_0000206
1788 Ga0495603_0105026
1789 Ga0495590_0136332
1790 Ga0495629_0000338
1791 Ga0495629_0002176
1792 Ga0495638_0003637
1793 Ga0495641_0005602
1794 Ga0495651_0044341
1795 Ga0495651_0155119
1796 Ga0495651_0397649
1797 Ga0495653_0112657
1798 Ga0495580_0003372
1799 Ga0495582_0000423
1800 Ga0495582_0220606
1801 Ga0495605_0077839
1802 Ga0495605_0192928
1803 Ga0495639_0000039
1804 Ga0495639_0330787
1805 Ga0495639_0606631
1806 Ga0495662_0004133
1807 Ga0495664_0000847
1808 Ga0495664_0111135
1809 Ga0495584_0283649
1810 Ga0495584_0488166
1811 Ga0495594_0006206
1812 Ga0495594_0503997
1813 Ga0495596_0197978
1814 Ga0495596_0374919
1815 Ga0495607_0249394
1816 Ga0495583_0138794
1817 Ga0495606_0005948
1818 Ga0495606_0105646
1819 Ga0495606_0123928
1820 Ga0495608_0332238
1821 Ga0495610_0043333
1822 Ga0495610_0342266
1823 Ga0495616_0038082
1824 Ga0495616_0132259
1825 Ga0495618_0081765
1826 Ga0495618_0114807
1827 Ga0495620_0022772
1828 Ga0495620_0110632
1829 Ga0495620_0216518
1830 Ga0495628_0020083
1831 Ga0495628_0321728
1832 Ga0495630_0002808
1833 Ga0495631_0198376
1834 Ga0495631_0313464
1835 Ga0495632_0150242
1836 Ga0495632_0264694
1837 Ga0495643_0123112
1838 Ga0495643_0248761
1839 Ga0495643_0284270
1840 Ga0495648_0018514
1841 Ga0495648_0077660
1842 Ga0495666_0028687
1843 Ga0495666_0392084
1844 Ga0495652_0424179
1845 Ga0495652_0975551
1846 Ga0495654_0213818
1847 Ga0495665_0316575
1848 Ga0495640_0034933
1849 Ga0495640_0035609
1850 Ga0495609_0109965
1851 Ga0495597_0031555
1852 Ga0495597_0068663
1853 Ga0495622_0013395
1854 Ga0495622_0058693
1855 Ga0495667_0006278
1856 Ga0495668_0105757
1857 Ga0495634_0000776
1858 Ga0495634_0045232
1859 Ga0495634_0117832
1860 Ga0495611_0204822
1861 Ga0495625_0130144
1862 Ga0495625_0344503
1863 Ga0495635_0001246
1864 Ga0495635_0156040
1865 Ga0495588_0002998
1866 Ga0495588_0013921
1867 Ga0495657_0004548
1868 Ga0495657_0163833
1869 Ga0495657_0202761
1870 Ga0495657_0495180
1871 Ga0495599_0314930
1872 Ga0495623_0116717
1873 Ga0495623_0321274
1874 Ga0495623_0338090
1875 Ga0495646_0202724
1876 Ga0495646_0275801
1877 Ga0495647_0001044
1878 Ga0495658_0000687
1879 Ga0495669_0234087
1880 Ga0495613_0001857
1881 Ga0495613_0011844
1882 Ga0495624_0003908
1883 Ga0495649_0077025
1884 Ga0495649_0284591
1885 Ga0495649_0593727
1886 Ga0495589_0095970
1887 Ga0495600_0008582
1888 Ga0495600_0187212
1889 Ga0495600_0238802
1890 Ga0495600_0630139
1891 Ga0495660_0156750
1892 Ga0495660_0284086
1893 Ga0495581_0000006
1894 Ga0495581_0146908
1895 Ga0495604_0014161
1896 Ga0495674_0002636
1897 Ga0495672_0272711
1898 Ga0495676_0045171
1899 Ga0495680_0074399
1900 Ga0495680_0278081
1901 Ga0495683_0045400
1902 Ga0495683_0199158
1903 Ga0495687_075690
1904 Ga0495687_223117
1905 Ga0495677_0316880
1906 Ga0495673_0036359
1907 Ga0495684_0053162
1908 Ga0495684_0554012
1909 Ga0495686_0318563
1910 Ga0495686_0362894
1911 Ga0495593_0000032
1912 Ga0495602_0138950
1913 Ga0495614_0031476
1914 Ga0495614_0343850
1915 Ga0495626_0080213
1916 Ga0496100_0098042
1917 Ga0496100_0208245
1918 Ga0496100_0238632
1919 Ga0496100_0391004
1920 Ga0496100_0721687
1921 Ga0496101_0031612
1922 Ga0496101_0035824
1923 Ga0496101_0146357
1924 Ga0496101_0350188
1925 Ga0496101_0357722
1926 Ga0496101_0404754
1927 Ga0496101_0536457
1928 Ga0496101_0822489
1929 Ga0496102_0006237
1930 Ga0496102_0156191
1931 Ga0496102_0277617
1932 Ga0496102_0849158
1933 Ga0496103_0014126
1934 Ga0496103_0934490
1935 Ga0496104_0024484
1936 Ga0496104_0047099
1937 Ga0496104_0283464
1938 Ga0496104_0354234
1939 Ga0496104_0390401
1940 Ga0496104_1130082
1941 Ga0496105_0108566
1942 Ga0496105_0117313
1943 Ga0496105_0125438
1944 Ga0496105_1289912
1945 Ga0496106_0056082
1946 Ga0496106_0081865
1947 Ga0496106_0175282
1948 Ga0496106_0580283
1949 Ga0496106_0808172
1950 Ga0496106_1509940
1951 Ga0496107_0040809
1952 Ga0496107_0234497
1953 Ga0496107_0509866
1954 Ga0496107_0833102
1955 Ga0496108_0008957
1956 Ga0496108_0146647
1957 Ga0496108_0424225
1958 Ga0496108_0436706
1959 Ga0496109_0020552
1960 Ga0496109_0069711
1961 Ga0496109_0592670
1962 Ga0496109_0612735
1963 Ga0496110_0051284
1964 Ga0496110_0257806
1965 Ga0496110_0301193
1966 Ga0496110_0316974
1967 Ga0496110_0355092
1968 Ga0496110_0549553
1969 Ga0496110_0747888
1970 Ga0496111_0327383
1971 Ga0496111_0426511
1972 Ga0496111_0458900
1973 Ga0496111_0631743
1974 Ga0496112_0000029
1975 Ga0496112_0054801
1976 Ga0496112_0070474
1977 Ga0496112_0124542
1978 Ga0496112_0451914
1979 Ga0496112_0510875
1980 Ga0496113_0096906
1981 Ga0496113_0305377
1982 Ga0496113_0620375
1983 Ga0496113_0841429
1984 Ga0496113_0963187
1985 Ga0496114_0021565
1986 Ga0496114_0295797
1987 Ga0496114_0392840
1988 Ga0496115_0063385
1989 Ga0496115_0149336
1990 Ga0496115_0215610
1991 Ga0496115_0274747
1992 Ga0496115_0298016
1993 Ga0496115_0779387
1994 Ga0496116_0063414
1995 Ga0496117_0063496
1996 Ga0496117_0176090
1997 Ga0496117_0263275
1998 Ga0496118_0061109
1999 Ga0496118_0210262
2000 Ga0496119_0004759
2001 Ga0496119_0162193
2002 Ga0496119_0506767
2003 Ga0496120_0011234
2004 Ga0496120_0278911
2005 Ga0496120_0483551
2006 Ga0496121_0067065
2007 Ga0496121_0076862
2008 Ga0496121_0109120
2009 Ga0496121_0233292
2010 Ga0496121_0298971
2011 Ga0496122_0349071
2012 Ga0496123_0245719
2013 Ga0496124_0199891
2014 Ga0496124_0237878
2015 Ga0496124_0783328
2016 Ga0496125_0074304
2017 Ga0496125_0239845
2018 Ga0496125_0413741
2019 Ga0496126_0021452
2020 Ga0496126_0067946
2021 Ga0496126_0269263
2022 Ga0496126_0320161
2023 Ga0496126_0400598
2024 Ga0496126_0462816
2025 Ga0496126_0905477
2026 Ga0495682_0050610
2027 Ga0495682_0319092
2028 Ga0501067_0049759
2029 Ga0501076_0363520
2030 nmdc:mga03683_150490_c1
2031 nmdc:mga03683_199845_c1
2032 nmdc:mga03683_252943_c1
2033 nmdc:mga03n38_30594_c1
2034 nmdc:mga03n38_504504_c1
2035 nmdc:mga00v17_205784_c1
2036 nmdc:mga00v17_433927_c1
2037 nmdc:mga00v17_51191_c1
2038 nmdc:mga00v17_552923_c1
2039 nmdc:mga0yw44_165693_c1
2040 nmdc:mga0yw44_290032_c1
2041 nmdc:mga0yw44_314787_c1
2042 nmdc:mga0yw44_430470_c1
2043 nmdc:mga0yw44_489999_c1
2044 nmdc:mga0yw44_52059_c2
2045 nmdc:mga0yw44_89419_c1
2046 nmdc:mga0k408_193427_c1
2047 nmdc:mga0k408_351600_c1
2048 nmdc:mga0k408_535205_c1
2049 nmdc:mga0k408_85455_c1
2050 nmdc:mga06z11_110142_c1
2051 nmdc:mga06z11_145484_c1
2052 nmdc:mga06z11_594653_c1
2053 nmdc:mga06z11_803530_c1
2054 nmdc:mga06z11_869202_c1
2055 nmdc:mga06z11_98777_c1
2056 nmdc:mga04h51_239456_c1
2057 nmdc:mga04h51_30802_c1
2058 nmdc:mga07m45_107885_c1
2059 nmdc:mga07m45_148537_c1
2060 nmdc:mga07m45_157563_c1
2061 nmdc:mga07m45_276925_c1
2062 nmdc:mga07m45_360449_c1
2063 nmdc:mga07m45_511601_c1
2064 nmdc:mga08x19_555763_c1
2065 nmdc:mga0sz30_117318_c1
2066 nmdc:mga0sz30_423468_c1
2067 nmdc:mga0sz30_46487_c1
2068 nmdc:mga0sz30_56744_c1
2069 nmdc:mga0sz30_57816_c1
2070 Ga0495601_0399700
2071 Ga0495601_0479505
2072 Ga0495612_0063222
2073 Ga0500635_0052270
2074 Ga0500635_0104445
2075 Ga0495655_0036092
2076 Ga0495655_0228197
2077 Ga0495655_0318806
2078 Ga0495655_0331075
2079 Ga0495619_0521281
2080 Ga0500578_0089840
2081 Ga0500644_0416289
2082 Ga0500647_0152105
2083 Ga0500647_0258320
2084 Ga0500647_0292036
2085 Ga0500651_0161790
2086 Ga0500651_0221522
2087 Ga0500566_0000270
2088 Ga0500566_0000780
2089 Ga0500640_000397
2090 Ga0500641_0220012
2091 Ga0500648_205690
2092 Ga0500650_0098641
2093 Ga0500556_0011510
2094 Ga0500557_000079
2095 Ga0500562_017834
2096 Ga0500569_106447
2097 Ga0500572_001115
2098 Ga0500572_001993
2099 Ga0500591_054386
2100 Ga0500595_133684
2101 Ga0500595_184201
2102 Ga0500608_006525
2103 Ga0500608_290587
2104 Ga0500614_003198
2105 Ga0500642_0000084
2106 Ga0500642_0129229
2107 Ga0500655_026358
2108 Ga0500658_0094183
2109 Ga0500658_0219063
2110 Ga0500559_0000775
2111 Ga0500559_0001813
2112 Ga0500559_0187609
2113 Ga0500568_0141164
2114 Ga0500590_174738
2115 Ga0500603_000151
2116 Ga0500603_071439
2117 Ga0500604_0076153
2118 Ga0500604_0205667
2119 Ga0500616_0023318
2120 Ga0500622_0017062
2121 Ga0500630_003510
2122 Ga0500633_0219779
2123 Ga0500638_004618
2124 Ga0500638_139274
2125 Ga0500639_000065
2126 Ga0500639_166687
2127 Ga0500639_322199
2128 Ga0500637_0140051
2129 Ga0500649_056880
2130 Ga0500576_021808
2131 Ga0500611_199520
2132 Ga0500625_072389
2133 Ga0500645_046585
2134 Ga0500609_002762
2135 Ga0500656_005804
2136 Ga0500552_001347
2137 Ga0500596_000494
2138 Ga0500596_003534
2139 Ga0500596_030737
2140 Ga0500599_000973
2141 Ga0500601_000768
2142 Ga0500601_026213
2143 Ga0500661_018802
2144 Ga0500661_040852
2145 Ga0530510_0333709
2146 2507505993
2147 2508540181
2148 2508696255
2149 2511397332
2150 2513624904
2151 2513638263
2152 2513649101
2153 2513716255
2154 2513877176
2155 2514014545
2156 2515628464
2157 2517103183
2158 2524440763
2159 2528850758
2160 2617347876
2161 2617374798
2162 2745076004
2163 2793061473
2164 2805916225
2165 2818240492
2166 2824666901
2167 2824674079
2168 2824683879
2169 2824690745
2170 2824704227
2171 2824710968
2172 2824737927
2173 2824752192
2174 2824760342
2175 2824772490
2176 2824776347
2177 2838125014
2178 2841945753
2179 2841956852
2180 2841973588
2181 2841981934
2182 2841989476
2183 2842044461
2184 2842051550
2185 2844316335
2186 2847939365
2187 2847941121
2188 2849082107
2189 2874596270
2190 2874622548
2191 2874633461
2192 2874650257
2193 2876763658
2194 2876776735
2195 2876824525
2196 2879080872
2197 2879087038
2198 2879104369
2199 2879133717
2200 2879148219
2201 2881669756
2202 2885367826
2203 2885412976
2204 2888387167
2205 2888389858
2206 2903728331
2207 2904671445
2208 2904719737
2209 2906606471
2210 2906631364
2211 2906646708
2212 2908777280
2213 2922389447
2214 2922398436
2215 2929622136
2216 2929630219
2217 2932787859
2218 2932795977
2219 2932807554
2220 2932817583
2221 2932826257
2222 2932835113
2223 2933584248
2224 2935614418
2225 2935620491
2226 2935640813
2227 2935649447
2228 2935657781
2229 2935670316
2230 2935679746
2231 2935687315
2232 2935696714
2233 2935709194
2234 2935718774
2235 2935728426
2236 2935736977
2237 2935746020
2238 2935753281
2239 2935766326
2240 2935770285
2241 2935777688
2242 2935786662
2243 2935794716
2244 2935809008
2245 2935813813
2246 2935826636
2247 2935832320
2248 2935844025
2249 2935851070
2250 2935862817
2251 2935864560
2252 2935875088
2253 2935890232
2254 2935913120
2255 2935922542
2256 2935930955
2257 2935939711
2258 2935946660
2259 2935956139
2260 2935965045
2261 2935972932
2262 2935978152
2263 2935985724
2264 2935999293
2265 2936005848
2266 2936012000
2267 2936020919
2268 2936029293
2269 2936039369
2270 2936048383
2271 2936056506
2272 2940559194
2273 2941534518
2274 2941541888
2275 3005491142
2276 3005510983
2277 3005591828
2278 3005595946
2279 3005719138
2280 8006931475
2281 8016517188
2282 8016527056
2283 8016545347
2284 8016556740
2285 8016570435
2286 8016582967
2287 8016585333
2288 8016602745
2289 8016605604
2290 8016624052
2291 8016634814
2292 8017059400
2293 8019531956
2294 8019539582
2295 8019551075
2296 8019576218
2297 8019594094
2298 8019607470
2299 8019611040
2300 8019621890
2301 8019631433
2302 8019651328
2303 8019668246
2304 8019677699
2305 8019687243
2306 8019693225
2307 8055743613
2308 8056681587
2309 8056692936
2310 8056974080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11011

DUF2849

Protein of unknown function (DUF2849)

16

102

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ra2-assembly1.cif.gz_A x-ray structure of the q7cpv8 protein from salmonella typhimurium at the resolution 1.9 a. northeast structural genomics consortium target str88a 0.6339 14 37
5cai-assembly1.cif.gz_A crystal structure of a putative lipoprotein from the duf903 family (kpn_03160) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.30 a resolution 0.5957 12 37
6hah-assembly1.cif.gz_A crystal structure of paf - p-sulfonatocalix[6]arene complex 0.4871 15 47
7vtk-assembly1.cif.gz_A crystal structure of glycoside hydrolases family 64 beta-1,3-glucanase 0.4671 13 48
7unf-assembly1.cif.gz_U cryoem structure of a meak7 bound human v-atpase complex 0.4558 5 29
ID Description Score Start End Superfamily
af_Q9W4N2_488_788_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.6303 7 37 3.30.470.30
af_Q5A6S0_10_141_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.5746 66 83 2.30.30.30
af_P48360_55_360_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.5121 62 88 3.50.50.60
af_Q9FHB0_225_327_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.5089 68 99 2.40.330.10
af_Q9VSI1_5_198_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5041 71 92 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A350AFY8-F1-model_v4 DUF2849 domain-containing protein 0.9545 14 52
AF-A0A523G486-F1-model_v4 DUF2849 domain-containing protein 0.9333 14 97
AF-A0A1E3W2T4-F1-model_v4 Nitrite reductase 0.9228 14 98
AF-A0A3D3WIW3-F1-model_v4 DUF2849 domain-containing protein 0.9153 14 94 GO:0046872
GO:0051536
AF-A0A2E6YPC1-F1-model_v4 Sulfite reductase 0.9131 10 95

Map