F490915
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1154 | 501 | 926 | 297 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|637000220|637323457 |
| Length | 327 |
| Sequence | ARFRRARAKPDDRSAVHSSPHLANENSSMPTPQVETVKLDELNCWRIRHGDAELLVAQQGAHILSYQVAGQQPLIWLNDEAVFKRGKSIRAGVPVCWPWFGNFARNPQAVQAMRQGTDPAPAHGLVRATDWELLGIESQGDSLLVELRLPCPAGGFPGWPHQVEPRLSIRLDQQLHISLSSHNLGTESVSISQALHSYFAVSDVRQVQVEGVDGLSYIETLEDWKTKVQSGSLHFTGETDRIYLNAPTQLEIVDPDWQRRIRLRSEGSRTAVIWNPWIDRAAQFSDMADDGWQRMLCIETANVMDDIVTLAPGASHTLSVSISAAPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 7 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 8 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 9 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 10 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 11 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 12 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 13 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 14 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 15 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 16 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 17 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 18 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 19 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 20 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 21 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 22 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 23 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 24 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 25 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 26 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 27 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 28 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 29 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 30 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 31 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 32 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 33 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 34 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 35 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 36 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 37 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 38 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 39 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 40 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 41 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 42 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 43 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 44 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 45 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 46 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 47 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 48 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 49 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 50 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 51 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 52 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 53 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 54 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 55 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 56 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 57 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 58 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 59 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 60 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 61 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 62 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 63 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 64 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 65 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 66 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 67 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 68 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 69 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 70 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 71 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 72 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 73 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 74 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 75 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 76 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 77 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 78 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 79 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 80 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 81 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 82 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 83 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 84 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 85 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 86 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 87 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 88 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 89 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 90 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 91 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 92 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 93 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 94 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 95 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 96 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 97 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 98 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 99 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 100 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 101 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 102 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 103 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 104 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 105 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 106 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 107 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 108 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 109 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 110 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 111 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 112 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 113 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 114 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 115 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 116 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 117 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 118 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 119 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 120 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 121 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 122 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 123 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 124 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 125 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 126 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 127 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 128 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 129 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 130 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 131 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 132 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 133 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 134 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 135 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 136 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 137 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 138 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 139 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 140 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 141 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 142 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 143 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 144 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 145 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 146 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 147 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 148 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 149 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 150 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 151 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 152 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 153 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 154 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 155 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 156 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 157 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 158 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 159 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 160 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 161 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 162 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 163 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 164 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 165 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 166 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 167 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 168 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 169 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 170 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 171 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 172 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 173 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 174 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 175 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 176 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 177 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 178 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 179 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 180 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 181 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 182 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 183 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 184 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 185 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 186 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 187 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 188 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 189 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 190 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 191 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 192 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 193 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 194 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 195 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 196 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 197 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 198 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 199 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 200 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 201 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 202 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 203 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 204 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 205 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 206 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 207 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 208 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 209 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 210 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 211 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 212 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 213 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 214 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 215 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 216 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 217 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 218 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 219 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 220 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 221 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 222 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 233 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 234 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 235 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 236 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 237 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 238 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 239 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 240 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 250 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 251 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 259 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 260 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 261 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 262 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 264 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 265 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 275 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 277 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 279 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 299 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 300 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 305 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 307 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 308 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 309 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 310 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 311 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 312 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 313 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 314 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 315 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 316 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 317 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 318 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 319 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 320 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 321 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 322 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 323 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 324 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 325 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 326 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 327 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 328 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 329 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 330 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 331 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 332 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 333 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 334 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 335 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 336 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 337 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 338 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 339 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 340 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 341 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 342 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 343 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 344 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 345 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 346 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 347 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 348 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 349 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 350 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 351 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 352 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 353 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 354 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 355 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 356 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 357 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 358 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 359 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 360 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 361 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 362 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 363 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 364 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 441 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 442 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 443 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 444 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 445 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 446 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 447 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 448 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 449 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 450 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 451 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 452 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 453 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 454 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 455 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 456 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 457 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 458 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 465 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 467 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 468 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 472 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 473 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 474 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 475 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 476 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 477 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 478 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 479 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 480 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 481 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 482 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 483 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 484 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 485 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 486 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 487 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 488 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 489 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 490 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 491 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 492 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 493 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 494 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 495 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 496 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 497 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 498 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 499 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 500 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 501 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.24 |
| Metatranscriptomes | 0 |
| Isolates | 19.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.81 |
| Nodule | 2.34 |
| Rhizoplane | 6.33 |
| Rhizosphere | 71.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_41 | 2124908027 | Bacteria | 51011 |
| 2 | MRS2a_Contig_973 | 2124908027 | Bacteria | 3358 |
| 3 | SwRhRL2b_contig_2143161 | 2162886007 | Bacteria | 1188 |
| 4 | JGI25162J39368_1000082 | 3300002737 | Bacteria | 112599 |
| 5 | JGI25162J39368_1000282 | 3300002737 | Bacteria | 47984 |
| 6 | JGI25163J39215_1001247 | 3300002771 | Bacteria | 4660 |
| 7 | JGI25163J39215_1001473 | 3300002771 | Bacteria | 3816 |
| 8 | JGI25164J39214_1000058 | 3300002772 | Bacteria | 112599 |
| 9 | JGI25164J39214_1000212 | 3300002772 | Bacteria | 47984 |
| 10 | JGI25165J46597_1000154 | 3300003214 | Bacteria | 112599 |
| 11 | JGI25165J46597_1000383 | 3300003214 | Bacteria | 47984 |
| 12 | rootH2_10020520 | 3300003320 | Bacteria | 37566 |
| 13 | rootH1_10191543 | 3300003323 | Bacteria | 1338 |
| 14 | Ga0055539_1000017 | 3300003752 | Bacteria | 353873 |
| 15 | Ga0055533_1000021 | 3300003756 | Bacteria | 353826 |
| 16 | Ga0055532_1000020 | 3300003758 | Bacteria | 270853 |
| 17 | Ga0055525_1000078 | 3300003759 | Bacteria | 165788 |
| 18 | Ga0055536_1004543 | 3300003781 | Bacteria | 7053 |
| 19 | Ga0055536_1009458 | 3300003781 | Bacteria | 4031 |
| 20 | Ga0055536_1010847 | 3300003781 | Bacteria | 3561 |
| 21 | Ga0055530_10005470 | 3300003791 | Bacteria | 6021 |
| 22 | Ga0055530_10008701 | 3300003791 | Bacteria | 4019 |
| 23 | Ga0055530_10013792 | 3300003791 | Bacteria | 2736 |
| 24 | Ga0055530_10015687 | 3300003791 | Bacteria | 2460 |
| 25 | Ga0055540_1004724 | 3300003792 | Bacteria | 6021 |
| 26 | Ga0055540_1007682 | 3300003792 | Bacteria | 4019 |
| 27 | Ga0055540_1007709 | 3300003792 | Bacteria | 4009 |
| 28 | Ga0055541_1000012 | 3300003841 | Bacteria | 353826 |
| 29 | Ga0058692_1002657 | 3300003856 | Bacteria | 5886 |
| 30 | Ga0065714_10000439 | 3300005288 | Bacteria | 5396 |
| 31 | Ga0065714_10002271 | 3300005288 | Bacteria | 29440 |
| 32 | Ga0065714_10006312 | 3300005288 | Bacteria | 3356 |
| 33 | Ga0065714_10008133 | 3300005288 | Bacteria | 2642 |
| 34 | Ga0065714_10066861 | 3300005288 | Bacteria | 6187 |
| 35 | Ga0065714_10072674 | 3300005288 | Bacteria | 3322 |
| 36 | Ga0065704_10075102 | 3300005289 | Bacteria | 5789 |
| 37 | Ga0065704_10082411 | 3300005289 | Bacteria | 3604 |
| 38 | Ga0065704_10088544 | 3300005289 | Bacteria | 2931 |
| 39 | Ga0065704_10096819 | 3300005289 | Bacteria | 2419 |
| 40 | Ga0065704_10139376 | 3300005289 | Bacteria | 1522 |
| 41 | Ga0065712_10087006 | 3300005290 | Bacteria | 2603 |
| 42 | Ga0070670_100009258 | 3300005331 | Bacteria | 8414 |
| 43 | Ga0070670_100032384 | 3300005331 | Bacteria | 4502 |
| 44 | Ga0070661_100004654 | 3300005344 | Bacteria | 9450 |
| 45 | Ga0070668_100342115 | 3300005347 | Bacteria | 1264 |
| 46 | Ga0070669_100000186 | 3300005353 | Bacteria | 54020 |
| 47 | Ga0070669_100005487 | 3300005353 | Bacteria | 9155 |
| 48 | Ga0070675_100355856 | 3300005354 | Unclassified | 1299 |
| 49 | Ga0070674_100194995 | 3300005356 | Bacteria | 1560 |
| 50 | Ga0070663_100300775 | 3300005455 | Bacteria | 1284 |
| 51 | Ga0070662_100112437 | 3300005457 | Bacteria | 2076 |
| 52 | Ga0070665_100046440 | 3300005548 | Bacteria | 4363 |
| 53 | Ga0070665_100144180 | 3300005548 | Bacteria | 2385 |
| 54 | Ga0070664_100000292 | 3300005564 | Bacteria | 36276 |
| 55 | Ga0068854_100013801 | 3300005578 | Bacteria | 5312 |
| 56 | Ga0068851_10000039 | 3300005834 | Bacteria | 93193 |
| 57 | Ga0075364_10071835 | 3300006051 | Bacteria | 2280 |
| 58 | Ga0075364_10080097 | 3300006051 | Bacteria | 2159 |
| 59 | Ga0075364_10087710 | 3300006051 | Bacteria | 2062 |
| 60 | Ga0075364_10310727 | 3300006051 | Bacteria | 1073 |
| 61 | Ga0075432_10005388 | 3300006058 | Bacteria | 4361 |
| 62 | Ga0075432_10007561 | 3300006058 | Bacteria | 3702 |
| 63 | Ga0075432_10024934 | 3300006058 | Bacteria | 2051 |
| 64 | Ga0075432_10037262 | 3300006058 | Bacteria | 1692 |
| 65 | Ga0075432_10120714 | 3300006058 | Bacteria | 984 |
| 66 | Ga0075362_10054894 | 3300006177 | Bacteria | 1791 |
| 67 | Ga0075362_10144102 | 3300006177 | Bacteria | 1140 |
| 68 | Ga0075436_100149243 | 3300006914 | Bacteria | 1644 |
| 69 | Ga0099823_1033941 | 3300006944 | Bacteria | 4068 |
| 70 | Ga0079104_1001850 | 3300006946 | Bacteria | 12887 |
| 71 | Ga0079104_1007967 | 3300006946 | Bacteria | 3769 |
| 72 | Ga0105251_10000089 | 3300009011 | Bacteria | 88101 |
| 73 | Ga0105251_10008371 | 3300009011 | Bacteria | 6235 |
| 74 | Ga0105251_10008839 | 3300009011 | Bacteria | 6032 |
| 75 | Ga0105251_10016631 | 3300009011 | Bacteria | 3967 |
| 76 | Ga0105251_10034558 | 3300009011 | Bacteria | 2500 |
| 77 | Ga0105251_10059337 | 3300009011 | Bacteria | 1804 |
| 78 | Ga0105251_10063703 | 3300009011 | Bacteria | 1729 |
| 79 | Ga0105244_10008948 | 3300009036 | Bacteria | 6199 |
| 80 | Ga0105244_10009039 | 3300009036 | Bacteria | 6165 |
| 81 | Ga0105244_10019248 | 3300009036 | Bacteria | 3818 |
| 82 | Ga0105244_10019839 | 3300009036 | Bacteria | 3742 |
| 83 | Ga0105244_10034337 | 3300009036 | Bacteria | 2671 |
| 84 | Ga0105244_10040258 | 3300009036 | Bacteria | 2428 |
| 85 | Ga0105244_10069281 | 3300009036 | Bacteria | 1761 |
| 86 | Ga0105244_10077974 | 3300009036 | Bacteria | 1643 |
| 87 | Ga0105244_10089195 | 3300009036 | Bacteria | 1518 |
| 88 | Ga0105250_10001135 | 3300009092 | Bacteria | 15004 |
| 89 | Ga0105250_10004905 | 3300009092 | Bacteria | 6080 |
| 90 | Ga0105250_10012182 | 3300009092 | Bacteria | 3556 |
| 91 | Ga0105250_10017305 | 3300009092 | Bacteria | 2931 |
| 92 | Ga0105250_10018249 | 3300009092 | Bacteria | 2845 |
| 93 | Ga0105250_10033111 | 3300009092 | Bacteria | 2074 |
| 94 | Ga0111539_10000054 | 3300009094 | Bacteria | 115242 |
| 95 | Ga0105243_10005333 | 3300009148 | Bacteria | 10041 |
| 96 | Ga0105243_10006305 | 3300009148 | Bacteria | 9166 |
| 97 | Ga0105243_10013497 | 3300009148 | Bacteria | 6179 |
| 98 | Ga0105243_10013630 | 3300009148 | Bacteria | 6149 |
| 99 | Ga0105243_10023427 | 3300009148 | Bacteria | 4702 |
| 100 | Ga0105243_10045133 | 3300009148 | Bacteria | 3461 |
| 101 | Ga0105243_10088764 | 3300009148 | Bacteria | 2540 |
| 102 | Ga0105243_10096892 | 3300009148 | Bacteria | 2441 |
| 103 | Ga0105242_10001069 | 3300009176 | Bacteria | 21506 |
| 104 | Ga0105242_10042069 | 3300009176 | Bacteria | 3687 |
| 105 | Ga0105237_10001100 | 3300009545 | Bacteria | 36161 |
| 106 | Ga0105237_10300209 | 3300009545 | Bacteria | 1609 |
| 107 | Ga0105249_10007620 | 3300009553 | Bacteria | 9443 |
| 108 | Ga0105246_10006273 | 3300011119 | Bacteria | 7256 |
| 109 | Ga0105246_10028338 | 3300011119 | Bacteria | 3678 |
| 110 | Ga0105246_10032290 | 3300011119 | Bacteria | 3471 |
| 111 | Ga0105246_10081744 | 3300011119 | Bacteria | 2304 |
| 112 | Ga0157337_1000334 | 3300012483 | Bacteria | 2169 |
| 113 | Ga0157345_1000279 | 3300012498 | Bacteria | 7054 |
| 114 | Ga0157373_10014293 | 3300013100 | Bacteria | 5822 |
| 115 | Ga0157373_10014510 | 3300013100 | Bacteria | 5775 |
| 116 | Ga0157373_10015661 | 3300013100 | Bacteria | 5539 |
| 117 | Ga0157373_10054780 | 3300013100 | Bacteria | 2833 |
| 118 | Ga0157373_10082138 | 3300013100 | Bacteria | 2271 |
| 119 | Ga0157373_10093502 | 3300013100 | Bacteria | 2118 |
| 120 | Ga0157373_10103609 | 3300013100 | Bacteria | 2001 |
| 121 | Ga0157373_10130352 | 3300013100 | Bacteria | 1768 |
| 122 | Ga0157373_10188610 | 3300013100 | Bacteria | 1453 |
| 123 | Ga0157371_10000109 | 3300013102 | Bacteria | 124990 |
| 124 | Ga0157371_10008323 | 3300013102 | Bacteria | 8280 |
| 125 | Ga0157371_10015185 | 3300013102 | Bacteria | 5783 |
| 126 | Ga0157371_10020452 | 3300013102 | Bacteria | 4871 |
| 127 | Ga0157370_10027707 | 3300013104 | Bacteria | 5586 |
| 128 | Ga0157370_10037357 | 3300013104 | Bacteria | 4708 |
| 129 | Ga0157370_10106867 | 3300013104 | Bacteria | 2619 |
| 130 | Ga0157370_10152461 | 3300013104 | Bacteria | 2150 |
| 131 | Ga0157369_10012771 | 3300013105 | Bacteria | 9523 |
| 132 | Ga0157369_10028227 | 3300013105 | Bacteria | 6212 |
| 133 | Ga0157369_10031841 | 3300013105 | Bacteria | 5803 |
| 134 | Ga0157369_10077343 | 3300013105 | Bacteria | 3566 |
| 135 | Ga0157369_10145778 | 3300013105 | Bacteria | 2503 |
| 136 | Ga0157369_10374681 | 3300013105 | Bacteria | 1478 |
| 137 | Ga0163162_10015186 | 3300013306 | Bacteria | 7522 |
| 138 | Ga0163162_10168413 | 3300013306 | Bacteria | 2315 |
| 139 | Ga0163162_10212584 | 3300013306 | Bacteria | 2064 |
| 140 | Ga0157372_10003284 | 3300013307 | Bacteria | 17473 |
| 141 | Ga0157372_10028128 | 3300013307 | Bacteria | 6133 |
| 142 | Ga0157375_10021950 | 3300013308 | Bacteria | 5867 |
| 143 | Ga0157375_10033370 | 3300013308 | Bacteria | 4890 |
| 144 | Ga0157375_10285399 | 3300013308 | Bacteria | 1814 |
| 145 | Ga0157375_10514152 | 3300013308 | Bacteria | 1361 |
| 146 | Ga0182008_10007384 | 3300014497 | Bacteria | 6071 |
| 147 | Ga0182008_10007985 | 3300014497 | Bacteria | 5801 |
| 148 | Ga0182008_10009595 | 3300014497 | Bacteria | 5212 |
| 149 | Ga0182008_10009942 | 3300014497 | Bacteria | 5114 |
| 150 | Ga0182008_10010565 | 3300014497 | Bacteria | 4940 |
| 151 | Ga0182008_10064150 | 3300014497 | Bacteria | 1808 |
| 152 | Ga0182008_10067524 | 3300014497 | Bacteria | 1759 |
| 153 | Ga0182006_1004263 | 3300015261 | Bacteria | 7077 |
| 154 | Ga0182006_1005362 | 3300015261 | Bacteria | 6133 |
| 155 | Ga0182006_1006516 | 3300015261 | Bacteria | 5417 |
| 156 | Ga0182006_1015408 | 3300015261 | Bacteria | 3277 |
| 157 | Ga0182007_10005678 | 3300015262 | Bacteria | 5445 |
| 158 | Ga0182007_10010392 | 3300015262 | Bacteria | 3680 |
| 159 | Ga0182005_1002764 | 3300015265 | Bacteria | 6119 |
| 160 | Ga0182005_1003401 | 3300015265 | Bacteria | 5412 |
| 161 | Ga0182005_1018358 | 3300015265 | Bacteria | 1932 |
| 162 | Ga0163161_10009183 | 3300017792 | Bacteria | 6834 |
| 163 | Ga0163161_10032067 | 3300017792 | Bacteria | 3748 |
| 164 | Ga0163161_10053254 | 3300017792 | Bacteria | 2934 |
| 165 | Ga0163161_10074015 | 3300017792 | Bacteria | 2497 |
| 166 | Ga0163161_10182217 | 3300017792 | Bacteria | 1611 |
| 167 | Ga0163161_10225644 | 3300017792 | Bacteria | 1452 |
| 168 | Ga0163161_10240801 | 3300017792 | Bacteria | 1407 |
| 169 | Ga0163161_10289252 | 3300017792 | Bacteria | 1288 |
| 170 | Ga0213872_10000383 | 3300021361 | Bacteria | 37014 |
| 171 | Ga0213872_10010717 | 3300021361 | Bacteria | 4354 |
| 172 | Ga0213872_10014578 | 3300021361 | Bacteria | 3666 |
| 173 | Ga0209435_100579 | 3300025206 | Bacteria | 6870 |
| 174 | Ga0209760_100160 | 3300025207 | Bacteria | 40397 |
| 175 | Ga0209760_100475 | 3300025207 | Bacteria | 8673 |
| 176 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 177 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 178 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 179 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 180 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 181 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 182 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 183 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 184 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 185 | Ga0209258_100321 | 3300025242 | Bacteria | 72995 |
| 186 | Ga0209646_1000787 | 3300025246 | Bacteria | 10866 |
| 187 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 188 | Ga0209759_1021813 | 3300025256 | Bacteria | 1447 |
| 189 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 190 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 191 | Ga0209675_1002421 | 3300025291 | Bacteria | 9611 |
| 192 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 193 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 194 | Ga0209676_1000278 | 3300025292 | Bacteria | 106516 |
| 195 | Ga0209676_1004422 | 3300025292 | Bacteria | 7842 |
| 196 | Ga0209676_1008322 | 3300025292 | Bacteria | 4644 |
| 197 | Ga0209676_1013187 | 3300025292 | Bacteria | 3193 |
| 198 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 199 | Ga0209050_1000061 | 3300025298 | Bacteria | 321435 |
| 200 | Ga0209050_1000241 | 3300025298 | Bacteria | 118446 |
| 201 | Ga0209050_1007643 | 3300025298 | Bacteria | 5991 |
| 202 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 203 | Ga0209051_1000519 | 3300025303 | Bacteria | 48314 |
| 204 | Ga0209051_1000572 | 3300025303 | Bacteria | 44529 |
| 205 | Ga0209051_1011562 | 3300025303 | Bacteria | 4348 |
| 206 | Ga0209257_1000143 | 3300025304 | Bacteria | 199975 |
| 207 | Ga0209257_1008653 | 3300025304 | Bacteria | 5705 |
| 208 | Ga0207656_10000009 | 3300025321 | Bacteria | 245637 |
| 209 | Ga0207696_1000055 | 3300025711 | Bacteria | 258289 |
| 210 | Ga0207696_1000078 | 3300025711 | Bacteria | 207623 |
| 211 | Ga0207696_1000080 | 3300025711 | Bacteria | 199217 |
| 212 | Ga0207696_1000204 | 3300025711 | Bacteria | 90602 |
| 213 | Ga0207696_1001609 | 3300025711 | Bacteria | 11938 |
| 214 | Ga0207696_1009608 | 3300025711 | Bacteria | 3600 |
| 215 | Ga0207696_1020354 | 3300025711 | Bacteria | 2143 |
| 216 | Ga0207696_1027443 | 3300025711 | Bacteria | 1754 |
| 217 | Ga0207655_1000033 | 3300025728 | Bacteria | 377066 |
| 218 | Ga0207655_1000116 | 3300025728 | Bacteria | 161950 |
| 219 | Ga0207655_1000541 | 3300025728 | Bacteria | 47787 |
| 220 | Ga0207655_1002134 | 3300025728 | Bacteria | 16488 |
| 221 | Ga0207655_1003858 | 3300025728 | Bacteria | 10912 |
| 222 | Ga0207655_1004732 | 3300025728 | Bacteria | 9511 |
| 223 | Ga0207655_1006294 | 3300025728 | Bacteria | 7894 |
| 224 | Ga0207655_1010039 | 3300025728 | Bacteria | 5797 |
| 225 | Ga0207655_1016218 | 3300025728 | Bacteria | 4089 |
| 226 | Ga0207655_1017720 | 3300025728 | Bacteria | 3826 |
| 227 | Ga0207655_1018480 | 3300025728 | Bacteria | 3693 |
| 228 | Ga0207655_1022478 | 3300025728 | Bacteria | 3160 |
| 229 | Ga0207655_1025331 | 3300025728 | Bacteria | 2882 |
| 230 | Ga0207655_1028204 | 3300025728 | Bacteria | 2653 |
| 231 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 232 | Ga0207713_1000707 | 3300025735 | Bacteria | 31256 |
| 233 | Ga0207713_1000912 | 3300025735 | Bacteria | 26556 |
| 234 | Ga0207713_1001717 | 3300025735 | Bacteria | 16907 |
| 235 | Ga0207713_1002747 | 3300025735 | Bacteria | 12500 |
| 236 | Ga0207713_1004151 | 3300025735 | Bacteria | 9518 |
| 237 | Ga0207713_1004468 | 3300025735 | Bacteria | 9059 |
| 238 | Ga0207713_1005294 | 3300025735 | Bacteria | 8115 |
| 239 | Ga0207713_1005979 | 3300025735 | Bacteria | 7507 |
| 240 | Ga0207713_1010169 | 3300025735 | Bacteria | 5227 |
| 241 | Ga0207713_1025127 | 3300025735 | Bacteria | 2758 |
| 242 | Ga0207713_1026441 | 3300025735 | Bacteria | 2659 |
| 243 | Ga0207713_1039658 | 3300025735 | Bacteria | 1984 |
| 244 | Ga0207713_1045320 | 3300025735 | Bacteria | 1797 |
| 245 | Ga0207713_1057758 | 3300025735 | Bacteria | 1498 |
| 246 | Ga0207671_10000027 | 3300025914 | Bacteria | 264907 |
| 247 | Ga0207671_10190213 | 3300025914 | Bacteria | 1600 |
| 248 | Ga0207649_10000007 | 3300025920 | Bacteria | 334217 |
| 249 | Ga0207681_10000059 | 3300025923 | Bacteria | 104079 |
| 250 | Ga0207650_10000044 | 3300025925 | Bacteria | 183146 |
| 251 | Ga0207650_10000089 | 3300025925 | Bacteria | 120962 |
| 252 | Ga0207706_10002297 | 3300025933 | Bacteria | 18648 |
| 253 | Ga0207706_10077495 | 3300025933 | Bacteria | 2923 |
| 254 | Ga0207686_10003528 | 3300025934 | Bacteria | 8397 |
| 255 | Ga0207709_10000061 | 3300025935 | Bacteria | 199097 |
| 256 | Ga0207709_10000063 | 3300025935 | Bacteria | 191397 |
| 257 | Ga0207709_10000545 | 3300025935 | Bacteria | 32259 |
| 258 | Ga0207709_10005565 | 3300025935 | Bacteria | 7135 |
| 259 | Ga0207709_10011028 | 3300025935 | Bacteria | 4983 |
| 260 | Ga0207709_10047897 | 3300025935 | Bacteria | 2601 |
| 261 | Ga0207679_10000013 | 3300025945 | Bacteria | 334197 |
| 262 | Ga0207679_10019106 | 3300025945 | Bacteria | 4599 |
| 263 | Ga0207712_10010833 | 3300025961 | Bacteria | 5801 |
| 264 | Ga0207640_10434927 | 3300025981 | Bacteria | 1077 |
| 265 | Ga0207639_10000091 | 3300026041 | Bacteria | 76122 |
| 266 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 267 | Ga0209281_1002512 | 3300027111 | Bacteria | 7222 |
| 268 | Ga0209281_1006212 | 3300027111 | Bacteria | 3155 |
| 269 | Ga0209389_1000036 | 3300027296 | Bacteria | 126146 |
| 270 | Ga0209371_1000632 | 3300027312 | Bacteria | 31121 |
| 271 | Ga0209996_1002843 | 3300027395 | Bacteria | 2153 |
| 272 | Ga0209982_1004294 | 3300027552 | Bacteria | 2040 |
| 273 | Ga0209970_1003071 | 3300027614 | Bacteria | 2814 |
| 274 | Ga0207428_10106391 | 3300027907 | Bacteria | 2163 |
| 275 | Ga0207428_10215854 | 3300027907 | Bacteria | 1440 |
| 276 | Ga0207428_10226076 | 3300027907 | Bacteria | 1402 |
| 277 | Ga0268266_10039955 | 3300028379 | Bacteria | 3997 |
| 278 | Ga0268266_10240282 | 3300028379 | Bacteria | 1671 |
| 279 | Ga0268266_10338178 | 3300028379 | Bacteria | 1412 |
| 280 | Ga0307517_10058899 | 3300028786 | Bacteria | 3689 |
| 281 | Ga0268256_1000247 | 3300030500 | Bacteria | 57439 |
| 282 | Ga0307511_10035806 | 3300030521 | Bacteria | 4328 |
| 283 | Ga0307511_10110889 | 3300030521 | Bacteria | 1747 |
| 284 | Ga0316177_1091565 | 3300030731 | Bacteria | 6654 |
| 285 | Ga0316179_1002654 | 3300030734 | Bacteria | 6862 |
| 286 | Ga0316178_1047147 | 3300030735 | Bacteria | 102800 |
| 287 | Ga0316183_1191323 | 3300030742 | Bacteria | 2861 |
| 288 | Ga0316181_1001658 | 3300030744 | Bacteria | 5430 |
| 289 | Ga0307408_100000002 | 3300031548 | Bacteria | 827227 |
| 290 | Ga0307408_100000014 | 3300031548 | Bacteria | 377369 |
| 291 | Ga0307408_100014178 | 3300031548 | Bacteria | 5295 |
| 292 | Ga0307408_100030241 | 3300031548 | Bacteria | 3759 |
| 293 | Ga0307408_100316253 | 3300031548 | Bacteria | 1313 |
| 294 | Ga0307516_10307124 | 3300031730 | Bacteria | 1260 |
| 295 | Ga0307405_10014255 | 3300031731 | Bacteria | 4268 |
| 296 | Ga0307405_10014813 | 3300031731 | Bacteria | 4204 |
| 297 | Ga0307405_10103727 | 3300031731 | Bacteria | 1912 |
| 298 | Ga0307410_10089350 | 3300031852 | Bacteria | 2183 |
| 299 | Ga0307407_10000093 | 3300031903 | Bacteria | 30798 |
| 300 | Ga0307407_10013087 | 3300031903 | Bacteria | 4012 |
| 301 | Ga0307407_10081643 | 3300031903 | Bacteria | 1957 |
| 302 | Ga0307412_10006130 | 3300031911 | Bacteria | 6775 |
| 303 | Ga0307412_10097956 | 3300031911 | Bacteria | 2067 |
| 304 | Ga0307416_100174387 | 3300032002 | Unclassified | 2006 |
| 305 | Ga0307416_100181693 | 3300032002 | Bacteria | 1972 |
| 306 | Ga0307416_100198823 | 3300032002 | Bacteria | 1899 |
| 307 | Ga0307414_10005772 | 3300032004 | Bacteria | 6842 |
| 308 | Ga0307414_10086135 | 3300032004 | Bacteria | 2317 |
| 309 | Ga0307414_10145876 | 3300032004 | Bacteria | 1859 |
| 310 | Ga0307411_10020289 | 3300032005 | Bacteria | 3861 |
| 311 | Ga0307411_10031149 | 3300032005 | Bacteria | 3278 |
| 312 | Ga0307411_10078066 | 3300032005 | Bacteria | 2268 |
| 313 | Ga0307510_10024600 | 3300033180 | Bacteria | 6955 |
| 314 | Ga0237819_00416 | 3300038705 | Bacteria | 14684 |
| 315 | Ga0436361_0009597 | 3300039447 | Bacteria | 38752 |
| 316 | Ga0436361_0299334 | 3300039447 | Bacteria | 4044 |
| 317 | Ga0436361_0723713 | 3300039447 | Bacteria | 5853 |
| 318 | Ga0436361_0772260 | 3300039447 | Bacteria | 34747 |
| 319 | Ga0439438_003796 | 3300041405 | Bacteria | 5971 |
| 320 | Ga0439438_004810 | 3300041405 | Bacteria | 5091 |
| 321 | Ga0439438_006281 | 3300041405 | Bacteria | 4221 |
| 322 | Ga0439438_007493 | 3300041405 | Bacteria | 3726 |
| 323 | Ga0439438_011129 | 3300041405 | Bacteria | 2816 |
| 324 | Ga0439438_011217 | 3300041405 | Bacteria | 2800 |
| 325 | Ga0439438_012118 | 3300041405 | Bacteria | 2656 |
| 326 | Ga0439438_013381 | 3300041405 | Bacteria | 2476 |
| 327 | Ga0439438_016490 | 3300041405 | Bacteria | 2147 |
| 328 | Ga0439438_020501 | 3300041405 | Bacteria | 1855 |
| 329 | Ga0439438_027053 | 3300041405 | Bacteria | 1551 |
| 330 | Ga0439438_034184 | 3300041405 | Bacteria | 1340 |
| 331 | Ga0439447_003950 | 3300041407 | Bacteria | 5191 |
| 332 | Ga0439447_004777 | 3300041407 | Bacteria | 4611 |
| 333 | Ga0439447_005109 | 3300041407 | Bacteria | 4404 |
| 334 | Ga0439447_008113 | 3300041407 | Bacteria | 3273 |
| 335 | Ga0439447_010104 | 3300041407 | Bacteria | 2817 |
| 336 | Ga0439453_0001129 | 3300041408 | Bacteria | 3333 |
| 337 | Ga0439466_0002316 | 3300041411 | Bacteria | 7474 |
| 338 | Ga0439466_0006210 | 3300041411 | Bacteria | 4548 |
| 339 | Ga0439466_0008448 | 3300041411 | Bacteria | 3882 |
| 340 | Ga0439466_0009141 | 3300041411 | Bacteria | 3714 |
| 341 | Ga0439466_0010840 | 3300041411 | Bacteria | 3381 |
| 342 | Ga0439466_0015214 | 3300041411 | Bacteria | 2795 |
| 343 | Ga0439466_0018909 | 3300041411 | Bacteria | 2467 |
| 344 | Ga0439466_0022259 | 3300041411 | Bacteria | 2238 |
| 345 | Ga0439466_0022816 | 3300041411 | Bacteria | 2205 |
| 346 | Ga0439465_0008204 | 3300041413 | Bacteria | 3297 |
| 347 | Ga0439431_0005396 | 3300041997 | Bacteria | 2824 |
| 348 | Ga0439437_000861 | 3300042000 | Bacteria | 3153 |
| 349 | Ga0439445_0026105 | 3300042004 | Bacteria | 1493 |
| 350 | Ga0439432_000735 | 3300042006 | Bacteria | 12268 |
| 351 | Ga0439432_001455 | 3300042006 | Bacteria | 8885 |
| 352 | Ga0439432_003124 | 3300042006 | Bacteria | 6169 |
| 353 | Ga0439432_007249 | 3300042006 | Bacteria | 3938 |
| 354 | Ga0439432_012126 | 3300042006 | Bacteria | 2957 |
| 355 | Ga0439432_013741 | 3300042006 | Bacteria | 2748 |
| 356 | Ga0439432_018391 | 3300042006 | Bacteria | 2335 |
| 357 | Ga0439432_041724 | 3300042006 | Bacteria | 1452 |
| 358 | Ga0439452_002183 | 3300042010 | Bacteria | 7391 |
| 359 | Ga0439452_002419 | 3300042010 | Bacteria | 6905 |
| 360 | Ga0439452_003104 | 3300042010 | Bacteria | 5888 |
| 361 | Ga0439452_004107 | 3300042010 | Bacteria | 4950 |
| 362 | Ga0439452_009764 | 3300042010 | Bacteria | 2817 |
| 363 | Ga0439452_012435 | 3300042010 | Bacteria | 2421 |
| 364 | Ga0439452_014704 | 3300042010 | Bacteria | 2165 |
| 365 | Ga0439456_000080 | 3300042013 | Bacteria | 33226 |
| 366 | Ga0439456_000660 | 3300042013 | Bacteria | 7118 |
| 367 | Ga0439456_003704 | 3300042013 | Bacteria | 3110 |
| 368 | Ga0439456_010763 | 3300042013 | Bacteria | 1891 |
| 369 | Ga0439456_034660 | 3300042013 | Bacteria | 1087 |
| 370 | Ga0439463_000477 | 3300042016 | Bacteria | 11171 |
| 371 | Ga0439463_002267 | 3300042016 | Bacteria | 4929 |
| 372 | Ga0439463_036010 | 3300042016 | Bacteria | 1253 |
| 373 | Ga0450911_000011 | 3300042115 | Bacteria | 130739 |
| 374 | Ga0450911_001296 | 3300042115 | Bacteria | 5940 |
| 375 | Ga0450911_002415 | 3300042115 | Bacteria | 3668 |
| 376 | Ga0450911_008467 | 3300042115 | Bacteria | 1463 |
| 377 | Ga0450911_010067 | 3300042115 | Bacteria | 1312 |
| 378 | Ga0450919_001008 | 3300042121 | Bacteria | 3640 |
| 379 | Ga0450919_001388 | 3300042121 | Bacteria | 3157 |
| 380 | Ga0450920_000286 | 3300042122 | Bacteria | 7648 |
| 381 | Ga0450922_000446 | 3300042124 | Bacteria | 4426 |
| 382 | Ga0450922_005333 | 3300042124 | Bacteria | 1188 |
| 383 | Ga0450923_000811 | 3300042125 | Bacteria | 3760 |
| 384 | Ga0450890_001272 | 3300042127 | Bacteria | 3651 |
| 385 | Ga0450900_008597 | 3300042136 | Bacteria | 1280 |
| 386 | Ga0450902_009904 | 3300042137 | Bacteria | 1505 |
| 387 | Ga0450903_001699 | 3300042138 | Bacteria | 4059 |
| 388 | Ga0450903_002152 | 3300042138 | Bacteria | 3526 |
| 389 | Ga0450903_002378 | 3300042138 | Bacteria | 3355 |
| 390 | Ga0450904_000115 | 3300042139 | Bacteria | 17804 |
| 391 | Ga0450904_002906 | 3300042139 | Bacteria | 1933 |
| 392 | Ga0450905_001046 | 3300042142 | Bacteria | 3473 |
| 393 | Ga0450905_001197 | 3300042142 | Bacteria | 3287 |
| 394 | Ga0450905_007282 | 3300042142 | Bacteria | 1505 |
| 395 | Ga0450906_000355 | 3300042145 | Bacteria | 9282 |
| 396 | Ga0450906_000517 | 3300042145 | Bacteria | 8109 |
| 397 | Ga0450906_004065 | 3300042145 | Bacteria | 3095 |
| 398 | Ga0450907_000520 | 3300042146 | Bacteria | 10559 |
| 399 | Ga0450907_000867 | 3300042146 | Bacteria | 7244 |
| 400 | Ga0450907_013384 | 3300042146 | Bacteria | 1366 |
| 401 | Ga0450910_000137 | 3300042147 | Bacteria | 7861 |
| 402 | Ga0439446_0003992 | 3300042156 | Bacteria | 3712 |
| 403 | Ga0439446_0007513 | 3300042156 | Bacteria | 2866 |
| 404 | Ga0439446_0008716 | 3300042156 | Bacteria | 2700 |
| 405 | Ga0450908_000962 | 3300042184 | Bacteria | 5546 |
| 406 | Ga0450908_019263 | 3300042184 | Bacteria | 1202 |
| 407 | Ga0450909_005573 | 3300042185 | Bacteria | 1810 |
| 408 | Ga0450909_005824 | 3300042185 | Bacteria | 1776 |
| 409 | Ga0439434_0001117 | 3300042435 | Bacteria | 7759 |
| 410 | Ga0439464_0055417 | 3300042439 | Bacteria | 1153 |
| 411 | Ga0439460_0000568 | 3300042461 | Bacteria | 8092 |
| 412 | Ga0450916_000390 | 3300042530 | Bacteria | 3715 |
| 413 | Ga0450918_001120 | 3300042531 | Bacteria | 5501 |
| 414 | Ga0450901_000691 | 3300042533 | Bacteria | 3994 |
| 415 | Ga0451577_0453479 | 3300042876 | Bacteria | 1165 |
| 416 | Ga0439440_0001238 | 3300042993 | Bacteria | 4602 |
| 417 | Ga0439440_0006091 | 3300042993 | Bacteria | 2417 |
| 418 | Ga0439440_0023973 | 3300042993 | Bacteria | 1395 |
| 419 | Ga0453684_0004105 | 3300044712 | Bacteria | 31580 |
| 420 | Ga0453684_0004702 | 3300044712 | Bacteria | 28256 |
| 421 | Ga0453684_0307229 | 3300044712 | Unclassified | 1801 |
| 422 | Ga0453684_0648342 | 3300044712 | Unclassified | 1152 |
| 423 | Ga0495617_002371 | 3300046452 | Bacteria | 7525 |
| 424 | Ga0495617_005595 | 3300046452 | Bacteria | 4446 |
| 425 | Ga0495617_006750 | 3300046452 | Bacteria | 4014 |
| 426 | Ga0495617_007712 | 3300046452 | Bacteria | 3722 |
| 427 | Ga0495617_010836 | 3300046452 | Bacteria | 3121 |
| 428 | Ga0495627_002716 | 3300046453 | Bacteria | 8271 |
| 429 | Ga0495627_005780 | 3300046453 | Bacteria | 4924 |
| 430 | Ga0495627_007033 | 3300046453 | Bacteria | 4362 |
| 431 | Ga0495627_010384 | 3300046453 | Bacteria | 3387 |
| 432 | Ga0495627_012080 | 3300046453 | Bacteria | 3075 |
| 433 | Ga0495627_025369 | 3300046453 | Bacteria | 1923 |
| 434 | Ga0495603_0014110 | 3300046455 | Bacteria | 4833 |
| 435 | Ga0495603_0031614 | 3300046455 | Bacteria | 3186 |
| 436 | Ga0495603_0114008 | 3300046455 | Bacteria | 1576 |
| 437 | Ga0495590_0001555 | 3300046457 | Bacteria | 9846 |
| 438 | Ga0495590_0080202 | 3300046457 | Bacteria | 1149 |
| 439 | Ga0495591_006081 | 3300046458 | Bacteria | 5424 |
| 440 | Ga0495591_006163 | 3300046458 | Bacteria | 5367 |
| 441 | Ga0495591_008415 | 3300046458 | Bacteria | 4226 |
| 442 | Ga0495591_009117 | 3300046458 | Bacteria | 3973 |
| 443 | Ga0495591_012038 | 3300046458 | Bacteria | 3241 |
| 444 | Ga0495591_014389 | 3300046458 | Bacteria | 2847 |
| 445 | Ga0495591_021636 | 3300046458 | Bacteria | 2094 |
| 446 | Ga0495591_033354 | 3300046458 | Bacteria | 1524 |
| 447 | Ga0495591_034441 | 3300046458 | Bacteria | 1490 |
| 448 | Ga0495629_0036122 | 3300046459 | Bacteria | 3491 |
| 449 | Ga0495638_0022813 | 3300046460 | Bacteria | 4104 |
| 450 | Ga0495638_0023151 | 3300046460 | Bacteria | 4067 |
| 451 | Ga0495638_0024593 | 3300046460 | Bacteria | 3925 |
| 452 | Ga0495638_0026476 | 3300046460 | Bacteria | 3758 |
| 453 | Ga0495638_0052159 | 3300046460 | Bacteria | 2548 |
| 454 | Ga0495638_0060791 | 3300046460 | Bacteria | 2335 |
| 455 | Ga0495638_0081819 | 3300046460 | Bacteria | 1959 |
| 456 | Ga0495638_0090973 | 3300046460 | Bacteria | 1838 |
| 457 | Ga0495638_0110025 | 3300046460 | Bacteria | 1637 |
| 458 | Ga0495653_0033929 | 3300046463 | Bacteria | 4040 |
| 459 | Ga0495653_0078624 | 3300046463 | Bacteria | 2445 |
| 460 | Ga0495653_0151236 | 3300046463 | Bacteria | 1621 |
| 461 | Ga0495650_0016462 | 3300046471 | Bacteria | 3744 |
| 462 | Ga0495650_0018974 | 3300046471 | Bacteria | 3401 |
| 463 | Ga0495650_0034626 | 3300046471 | Bacteria | 2232 |
| 464 | Ga0495650_0040697 | 3300046471 | Bacteria | 1992 |
| 465 | Ga0495650_0041796 | 3300046471 | Bacteria | 1957 |
| 466 | Ga0495582_0012502 | 3300046473 | Bacteria | 4679 |
| 467 | Ga0495605_0010405 | 3300046474 | Bacteria | 5204 |
| 468 | Ga0495605_0010597 | 3300046474 | Bacteria | 5155 |
| 469 | Ga0495605_0019206 | 3300046474 | Bacteria | 3656 |
| 470 | Ga0495605_0019237 | 3300046474 | Bacteria | 3653 |
| 471 | Ga0495605_0019680 | 3300046474 | Bacteria | 3601 |
| 472 | Ga0495605_0104359 | 3300046474 | Bacteria | 1299 |
| 473 | Ga0495639_0004422 | 3300046475 | Bacteria | 6026 |
| 474 | Ga0495639_0011705 | 3300046475 | Bacteria | 3784 |
| 475 | Ga0495584_0006922 | 3300046491 | Bacteria | 5925 |
| 476 | Ga0495584_0006997 | 3300046491 | Bacteria | 5892 |
| 477 | Ga0495584_0007121 | 3300046491 | Bacteria | 5843 |
| 478 | Ga0495584_0007934 | 3300046491 | Bacteria | 5521 |
| 479 | Ga0495584_0008019 | 3300046491 | Bacteria | 5489 |
| 480 | Ga0495584_0008025 | 3300046491 | Bacteria | 5487 |
| 481 | Ga0495584_0010834 | 3300046491 | Bacteria | 4679 |
| 482 | Ga0495584_0017646 | 3300046491 | Bacteria | 3631 |
| 483 | Ga0495584_0050636 | 3300046491 | Bacteria | 2091 |
| 484 | Ga0495584_0076986 | 3300046491 | Bacteria | 1677 |
| 485 | Ga0495585_0009311 | 3300046492 | Bacteria | 5899 |
| 486 | Ga0495585_0014262 | 3300046492 | Bacteria | 4634 |
| 487 | Ga0495585_0031938 | 3300046492 | Bacteria | 2985 |
| 488 | Ga0495585_0089168 | 3300046492 | Bacteria | 1662 |
| 489 | Ga0495585_0092639 | 3300046492 | Bacteria | 1626 |
| 490 | Ga0495585_0099657 | 3300046492 | Bacteria | 1555 |
| 491 | Ga0495585_0112100 | 3300046492 | Bacteria | 1449 |
| 492 | Ga0495585_0202973 | 3300046492 | Bacteria | 1008 |
| 493 | Ga0495594_0022996 | 3300046499 | Bacteria | 3338 |
| 494 | Ga0495607_0007687 | 3300046501 | Bacteria | 7428 |
| 495 | Ga0495607_0017405 | 3300046501 | Bacteria | 4614 |
| 496 | Ga0495607_0023033 | 3300046501 | Bacteria | 3903 |
| 497 | Ga0495607_0043277 | 3300046501 | Bacteria | 2663 |
| 498 | Ga0495607_0063235 | 3300046501 | Bacteria | 2094 |
| 499 | Ga0495607_0081937 | 3300046501 | Bacteria | 1772 |
| 500 | Ga0495607_0082640 | 3300046501 | Bacteria | 1761 |
| 501 | Ga0495607_0113879 | 3300046501 | Bacteria | 1430 |
| 502 | Ga0495607_0114434 | 3300046501 | Bacteria | 1425 |
| 503 | Ga0495607_0126075 | 3300046501 | Bacteria | 1338 |
| 504 | Ga0495583_0007538 | 3300046506 | Bacteria | 6811 |
| 505 | Ga0495583_0009278 | 3300046506 | Bacteria | 5894 |
| 506 | Ga0495583_0027693 | 3300046506 | Bacteria | 2794 |
| 507 | Ga0495583_0037330 | 3300046506 | Bacteria | 2303 |
| 508 | Ga0495583_0050437 | 3300046506 | Bacteria | 1902 |
| 509 | Ga0495606_0009824 | 3300046507 | Bacteria | 8036 |
| 510 | Ga0495606_0015236 | 3300046507 | Bacteria | 5936 |
| 511 | Ga0495606_0022442 | 3300046507 | Bacteria | 4598 |
| 512 | Ga0495606_0031970 | 3300046507 | Bacteria | 3652 |
| 513 | Ga0495606_0034591 | 3300046507 | Bacteria | 3467 |
| 514 | Ga0495606_0080532 | 3300046507 | Bacteria | 2026 |
| 515 | Ga0495606_0101185 | 3300046507 | Bacteria | 1754 |
| 516 | Ga0495606_0141635 | 3300046507 | Bacteria | 1419 |
| 517 | Ga0495606_0176015 | 3300046507 | Bacteria | 1237 |
| 518 | Ga0495606_0190457 | 3300046507 | Bacteria | 1176 |
| 519 | Ga0495610_0011258 | 3300046512 | Bacteria | 5482 |
| 520 | Ga0495610_0019562 | 3300046512 | Bacteria | 3784 |
| 521 | Ga0495610_0019797 | 3300046512 | Bacteria | 3753 |
| 522 | Ga0495610_0020042 | 3300046512 | Bacteria | 3723 |
| 523 | Ga0495610_0021799 | 3300046512 | Bacteria | 3516 |
| 524 | Ga0495610_0023220 | 3300046512 | Bacteria | 3376 |
| 525 | Ga0495610_0031649 | 3300046512 | Bacteria | 2757 |
| 526 | Ga0495610_0038654 | 3300046512 | Bacteria | 2420 |
| 527 | Ga0495610_0051483 | 3300046512 | Bacteria | 2003 |
| 528 | Ga0495610_0055379 | 3300046512 | Bacteria | 1911 |
| 529 | Ga0495610_0060909 | 3300046512 | Bacteria | 1795 |
| 530 | Ga0495610_0088271 | 3300046512 | Bacteria | 1410 |
| 531 | Ga0495616_0005952 | 3300046513 | Bacteria | 7439 |
| 532 | Ga0495616_0030838 | 3300046513 | Bacteria | 2812 |
| 533 | Ga0495616_0042648 | 3300046513 | Bacteria | 2308 |
| 534 | Ga0495616_0106873 | 3300046513 | Bacteria | 1304 |
| 535 | Ga0495616_0155799 | 3300046513 | Bacteria | 1030 |
| 536 | Ga0495620_0000538 | 3300046515 | Bacteria | 24158 |
| 537 | Ga0495620_0006866 | 3300046515 | Bacteria | 6221 |
| 538 | Ga0495620_0017505 | 3300046515 | Bacteria | 3570 |
| 539 | Ga0495620_0019311 | 3300046515 | Bacteria | 3354 |
| 540 | Ga0495620_0024409 | 3300046515 | Bacteria | 2875 |
| 541 | Ga0495620_0041188 | 3300046515 | Bacteria | 2027 |
| 542 | Ga0495620_0048251 | 3300046515 | Bacteria | 1828 |
| 543 | Ga0495620_0070235 | 3300046515 | Bacteria | 1435 |
| 544 | Ga0495620_0091851 | 3300046515 | Bacteria | 1217 |
| 545 | Ga0495630_0023231 | 3300046517 | Bacteria | 4583 |
| 546 | Ga0495630_0136413 | 3300046517 | Bacteria | 1864 |
| 547 | Ga0495631_0006682 | 3300046518 | Bacteria | 5928 |
| 548 | Ga0495631_0010667 | 3300046518 | Bacteria | 4541 |
| 549 | Ga0495631_0044748 | 3300046518 | Bacteria | 1950 |
| 550 | Ga0495631_0087310 | 3300046518 | Bacteria | 1343 |
| 551 | Ga0495631_0090360 | 3300046518 | Bacteria | 1318 |
| 552 | Ga0495632_0006009 | 3300046519 | Bacteria | 7897 |
| 553 | Ga0495632_0006308 | 3300046519 | Bacteria | 7652 |
| 554 | Ga0495632_0007314 | 3300046519 | Bacteria | 6957 |
| 555 | Ga0495632_0009750 | 3300046519 | Bacteria | 5757 |
| 556 | Ga0495632_0010862 | 3300046519 | Bacteria | 5356 |
| 557 | Ga0495632_0011087 | 3300046519 | Bacteria | 5281 |
| 558 | Ga0495632_0013427 | 3300046519 | Bacteria | 4674 |
| 559 | Ga0495632_0022427 | 3300046519 | Bacteria | 3384 |
| 560 | Ga0495632_0028157 | 3300046519 | Bacteria | 2934 |
| 561 | Ga0495632_0052886 | 3300046519 | Bacteria | 1995 |
| 562 | Ga0495632_0059832 | 3300046519 | Bacteria | 1852 |
| 563 | Ga0495632_0091159 | 3300046519 | Bacteria | 1445 |
| 564 | Ga0495632_0132033 | 3300046519 | Bacteria | 1161 |
| 565 | Ga0495632_0156963 | 3300046519 | Bacteria | 1049 |
| 566 | Ga0495637_0004958 | 3300046520 | Bacteria | 6852 |
| 567 | Ga0495637_0007048 | 3300046520 | Bacteria | 5598 |
| 568 | Ga0495637_0011893 | 3300046520 | Bacteria | 4170 |
| 569 | Ga0495637_0014187 | 3300046520 | Bacteria | 3762 |
| 570 | Ga0495637_0022402 | 3300046520 | Bacteria | 2881 |
| 571 | Ga0495637_0034274 | 3300046520 | Bacteria | 2224 |
| 572 | Ga0495637_0035140 | 3300046520 | Bacteria | 2190 |
| 573 | Ga0495637_0058271 | 3300046520 | Bacteria | 1592 |
| 574 | Ga0495643_0000120 | 3300046522 | Bacteria | 126112 |
| 575 | Ga0495643_0000763 | 3300046522 | Bacteria | 36080 |
| 576 | Ga0495643_0008586 | 3300046522 | Bacteria | 6452 |
| 577 | Ga0495643_0011962 | 3300046522 | Bacteria | 5253 |
| 578 | Ga0495643_0029901 | 3300046522 | Bacteria | 3045 |
| 579 | Ga0495643_0037993 | 3300046522 | Bacteria | 2638 |
| 580 | Ga0495644_0008526 | 3300046523 | Bacteria | 3948 |
| 581 | Ga0495644_0040264 | 3300046523 | Bacteria | 1761 |
| 582 | Ga0495644_0061702 | 3300046523 | Bacteria | 1408 |
| 583 | Ga0495644_0089361 | 3300046523 | Bacteria | 1162 |
| 584 | Ga0495648_0002285 | 3300046524 | Bacteria | 17885 |
| 585 | Ga0495648_0007380 | 3300046524 | Bacteria | 8803 |
| 586 | Ga0495648_0008468 | 3300046524 | Bacteria | 8091 |
| 587 | Ga0495648_0025115 | 3300046524 | Bacteria | 4039 |
| 588 | Ga0495648_0026142 | 3300046524 | Bacteria | 3934 |
| 589 | Ga0495648_0046488 | 3300046524 | Bacteria | 2690 |
| 590 | Ga0495648_0061516 | 3300046524 | Bacteria | 2229 |
| 591 | Ga0495648_0118584 | 3300046524 | Bacteria | 1426 |
| 592 | Ga0495666_0015629 | 3300046526 | Bacteria | 3778 |
| 593 | Ga0495666_0044785 | 3300046526 | Bacteria | 2135 |
| 594 | Ga0495666_0048946 | 3300046526 | Bacteria | 2034 |
| 595 | Ga0495642_0003701 | 3300046528 | Bacteria | 5997 |
| 596 | Ga0495642_0003845 | 3300046528 | Bacteria | 5883 |
| 597 | Ga0495642_0011725 | 3300046528 | Bacteria | 3374 |
| 598 | Ga0495654_0005016 | 3300046530 | Bacteria | 7768 |
| 599 | Ga0495654_0007275 | 3300046530 | Bacteria | 6200 |
| 600 | Ga0495654_0008103 | 3300046530 | Bacteria | 5826 |
| 601 | Ga0495654_0009176 | 3300046530 | Bacteria | 5423 |
| 602 | Ga0495654_0009378 | 3300046530 | Bacteria | 5364 |
| 603 | Ga0495654_0019319 | 3300046530 | Bacteria | 3564 |
| 604 | Ga0495654_0019550 | 3300046530 | Bacteria | 3542 |
| 605 | Ga0495654_0021353 | 3300046530 | Bacteria | 3368 |
| 606 | Ga0495654_0021395 | 3300046530 | Bacteria | 3364 |
| 607 | Ga0495654_0022453 | 3300046530 | Bacteria | 3276 |
| 608 | Ga0495654_0034277 | 3300046530 | Bacteria | 2562 |
| 609 | Ga0495654_0075665 | 3300046530 | Bacteria | 1588 |
| 610 | Ga0495654_0080817 | 3300046530 | Bacteria | 1524 |
| 611 | Ga0495654_0122997 | 3300046530 | Bacteria | 1172 |
| 612 | Ga0495586_0019543 | 3300046535 | Bacteria | 3607 |
| 613 | Ga0495587_0021921 | 3300046536 | Bacteria | 3938 |
| 614 | Ga0495587_0023256 | 3300046536 | Bacteria | 3808 |
| 615 | Ga0495609_0008828 | 3300046538 | Bacteria | 4905 |
| 616 | Ga0495609_0037995 | 3300046538 | Bacteria | 2171 |
| 617 | Ga0495609_0092532 | 3300046538 | Bacteria | 1314 |
| 618 | Ga0495609_0100808 | 3300046538 | Bacteria | 1251 |
| 619 | Ga0495597_0008646 | 3300046542 | Bacteria | 5091 |
| 620 | Ga0495597_0011773 | 3300046542 | Bacteria | 4236 |
| 621 | Ga0495597_0023713 | 3300046542 | Bacteria | 2837 |
| 622 | Ga0495597_0031816 | 3300046542 | Bacteria | 2397 |
| 623 | Ga0495597_0035492 | 3300046542 | Bacteria | 2249 |
| 624 | Ga0495597_0040078 | 3300046542 | Bacteria | 2094 |
| 625 | Ga0495597_0042867 | 3300046542 | Bacteria | 2016 |
| 626 | Ga0495622_0005353 | 3300046557 | Bacteria | 5958 |
| 627 | Ga0495622_0006837 | 3300046557 | Bacteria | 5294 |
| 628 | Ga0495622_0010735 | 3300046557 | Bacteria | 4226 |
| 629 | Ga0495622_0014230 | 3300046557 | Bacteria | 3695 |
| 630 | Ga0495622_0019253 | 3300046557 | Bacteria | 3178 |
| 631 | Ga0495633_0004409 | 3300046558 | Bacteria | 8961 |
| 632 | Ga0495633_0029754 | 3300046558 | Bacteria | 2656 |
| 633 | Ga0495668_0125017 | 3300046616 | Bacteria | 1407 |
| 634 | Ga0495634_0038849 | 3300046642 | Bacteria | 3244 |
| 635 | Ga0495611_0004728 | 3300046648 | Bacteria | 5848 |
| 636 | Ga0495611_0171381 | 3300046648 | Bacteria | 1014 |
| 637 | Ga0495625_0013708 | 3300046660 | Bacteria | 6498 |
| 638 | Ga0495625_0016331 | 3300046660 | Bacteria | 5845 |
| 639 | Ga0495625_0040956 | 3300046660 | Bacteria | 3374 |
| 640 | Ga0495625_0053577 | 3300046660 | Bacteria | 2884 |
| 641 | Ga0495625_0081536 | 3300046660 | Bacteria | 2251 |
| 642 | Ga0495625_0095483 | 3300046660 | Bacteria | 2049 |
| 643 | Ga0495625_0184089 | 3300046660 | Bacteria | 1387 |
| 644 | Ga0495625_0274348 | 3300046660 | Bacteria | 1087 |
| 645 | Ga0495635_0014354 | 3300046663 | Bacteria | 5541 |
| 646 | Ga0495635_0019486 | 3300046663 | Bacteria | 4728 |
| 647 | Ga0495659_0001791 | 3300046664 | Bacteria | 7127 |
| 648 | Ga0495659_0016823 | 3300046664 | Bacteria | 2416 |
| 649 | Ga0495659_0027937 | 3300046664 | Bacteria | 1949 |
| 650 | Ga0495661_0006107 | 3300046665 | Bacteria | 8486 |
| 651 | Ga0495661_0016928 | 3300046665 | Bacteria | 4817 |
| 652 | Ga0495661_0035759 | 3300046665 | Bacteria | 3114 |
| 653 | Ga0495661_0063253 | 3300046665 | Bacteria | 2188 |
| 654 | Ga0495661_0068699 | 3300046665 | Bacteria | 2078 |
| 655 | Ga0495661_0071228 | 3300046665 | Bacteria | 2032 |
| 656 | Ga0495661_0136852 | 3300046665 | Bacteria | 1336 |
| 657 | Ga0495588_0026696 | 3300046674 | Bacteria | 2884 |
| 658 | Ga0495588_0097039 | 3300046674 | Bacteria | 1546 |
| 659 | Ga0495657_0044627 | 3300046675 | Bacteria | 3014 |
| 660 | Ga0495623_0010236 | 3300046679 | Bacteria | 6066 |
| 661 | Ga0495623_0078007 | 3300046679 | Bacteria | 2054 |
| 662 | Ga0495646_0031451 | 3300046680 | Bacteria | 3307 |
| 663 | Ga0495646_0089516 | 3300046680 | Bacteria | 1781 |
| 664 | Ga0495646_0126251 | 3300046680 | Bacteria | 1443 |
| 665 | Ga0495669_0002201 | 3300046684 | Bacteria | 8004 |
| 666 | Ga0495613_0093582 | 3300046689 | Bacteria | 2175 |
| 667 | Ga0495613_0174622 | 3300046689 | Bacteria | 1524 |
| 668 | Ga0495624_0013052 | 3300046690 | Bacteria | 5664 |
| 669 | Ga0495670_0003539 | 3300046691 | Bacteria | 7669 |
| 670 | Ga0495670_0004439 | 3300046691 | Bacteria | 6883 |
| 671 | Ga0495670_0007472 | 3300046691 | Bacteria | 5368 |
| 672 | Ga0495670_0017507 | 3300046691 | Bacteria | 3526 |
| 673 | Ga0495670_0035427 | 3300046691 | Bacteria | 2488 |
| 674 | Ga0495670_0035582 | 3300046691 | Bacteria | 2481 |
| 675 | Ga0495671_0007515 | 3300046692 | Bacteria | 6205 |
| 676 | Ga0495671_0008147 | 3300046692 | Bacteria | 5912 |
| 677 | Ga0495671_0015135 | 3300046692 | Bacteria | 4140 |
| 678 | Ga0495671_0016779 | 3300046692 | Bacteria | 3904 |
| 679 | Ga0495671_0039934 | 3300046692 | Bacteria | 2367 |
| 680 | Ga0495671_0044041 | 3300046692 | Bacteria | 2238 |
| 681 | Ga0495671_0045845 | 3300046692 | Bacteria | 2188 |
| 682 | Ga0495671_0070052 | 3300046692 | Bacteria | 1723 |
| 683 | Ga0495649_0009532 | 3300046694 | Bacteria | 5761 |
| 684 | Ga0495649_0010872 | 3300046694 | Bacteria | 5359 |
| 685 | Ga0495649_0021128 | 3300046694 | Bacteria | 3649 |
| 686 | Ga0495649_0022431 | 3300046694 | Bacteria | 3533 |
| 687 | Ga0495649_0022787 | 3300046694 | Bacteria | 3502 |
| 688 | Ga0495649_0044662 | 3300046694 | Bacteria | 2418 |
| 689 | Ga0495649_0049537 | 3300046694 | Bacteria | 2282 |
| 690 | Ga0495649_0050302 | 3300046694 | Bacteria | 2262 |
| 691 | Ga0495649_0064685 | 3300046694 | Bacteria | 1963 |
| 692 | Ga0495649_0093662 | 3300046694 | Bacteria | 1599 |
| 693 | Ga0495649_0102563 | 3300046694 | Bacteria | 1519 |
| 694 | Ga0495649_0164274 | 3300046694 | Bacteria | 1163 |
| 695 | Ga0495589_0004591 | 3300046794 | Bacteria | 7344 |
| 696 | Ga0495589_0015753 | 3300046794 | Bacteria | 3886 |
| 697 | Ga0495589_0017724 | 3300046794 | Bacteria | 3654 |
| 698 | Ga0495589_0019172 | 3300046794 | Bacteria | 3509 |
| 699 | Ga0495589_0021058 | 3300046794 | Bacteria | 3332 |
| 700 | Ga0495589_0023614 | 3300046794 | Bacteria | 3131 |
| 701 | Ga0495589_0024014 | 3300046794 | Bacteria | 3100 |
| 702 | Ga0495589_0054055 | 3300046794 | Bacteria | 1980 |
| 703 | Ga0495589_0087850 | 3300046794 | Bacteria | 1509 |
| 704 | Ga0495600_0138230 | 3300046809 | Bacteria | 1581 |
| 705 | Ga0495660_0021050 | 3300046810 | Bacteria | 3736 |
| 706 | Ga0495660_0024147 | 3300046810 | Bacteria | 3464 |
| 707 | Ga0495660_0059586 | 3300046810 | Bacteria | 2052 |
| 708 | Ga0495660_0072557 | 3300046810 | Bacteria | 1823 |
| 709 | Ga0495660_0079391 | 3300046810 | Bacteria | 1723 |
| 710 | Ga0495660_0101093 | 3300046810 | Bacteria | 1484 |
| 711 | Ga0495660_0107168 | 3300046810 | Bacteria | 1430 |
| 712 | Ga0495660_0108366 | 3300046810 | Bacteria | 1420 |
| 713 | Ga0495660_0171786 | 3300046810 | Bacteria | 1055 |
| 714 | Ga0495660_0171925 | 3300046810 | Bacteria | 1054 |
| 715 | Ga0495581_0037857 | 3300047315 | Bacteria | 2791 |
| 716 | Ga0495604_0023499 | 3300047317 | Bacteria | 4918 |
| 717 | Ga0495604_0024919 | 3300047317 | Bacteria | 4770 |
| 718 | Ga0495604_0047322 | 3300047317 | Bacteria | 3350 |
| 719 | Ga0495636_0005514 | 3300047318 | Bacteria | 4966 |
| 720 | Ga0495636_0139114 | 3300047318 | Bacteria | 1083 |
| 721 | Ga0495674_0368676 | 3300047319 | Bacteria | 1163 |
| 722 | Ga0495672_0009503 | 3300047320 | Bacteria | 7039 |
| 723 | Ga0495672_0011796 | 3300047320 | Bacteria | 6139 |
| 724 | Ga0495672_0013936 | 3300047320 | Bacteria | 5526 |
| 725 | Ga0495672_0019645 | 3300047320 | Bacteria | 4453 |
| 726 | Ga0495672_0020472 | 3300047320 | Bacteria | 4335 |
| 727 | Ga0495672_0023885 | 3300047320 | Bacteria | 3949 |
| 728 | Ga0495672_0024934 | 3300047320 | Bacteria | 3840 |
| 729 | Ga0495672_0031871 | 3300047320 | Bacteria | 3286 |
| 730 | Ga0495672_0039277 | 3300047320 | Bacteria | 2878 |
| 731 | Ga0495672_0041460 | 3300047320 | Bacteria | 2783 |
| 732 | Ga0495672_0049871 | 3300047320 | Bacteria | 2475 |
| 733 | Ga0495672_0061973 | 3300047320 | Bacteria | 2154 |
| 734 | Ga0495672_0062986 | 3300047320 | Bacteria | 2130 |
| 735 | Ga0495672_0079955 | 3300047320 | Bacteria | 1824 |
| 736 | Ga0495676_0044165 | 3300047321 | Bacteria | 3640 |
| 737 | Ga0495676_0048783 | 3300047321 | Bacteria | 3410 |
| 738 | Ga0495680_0022187 | 3300047322 | Bacteria | 5297 |
| 739 | Ga0495680_0022986 | 3300047322 | Bacteria | 5189 |
| 740 | Ga0495680_0101719 | 3300047322 | Bacteria | 2140 |
| 741 | Ga0495680_0150918 | 3300047322 | Bacteria | 1694 |
| 742 | Ga0495680_0198654 | 3300047322 | Bacteria | 1439 |
| 743 | Ga0495683_0004276 | 3300047323 | Bacteria | 8140 |
| 744 | Ga0495683_0007387 | 3300047323 | Bacteria | 5952 |
| 745 | Ga0495683_0008977 | 3300047323 | Bacteria | 5334 |
| 746 | Ga0495683_0022433 | 3300047323 | Bacteria | 3246 |
| 747 | Ga0495683_0052923 | 3300047323 | Bacteria | 2025 |
| 748 | Ga0495683_0095991 | 3300047323 | Bacteria | 1430 |
| 749 | Ga0495687_009435 | 3300047443 | Bacteria | 5452 |
| 750 | Ga0495687_013719 | 3300047443 | Bacteria | 4209 |
| 751 | Ga0495687_027904 | 3300047443 | Bacteria | 2634 |
| 752 | Ga0495675_0108420 | 3300047444 | Bacteria | 1734 |
| 753 | Ga0495677_0016584 | 3300047445 | Bacteria | 2673 |
| 754 | Ga0495679_012600 | 3300047446 | Bacteria | 3208 |
| 755 | Ga0495679_021760 | 3300047446 | Bacteria | 2206 |
| 756 | Ga0495679_027810 | 3300047446 | Bacteria | 1860 |
| 757 | Ga0495679_036770 | 3300047446 | Bacteria | 1545 |
| 758 | Ga0495679_043255 | 3300047446 | Bacteria | 1385 |
| 759 | Ga0495679_044623 | 3300047446 | Bacteria | 1357 |
| 760 | Ga0495673_0014003 | 3300047469 | Bacteria | 4186 |
| 761 | Ga0495673_0014323 | 3300047469 | Bacteria | 4126 |
| 762 | Ga0495673_0018172 | 3300047469 | Bacteria | 3552 |
| 763 | Ga0495673_0019618 | 3300047469 | Bacteria | 3385 |
| 764 | Ga0495673_0023534 | 3300047469 | Bacteria | 2994 |
| 765 | Ga0495673_0028726 | 3300047469 | Bacteria | 2631 |
| 766 | Ga0495673_0046606 | 3300047469 | Bacteria | 1920 |
| 767 | Ga0495673_0065244 | 3300047469 | Bacteria | 1546 |
| 768 | Ga0495673_0083791 | 3300047469 | Bacteria | 1315 |
| 769 | Ga0495673_0104504 | 3300047469 | Bacteria | 1140 |
| 770 | Ga0495681_0009856 | 3300047470 | Bacteria | 5842 |
| 771 | Ga0495681_0011636 | 3300047470 | Bacteria | 5226 |
| 772 | Ga0495681_0018997 | 3300047470 | Bacteria | 3767 |
| 773 | Ga0495681_0019272 | 3300047470 | Bacteria | 3731 |
| 774 | Ga0495681_0020409 | 3300047470 | Bacteria | 3596 |
| 775 | Ga0495681_0021063 | 3300047470 | Bacteria | 3521 |
| 776 | Ga0495681_0021784 | 3300047470 | Bacteria | 3444 |
| 777 | Ga0495681_0023153 | 3300047470 | Bacteria | 3305 |
| 778 | Ga0495681_0036879 | 3300047470 | Bacteria | 2413 |
| 779 | Ga0495681_0070110 | 3300047470 | Bacteria | 1590 |
| 780 | Ga0495681_0123485 | 3300047470 | Bacteria | 1108 |
| 781 | Ga0495684_0038420 | 3300047471 | Bacteria | 3670 |
| 782 | Ga0495686_0012681 | 3300047472 | Bacteria | 5890 |
| 783 | Ga0495686_0024290 | 3300047472 | Bacteria | 3985 |
| 784 | Ga0495686_0026888 | 3300047472 | Bacteria | 3762 |
| 785 | Ga0495686_0081535 | 3300047472 | Bacteria | 1975 |
| 786 | Ga0495593_0013908 | 3300047673 | Bacteria | 4584 |
| 787 | Ga0495593_0034872 | 3300047673 | Bacteria | 2734 |
| 788 | Ga0495593_0049834 | 3300047673 | Bacteria | 2220 |
| 789 | Ga0495593_0238839 | 3300047673 | Bacteria | 910 |
| 790 | Ga0495602_0057621 | 3300048088 | Bacteria | 3406 |
| 791 | Ga0495626_0004732 | 3300048091 | Bacteria | 8236 |
| 792 | Ga0495626_0005414 | 3300048091 | Bacteria | 7482 |
| 793 | Ga0495626_0016287 | 3300048091 | Bacteria | 3779 |
| 794 | Ga0495626_0026943 | 3300048091 | Bacteria | 2796 |
| 795 | Ga0495626_0028535 | 3300048091 | Bacteria | 2704 |
| 796 | Ga0495626_0045249 | 3300048091 | Bacteria | 2055 |
| 797 | Ga0495626_0076767 | 3300048091 | Bacteria | 1491 |
| 798 | Ga0496102_0020156 | 3300048905 | Bacteria | 5887 |
| 799 | Ga0496103_0014360 | 3300048906 | Bacteria | 4704 |
| 800 | Ga0496103_0202550 | 3300048906 | Bacteria | 1276 |
| 801 | Ga0496105_0108314 | 3300048908 | Bacteria | 2294 |
| 802 | Ga0496106_0089174 | 3300048909 | Bacteria | 2378 |
| 803 | Ga0496110_0023141 | 3300048913 | Bacteria | 5284 |
| 804 | Ga0496110_0406423 | 3300048913 | Bacteria | 1241 |
| 805 | Ga0496111_0111697 | 3300048914 | Bacteria | 2013 |
| 806 | Ga0496114_0061661 | 3300048917 | Bacteria | 3137 |
| 807 | Ga0496114_0070475 | 3300048917 | Bacteria | 2936 |
| 808 | Ga0496116_0001725 | 3300048919 | Bacteria | 23879 |
| 809 | Ga0496116_0011675 | 3300048919 | Bacteria | 7240 |
| 810 | Ga0496116_0018429 | 3300048919 | Bacteria | 5383 |
| 811 | Ga0496116_0025706 | 3300048919 | Bacteria | 4323 |
| 812 | Ga0496116_0028412 | 3300048919 | Bacteria | 4052 |
| 813 | Ga0496116_0061418 | 3300048919 | Bacteria | 2433 |
| 814 | Ga0496116_0171567 | 3300048919 | Bacteria | 1174 |
| 815 | Ga0496117_0006500 | 3300048920 | Bacteria | 11789 |
| 816 | Ga0496117_0007309 | 3300048920 | Bacteria | 10841 |
| 817 | Ga0496117_0008713 | 3300048920 | Bacteria | 9585 |
| 818 | Ga0496117_0009017 | 3300048920 | Bacteria | 9382 |
| 819 | Ga0496117_0017029 | 3300048920 | Bacteria | 6088 |
| 820 | Ga0496117_0018515 | 3300048920 | Bacteria | 5762 |
| 821 | Ga0496117_0024973 | 3300048920 | Bacteria | 4707 |
| 822 | Ga0496117_0030449 | 3300048920 | Bacteria | 4141 |
| 823 | Ga0496117_0036558 | 3300048920 | Bacteria | 3672 |
| 824 | Ga0496117_0037524 | 3300048920 | Bacteria | 3608 |
| 825 | Ga0496117_0050656 | 3300048920 | Bacteria | 2943 |
| 826 | Ga0496117_0067715 | 3300048920 | Bacteria | 2414 |
| 827 | Ga0496117_0092587 | 3300048920 | Bacteria | 1941 |
| 828 | Ga0496117_0092825 | 3300048920 | Bacteria | 1937 |
| 829 | Ga0496117_0314349 | 3300048920 | Bacteria | 823 |
| 830 | Ga0496118_0002317 | 3300048921 | Bacteria | 25853 |
| 831 | Ga0496118_0012115 | 3300048921 | Bacteria | 8323 |
| 832 | Ga0496118_0031832 | 3300048921 | Bacteria | 4362 |
| 833 | Ga0496118_0033154 | 3300048921 | Bacteria | 4243 |
| 834 | Ga0496118_0040995 | 3300048921 | Bacteria | 3672 |
| 835 | Ga0496118_0042110 | 3300048921 | Bacteria | 3607 |
| 836 | Ga0496118_0050786 | 3300048921 | Bacteria | 3178 |
| 837 | Ga0496118_0069336 | 3300048921 | Bacteria | 2554 |
| 838 | Ga0496118_0083779 | 3300048921 | Bacteria | 2227 |
| 839 | Ga0496118_0113771 | 3300048921 | Bacteria | 1786 |
| 840 | Ga0496119_0000506 | 3300048922 | Bacteria | 53174 |
| 841 | Ga0496119_0021440 | 3300048922 | Bacteria | 4671 |
| 842 | Ga0496119_0029940 | 3300048922 | Bacteria | 3679 |
| 843 | Ga0496119_0080186 | 3300048922 | Bacteria | 1883 |
| 844 | Ga0496120_0001362 | 3300048923 | Bacteria | 29974 |
| 845 | Ga0496120_0015048 | 3300048923 | Bacteria | 5119 |
| 846 | Ga0496120_0015699 | 3300048923 | Bacteria | 4982 |
| 847 | Ga0496120_0029448 | 3300048923 | Bacteria | 3351 |
| 848 | Ga0496121_0014652 | 3300048924 | Bacteria | 8290 |
| 849 | Ga0496121_0022108 | 3300048924 | Bacteria | 6188 |
| 850 | Ga0496121_0054583 | 3300048924 | Bacteria | 3336 |
| 851 | Ga0496121_0076594 | 3300048924 | Bacteria | 2666 |
| 852 | Ga0496121_0130328 | 3300048924 | Bacteria | 1883 |
| 853 | Ga0496121_0139478 | 3300048924 | Bacteria | 1801 |
| 854 | Ga0496121_0231312 | 3300048924 | Bacteria | 1294 |
| 855 | Ga0496122_0007408 | 3300048925 | Bacteria | 12214 |
| 856 | Ga0496122_0021592 | 3300048925 | Bacteria | 5756 |
| 857 | Ga0496122_0049252 | 3300048925 | Bacteria | 3229 |
| 858 | Ga0496122_0061538 | 3300048925 | Bacteria | 2755 |
| 859 | Ga0496122_0076976 | 3300048925 | Bacteria | 2345 |
| 860 | Ga0496122_0110047 | 3300048925 | Bacteria | 1811 |
| 861 | Ga0496122_0152576 | 3300048925 | Bacteria | 1423 |
| 862 | Ga0496122_0164831 | 3300048925 | Bacteria | 1345 |
| 863 | Ga0496123_0005881 | 3300048926 | Bacteria | 12133 |
| 864 | Ga0496123_0022349 | 3300048926 | Bacteria | 4877 |
| 865 | Ga0496123_0024029 | 3300048926 | Bacteria | 4646 |
| 866 | Ga0496123_0043661 | 3300048926 | Bacteria | 3075 |
| 867 | Ga0496123_0053521 | 3300048926 | Bacteria | 2666 |
| 868 | Ga0496123_0069220 | 3300048926 | Bacteria | 2217 |
| 869 | Ga0496124_0007177 | 3300048927 | Bacteria | 11908 |
| 870 | Ga0496124_0013682 | 3300048927 | Bacteria | 7905 |
| 871 | Ga0496124_0035067 | 3300048927 | Bacteria | 4393 |
| 872 | Ga0496124_0041751 | 3300048927 | Bacteria | 3955 |
| 873 | Ga0496124_0053014 | 3300048927 | Bacteria | 3441 |
| 874 | Ga0496124_0053428 | 3300048927 | Bacteria | 3424 |
| 875 | Ga0496124_0053454 | 3300048927 | Bacteria | 3423 |
| 876 | Ga0496124_0079617 | 3300048927 | Bacteria | 2697 |
| 877 | Ga0496124_0086342 | 3300048927 | Bacteria | 2568 |
| 878 | Ga0496124_0094804 | 3300048927 | Bacteria | 2426 |
| 879 | Ga0496124_0140762 | 3300048927 | Bacteria | 1904 |
| 880 | Ga0496124_0150082 | 3300048927 | Bacteria | 1829 |
| 881 | Ga0496124_0202845 | 3300048927 | Bacteria | 1507 |
| 882 | Ga0496125_0014065 | 3300048928 | Bacteria | 7821 |
| 883 | Ga0496125_0015865 | 3300048928 | Bacteria | 7258 |
| 884 | Ga0496125_0020727 | 3300048928 | Bacteria | 6162 |
| 885 | Ga0496125_0026454 | 3300048928 | Bacteria | 5287 |
| 886 | Ga0496125_0032010 | 3300048928 | Bacteria | 4677 |
| 887 | Ga0496125_0040318 | 3300048928 | Bacteria | 4008 |
| 888 | Ga0496125_0040690 | 3300048928 | Bacteria | 3983 |
| 889 | Ga0496125_0049097 | 3300048928 | Bacteria | 3510 |
| 890 | Ga0496125_0096023 | 3300048928 | Bacteria | 2202 |
| 891 | Ga0496125_0159557 | 3300048928 | Bacteria | 1534 |
| 892 | Ga0496125_0198684 | 3300048928 | Bacteria | 1315 |
| 893 | Ga0496126_0056657 | 3300048929 | Bacteria | 3541 |
| 894 | Ga0496126_0063156 | 3300048929 | Bacteria | 3320 |
| 895 | Ga0496126_0074537 | 3300048929 | Bacteria | 3013 |
| 896 | Ga0496126_0106470 | 3300048929 | Bacteria | 2447 |
| 897 | Ga0496126_0115530 | 3300048929 | Bacteria | 2333 |
| 898 | Ga0495678_005003 | 3300049459 | Bacteria | 7467 |
| 899 | Ga0495678_006344 | 3300049459 | Bacteria | 6305 |
| 900 | Ga0495678_007286 | 3300049459 | Bacteria | 5754 |
| 901 | Ga0495678_007969 | 3300049459 | Bacteria | 5417 |
| 902 | Ga0495678_015351 | 3300049459 | Bacteria | 3527 |
| 903 | Ga0495678_025182 | 3300049459 | Bacteria | 2559 |
| 904 | Ga0495678_040233 | 3300049459 | Bacteria | 1880 |
| 905 | Ga0495678_051651 | 3300049459 | Bacteria | 1587 |
| 906 | Ga0495678_072721 | 3300049459 | Bacteria | 1255 |
| 907 | Ga0495682_0001713 | 3300049460 | Bacteria | 11116 |
| 908 | Ga0495682_0011732 | 3300049460 | Bacteria | 3367 |
| 909 | Ga0495682_0015052 | 3300049460 | Bacteria | 2931 |
| 910 | Ga0495682_0019726 | 3300049460 | Bacteria | 2533 |
| 911 | Ga0495682_0073658 | 3300049460 | Bacteria | 1228 |
| 912 | Ga0501032_0001964 | 3300049569 | Bacteria | 16181 |
| 913 | Ga0501034_0000136 | 3300049571 | Bacteria | 136835 |
| 914 | Ga0501038_0023398 | 3300049574 | Bacteria | 5523 |
| 915 | Ga0501039_0123006 | 3300049575 | Bacteria | 2034 |
| 916 | Ga0501241_002825 | 3300049758 | Bacteria | 3335 |
| 917 | Ga0501035_0058574 | 3300049822 | Bacteria | 3432 |
| 918 | Ga0501226_000060 | 3300049853 | Bacteria | 36795 |
| 919 | nmdc:mga03683_46565_c1 | 3300050489 | Bacteria | 1798 |
| 920 | nmdc:mga00v17_87723_c1 | 3300050491 | Bacteria | 1950 |
| 921 | nmdc:mga08y16_28_c1 | 3300050511 | Bacteria | 201429 |
| 922 | nmdc:mga08x19_104733_c1 | 3300050514 | Bacteria | 1880 |
| 923 | Ga0500572_008110 | 3300053111 | Bacteria | 2447 |
| 924 | Ga0500595_008482 | 3300053119 | Bacteria | 4193 |
| 925 | Ga0500659_0003173 | 3300053135 | Bacteria | 9728 |
| 926 | Ga0500634_0026777 | 3300053161 | Bacteria | 3141 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048920 | Ga0496117_0314349 | Ga0496117_0314349_73_813 | 232 |
| 2 | 3300046530 | Ga0495654_0075665 | Ga0495654_0075665_380_1120 | 246 |
| 3 | iso_pu_bacteria | 2554235231 | 2555246463 | 249 |
| 4 | 3300047673 | Ga0495593_0238839 | Ga0495593_0238839_112_894 | 260 |
| 5 | 3300042138 | Ga0450903_002378 | Ga0450903_002378_1162_2085 | 262 |
| 6 | 3300046460 | Ga0495638_0081819 | Ga0495638_0081819_939_1862 | 262 |
| 7 | 3300046452 | Ga0495617_002371 | Ga0495617_002371_4179_5078 | 264 |
| 8 | 3300046471 | Ga0495650_0016462 | Ga0495650_0016462_436_1335 | 264 |
| 9 | 3300046501 | Ga0495607_0007687 | Ga0495607_0007687_2387_3286 | 264 |
| 10 | 3300047318 | Ga0495636_0005514 | Ga0495636_0005514_1619_2518 | 264 |
| 11 | 3300047320 | Ga0495672_0019645 | Ga0495672_0019645_1908_2807 | 264 |
| 12 | 3300046660 | Ga0495625_0040956 | Ga0495625_0040956_595_1572 | 267 |
| 13 | 3300048091 | Ga0495626_0076767 | Ga0495626_0076767_540_1439 | 267 |
| 14 | 3300041405 | Ga0439438_012118 | Ga0439438_012118_1134_2033 | 268 |
| 15 | 3300021361 | Ga0213872_10000383 | Ga0213872_1000038325 | 269 |
| 16 | 3300021361 | Ga0213872_10010717 | Ga0213872_100107176 | 269 |
| 17 | 3300039447 | Ga0436361_0009597 | Ga0436361_0009597_25708_26565 | 269 |
| 18 | 3300039447 | Ga0436361_0772260 | Ga0436361_0772260_21589_22446 | 269 |
| 19 | 3300021361 | Ga0213872_10014578 | Ga0213872_100145785 | 271 |
| 20 | 3300039447 | Ga0436361_0299334 | Ga0436361_0299334_346_1215 | 271 |
| 21 | 3300039447 | Ga0436361_0723713 | Ga0436361_0723713_2567_3436 | 271 |
| 22 | 3300042006 | Ga0439432_012126 | Ga0439432_012126_1171_2010 | 271 |
| 23 | 3300046491 | Ga0495584_0007121 | Ga0495584_0007121_2411_3310 | 273 |
| 24 | 3300046518 | Ga0495631_0044748 | Ga0495631_0044748_680_1501 | 273 |
| 25 | 3300046692 | Ga0495671_0008147 | Ga0495671_0008147_2411_3310 | 273 |
| 26 | 3300048091 | Ga0495626_0045249 | Ga0495626_0045249_213_1112 | 273 |
| 27 | 3300003320 | rootH2_10020520 | rootH2_1002052030 | 278 |
| 28 | 3300005354 | Ga0070675_100355856 | Ga0070675_1003558561 | 278 |
| 29 | 3300031548 | Ga0307408_100000014 | Ga0307408_100000014305 | 278 |
| 30 | 3300031903 | Ga0307407_10000093 | Ga0307407_1000009316 | 278 |
| 31 | 3300032002 | Ga0307416_100174387 | Ga0307416_1001743871 | 278 |
| 32 | 3300032005 | Ga0307411_10031149 | Ga0307411_100311493 | 278 |
| 33 | 3300046542 | Ga0495597_0035492 | Ga0495597_0035492_11_907 | 278 |
| 34 | 3300046471 | Ga0495650_0041796 | Ga0495650_0041796_496_1395 | 279 |
| 35 | 3300046519 | Ga0495632_0028157 | Ga0495632_0028157_1475_2374 | 279 |
| 36 | 3300046542 | Ga0495597_0031816 | Ga0495597_0031816_1113_2012 | 279 |
| 37 | 3300046810 | Ga0495660_0171925 | Ga0495660_0171925_110_1009 | 279 |
| 38 | 3300048091 | Ga0495626_0004732 | Ga0495626_0004732_4976_5875 | 279 |
| 39 | 3300009094 | Ga0111539_10000054 | Ga0111539_100000546 | 280 |
| 40 | 3300050511 | nmdc:mga08y16_28_c1 | nmdc:mga08y16_28_c1_192459_193337 | 280 |
| 41 | 3300047469 | Ga0495673_0014323 | Ga0495673_0014323_2343_3242 | 281 |
| 42 | 3300041408 | Ga0439453_0001129 | Ga0439453_0001129_494_1426 | 282 |
| 43 | 3300044712 | Ga0453684_0004105 | Ga0453684_0004105_28187_29053 | 282 |
| 44 | 3300044712 | Ga0453684_0307229 | Ga0453684_0307229_924_1790 | 282 |
| 45 | 3300044712 | Ga0453684_0648342 | Ga0453684_0648342_208_1074 | 282 |
| 46 | 3300027614 | Ga0209970_1003071 | Ga0209970_10030712 | 284 |
| 47 | 3300041997 | Ga0439431_0005396 | Ga0439431_0005396_1564_2463 | 284 |
| 48 | 3300042000 | Ga0439437_000861 | Ga0439437_000861_2197_3096 | 284 |
| 49 | 3300042115 | Ga0450911_000011 | Ga0450911_000011_13413_14312 | 284 |
| 50 | 3300042139 | Ga0450904_000115 | Ga0450904_000115_10482_11381 | 284 |
| 51 | 3300042156 | Ga0439446_0008716 | Ga0439446_0008716_382_1281 | 284 |
| 52 | 3300042439 | Ga0439464_0055417 | Ga0439464_0055417_128_1027 | 284 |
| 53 | 3300003781 | Ga0055536_1010847 | Ga0055536_10108474 | 285 |
| 54 | 3300003791 | Ga0055530_10013792 | Ga0055530_100137922 | 285 |
| 55 | 3300003792 | Ga0055540_1007709 | Ga0055540_10077095 | 285 |
| 56 | 3300006177 | Ga0075362_10054894 | Ga0075362_100548942 | 285 |
| 57 | 3300009036 | Ga0105244_10089195 | Ga0105244_100891952 | 285 |
| 58 | 3300009148 | Ga0105243_10006305 | Ga0105243_100063058 | 285 |
| 59 | 3300011119 | Ga0105246_10032290 | Ga0105246_100322904 | 285 |
| 60 | 3300025292 | Ga0209676_1000015 | Ga0209676_1000015213 | 285 |
| 61 | 3300025298 | Ga0209050_1000030 | Ga0209050_1000030225 | 285 |
| 62 | 3300025303 | Ga0209051_1000012 | Ga0209051_1000012466 | 285 |
| 63 | 3300025304 | Ga0209257_1000143 | Ga0209257_1000143131 | 285 |
| 64 | 3300025728 | Ga0207655_1000116 | Ga0207655_100011671 | 285 |
| 65 | 3300025735 | Ga0207713_1004151 | Ga0207713_10041513 | 285 |
| 66 | 3300025935 | Ga0207709_10000061 | Ga0207709_1000006177 | 285 |
| 67 | 3300044712 | Ga0453684_0004702 | Ga0453684_0004702_23770_24672 | 285 |
| 68 | 3300046522 | Ga0495643_0000120 | Ga0495643_0000120_31399_32301 | 285 |
| 69 | 3300048927 | Ga0496124_0053454 | Ga0496124_0053454_1336_2232 | 285 |
| 70 | 3300049574 | Ga0501038_0023398 | Ga0501038_0023398_319_1224 | 286 |
| 71 | 3300003323 | rootH1_10191543 | rootH1_101915432 | 287 |
| 72 | 3300003791 | Ga0055530_10015687 | Ga0055530_100156874 | 287 |
| 73 | 3300025292 | Ga0209676_1008322 | Ga0209676_10083223 | 287 |
| 74 | 3300025298 | Ga0209050_1007643 | Ga0209050_10076433 | 287 |
| 75 | 3300025303 | Ga0209051_1011562 | Ga0209051_10115624 | 287 |
| 76 | 3300025735 | Ga0207713_1005979 | Ga0207713_10059797 | 287 |
| 77 | 3300042876 | Ga0451577_0453479 | Ga0451577_0453479_206_1114 | 287 |
| 78 | 3300049569 | Ga0501032_0001964 | Ga0501032_0001964_9540_10448 | 287 |
| 79 | 3300049575 | Ga0501039_0123006 | Ga0501039_0123006_595_1503 | 287 |
| 80 | 3300049822 | Ga0501035_0058574 | Ga0501035_0058574_1947_2855 | 287 |
| 81 | 3300042013 | Ga0439456_003704 | Ga0439456_003704_1301_2200 | 289 |
| 82 | 3300042138 | Ga0450903_001699 | Ga0450903_001699_2151_3050 | 289 |
| 83 | 3300046452 | Ga0495617_006750 | Ga0495617_006750_2935_3834 | 289 |
| 84 | 3300046458 | Ga0495591_021636 | Ga0495591_021636_333_1232 | 289 |
| 85 | 3300046463 | Ga0495653_0033929 | Ga0495653_0033929_570_1469 | 289 |
| 86 | 3300046519 | Ga0495632_0156963 | Ga0495632_0156963_96_995 | 289 |
| 87 | 3300046542 | Ga0495597_0008646 | Ga0495597_0008646_2049_2948 | 289 |
| 88 | 3300046660 | Ga0495625_0095483 | Ga0495625_0095483_1066_1965 | 289 |
| 89 | 3300046690 | Ga0495624_0013052 | Ga0495624_0013052_2567_3466 | 289 |
| 90 | 3300046691 | Ga0495670_0007472 | Ga0495670_0007472_2398_3297 | 289 |
| 91 | 3300046809 | Ga0495600_0138230 | Ga0495600_0138230_523_1422 | 289 |
| 92 | 3300047320 | Ga0495672_0023885 | Ga0495672_0023885_2480_3379 | 289 |
| 93 | 3300047323 | Ga0495683_0022433 | Ga0495683_0022433_2104_3003 | 289 |
| 94 | 3300047470 | Ga0495681_0011636 | Ga0495681_0011636_2008_2907 | 289 |
| 95 | 3300048088 | Ga0495602_0057621 | Ga0495602_0057621_1940_2839 | 289 |
| 96 | 3300050514 | nmdc:mga08x19_104733_c1 | nmdc:mga08x19_104733_c1_179_1078 | 289 |
| 97 | 3300005455 | Ga0070663_100300775 | Ga0070663_1003007751 | 291 |
| 98 | 3300013307 | Ga0157372_10028128 | Ga0157372_100281284 | 291 |
| 99 | 3300042137 | Ga0450902_009904 | Ga0450902_009904_537_1412 | 291 |
| 100 | 3300046518 | Ga0495631_0090360 | Ga0495631_0090360_427_1302 | 291 |
| 101 | 3300046692 | Ga0495671_0039934 | Ga0495671_0039934_1472_2347 | 291 |
| 102 | 3300047469 | Ga0495673_0083791 | Ga0495673_0083791_427_1302 | 291 |
| 103 | 3300048923 | Ga0496120_0029448 | Ga0496120_0029448_1877_2776 | 291 |
| 104 | 3300048924 | Ga0496121_0076594 | Ga0496121_0076594_849_1748 | 291 |
| 105 | 3300048925 | Ga0496122_0152576 | Ga0496122_0152576_420_1319 | 291 |
| 106 | 3300049459 | Ga0495678_072721 | Ga0495678_072721_338_1237 | 291 |
| 107 | 3300046680 | Ga0495646_0089516 | Ga0495646_0089516_726_1625 | 292 |
| 108 | 3300046689 | Ga0495613_0174622 | Ga0495613_0174622_178_1077 | 292 |
| 109 | 3300047321 | Ga0495676_0048783 | Ga0495676_0048783_1784_2683 | 292 |
| 110 | 3300047322 | Ga0495680_0101719 | Ga0495680_0101719_1085_1984 | 292 |
| 111 | iso_pu_bacteria | 2600255389 | 2602008139 | 293 |
| 112 | iso_pu_bacteria | 2823421272 | 2823426013 | 293 |
| 113 | iso_pu_bacteria | 2926063275 | 2926064432 | 293 |
| 114 | 3300027395 | Ga0209996_1002843 | Ga0209996_10028433 | 294 |
| 115 | 3300027552 | Ga0209982_1004294 | Ga0209982_10042942 | 294 |
| 116 | 3300032004 | Ga0307414_10086135 | Ga0307414_100861351 | 294 |
| 117 | iso_pu_bacteria | 2511231024 | 2511376587 | 294 |
| 118 | iso_pu_bacteria | 2728369097 | 2729146799 | 294 |
| 119 | iso_pu_bacteria | 2765235841 | 2765586733 | 294 |
| 120 | iso_pu_bacteria | 2806310737 | 2807410927 | 294 |
| 121 | iso_pu_bacteria | 2806310745 | 2807459268 | 294 |
| 122 | iso_pu_bacteria | 2808606373 | 2808906100 | 294 |
| 123 | iso_pu_bacteria | 2912963787 | 2912969051 | 294 |
| 124 | iso_pu_bacteria | 2919155634 | 2919156042 | 294 |
| 125 | iso_pu_bacteria | 2939651529 | 2939654311 | 294 |
| 126 | iso_pu_bacteria | 3007803356 | 3007805912 | 294 |
| 127 | iso_pu_bacteria | 3007872151 | 3007873170 | 294 |
| 128 | iso_pu_bacteria | 8052494512 | 8052494691 | 294 |
| 129 | iso_pu_bacteria | 8054929484 | 8054929737 | 294 |
| 130 | iso_pu_bacteria | 8055878733 | 8055881725 | 294 |
| 131 | iso_pu_bacteria | 8056115690 | 8056116389 | 294 |
| 132 | iso_pu_bacteria | 8056120720 | 8056125842 | 294 |
| 133 | iso_pu_bacteria | 8056137416 | 8056142961 | 294 |
| 134 | 3300053119 | Ga0500595_008482 | Ga0500595_008482_1940_2854 | 295 |
| 135 | iso_pu_bacteria | 2511231004 | 2511253526 | 295 |
| 136 | iso_pu_bacteria | 2511231006 | 2511266974 | 295 |
| 137 | iso_pu_bacteria | 2511231007 | 2511269897 | 295 |
| 138 | iso_pu_bacteria | 2511231008 | 2511275280 | 295 |
| 139 | iso_pu_bacteria | 2511231010 | 2511289815 | 295 |
| 140 | iso_pu_bacteria | 2511231011 | 2511294317 | 295 |
| 141 | iso_pu_bacteria | 2511231012 | 2511300110 | 295 |
| 142 | iso_pu_bacteria | 2511231014 | 2511317025 | 295 |
| 143 | iso_pu_bacteria | 2511231015 | 2511318622 | 295 |
| 144 | iso_pu_bacteria | 2511231016 | 2511325131 | 295 |
| 145 | iso_pu_bacteria | 2511231017 | 2511332125 | 295 |
| 146 | iso_pu_bacteria | 2511231018 | 2511339227 | 295 |
| 147 | iso_pu_bacteria | 2511231019 | 2511343212 | 295 |
| 148 | iso_pu_bacteria | 2511231020 | 2511347899 | 295 |
| 149 | iso_pu_bacteria | 2511231021 | 2511359069 | 295 |
| 150 | iso_pu_bacteria | 2511231022 | 2511364314 | 295 |
| 151 | iso_pu_bacteria | 2511231023 | 2511367430 | 295 |
| 152 | iso_pu_bacteria | 2511231031 | 2511416436 | 295 |
| 153 | iso_pu_bacteria | 2511231156 | 2511822087 | 295 |
| 154 | iso_pu_bacteria | 2512047018 | 2512326486 | 295 |
| 155 | iso_pu_bacteria | 2554235341 | 2555673027 | 295 |
| 156 | iso_pu_bacteria | 2582580891 | 2583795535 | 295 |
| 157 | iso_pu_bacteria | 2597489887 | 2597861082 | 295 |
| 158 | iso_pu_bacteria | 2597489888 | 2597866816 | 295 |
| 159 | iso_pu_bacteria | 2597489889 | 2597872674 | 295 |
| 160 | iso_pu_bacteria | 2599185160 | 2599355768 | 295 |
| 161 | iso_pu_bacteria | 2599185161 | 2599362830 | 295 |
| 162 | iso_pu_bacteria | 2599185162 | 2599368864 | 295 |
| 163 | iso_pu_bacteria | 2599185163 | 2599375939 | 295 |
| 164 | iso_pu_bacteria | 2599185164 | 2599380874 | 295 |
| 165 | iso_pu_bacteria | 2599185165 | 2599387610 | 295 |
| 166 | iso_pu_bacteria | 2599185166 | 2599394797 | 295 |
| 167 | iso_pu_bacteria | 2599185167 | 2599400981 | 295 |
| 168 | iso_pu_bacteria | 2599185168 | 2599406562 | 295 |
| 169 | iso_pu_bacteria | 2599185179 | 2599449674 | 295 |
| 170 | iso_pu_bacteria | 2599185181 | 2599462602 | 295 |
| 171 | iso_pu_bacteria | 2599185182 | 2599467976 | 295 |
| 172 | iso_pu_bacteria | 2599185185 | 2599487205 | 295 |
| 173 | iso_pu_bacteria | 2599185186 | 2599491619 | 295 |
| 174 | iso_pu_bacteria | 2599185188 | 2599503660 | 295 |
| 175 | iso_pu_bacteria | 2599185189 | 2599505933 | 295 |
| 176 | iso_pu_bacteria | 2599185190 | 2599511746 | 295 |
| 177 | iso_pu_bacteria | 2599185191 | 2599516732 | 295 |
| 178 | iso_pu_bacteria | 2599185212 | 2599616118 | 295 |
| 179 | iso_pu_bacteria | 2599185248 | 2599767727 | 295 |
| 180 | iso_pu_bacteria | 2599185257 | 2599804469 | 295 |
| 181 | iso_pu_bacteria | 2599185288 | 2599879222 | 295 |
| 182 | iso_pu_bacteria | 2599185289 | 2599887959 | 295 |
| 183 | iso_pu_bacteria | 2599185290 | 2599893249 | 295 |
| 184 | iso_pu_bacteria | 2599185291 | 2599899350 | 295 |
| 185 | iso_pu_bacteria | 2599185300 | 2599933089 | 295 |
| 186 | iso_pu_bacteria | 2599185302 | 2599942161 | 295 |
| 187 | iso_pu_bacteria | 2599185303 | 2599948830 | 295 |
| 188 | iso_pu_bacteria | 2599185304 | 2599955141 | 295 |
| 189 | iso_pu_bacteria | 2599185305 | 2599963680 | 295 |
| 190 | iso_pu_bacteria | 2599185306 | 2599968741 | 295 |
| 191 | iso_pu_bacteria | 2599185308 | 2599979884 | 295 |
| 192 | iso_pu_bacteria | 2599185309 | 2599984467 | 295 |
| 193 | iso_pu_bacteria | 2599185310 | 2599990746 | 295 |
| 194 | iso_pu_bacteria | 2599185311 | 2599997258 | 295 |
| 195 | iso_pu_bacteria | 2599185312 | 2600000669 | 295 |
| 196 | iso_pu_bacteria | 2599185313 | 2600007412 | 295 |
| 197 | iso_pu_bacteria | 2599185314 | 2600013709 | 295 |
| 198 | iso_pu_bacteria | 2599185315 | 2600021301 | 295 |
| 199 | iso_pu_bacteria | 2599185316 | 2600026777 | 295 |
| 200 | iso_pu_bacteria | 2599185318 | 2600038591 | 295 |
| 201 | iso_pu_bacteria | 2599185319 | 2600043992 | 295 |
| 202 | iso_pu_bacteria | 2599185320 | 2600049736 | 295 |
| 203 | iso_pu_bacteria | 2599185321 | 2600056373 | 295 |
| 204 | iso_pu_bacteria | 2599185322 | 2600062438 | 295 |
| 205 | iso_pu_bacteria | 2599185323 | 2600065246 | 295 |
| 206 | iso_pu_bacteria | 2599185324 | 2600074324 | 295 |
| 207 | iso_pu_bacteria | 2599185325 | 2600080452 | 295 |
| 208 | iso_pu_bacteria | 2599185356 | 2600215226 | 295 |
| 209 | iso_pu_bacteria | 2600254930 | 2600361620 | 295 |
| 210 | iso_pu_bacteria | 2600254931 | 2600363355 | 295 |
| 211 | iso_pu_bacteria | 2600255296 | 2601693178 | 295 |
| 212 | iso_pu_bacteria | 2600255313 | 2601775392 | 295 |
| 213 | iso_pu_bacteria | 2600255318 | 2601798349 | 295 |
| 214 | iso_pu_bacteria | 2603880185 | 2606077243 | 295 |
| 215 | iso_pu_bacteria | 2603880199 | 2606129511 | 295 |
| 216 | iso_pu_bacteria | 2619619299 | 2621296658 | 295 |
| 217 | iso_pu_bacteria | 2623620443 | 2624483617 | 295 |
| 218 | iso_pu_bacteria | 2623620446 | 2624495195 | 295 |
| 219 | iso_pu_bacteria | 2643221565 | 2643843297 | 295 |
| 220 | iso_pu_bacteria | 2643221571 | 2643873401 | 295 |
| 221 | iso_pu_bacteria | 2643221589 | 2643956146 | 295 |
| 222 | iso_pu_bacteria | 2643221602 | 2644020268 | 295 |
| 223 | iso_pu_bacteria | 2643221633 | 2644184280 | 295 |
| 224 | iso_pu_bacteria | 2643221650 | 2644282800 | 295 |
| 225 | iso_pu_bacteria | 2643221713 | 2644621233 | 295 |
| 226 | iso_pu_bacteria | 2651869719 | 2652546310 | 295 |
| 227 | iso_pu_bacteria | 2667528170 | 2671091854 | 295 |
| 228 | iso_pu_bacteria | 2667528171 | 2671099471 | 295 |
| 229 | iso_pu_bacteria | 2667528176 | 2671129563 | 295 |
| 230 | iso_pu_bacteria | 2671180172 | 2671771477 | 295 |
| 231 | iso_pu_bacteria | 2675903420 | 2677900564 | 295 |
| 232 | iso_pu_bacteria | 2675903515 | 2678266567 | 295 |
| 233 | iso_pu_bacteria | 2713897148 | 2715749628 | 295 |
| 234 | iso_pu_bacteria | 2713897149 | 2715754638 | 295 |
| 235 | iso_pu_bacteria | 2718217725 | 2718636814 | 295 |
| 236 | iso_pu_bacteria | 2721755607 | 2723251547 | 295 |
| 237 | iso_pu_bacteria | 2738541265 | 2738673593 | 295 |
| 238 | iso_pu_bacteria | 2738541282 | 2738751986 | 295 |
| 239 | iso_pu_bacteria | 2738541294 | 2738807440 | 295 |
| 240 | iso_pu_bacteria | 2738541303 | 2738861027 | 295 |
| 241 | iso_pu_bacteria | 2738541309 | 2738894800 | 295 |
| 242 | iso_pu_bacteria | 2738543004 | 2739201064 | 295 |
| 243 | iso_pu_bacteria | 2738543015 | 2739260573 | 295 |
| 244 | iso_pu_bacteria | 2738543025 | 2739312295 | 295 |
| 245 | iso_pu_bacteria | 2740892503 | 2743740621 | 295 |
| 246 | iso_pu_bacteria | 2744054620 | 2745007797 | 295 |
| 247 | iso_pu_bacteria | 2773857670 | 2774118150 | 295 |
| 248 | iso_pu_bacteria | 2773857673 | 2774136391 | 295 |
| 249 | iso_pu_bacteria | 2784132063 | 2784261614 | 295 |
| 250 | iso_pu_bacteria | 2784132072 | 2784316918 | 295 |
| 251 | iso_pu_bacteria | 2791355520 | 2794598970 | 295 |
| 252 | iso_pu_bacteria | 2808606361 | 2808856662 | 295 |
| 253 | iso_pu_bacteria | 2808606376 | 2808925805 | 295 |
| 254 | iso_pu_bacteria | 2808606377 | 2808928242 | 295 |
| 255 | iso_pu_bacteria | 2808606378 | 2808936628 | 295 |
| 256 | iso_pu_bacteria | 2808606380 | 2808947954 | 295 |
| 257 | iso_pu_bacteria | 2808606381 | 2808950576 | 295 |
| 258 | iso_pu_bacteria | 2808606382 | 2808961433 | 295 |
| 259 | iso_pu_bacteria | 2808606383 | 2808965079 | 295 |
| 260 | iso_pu_bacteria | 2808606385 | 2808976343 | 295 |
| 261 | iso_pu_bacteria | 2808606388 | 2808994197 | 295 |
| 262 | iso_pu_bacteria | 2808606389 | 2808999971 | 295 |
| 263 | iso_pu_bacteria | 2808606445 | 2809217427 | 295 |
| 264 | iso_pu_bacteria | 2816332298 | 2817494229 | 295 |
| 265 | iso_pu_bacteria | 2818991456 | 2819655335 | 295 |
| 266 | iso_pu_bacteria | 2818991464 | 2819704617 | 295 |
| 267 | iso_pu_bacteria | 2825651385 | 2825654643 | 295 |
| 268 | iso_pu_bacteria | 2834028612 | 2834031136 | 295 |
| 269 | iso_pu_bacteria | 2842826826 | 2842828586 | 295 |
| 270 | iso_pu_bacteria | 2842832357 | 2842833662 | 295 |
| 271 | iso_pu_bacteria | 2842837860 | 2842838080 | 295 |
| 272 | iso_pu_bacteria | 2842843487 | 2842845894 | 295 |
| 273 | iso_pu_bacteria | 2842854478 | 2842855821 | 295 |
| 274 | iso_pu_bacteria | 2844665904 | 2844667295 | 295 |
| 275 | iso_pu_bacteria | 2852612431 | 2852616538 | 295 |
| 276 | iso_pu_bacteria | 2852657418 | 2852660015 | 295 |
| 277 | iso_pu_bacteria | 2852667396 | 2852671506 | 295 |
| 278 | iso_pu_bacteria | 2860339153 | 2860341919 | 295 |
| 279 | iso_pu_bacteria | 2860867994 | 2860873209 | 295 |
| 280 | iso_pu_bacteria | 2878029506 | 2878029621 | 295 |
| 281 | iso_pu_bacteria | 2880230671 | 2880236201 | 295 |
| 282 | iso_pu_bacteria | 2904518522 | 2904518751 | 295 |
| 283 | iso_pu_bacteria | 2904550169 | 2904553513 | 295 |
| 284 | iso_pu_bacteria | 2908446538 | 2908452806 | 295 |
| 285 | iso_pu_bacteria | 2913036834 | 2913042748 | 295 |
| 286 | iso_pu_bacteria | 2917070673 | 2917076926 | 295 |
| 287 | iso_pu_bacteria | 2919063839 | 2919065305 | 295 |
| 288 | iso_pu_bacteria | 2919385768 | 2919388989 | 295 |
| 289 | iso_pu_bacteria | 2919456309 | 2919457778 | 295 |
| 290 | iso_pu_bacteria | 2919481497 | 2919487166 | 295 |
| 291 | iso_pu_bacteria | 2919487758 | 2919487918 | 295 |
| 292 | iso_pu_bacteria | 2919697872 | 2919702528 | 295 |
| 293 | iso_pu_bacteria | 2923153595 | 2923159717 | 295 |
| 294 | iso_pu_bacteria | 2923586266 | 2923589423 | 295 |
| 295 | iso_pu_bacteria | 2929144301 | 2929144431 | 295 |
| 296 | iso_pu_bacteria | 2929189879 | 2929195336 | 295 |
| 297 | iso_pu_bacteria | 2931369376 | 2931372222 | 295 |
| 298 | iso_pu_bacteria | 2931390751 | 2931390850 | 295 |
| 299 | iso_pu_bacteria | 2931396565 | 2931398316 | 295 |
| 300 | iso_pu_bacteria | 2935353572 | 2935358107 | 295 |
| 301 | iso_pu_bacteria | 2939636861 | 2939640638 | 295 |
| 302 | iso_pu_bacteria | 2945928738 | 2945930727 | 295 |
| 303 | iso_pu_bacteria | 2945961074 | 2945967056 | 295 |
| 304 | iso_pu_bacteria | 2946006987 | 2946013072 | 295 |
| 305 | iso_pu_bacteria | 2946027586 | 2946028086 | 295 |
| 306 | iso_pu_bacteria | 2947233263 | 2947234615 | 295 |
| 307 | iso_pu_bacteria | 2969304461 | 2969310421 | 295 |
| 308 | iso_pu_bacteria | 2974289157 | 2974293878 | 295 |
| 309 | iso_pu_bacteria | 2984286254 | 2984286400 | 295 |
| 310 | iso_pu_bacteria | 2988728565 | 2988731679 | 295 |
| 311 | iso_pu_bacteria | 2998139840 | 2998139951 | 295 |
| 312 | iso_pu_bacteria | 3007395558 | 3007399202 | 295 |
| 313 | iso_pu_bacteria | 3007419365 | 3007419473 | 295 |
| 314 | iso_pu_bacteria | 3007511990 | 3007517377 | 295 |
| 315 | iso_pu_bacteria | 3007614139 | 3007615813 | 295 |
| 316 | iso_pu_bacteria | 3007619802 | 3007622662 | 295 |
| 317 | iso_pu_bacteria | 3007718800 | 3007723075 | 295 |
| 318 | iso_pu_bacteria | 3007855910 | 3007859397 | 295 |
| 319 | iso_pu_bacteria | 3007861166 | 3007864894 | 295 |
| 320 | iso_pu_bacteria | 8015687852 | 8015693810 | 295 |
| 321 | iso_pu_bacteria | 8019769354 | 8019769581 | 295 |
| 322 | iso_pu_bacteria | 8019775933 | 8019779750 | 295 |
| 323 | iso_pu_bacteria | 8029995093 | 8029995302 | 295 |
| 324 | iso_pu_bacteria | 8054285046 | 8054287149 | 295 |
| 325 | iso_pu_bacteria | 8054347763 | 8054349402 | 295 |
| 326 | iso_pu_bacteria | 8054503363 | 8054503457 | 295 |
| 327 | iso_pu_bacteria | 8055770955 | 8055777072 | 295 |
| 328 | iso_pu_bacteria | 8055817908 | 8055824093 | 295 |
| 329 | iso_pu_bacteria | 8056125926 | 8056125987 | 295 |
| 330 | iso_pu_bacteria | 8056131705 | 8056131796 | 295 |
| 331 | iso_pu_bacteria | 8056148874 | 8056151309 | 295 |
| 332 | iso_pu_bacteria | 8056155041 | 8056159949 | 295 |
| 333 | iso_pu_bacteria | 8056161164 | 8056163813 | 295 |
| 334 | iso_pu_bacteria | 8056166840 | 8056171100 | 295 |
| 335 | iso_pu_bacteria | 8056172158 | 8056177222 | 295 |
| 336 | iso_pu_bacteria | 8056177738 | 8056182311 | 295 |
| 337 | iso_pu_bacteria | 8056569372 | 8056570673 | 295 |
| 338 | iso_pu_bacteria | 8057798959 | 8057802134 | 295 |
| 339 | 3300031548 | Ga0307408_100000002 | Ga0307408_100000002674 | 296 |
| 340 | 3300046512 | Ga0495610_0060909 | Ga0495610_0060909_808_1701 | 297 |
| 341 | 2162886007 | SwRhRL2b_contig_2143161 | SwRhRL2b_0105.00000890 | 298 |
| 342 | 3300003856 | Ga0058692_1002657 | Ga0058692_10026574 | 298 |
| 343 | 3300005289 | Ga0065704_10096819 | Ga0065704_100968193 | 298 |
| 344 | 3300005289 | Ga0065704_10139376 | Ga0065704_101393761 | 298 |
| 345 | 3300005347 | Ga0070668_100342115 | Ga0070668_1003421151 | 298 |
| 346 | 3300006944 | Ga0099823_1033941 | Ga0099823_10339412 | 298 |
| 347 | 3300009011 | Ga0105251_10008371 | Ga0105251_100083715 | 298 |
| 348 | 3300009036 | Ga0105244_10019248 | Ga0105244_100192483 | 298 |
| 349 | 3300009036 | Ga0105244_10019839 | Ga0105244_100198392 | 298 |
| 350 | 3300009036 | Ga0105244_10034337 | Ga0105244_100343373 | 298 |
| 351 | 3300009036 | Ga0105244_10040258 | Ga0105244_100402583 | 298 |
| 352 | 3300009092 | Ga0105250_10033111 | Ga0105250_100331112 | 298 |
| 353 | 3300009148 | Ga0105243_10013630 | Ga0105243_100136304 | 298 |
| 354 | 3300009148 | Ga0105243_10023427 | Ga0105243_100234274 | 298 |
| 355 | 3300009148 | Ga0105243_10096892 | Ga0105243_100968922 | 298 |
| 356 | 3300013104 | Ga0157370_10106867 | Ga0157370_101068674 | 298 |
| 357 | 3300013307 | Ga0157372_10003284 | Ga0157372_100032849 | 298 |
| 358 | 3300025292 | Ga0209676_1004422 | Ga0209676_10044224 | 298 |
| 359 | 3300025711 | Ga0207696_1000055 | Ga0207696_100005554 | 298 |
| 360 | 3300025711 | Ga0207696_1009608 | Ga0207696_10096082 | 298 |
| 361 | 3300025728 | Ga0207655_1000541 | Ga0207655_10005417 | 298 |
| 362 | 3300025728 | Ga0207655_1006294 | Ga0207655_10062947 | 298 |
| 363 | 3300025728 | Ga0207655_1010039 | Ga0207655_10100394 | 298 |
| 364 | 3300025728 | Ga0207655_1017720 | Ga0207655_10177203 | 298 |
| 365 | 3300025735 | Ga0207713_1010169 | Ga0207713_10101694 | 298 |
| 366 | 3300025735 | Ga0207713_1025127 | Ga0207713_10251273 | 298 |
| 367 | 3300025735 | Ga0207713_1045320 | Ga0207713_10453203 | 298 |
| 368 | 3300025935 | Ga0207709_10005565 | Ga0207709_100055654 | 298 |
| 369 | 3300025935 | Ga0207709_10011028 | Ga0207709_100110282 | 298 |
| 370 | 3300027296 | Ga0209389_1000036 | Ga0209389_100003650 | 298 |
| 371 | 3300027312 | Ga0209371_1000632 | Ga0209371_10006327 | 298 |
| 372 | 3300030500 | Ga0268256_1000247 | Ga0268256_10002477 | 298 |
| 373 | 3300041405 | Ga0439438_034184 | Ga0439438_034184_296_1192 | 298 |
| 374 | 3300042006 | Ga0439432_001455 | Ga0439432_001455_2876_3772 | 298 |
| 375 | 3300042013 | Ga0439456_000080 | Ga0439456_000080_26042_26938 | 298 |
| 376 | 3300042136 | Ga0450900_008597 | Ga0450900_008597_365_1261 | 298 |
| 377 | 3300042142 | Ga0450905_001046 | Ga0450905_001046_93_989 | 298 |
| 378 | 3300042142 | Ga0450905_001197 | Ga0450905_001197_1197_2093 | 298 |
| 379 | 3300042530 | Ga0450916_000390 | Ga0450916_000390_1991_2890 | 298 |
| 380 | 3300046515 | Ga0495620_0000538 | Ga0495620_0000538_16159_17055 | 298 |
| 381 | 3300046519 | Ga0495632_0006009 | Ga0495632_0006009_2257_3153 | 298 |
| 382 | 3300046522 | Ga0495643_0000763 | Ga0495643_0000763_30426_31322 | 298 |
| 383 | 3300046522 | Ga0495643_0008586 | Ga0495643_0008586_2628_3524 | 298 |
| 384 | 3300046524 | Ga0495648_0002285 | Ga0495648_0002285_861_1757 | 298 |
| 385 | 3300048913 | Ga0496110_0406423 | Ga0496110_0406423_95_991 | 298 |
| 386 | 3300048917 | Ga0496114_0061661 | Ga0496114_0061661_2163_3059 | 298 |
| 387 | 3300048917 | Ga0496114_0070475 | Ga0496114_0070475_835_1731 | 298 |
| 388 | 3300048920 | Ga0496117_0007309 | Ga0496117_0007309_2524_3420 | 298 |
| 389 | 3300048920 | Ga0496117_0008713 | Ga0496117_0008713_2613_3509 | 298 |
| 390 | 3300048920 | Ga0496117_0009017 | Ga0496117_0009017_2226_3122 | 298 |
| 391 | 3300048921 | Ga0496118_0002317 | Ga0496118_0002317_95_991 | 298 |
| 392 | 3300048921 | Ga0496118_0012115 | Ga0496118_0012115_7361_8257 | 298 |
| 393 | 3300048922 | Ga0496119_0000506 | Ga0496119_0000506_42551_43456 | 298 |
| 394 | 3300048922 | Ga0496119_0080186 | Ga0496119_0080186_925_1821 | 298 |
| 395 | 3300048923 | Ga0496120_0001362 | Ga0496120_0001362_4700_5605 | 298 |
| 396 | 3300048924 | Ga0496121_0139478 | Ga0496121_0139478_77_973 | 298 |
| 397 | 3300048925 | Ga0496122_0007408 | Ga0496122_0007408_7625_8521 | 298 |
| 398 | 3300048926 | Ga0496123_0005881 | Ga0496123_0005881_3921_4817 | 298 |
| 399 | 3300048926 | Ga0496123_0053521 | Ga0496123_0053521_598_1494 | 298 |
| 400 | 3300048927 | Ga0496124_0007177 | Ga0496124_0007177_2631_3527 | 298 |
| 401 | 3300048927 | Ga0496124_0035067 | Ga0496124_0035067_2345_3244 | 298 |
| 402 | 3300048927 | Ga0496124_0041751 | Ga0496124_0041751_2396_3292 | 298 |
| 403 | 3300048927 | Ga0496124_0053428 | Ga0496124_0053428_59_955 | 298 |
| 404 | 3300048927 | Ga0496124_0140762 | Ga0496124_0140762_47_943 | 298 |
| 405 | 3300048928 | Ga0496125_0014065 | Ga0496125_0014065_4252_5148 | 298 |
| 406 | 3300048928 | Ga0496125_0020727 | Ga0496125_0020727_1495_2391 | 298 |
| 407 | 3300048928 | Ga0496125_0198684 | Ga0496125_0198684_135_1031 | 298 |
| 408 | 3300048929 | Ga0496126_0106470 | Ga0496126_0106470_96_992 | 298 |
| 409 | 3300049571 | Ga0501034_0000136 | Ga0501034_0000136_94959_95855 | 298 |
| 410 | 3300049853 | Ga0501226_000060 | Ga0501226_000060_17451_18350 | 298 |
| 411 | 3300053135 | Ga0500659_0003173 | Ga0500659_0003173_93_989 | 298 |
| 412 | 2124908027 | MRS2a_Contig_41 | MRS2a_00299900 | 299 |
| 413 | 2124908027 | MRS2a_Contig_973 | MRS2a_00809160 | 299 |
| 414 | 3300002737 | JGI25162J39368_1000082 | JGI25162J39368_100008237 | 299 |
| 415 | 3300002737 | JGI25162J39368_1000282 | JGI25162J39368_100028222 | 299 |
| 416 | 3300002771 | JGI25163J39215_1001247 | JGI25163J39215_10012473 | 299 |
| 417 | 3300002771 | JGI25163J39215_1001473 | JGI25163J39215_10014733 | 299 |
| 418 | 3300002772 | JGI25164J39214_1000058 | JGI25164J39214_100005837 | 299 |
| 419 | 3300002772 | JGI25164J39214_1000212 | JGI25164J39214_100021222 | 299 |
| 420 | 3300003214 | JGI25165J46597_1000154 | JGI25165J46597_100015437 | 299 |
| 421 | 3300003214 | JGI25165J46597_1000383 | JGI25165J46597_100038323 | 299 |
| 422 | 3300003752 | Ga0055539_1000017 | Ga0055539_1000017203 | 299 |
| 423 | 3300003756 | Ga0055533_1000021 | Ga0055533_1000021203 | 299 |
| 424 | 3300003758 | Ga0055532_1000020 | Ga0055532_100002039 | 299 |
| 425 | 3300003759 | Ga0055525_1000078 | Ga0055525_100007875 | 299 |
| 426 | 3300003781 | Ga0055536_1004543 | Ga0055536_10045434 | 299 |
| 427 | 3300003781 | Ga0055536_1009458 | Ga0055536_10094585 | 299 |
| 428 | 3300003791 | Ga0055530_10005470 | Ga0055530_100054705 | 299 |
| 429 | 3300003791 | Ga0055530_10008701 | Ga0055530_100087015 | 299 |
| 430 | 3300003792 | Ga0055540_1004724 | Ga0055540_10047245 | 299 |
| 431 | 3300003792 | Ga0055540_1007682 | Ga0055540_10076822 | 299 |
| 432 | 3300003841 | Ga0055541_1000012 | Ga0055541_1000012203 | 299 |
| 433 | 3300005288 | Ga0065714_10000439 | Ga0065714_100004392 | 299 |
| 434 | 3300005288 | Ga0065714_10002271 | Ga0065714_1000227129 | 299 |
| 435 | 3300005288 | Ga0065714_10006312 | Ga0065714_100063123 | 299 |
| 436 | 3300005288 | Ga0065714_10008133 | Ga0065714_100081334 | 299 |
| 437 | 3300005288 | Ga0065714_10066861 | Ga0065714_100668614 | 299 |
| 438 | 3300005288 | Ga0065714_10072674 | Ga0065714_100726743 | 299 |
| 439 | 3300005289 | Ga0065704_10075102 | Ga0065704_100751025 | 299 |
| 440 | 3300005289 | Ga0065704_10082411 | Ga0065704_100824113 | 299 |
| 441 | 3300005289 | Ga0065704_10088544 | Ga0065704_100885442 | 299 |
| 442 | 3300005290 | Ga0065712_10087006 | Ga0065712_100870061 | 299 |
| 443 | 3300005331 | Ga0070670_100009258 | Ga0070670_1000092586 | 299 |
| 444 | 3300005331 | Ga0070670_100032384 | Ga0070670_1000323843 | 299 |
| 445 | 3300005344 | Ga0070661_100004654 | Ga0070661_1000046543 | 299 |
| 446 | 3300005353 | Ga0070669_100000186 | Ga0070669_10000018623 | 299 |
| 447 | 3300005353 | Ga0070669_100005487 | Ga0070669_1000054875 | 299 |
| 448 | 3300005356 | Ga0070674_100194995 | Ga0070674_1001949952 | 299 |
| 449 | 3300005457 | Ga0070662_100112437 | Ga0070662_1001124371 | 299 |
| 450 | 3300005548 | Ga0070665_100046440 | Ga0070665_1000464403 | 299 |
| 451 | 3300005548 | Ga0070665_100144180 | Ga0070665_1001441803 | 299 |
| 452 | 3300005564 | Ga0070664_100000292 | Ga0070664_10000029227 | 299 |
| 453 | 3300005578 | Ga0068854_100013801 | Ga0068854_1000138013 | 299 |
| 454 | 3300005834 | Ga0068851_10000039 | Ga0068851_100000397 | 299 |
| 455 | 3300006051 | Ga0075364_10071835 | Ga0075364_100718353 | 299 |
| 456 | 3300006051 | Ga0075364_10080097 | Ga0075364_100800972 | 299 |
| 457 | 3300006051 | Ga0075364_10087710 | Ga0075364_100877102 | 299 |
| 458 | 3300006051 | Ga0075364_10310727 | Ga0075364_103107272 | 299 |
| 459 | 3300006058 | Ga0075432_10005388 | Ga0075432_100053884 | 299 |
| 460 | 3300006058 | Ga0075432_10007561 | Ga0075432_100075614 | 299 |
| 461 | 3300006058 | Ga0075432_10024934 | Ga0075432_100249343 | 299 |
| 462 | 3300006058 | Ga0075432_10037262 | Ga0075432_100372622 | 299 |
| 463 | 3300006058 | Ga0075432_10120714 | Ga0075432_101207141 | 299 |
| 464 | 3300006177 | Ga0075362_10144102 | Ga0075362_101441021 | 299 |
| 465 | 3300006914 | Ga0075436_100149243 | Ga0075436_1001492432 | 299 |
| 466 | 3300006946 | Ga0079104_1001850 | Ga0079104_10018506 | 299 |
| 467 | 3300006946 | Ga0079104_1007967 | Ga0079104_10079675 | 299 |
| 468 | 3300009011 | Ga0105251_10000089 | Ga0105251_100000899 | 299 |
| 469 | 3300009011 | Ga0105251_10008839 | Ga0105251_100088393 | 299 |
| 470 | 3300009011 | Ga0105251_10016631 | Ga0105251_100166312 | 299 |
| 471 | 3300009011 | Ga0105251_10034558 | Ga0105251_100345584 | 299 |
| 472 | 3300009011 | Ga0105251_10059337 | Ga0105251_100593372 | 299 |
| 473 | 3300009011 | Ga0105251_10063703 | Ga0105251_100637032 | 299 |
| 474 | 3300009036 | Ga0105244_10008948 | Ga0105244_100089484 | 299 |
| 475 | 3300009036 | Ga0105244_10009039 | Ga0105244_100090393 | 299 |
| 476 | 3300009036 | Ga0105244_10069281 | Ga0105244_100692812 | 299 |
| 477 | 3300009036 | Ga0105244_10077974 | Ga0105244_100779741 | 299 |
| 478 | 3300009092 | Ga0105250_10001135 | Ga0105250_100011358 | 299 |
| 479 | 3300009092 | Ga0105250_10004905 | Ga0105250_100049054 | 299 |
| 480 | 3300009092 | Ga0105250_10012182 | Ga0105250_100121822 | 299 |
| 481 | 3300009092 | Ga0105250_10017305 | Ga0105250_100173053 | 299 |
| 482 | 3300009092 | Ga0105250_10018249 | Ga0105250_100182492 | 299 |
| 483 | 3300009148 | Ga0105243_10005333 | Ga0105243_100053335 | 299 |
| 484 | 3300009148 | Ga0105243_10013497 | Ga0105243_100134974 | 299 |
| 485 | 3300009148 | Ga0105243_10045133 | Ga0105243_100451334 | 299 |
| 486 | 3300009148 | Ga0105243_10088764 | Ga0105243_100887644 | 299 |
| 487 | 3300009176 | Ga0105242_10001069 | Ga0105242_100010696 | 299 |
| 488 | 3300009176 | Ga0105242_10042069 | Ga0105242_100420693 | 299 |
| 489 | 3300009545 | Ga0105237_10001100 | Ga0105237_1000110027 | 299 |
| 490 | 3300009545 | Ga0105237_10300209 | Ga0105237_103002092 | 299 |
| 491 | 3300009553 | Ga0105249_10007620 | Ga0105249_100076206 | 299 |
| 492 | 3300011119 | Ga0105246_10006273 | Ga0105246_100062735 | 299 |
| 493 | 3300011119 | Ga0105246_10028338 | Ga0105246_100283382 | 299 |
| 494 | 3300011119 | Ga0105246_10081744 | Ga0105246_100817443 | 299 |
| 495 | 3300012483 | Ga0157337_1000334 | Ga0157337_10003343 | 299 |
| 496 | 3300012498 | Ga0157345_1000279 | Ga0157345_10002795 | 299 |
| 497 | 3300013100 | Ga0157373_10014293 | Ga0157373_100142934 | 299 |
| 498 | 3300013100 | Ga0157373_10014510 | Ga0157373_100145103 | 299 |
| 499 | 3300013100 | Ga0157373_10015661 | Ga0157373_100156613 | 299 |
| 500 | 3300013100 | Ga0157373_10054780 | Ga0157373_100547802 | 299 |
| 501 | 3300013100 | Ga0157373_10082138 | Ga0157373_100821383 | 299 |
| 502 | 3300013100 | Ga0157373_10093502 | Ga0157373_100935022 | 299 |
| 503 | 3300013100 | Ga0157373_10103609 | Ga0157373_101036092 | 299 |
| 504 | 3300013100 | Ga0157373_10130352 | Ga0157373_101303522 | 299 |
| 505 | 3300013100 | Ga0157373_10188610 | Ga0157373_101886101 | 299 |
| 506 | 3300013102 | Ga0157371_10000109 | Ga0157371_1000010968 | 299 |
| 507 | 3300013102 | Ga0157371_10008323 | Ga0157371_100083234 | 299 |
| 508 | 3300013102 | Ga0157371_10015185 | Ga0157371_100151855 | 299 |
| 509 | 3300013102 | Ga0157371_10020452 | Ga0157371_100204523 | 299 |
| 510 | 3300013104 | Ga0157370_10027707 | Ga0157370_100277075 | 299 |
| 511 | 3300013104 | Ga0157370_10037357 | Ga0157370_100373573 | 299 |
| 512 | 3300013104 | Ga0157370_10152461 | Ga0157370_101524612 | 299 |
| 513 | 3300013105 | Ga0157369_10012771 | Ga0157369_100127713 | 299 |
| 514 | 3300013105 | Ga0157369_10028227 | Ga0157369_100282275 | 299 |
| 515 | 3300013105 | Ga0157369_10031841 | Ga0157369_100318415 | 299 |
| 516 | 3300013105 | Ga0157369_10077343 | Ga0157369_100773432 | 299 |
| 517 | 3300013105 | Ga0157369_10145778 | Ga0157369_101457782 | 299 |
| 518 | 3300013105 | Ga0157369_10374681 | Ga0157369_103746812 | 299 |
| 519 | 3300013306 | Ga0163162_10015186 | Ga0163162_100151863 | 299 |
| 520 | 3300013306 | Ga0163162_10168413 | Ga0163162_101684132 | 299 |
| 521 | 3300013306 | Ga0163162_10212584 | Ga0163162_102125842 | 299 |
| 522 | 3300013308 | Ga0157375_10021950 | Ga0157375_100219505 | 299 |
| 523 | 3300013308 | Ga0157375_10033370 | Ga0157375_100333703 | 299 |
| 524 | 3300013308 | Ga0157375_10285399 | Ga0157375_102853992 | 299 |
| 525 | 3300013308 | Ga0157375_10514152 | Ga0157375_105141522 | 299 |
| 526 | 3300014497 | Ga0182008_10007384 | Ga0182008_100073845 | 299 |
| 527 | 3300014497 | Ga0182008_10007985 | Ga0182008_100079854 | 299 |
| 528 | 3300014497 | Ga0182008_10009595 | Ga0182008_100095954 | 299 |
| 529 | 3300014497 | Ga0182008_10009942 | Ga0182008_100099423 | 299 |
| 530 | 3300014497 | Ga0182008_10010565 | Ga0182008_100105654 | 299 |
| 531 | 3300014497 | Ga0182008_10064150 | Ga0182008_100641502 | 299 |
| 532 | 3300014497 | Ga0182008_10067524 | Ga0182008_100675241 | 299 |
| 533 | 3300015261 | Ga0182006_1004263 | Ga0182006_10042636 | 299 |
| 534 | 3300015261 | Ga0182006_1005362 | Ga0182006_10053625 | 299 |
| 535 | 3300015261 | Ga0182006_1006516 | Ga0182006_10065164 | 299 |
| 536 | 3300015261 | Ga0182006_1015408 | Ga0182006_10154081 | 299 |
| 537 | 3300015262 | Ga0182007_10005678 | Ga0182007_100056784 | 299 |
| 538 | 3300015262 | Ga0182007_10010392 | Ga0182007_100103924 | 299 |
| 539 | 3300015265 | Ga0182005_1002764 | Ga0182005_10027643 | 299 |
| 540 | 3300015265 | Ga0182005_1003401 | Ga0182005_10034013 | 299 |
| 541 | 3300015265 | Ga0182005_1018358 | Ga0182005_10183582 | 299 |
| 542 | 3300017792 | Ga0163161_10009183 | Ga0163161_100091835 | 299 |
| 543 | 3300017792 | Ga0163161_10032067 | Ga0163161_100320672 | 299 |
| 544 | 3300017792 | Ga0163161_10053254 | Ga0163161_100532542 | 299 |
| 545 | 3300017792 | Ga0163161_10074015 | Ga0163161_100740153 | 299 |
| 546 | 3300017792 | Ga0163161_10182217 | Ga0163161_101822172 | 299 |
| 547 | 3300017792 | Ga0163161_10225644 | Ga0163161_102256442 | 299 |
| 548 | 3300017792 | Ga0163161_10240801 | Ga0163161_102408012 | 299 |
| 549 | 3300017792 | Ga0163161_10289252 | Ga0163161_102892522 | 299 |
| 550 | 3300025206 | Ga0209435_100579 | Ga0209435_1005794 | 299 |
| 551 | 3300025207 | Ga0209760_100160 | Ga0209760_10016034 | 299 |
| 552 | 3300025207 | Ga0209760_100475 | Ga0209760_1004757 | 299 |
| 553 | 3300025224 | Ga0209784_100007 | Ga0209784_100007203 | 299 |
| 554 | 3300025225 | Ga0209566_100009 | Ga0209566_100009203 | 299 |
| 555 | 3300025226 | Ga0209674_100021 | Ga0209674_100021203 | 299 |
| 556 | 3300025229 | Ga0209147_100009 | Ga0209147_100009203 | 299 |
| 557 | 3300025230 | Ga0209563_100018 | Ga0209563_100018203 | 299 |
| 558 | 3300025231 | Ga0207427_100005 | Ga0207427_100005519 | 299 |
| 559 | 3300025231 | Ga0207427_100006 | Ga0207427_100006223 | 299 |
| 560 | 3300025233 | Ga0209437_100013 | Ga0209437_100013223 | 299 |
| 561 | 3300025233 | Ga0209437_100018 | Ga0209437_100018429 | 299 |
| 562 | 3300025242 | Ga0209258_100321 | Ga0209258_10032126 | 299 |
| 563 | 3300025246 | Ga0209646_1000787 | Ga0209646_10007876 | 299 |
| 564 | 3300025253 | Ga0209677_100012 | Ga0209677_100012203 | 299 |
| 565 | 3300025256 | Ga0209759_1021813 | Ga0209759_10218131 | 299 |
| 566 | 3300025261 | Ga0209233_1000021 | Ga0209233_1000021519 | 299 |
| 567 | 3300025261 | Ga0209233_1000022 | Ga0209233_1000022223 | 299 |
| 568 | 3300025291 | Ga0209675_1002421 | Ga0209675_10024216 | 299 |
| 569 | 3300025292 | Ga0209676_1000030 | Ga0209676_1000030461 | 299 |
| 570 | 3300025292 | Ga0209676_1000278 | Ga0209676_100027872 | 299 |
| 571 | 3300025292 | Ga0209676_1013187 | Ga0209676_10131873 | 299 |
| 572 | 3300025298 | Ga0209050_1000061 | Ga0209050_100006143 | 299 |
| 573 | 3300025298 | Ga0209050_1000241 | Ga0209050_10002416 | 299 |
| 574 | 3300025303 | Ga0209051_1000519 | Ga0209051_100051942 | 299 |
| 575 | 3300025303 | Ga0209051_1000572 | Ga0209051_100057243 | 299 |
| 576 | 3300025304 | Ga0209257_1008653 | Ga0209257_10086535 | 299 |
| 577 | 3300025321 | Ga0207656_10000009 | Ga0207656_10000009204 | 299 |
| 578 | 3300025711 | Ga0207696_1000078 | Ga0207696_100007875 | 299 |
| 579 | 3300025711 | Ga0207696_1000080 | Ga0207696_1000080103 | 299 |
| 580 | 3300025711 | Ga0207696_1000204 | Ga0207696_10002048 | 299 |
| 581 | 3300025711 | Ga0207696_1001609 | Ga0207696_100160910 | 299 |
| 582 | 3300025711 | Ga0207696_1020354 | Ga0207696_10203543 | 299 |
| 583 | 3300025711 | Ga0207696_1027443 | Ga0207696_10274432 | 299 |
| 584 | 3300025728 | Ga0207655_1000033 | Ga0207655_1000033266 | 299 |
| 585 | 3300025728 | Ga0207655_1002134 | Ga0207655_10021343 | 299 |
| 586 | 3300025728 | Ga0207655_1003858 | Ga0207655_10038586 | 299 |
| 587 | 3300025728 | Ga0207655_1004732 | Ga0207655_10047325 | 299 |
| 588 | 3300025728 | Ga0207655_1016218 | Ga0207655_10162183 | 299 |
| 589 | 3300025728 | Ga0207655_1018480 | Ga0207655_10184803 | 299 |
| 590 | 3300025728 | Ga0207655_1022478 | Ga0207655_10224783 | 299 |
| 591 | 3300025728 | Ga0207655_1025331 | Ga0207655_10253313 | 299 |
| 592 | 3300025728 | Ga0207655_1028204 | Ga0207655_10282043 | 299 |
| 593 | 3300025735 | Ga0207713_1000010 | Ga0207713_1000010430 | 299 |
| 594 | 3300025735 | Ga0207713_1000707 | Ga0207713_100070720 | 299 |
| 595 | 3300025735 | Ga0207713_1000912 | Ga0207713_10009122 | 299 |
| 596 | 3300025735 | Ga0207713_1001717 | Ga0207713_10017171 | 299 |
| 597 | 3300025735 | Ga0207713_1002747 | Ga0207713_10027475 | 299 |
| 598 | 3300025735 | Ga0207713_1004468 | Ga0207713_10044688 | 299 |
| 599 | 3300025735 | Ga0207713_1005294 | Ga0207713_10052945 | 299 |
| 600 | 3300025735 | Ga0207713_1026441 | Ga0207713_10264414 | 299 |
| 601 | 3300025735 | Ga0207713_1039658 | Ga0207713_10396582 | 299 |
| 602 | 3300025735 | Ga0207713_1057758 | Ga0207713_10577582 | 299 |
| 603 | 3300025914 | Ga0207671_10000027 | Ga0207671_10000027124 | 299 |
| 604 | 3300025914 | Ga0207671_10190213 | Ga0207671_101902132 | 299 |
| 605 | 3300025920 | Ga0207649_10000007 | Ga0207649_1000000750 | 299 |
| 606 | 3300025923 | Ga0207681_10000059 | Ga0207681_1000005927 | 299 |
| 607 | 3300025925 | Ga0207650_10000044 | Ga0207650_1000004487 | 299 |
| 608 | 3300025925 | Ga0207650_10000089 | Ga0207650_1000008989 | 299 |
| 609 | 3300025933 | Ga0207706_10002297 | Ga0207706_100022976 | 299 |
| 610 | 3300025933 | Ga0207706_10077495 | Ga0207706_100774952 | 299 |
| 611 | 3300025934 | Ga0207686_10003528 | Ga0207686_100035285 | 299 |
| 612 | 3300025935 | Ga0207709_10000063 | Ga0207709_1000006398 | 299 |
| 613 | 3300025935 | Ga0207709_10000545 | Ga0207709_1000054513 | 299 |
| 614 | 3300025935 | Ga0207709_10047897 | Ga0207709_100478972 | 299 |
| 615 | 3300025945 | Ga0207679_10000013 | Ga0207679_10000013254 | 299 |
| 616 | 3300025945 | Ga0207679_10019106 | Ga0207679_100191063 | 299 |
| 617 | 3300025961 | Ga0207712_10010833 | Ga0207712_100108336 | 299 |
| 618 | 3300025981 | Ga0207640_10434927 | Ga0207640_104349271 | 299 |
| 619 | 3300026041 | Ga0207639_10000091 | Ga0207639_1000009124 | 299 |
| 620 | 3300027111 | Ga0209281_1000016 | Ga0209281_1000016466 | 299 |
| 621 | 3300027111 | Ga0209281_1002512 | Ga0209281_10025126 | 299 |
| 622 | 3300027111 | Ga0209281_1006212 | Ga0209281_10062122 | 299 |
| 623 | 3300027907 | Ga0207428_10106391 | Ga0207428_101063912 | 299 |
| 624 | 3300027907 | Ga0207428_10215854 | Ga0207428_102158542 | 299 |
| 625 | 3300027907 | Ga0207428_10226076 | Ga0207428_102260762 | 299 |
| 626 | 3300028379 | Ga0268266_10039955 | Ga0268266_100399553 | 299 |
| 627 | 3300028379 | Ga0268266_10240282 | Ga0268266_102402822 | 299 |
| 628 | 3300028379 | Ga0268266_10338178 | Ga0268266_103381781 | 299 |
| 629 | 3300028786 | Ga0307517_10058899 | Ga0307517_100588991 | 299 |
| 630 | 3300030521 | Ga0307511_10035806 | Ga0307511_100358064 | 299 |
| 631 | 3300030521 | Ga0307511_10110889 | Ga0307511_101108891 | 299 |
| 632 | 3300030731 | Ga0316177_1091565 | Ga0316177_10915655 | 299 |
| 633 | 3300030734 | Ga0316179_1002654 | Ga0316179_10026544 | 299 |
| 634 | 3300030735 | Ga0316178_1047147 | Ga0316178_104714789 | 299 |
| 635 | 3300030742 | Ga0316183_1191323 | Ga0316183_11913232 | 299 |
| 636 | 3300030744 | Ga0316181_1001658 | Ga0316181_10016585 | 299 |
| 637 | 3300031548 | Ga0307408_100014178 | Ga0307408_1000141784 | 299 |
| 638 | 3300031548 | Ga0307408_100030241 | Ga0307408_1000302411 | 299 |
| 639 | 3300031548 | Ga0307408_100316253 | Ga0307408_1003162532 | 299 |
| 640 | 3300031730 | Ga0307516_10307124 | Ga0307516_103071242 | 299 |
| 641 | 3300031731 | Ga0307405_10014255 | Ga0307405_100142554 | 299 |
| 642 | 3300031731 | Ga0307405_10014813 | Ga0307405_100148132 | 299 |
| 643 | 3300031731 | Ga0307405_10103727 | Ga0307405_101037273 | 299 |
| 644 | 3300031852 | Ga0307410_10089350 | Ga0307410_100893502 | 299 |
| 645 | 3300031903 | Ga0307407_10013087 | Ga0307407_100130874 | 299 |
| 646 | 3300031903 | Ga0307407_10081643 | Ga0307407_100816433 | 299 |
| 647 | 3300031911 | Ga0307412_10006130 | Ga0307412_100061304 | 299 |
| 648 | 3300031911 | Ga0307412_10097956 | Ga0307412_100979562 | 299 |
| 649 | 3300032002 | Ga0307416_100181693 | Ga0307416_1001816932 | 299 |
| 650 | 3300032002 | Ga0307416_100198823 | Ga0307416_1001988232 | 299 |
| 651 | 3300032004 | Ga0307414_10005772 | Ga0307414_100057724 | 299 |
| 652 | 3300032004 | Ga0307414_10145876 | Ga0307414_101458762 | 299 |
| 653 | 3300032005 | Ga0307411_10020289 | Ga0307411_100202894 | 299 |
| 654 | 3300032005 | Ga0307411_10078066 | Ga0307411_100780662 | 299 |
| 655 | 3300033180 | Ga0307510_10024600 | Ga0307510_100246005 | 299 |
| 656 | 3300038705 | Ga0237819_00416 | Ga0237819_00416_11232_12131 | 299 |
| 657 | 3300041405 | Ga0439438_003796 | Ga0439438_003796_2282_3181 | 299 |
| 658 | 3300041405 | Ga0439438_004810 | Ga0439438_004810_2429_3328 | 299 |
| 659 | 3300041405 | Ga0439438_006281 | Ga0439438_006281_920_1819 | 299 |
| 660 | 3300041405 | Ga0439438_007493 | Ga0439438_007493_722_1645 | 299 |
| 661 | 3300041405 | Ga0439438_011129 | Ga0439438_011129_839_1738 | 299 |
| 662 | 3300041405 | Ga0439438_011217 | Ga0439438_011217_722_1645 | 299 |
| 663 | 3300041405 | Ga0439438_013381 | Ga0439438_013381_30_929 | 299 |
| 664 | 3300041405 | Ga0439438_016490 | Ga0439438_016490_276_1175 | 299 |
| 665 | 3300041405 | Ga0439438_020501 | Ga0439438_020501_75_974 | 299 |
| 666 | 3300041405 | Ga0439438_027053 | Ga0439438_027053_519_1418 | 299 |
| 667 | 3300041407 | Ga0439447_003950 | Ga0439447_003950_1872_2771 | 299 |
| 668 | 3300041407 | Ga0439447_004777 | Ga0439447_004777_2319_3218 | 299 |
| 669 | 3300041407 | Ga0439447_005109 | Ga0439447_005109_1109_2008 | 299 |
| 670 | 3300041407 | Ga0439447_008113 | Ga0439447_008113_936_1835 | 299 |
| 671 | 3300041407 | Ga0439447_010104 | Ga0439447_010104_211_1110 | 299 |
| 672 | 3300041411 | Ga0439466_0002316 | Ga0439466_0002316_6412_7311 | 299 |
| 673 | 3300041411 | Ga0439466_0006210 | Ga0439466_0006210_2550_3449 | 299 |
| 674 | 3300041411 | Ga0439466_0008448 | Ga0439466_0008448_380_1279 | 299 |
| 675 | 3300041411 | Ga0439466_0009141 | Ga0439466_0009141_1693_2592 | 299 |
| 676 | 3300041411 | Ga0439466_0010840 | Ga0439466_0010840_1104_2003 | 299 |
| 677 | 3300041411 | Ga0439466_0015214 | Ga0439466_0015214_1822_2721 | 299 |
| 678 | 3300041411 | Ga0439466_0018909 | Ga0439466_0018909_53_952 | 299 |
| 679 | 3300041411 | Ga0439466_0022259 | Ga0439466_0022259_1139_2038 | 299 |
| 680 | 3300041411 | Ga0439466_0022816 | Ga0439466_0022816_1279_2178 | 299 |
| 681 | 3300041413 | Ga0439465_0008204 | Ga0439465_0008204_1049_1948 | 299 |
| 682 | 3300042004 | Ga0439445_0026105 | Ga0439445_0026105_459_1358 | 299 |
| 683 | 3300042006 | Ga0439432_000735 | Ga0439432_000735_9606_10505 | 299 |
| 684 | 3300042006 | Ga0439432_003124 | Ga0439432_003124_2555_3454 | 299 |
| 685 | 3300042006 | Ga0439432_007249 | Ga0439432_007249_198_1097 | 299 |
| 686 | 3300042006 | Ga0439432_013741 | Ga0439432_013741_1667_2566 | 299 |
| 687 | 3300042006 | Ga0439432_018391 | Ga0439432_018391_1362_2261 | 299 |
| 688 | 3300042006 | Ga0439432_041724 | Ga0439432_041724_110_1009 | 299 |
| 689 | 3300042010 | Ga0439452_002183 | Ga0439452_002183_2420_3319 | 299 |
| 690 | 3300042010 | Ga0439452_002419 | Ga0439452_002419_2751_3650 | 299 |
| 691 | 3300042010 | Ga0439452_003104 | Ga0439452_003104_2405_3304 | 299 |
| 692 | 3300042010 | Ga0439452_004107 | Ga0439452_004107_1631_2530 | 299 |
| 693 | 3300042010 | Ga0439452_009764 | Ga0439452_009764_1752_2651 | 299 |
| 694 | 3300042010 | Ga0439452_012435 | Ga0439452_012435_506_1405 | 299 |
| 695 | 3300042010 | Ga0439452_014704 | Ga0439452_014704_39_938 | 299 |
| 696 | 3300042013 | Ga0439456_000660 | Ga0439456_000660_5714_6613 | 299 |
| 697 | 3300042013 | Ga0439456_010763 | Ga0439456_010763_786_1685 | 299 |
| 698 | 3300042013 | Ga0439456_034660 | Ga0439456_034660_124_1023 | 299 |
| 699 | 3300042016 | Ga0439463_000477 | Ga0439463_000477_4589_5488 | 299 |
| 700 | 3300042016 | Ga0439463_002267 | Ga0439463_002267_1543_2442 | 299 |
| 701 | 3300042016 | Ga0439463_036010 | Ga0439463_036010_238_1137 | 299 |
| 702 | 3300042115 | Ga0450911_001296 | Ga0450911_001296_2426_3325 | 299 |
| 703 | 3300042115 | Ga0450911_002415 | Ga0450911_002415_1578_2477 | 299 |
| 704 | 3300042115 | Ga0450911_008467 | Ga0450911_008467_24_923 | 299 |
| 705 | 3300042115 | Ga0450911_010067 | Ga0450911_010067_237_1136 | 299 |
| 706 | 3300042121 | Ga0450919_001008 | Ga0450919_001008_301_1200 | 299 |
| 707 | 3300042121 | Ga0450919_001388 | Ga0450919_001388_1369_2268 | 299 |
| 708 | 3300042122 | Ga0450920_000286 | Ga0450920_000286_6002_6901 | 299 |
| 709 | 3300042124 | Ga0450922_000446 | Ga0450922_000446_2635_3534 | 299 |
| 710 | 3300042124 | Ga0450922_005333 | Ga0450922_005333_195_1094 | 299 |
| 711 | 3300042125 | Ga0450923_000811 | Ga0450923_000811_1394_2293 | 299 |
| 712 | 3300042127 | Ga0450890_001272 | Ga0450890_001272_2654_3553 | 299 |
| 713 | 3300042138 | Ga0450903_002152 | Ga0450903_002152_2611_3510 | 299 |
| 714 | 3300042139 | Ga0450904_002906 | Ga0450904_002906_200_1099 | 299 |
| 715 | 3300042142 | Ga0450905_007282 | Ga0450905_007282_41_940 | 299 |
| 716 | 3300042145 | Ga0450906_000355 | Ga0450906_000355_5984_6883 | 299 |
| 717 | 3300042145 | Ga0450906_000517 | Ga0450906_000517_1855_2754 | 299 |
| 718 | 3300042145 | Ga0450906_004065 | Ga0450906_004065_816_1715 | 299 |
| 719 | 3300042146 | Ga0450907_000520 | Ga0450907_000520_4195_5094 | 299 |
| 720 | 3300042146 | Ga0450907_000867 | Ga0450907_000867_2078_2977 | 299 |
| 721 | 3300042146 | Ga0450907_013384 | Ga0450907_013384_393_1292 | 299 |
| 722 | 3300042147 | Ga0450910_000137 | Ga0450910_000137_6085_6984 | 299 |
| 723 | 3300042156 | Ga0439446_0003992 | Ga0439446_0003992_2615_3514 | 299 |
| 724 | 3300042156 | Ga0439446_0007513 | Ga0439446_0007513_1375_2274 | 299 |
| 725 | 3300042184 | Ga0450908_000962 | Ga0450908_000962_2321_3220 | 299 |
| 726 | 3300042184 | Ga0450908_019263 | Ga0450908_019263_44_943 | 299 |
| 727 | 3300042185 | Ga0450909_005573 | Ga0450909_005573_92_991 | 299 |
| 728 | 3300042185 | Ga0450909_005824 | Ga0450909_005824_762_1661 | 299 |
| 729 | 3300042435 | Ga0439434_0001117 | Ga0439434_0001117_4229_5128 | 299 |
| 730 | 3300042461 | Ga0439460_0000568 | Ga0439460_0000568_6729_7628 | 299 |
| 731 | 3300042531 | Ga0450918_001120 | Ga0450918_001120_2393_3292 | 299 |
| 732 | 3300042533 | Ga0450901_000691 | Ga0450901_000691_1323_2222 | 299 |
| 733 | 3300042993 | Ga0439440_0001238 | Ga0439440_0001238_1356_2255 | 299 |
| 734 | 3300042993 | Ga0439440_0006091 | Ga0439440_0006091_356_1255 | 299 |
| 735 | 3300042993 | Ga0439440_0023973 | Ga0439440_0023973_250_1149 | 299 |
| 736 | 3300046452 | Ga0495617_005595 | Ga0495617_005595_982_1881 | 299 |
| 737 | 3300046452 | Ga0495617_007712 | Ga0495617_007712_2337_3236 | 299 |
| 738 | 3300046452 | Ga0495617_010836 | Ga0495617_010836_1130_2032 | 299 |
| 739 | 3300046453 | Ga0495627_002716 | Ga0495627_002716_4630_5532 | 299 |
| 740 | 3300046453 | Ga0495627_005780 | Ga0495627_005780_1511_2410 | 299 |
| 741 | 3300046453 | Ga0495627_007033 | Ga0495627_007033_691_1590 | 299 |
| 742 | 3300046453 | Ga0495627_010384 | Ga0495627_010384_110_1009 | 299 |
| 743 | 3300046453 | Ga0495627_012080 | Ga0495627_012080_953_1852 | 299 |
| 744 | 3300046453 | Ga0495627_025369 | Ga0495627_025369_531_1430 | 299 |
| 745 | 3300046455 | Ga0495603_0014110 | Ga0495603_0014110_1391_2290 | 299 |
| 746 | 3300046455 | Ga0495603_0031614 | Ga0495603_0031614_49_948 | 299 |
| 747 | 3300046455 | Ga0495603_0114008 | Ga0495603_0114008_571_1470 | 299 |
| 748 | 3300046457 | Ga0495590_0001555 | Ga0495590_0001555_4023_4922 | 299 |
| 749 | 3300046457 | Ga0495590_0080202 | Ga0495590_0080202_86_985 | 299 |
| 750 | 3300046458 | Ga0495591_006081 | Ga0495591_006081_2135_3034 | 299 |
| 751 | 3300046458 | Ga0495591_006163 | Ga0495591_006163_2956_3855 | 299 |
| 752 | 3300046458 | Ga0495591_008415 | Ga0495591_008415_471_1370 | 299 |
| 753 | 3300046458 | Ga0495591_009117 | Ga0495591_009117_537_1436 | 299 |
| 754 | 3300046458 | Ga0495591_012038 | Ga0495591_012038_295_1194 | 299 |
| 755 | 3300046458 | Ga0495591_014389 | Ga0495591_014389_832_1731 | 299 |
| 756 | 3300046458 | Ga0495591_033354 | Ga0495591_033354_536_1435 | 299 |
| 757 | 3300046458 | Ga0495591_034441 | Ga0495591_034441_233_1132 | 299 |
| 758 | 3300046459 | Ga0495629_0036122 | Ga0495629_0036122_1219_2118 | 299 |
| 759 | 3300046460 | Ga0495638_0022813 | Ga0495638_0022813_1031_1930 | 299 |
| 760 | 3300046460 | Ga0495638_0023151 | Ga0495638_0023151_948_1847 | 299 |
| 761 | 3300046460 | Ga0495638_0024593 | Ga0495638_0024593_2962_3861 | 299 |
| 762 | 3300046460 | Ga0495638_0026476 | Ga0495638_0026476_1495_2394 | 299 |
| 763 | 3300046460 | Ga0495638_0052159 | Ga0495638_0052159_1157_2056 | 299 |
| 764 | 3300046460 | Ga0495638_0060791 | Ga0495638_0060791_1327_2226 | 299 |
| 765 | 3300046460 | Ga0495638_0090973 | Ga0495638_0090973_434_1333 | 299 |
| 766 | 3300046460 | Ga0495638_0110025 | Ga0495638_0110025_364_1263 | 299 |
| 767 | 3300046463 | Ga0495653_0078624 | Ga0495653_0078624_672_1571 | 299 |
| 768 | 3300046463 | Ga0495653_0151236 | Ga0495653_0151236_445_1344 | 299 |
| 769 | 3300046471 | Ga0495650_0018974 | Ga0495650_0018974_1071_1970 | 299 |
| 770 | 3300046471 | Ga0495650_0034626 | Ga0495650_0034626_445_1344 | 299 |
| 771 | 3300046471 | Ga0495650_0040697 | Ga0495650_0040697_750_1652 | 299 |
| 772 | 3300046473 | Ga0495582_0012502 | Ga0495582_0012502_1626_2525 | 299 |
| 773 | 3300046474 | Ga0495605_0010405 | Ga0495605_0010405_2704_3603 | 299 |
| 774 | 3300046474 | Ga0495605_0010597 | Ga0495605_0010597_1925_2824 | 299 |
| 775 | 3300046474 | Ga0495605_0019206 | Ga0495605_0019206_2544_3443 | 299 |
| 776 | 3300046474 | Ga0495605_0019237 | Ga0495605_0019237_2356_3255 | 299 |
| 777 | 3300046474 | Ga0495605_0019680 | Ga0495605_0019680_2203_3102 | 299 |
| 778 | 3300046474 | Ga0495605_0104359 | Ga0495605_0104359_327_1226 | 299 |
| 779 | 3300046475 | Ga0495639_0004422 | Ga0495639_0004422_2542_3441 | 299 |
| 780 | 3300046475 | Ga0495639_0011705 | Ga0495639_0011705_1773_2672 | 299 |
| 781 | 3300046491 | Ga0495584_0006922 | Ga0495584_0006922_2392_3291 | 299 |
| 782 | 3300046491 | Ga0495584_0006997 | Ga0495584_0006997_2423_3322 | 299 |
| 783 | 3300046491 | Ga0495584_0007934 | Ga0495584_0007934_2239_3138 | 299 |
| 784 | 3300046491 | Ga0495584_0008019 | Ga0495584_0008019_2387_3286 | 299 |
| 785 | 3300046491 | Ga0495584_0008025 | Ga0495584_0008025_2358_3257 | 299 |
| 786 | 3300046491 | Ga0495584_0010834 | Ga0495584_0010834_1407_2306 | 299 |
| 787 | 3300046491 | Ga0495584_0017646 | Ga0495584_0017646_1959_2858 | 299 |
| 788 | 3300046491 | Ga0495584_0050636 | Ga0495584_0050636_787_1686 | 299 |
| 789 | 3300046491 | Ga0495584_0076986 | Ga0495584_0076986_710_1609 | 299 |
| 790 | 3300046492 | Ga0495585_0009311 | Ga0495585_0009311_2598_3497 | 299 |
| 791 | 3300046492 | Ga0495585_0014262 | Ga0495585_0014262_2369_3268 | 299 |
| 792 | 3300046492 | Ga0495585_0031938 | Ga0495585_0031938_2024_2923 | 299 |
| 793 | 3300046492 | Ga0495585_0089168 | Ga0495585_0089168_142_1041 | 299 |
| 794 | 3300046492 | Ga0495585_0092639 | Ga0495585_0092639_539_1438 | 299 |
| 795 | 3300046492 | Ga0495585_0099657 | Ga0495585_0099657_622_1521 | 299 |
| 796 | 3300046492 | Ga0495585_0112100 | Ga0495585_0112100_403_1302 | 299 |
| 797 | 3300046492 | Ga0495585_0202973 | Ga0495585_0202973_13_912 | 299 |
| 798 | 3300046499 | Ga0495594_0022996 | Ga0495594_0022996_1737_2636 | 299 |
| 799 | 3300046501 | Ga0495607_0017405 | Ga0495607_0017405_2138_3040 | 299 |
| 800 | 3300046501 | Ga0495607_0023033 | Ga0495607_0023033_693_1592 | 299 |
| 801 | 3300046501 | Ga0495607_0043277 | Ga0495607_0043277_133_1032 | 299 |
| 802 | 3300046501 | Ga0495607_0063235 | Ga0495607_0063235_1129_2028 | 299 |
| 803 | 3300046501 | Ga0495607_0081937 | Ga0495607_0081937_542_1468 | 299 |
| 804 | 3300046501 | Ga0495607_0082640 | Ga0495607_0082640_335_1234 | 299 |
| 805 | 3300046501 | Ga0495607_0113879 | Ga0495607_0113879_465_1364 | 299 |
| 806 | 3300046501 | Ga0495607_0114434 | Ga0495607_0114434_486_1385 | 299 |
| 807 | 3300046501 | Ga0495607_0126075 | Ga0495607_0126075_166_1065 | 299 |
| 808 | 3300046506 | Ga0495583_0007538 | Ga0495583_0007538_3430_4329 | 299 |
| 809 | 3300046506 | Ga0495583_0009278 | Ga0495583_0009278_2861_3760 | 299 |
| 810 | 3300046506 | Ga0495583_0027693 | Ga0495583_0027693_1557_2456 | 299 |
| 811 | 3300046506 | Ga0495583_0037330 | Ga0495583_0037330_708_1607 | 299 |
| 812 | 3300046506 | Ga0495583_0050437 | Ga0495583_0050437_75_974 | 299 |
| 813 | 3300046507 | Ga0495606_0009824 | Ga0495606_0009824_2142_3041 | 299 |
| 814 | 3300046507 | Ga0495606_0015236 | Ga0495606_0015236_4036_4935 | 299 |
| 815 | 3300046507 | Ga0495606_0022442 | Ga0495606_0022442_2334_3233 | 299 |
| 816 | 3300046507 | Ga0495606_0031970 | Ga0495606_0031970_1198_2097 | 299 |
| 817 | 3300046507 | Ga0495606_0034591 | Ga0495606_0034591_492_1391 | 299 |
| 818 | 3300046507 | Ga0495606_0080532 | Ga0495606_0080532_976_1875 | 299 |
| 819 | 3300046507 | Ga0495606_0101185 | Ga0495606_0101185_745_1644 | 299 |
| 820 | 3300046507 | Ga0495606_0141635 | Ga0495606_0141635_450_1349 | 299 |
| 821 | 3300046507 | Ga0495606_0176015 | Ga0495606_0176015_242_1141 | 299 |
| 822 | 3300046507 | Ga0495606_0190457 | Ga0495606_0190457_50_949 | 299 |
| 823 | 3300046512 | Ga0495610_0011258 | Ga0495610_0011258_2188_3087 | 299 |
| 824 | 3300046512 | Ga0495610_0019562 | Ga0495610_0019562_276_1175 | 299 |
| 825 | 3300046512 | Ga0495610_0019797 | Ga0495610_0019797_1910_2809 | 299 |
| 826 | 3300046512 | Ga0495610_0020042 | Ga0495610_0020042_64_963 | 299 |
| 827 | 3300046512 | Ga0495610_0021799 | Ga0495610_0021799_1934_2833 | 299 |
| 828 | 3300046512 | Ga0495610_0023220 | Ga0495610_0023220_245_1144 | 299 |
| 829 | 3300046512 | Ga0495610_0031649 | Ga0495610_0031649_540_1439 | 299 |
| 830 | 3300046512 | Ga0495610_0038654 | Ga0495610_0038654_827_1726 | 299 |
| 831 | 3300046512 | Ga0495610_0051483 | Ga0495610_0051483_344_1243 | 299 |
| 832 | 3300046512 | Ga0495610_0055379 | Ga0495610_0055379_553_1452 | 299 |
| 833 | 3300046512 | Ga0495610_0088271 | Ga0495610_0088271_250_1149 | 299 |
| 834 | 3300046513 | Ga0495616_0005952 | Ga0495616_0005952_2608_3507 | 299 |
| 835 | 3300046513 | Ga0495616_0030838 | Ga0495616_0030838_752_1651 | 299 |
| 836 | 3300046513 | Ga0495616_0042648 | Ga0495616_0042648_562_1461 | 299 |
| 837 | 3300046513 | Ga0495616_0106873 | Ga0495616_0106873_31_930 | 299 |
| 838 | 3300046513 | Ga0495616_0155799 | Ga0495616_0155799_64_963 | 299 |
| 839 | 3300046515 | Ga0495620_0006866 | Ga0495620_0006866_4780_5679 | 299 |
| 840 | 3300046515 | Ga0495620_0017505 | Ga0495620_0017505_526_1425 | 299 |
| 841 | 3300046515 | Ga0495620_0019311 | Ga0495620_0019311_1201_2100 | 299 |
| 842 | 3300046515 | Ga0495620_0024409 | Ga0495620_0024409_506_1405 | 299 |
| 843 | 3300046515 | Ga0495620_0041188 | Ga0495620_0041188_526_1425 | 299 |
| 844 | 3300046515 | Ga0495620_0048251 | Ga0495620_0048251_715_1614 | 299 |
| 845 | 3300046515 | Ga0495620_0070235 | Ga0495620_0070235_46_945 | 299 |
| 846 | 3300046515 | Ga0495620_0091851 | Ga0495620_0091851_52_951 | 299 |
| 847 | 3300046517 | Ga0495630_0023231 | Ga0495630_0023231_1087_1986 | 299 |
| 848 | 3300046517 | Ga0495630_0136413 | Ga0495630_0136413_67_966 | 299 |
| 849 | 3300046518 | Ga0495631_0006682 | Ga0495631_0006682_2649_3548 | 299 |
| 850 | 3300046518 | Ga0495631_0010667 | Ga0495631_0010667_1309_2211 | 299 |
| 851 | 3300046518 | Ga0495631_0087310 | Ga0495631_0087310_354_1253 | 299 |
| 852 | 3300046519 | Ga0495632_0006308 | Ga0495632_0006308_2482_3381 | 299 |
| 853 | 3300046519 | Ga0495632_0007314 | Ga0495632_0007314_2120_3019 | 299 |
| 854 | 3300046519 | Ga0495632_0009750 | Ga0495632_0009750_2388_3287 | 299 |
| 855 | 3300046519 | Ga0495632_0010862 | Ga0495632_0010862_554_1456 | 299 |
| 856 | 3300046519 | Ga0495632_0011087 | Ga0495632_0011087_2872_3771 | 299 |
| 857 | 3300046519 | Ga0495632_0013427 | Ga0495632_0013427_984_1883 | 299 |
| 858 | 3300046519 | Ga0495632_0022427 | Ga0495632_0022427_49_972 | 299 |
| 859 | 3300046519 | Ga0495632_0052886 | Ga0495632_0052886_97_996 | 299 |
| 860 | 3300046519 | Ga0495632_0059832 | Ga0495632_0059832_381_1280 | 299 |
| 861 | 3300046519 | Ga0495632_0091159 | Ga0495632_0091159_499_1398 | 299 |
| 862 | 3300046519 | Ga0495632_0132033 | Ga0495632_0132033_139_1038 | 299 |
| 863 | 3300046520 | Ga0495637_0004958 | Ga0495637_0004958_3914_4813 | 299 |
| 864 | 3300046520 | Ga0495637_0007048 | Ga0495637_0007048_2578_3477 | 299 |
| 865 | 3300046520 | Ga0495637_0011893 | Ga0495637_0011893_2499_3398 | 299 |
| 866 | 3300046520 | Ga0495637_0014187 | Ga0495637_0014187_2264_3163 | 299 |
| 867 | 3300046520 | Ga0495637_0022402 | Ga0495637_0022402_851_1750 | 299 |
| 868 | 3300046520 | Ga0495637_0034274 | Ga0495637_0034274_987_1886 | 299 |
| 869 | 3300046520 | Ga0495637_0035140 | Ga0495637_0035140_396_1295 | 299 |
| 870 | 3300046520 | Ga0495637_0058271 | Ga0495637_0058271_62_961 | 299 |
| 871 | 3300046522 | Ga0495643_0011962 | Ga0495643_0011962_3923_4822 | 299 |
| 872 | 3300046522 | Ga0495643_0029901 | Ga0495643_0029901_713_1612 | 299 |
| 873 | 3300046522 | Ga0495643_0037993 | Ga0495643_0037993_387_1286 | 299 |
| 874 | 3300046523 | Ga0495644_0008526 | Ga0495644_0008526_2077_2976 | 299 |
| 875 | 3300046523 | Ga0495644_0040264 | Ga0495644_0040264_804_1703 | 299 |
| 876 | 3300046523 | Ga0495644_0061702 | Ga0495644_0061702_118_1017 | 299 |
| 877 | 3300046523 | Ga0495644_0089361 | Ga0495644_0089361_168_1067 | 299 |
| 878 | 3300046524 | Ga0495648_0007380 | Ga0495648_0007380_4901_5800 | 299 |
| 879 | 3300046524 | Ga0495648_0008468 | Ga0495648_0008468_4899_5798 | 299 |
| 880 | 3300046524 | Ga0495648_0025115 | Ga0495648_0025115_1372_2271 | 299 |
| 881 | 3300046524 | Ga0495648_0026142 | Ga0495648_0026142_2290_3189 | 299 |
| 882 | 3300046524 | Ga0495648_0046488 | Ga0495648_0046488_777_1676 | 299 |
| 883 | 3300046524 | Ga0495648_0061516 | Ga0495648_0061516_1255_2154 | 299 |
| 884 | 3300046524 | Ga0495648_0118584 | Ga0495648_0118584_41_940 | 299 |
| 885 | 3300046526 | Ga0495666_0015629 | Ga0495666_0015629_1695_2594 | 299 |
| 886 | 3300046526 | Ga0495666_0044785 | Ga0495666_0044785_481_1380 | 299 |
| 887 | 3300046526 | Ga0495666_0048946 | Ga0495666_0048946_935_1834 | 299 |
| 888 | 3300046528 | Ga0495642_0003701 | Ga0495642_0003701_2705_3604 | 299 |
| 889 | 3300046528 | Ga0495642_0003845 | Ga0495642_0003845_2583_3482 | 299 |
| 890 | 3300046528 | Ga0495642_0011725 | Ga0495642_0011725_2423_3322 | 299 |
| 891 | 3300046530 | Ga0495654_0005016 | Ga0495654_0005016_1019_1918 | 299 |
| 892 | 3300046530 | Ga0495654_0007275 | Ga0495654_0007275_3166_4065 | 299 |
| 893 | 3300046530 | Ga0495654_0008103 | Ga0495654_0008103_2414_3313 | 299 |
| 894 | 3300046530 | Ga0495654_0009176 | Ga0495654_0009176_2400_3299 | 299 |
| 895 | 3300046530 | Ga0495654_0009378 | Ga0495654_0009378_2790_3692 | 299 |
| 896 | 3300046530 | Ga0495654_0019319 | Ga0495654_0019319_2581_3480 | 299 |
| 897 | 3300046530 | Ga0495654_0019550 | Ga0495654_0019550_885_1784 | 299 |
| 898 | 3300046530 | Ga0495654_0021353 | Ga0495654_0021353_73_972 | 299 |
| 899 | 3300046530 | Ga0495654_0021395 | Ga0495654_0021395_356_1255 | 299 |
| 900 | 3300046530 | Ga0495654_0022453 | Ga0495654_0022453_1042_1944 | 299 |
| 901 | 3300046530 | Ga0495654_0034277 | Ga0495654_0034277_1530_2429 | 299 |
| 902 | 3300046530 | Ga0495654_0080817 | Ga0495654_0080817_487_1386 | 299 |
| 903 | 3300046530 | Ga0495654_0122997 | Ga0495654_0122997_169_1068 | 299 |
| 904 | 3300046535 | Ga0495586_0019543 | Ga0495586_0019543_1583_2482 | 299 |
| 905 | 3300046536 | Ga0495587_0021921 | Ga0495587_0021921_2334_3233 | 299 |
| 906 | 3300046536 | Ga0495587_0023256 | Ga0495587_0023256_2416_3315 | 299 |
| 907 | 3300046538 | Ga0495609_0008828 | Ga0495609_0008828_2407_3306 | 299 |
| 908 | 3300046538 | Ga0495609_0037995 | Ga0495609_0037995_845_1744 | 299 |
| 909 | 3300046538 | Ga0495609_0092532 | Ga0495609_0092532_261_1160 | 299 |
| 910 | 3300046538 | Ga0495609_0100808 | Ga0495609_0100808_178_1077 | 299 |
| 911 | 3300046542 | Ga0495597_0011773 | Ga0495597_0011773_1241_2140 | 299 |
| 912 | 3300046542 | Ga0495597_0023713 | Ga0495597_0023713_572_1471 | 299 |
| 913 | 3300046542 | Ga0495597_0040078 | Ga0495597_0040078_542_1441 | 299 |
| 914 | 3300046542 | Ga0495597_0042867 | Ga0495597_0042867_895_1794 | 299 |
| 915 | 3300046557 | Ga0495622_0005353 | Ga0495622_0005353_853_1752 | 299 |
| 916 | 3300046557 | Ga0495622_0006837 | Ga0495622_0006837_2297_3196 | 299 |
| 917 | 3300046557 | Ga0495622_0010735 | Ga0495622_0010735_2320_3219 | 299 |
| 918 | 3300046557 | Ga0495622_0014230 | Ga0495622_0014230_1495_2394 | 299 |
| 919 | 3300046557 | Ga0495622_0019253 | Ga0495622_0019253_1767_2666 | 299 |
| 920 | 3300046558 | Ga0495633_0004409 | Ga0495633_0004409_4156_5055 | 299 |
| 921 | 3300046558 | Ga0495633_0029754 | Ga0495633_0029754_1269_2168 | 299 |
| 922 | 3300046616 | Ga0495668_0125017 | Ga0495668_0125017_478_1377 | 299 |
| 923 | 3300046642 | Ga0495634_0038849 | Ga0495634_0038849_1411_2310 | 299 |
| 924 | 3300046648 | Ga0495611_0004728 | Ga0495611_0004728_2782_3681 | 299 |
| 925 | 3300046648 | Ga0495611_0171381 | Ga0495611_0171381_57_956 | 299 |
| 926 | 3300046660 | Ga0495625_0013708 | Ga0495625_0013708_5018_5917 | 299 |
| 927 | 3300046660 | Ga0495625_0016331 | Ga0495625_0016331_2120_3019 | 299 |
| 928 | 3300046660 | Ga0495625_0053577 | Ga0495625_0053577_103_1002 | 299 |
| 929 | 3300046660 | Ga0495625_0081536 | Ga0495625_0081536_503_1402 | 299 |
| 930 | 3300046660 | Ga0495625_0184089 | Ga0495625_0184089_219_1118 | 299 |
| 931 | 3300046660 | Ga0495625_0274348 | Ga0495625_0274348_80_979 | 299 |
| 932 | 3300046663 | Ga0495635_0014354 | Ga0495635_0014354_2262_3161 | 299 |
| 933 | 3300046663 | Ga0495635_0019486 | Ga0495635_0019486_2408_3307 | 299 |
| 934 | 3300046664 | Ga0495659_0001791 | Ga0495659_0001791_2330_3229 | 299 |
| 935 | 3300046664 | Ga0495659_0016823 | Ga0495659_0016823_83_982 | 299 |
| 936 | 3300046664 | Ga0495659_0027937 | Ga0495659_0027937_944_1843 | 299 |
| 937 | 3300046665 | Ga0495661_0006107 | Ga0495661_0006107_5015_5914 | 299 |
| 938 | 3300046665 | Ga0495661_0016928 | Ga0495661_0016928_1360_2259 | 299 |
| 939 | 3300046665 | Ga0495661_0035759 | Ga0495661_0035759_824_1723 | 299 |
| 940 | 3300046665 | Ga0495661_0063253 | Ga0495661_0063253_100_999 | 299 |
| 941 | 3300046665 | Ga0495661_0068699 | Ga0495661_0068699_408_1307 | 299 |
| 942 | 3300046665 | Ga0495661_0071228 | Ga0495661_0071228_53_952 | 299 |
| 943 | 3300046665 | Ga0495661_0136852 | Ga0495661_0136852_356_1255 | 299 |
| 944 | 3300046674 | Ga0495588_0026696 | Ga0495588_0026696_830_1729 | 299 |
| 945 | 3300046674 | Ga0495588_0097039 | Ga0495588_0097039_602_1501 | 299 |
| 946 | 3300046675 | Ga0495657_0044627 | Ga0495657_0044627_549_1448 | 299 |
| 947 | 3300046679 | Ga0495623_0010236 | Ga0495623_0010236_2551_3450 | 299 |
| 948 | 3300046679 | Ga0495623_0078007 | Ga0495623_0078007_1090_1989 | 299 |
| 949 | 3300046680 | Ga0495646_0031451 | Ga0495646_0031451_2342_3241 | 299 |
| 950 | 3300046680 | Ga0495646_0126251 | Ga0495646_0126251_333_1232 | 299 |
| 951 | 3300046684 | Ga0495669_0002201 | Ga0495669_0002201_2747_3646 | 299 |
| 952 | 3300046689 | Ga0495613_0093582 | Ga0495613_0093582_129_1028 | 299 |
| 953 | 3300046691 | Ga0495670_0003539 | Ga0495670_0003539_3966_4865 | 299 |
| 954 | 3300046691 | Ga0495670_0004439 | Ga0495670_0004439_2061_2960 | 299 |
| 955 | 3300046691 | Ga0495670_0017507 | Ga0495670_0017507_250_1149 | 299 |
| 956 | 3300046691 | Ga0495670_0035427 | Ga0495670_0035427_781_1680 | 299 |
| 957 | 3300046691 | Ga0495670_0035582 | Ga0495670_0035582_94_993 | 299 |
| 958 | 3300046692 | Ga0495671_0007515 | Ga0495671_0007515_1091_1990 | 299 |
| 959 | 3300046692 | Ga0495671_0015135 | Ga0495671_0015135_922_1821 | 299 |
| 960 | 3300046692 | Ga0495671_0016779 | Ga0495671_0016779_2380_3279 | 299 |
| 961 | 3300046692 | Ga0495671_0044041 | Ga0495671_0044041_561_1460 | 299 |
| 962 | 3300046692 | Ga0495671_0045845 | Ga0495671_0045845_121_1047 | 299 |
| 963 | 3300046692 | Ga0495671_0070052 | Ga0495671_0070052_610_1509 | 299 |
| 964 | 3300046694 | Ga0495649_0009532 | Ga0495649_0009532_2319_3218 | 299 |
| 965 | 3300046694 | Ga0495649_0010872 | Ga0495649_0010872_440_1339 | 299 |
| 966 | 3300046694 | Ga0495649_0021128 | Ga0495649_0021128_152_1051 | 299 |
| 967 | 3300046694 | Ga0495649_0022431 | Ga0495649_0022431_856_1755 | 299 |
| 968 | 3300046694 | Ga0495649_0022787 | Ga0495649_0022787_534_1433 | 299 |
| 969 | 3300046694 | Ga0495649_0044662 | Ga0495649_0044662_1021_1920 | 299 |
| 970 | 3300046694 | Ga0495649_0049537 | Ga0495649_0049537_1007_1906 | 299 |
| 971 | 3300046694 | Ga0495649_0050302 | Ga0495649_0050302_1151_2050 | 299 |
| 972 | 3300046694 | Ga0495649_0064685 | Ga0495649_0064685_539_1438 | 299 |
| 973 | 3300046694 | Ga0495649_0093662 | Ga0495649_0093662_489_1388 | 299 |
| 974 | 3300046694 | Ga0495649_0102563 | Ga0495649_0102563_493_1392 | 299 |
| 975 | 3300046694 | Ga0495649_0164274 | Ga0495649_0164274_178_1077 | 299 |
| 976 | 3300046794 | Ga0495589_0004591 | Ga0495589_0004591_4063_4962 | 299 |
| 977 | 3300046794 | Ga0495589_0015753 | Ga0495589_0015753_1311_2210 | 299 |
| 978 | 3300046794 | Ga0495589_0017724 | Ga0495589_0017724_1362_2261 | 299 |
| 979 | 3300046794 | Ga0495589_0019172 | Ga0495589_0019172_529_1428 | 299 |
| 980 | 3300046794 | Ga0495589_0021058 | Ga0495589_0021058_1931_2830 | 299 |
| 981 | 3300046794 | Ga0495589_0023614 | Ga0495589_0023614_1782_2681 | 299 |
| 982 | 3300046794 | Ga0495589_0024014 | Ga0495589_0024014_74_973 | 299 |
| 983 | 3300046794 | Ga0495589_0054055 | Ga0495589_0054055_739_1638 | 299 |
| 984 | 3300046794 | Ga0495589_0087850 | Ga0495589_0087850_540_1439 | 299 |
| 985 | 3300046810 | Ga0495660_0021050 | Ga0495660_0021050_2133_3032 | 299 |
| 986 | 3300046810 | Ga0495660_0024147 | Ga0495660_0024147_1426_2328 | 299 |
| 987 | 3300046810 | Ga0495660_0059586 | Ga0495660_0059586_631_1530 | 299 |
| 988 | 3300046810 | Ga0495660_0072557 | Ga0495660_0072557_704_1603 | 299 |
| 989 | 3300046810 | Ga0495660_0079391 | Ga0495660_0079391_486_1385 | 299 |
| 990 | 3300046810 | Ga0495660_0101093 | Ga0495660_0101093_162_1061 | 299 |
| 991 | 3300046810 | Ga0495660_0107168 | Ga0495660_0107168_446_1345 | 299 |
| 992 | 3300046810 | Ga0495660_0108366 | Ga0495660_0108366_76_975 | 299 |
| 993 | 3300046810 | Ga0495660_0171786 | Ga0495660_0171786_93_992 | 299 |
| 994 | 3300047315 | Ga0495581_0037857 | Ga0495581_0037857_1714_2613 | 299 |
| 995 | 3300047317 | Ga0495604_0023499 | Ga0495604_0023499_2557_3456 | 299 |
| 996 | 3300047317 | Ga0495604_0024919 | Ga0495604_0024919_1507_2406 | 299 |
| 997 | 3300047317 | Ga0495604_0047322 | Ga0495604_0047322_743_1642 | 299 |
| 998 | 3300047318 | Ga0495636_0139114 | Ga0495636_0139114_81_980 | 299 |
| 999 | 3300047319 | Ga0495674_0368676 | Ga0495674_0368676_105_1004 | 299 |
| 1000 | 3300047320 | Ga0495672_0009503 | Ga0495672_0009503_4036_4935 | 299 |
| 1001 | 3300047320 | Ga0495672_0011796 | Ga0495672_0011796_2649_3551 | 299 |
| 1002 | 3300047320 | Ga0495672_0013936 | Ga0495672_0013936_534_1433 | 299 |
| 1003 | 3300047320 | Ga0495672_0020472 | Ga0495672_0020472_2584_3483 | 299 |
| 1004 | 3300047320 | Ga0495672_0024934 | Ga0495672_0024934_859_1758 | 299 |
| 1005 | 3300047320 | Ga0495672_0031871 | Ga0495672_0031871_816_1715 | 299 |
| 1006 | 3300047320 | Ga0495672_0039277 | Ga0495672_0039277_602_1501 | 299 |
| 1007 | 3300047320 | Ga0495672_0041460 | Ga0495672_0041460_1249_2148 | 299 |
| 1008 | 3300047320 | Ga0495672_0049871 | Ga0495672_0049871_99_998 | 299 |
| 1009 | 3300047320 | Ga0495672_0061973 | Ga0495672_0061973_196_1095 | 299 |
| 1010 | 3300047320 | Ga0495672_0062986 | Ga0495672_0062986_1021_1920 | 299 |
| 1011 | 3300047320 | Ga0495672_0079955 | Ga0495672_0079955_416_1315 | 299 |
| 1012 | 3300047321 | Ga0495676_0044165 | Ga0495676_0044165_2383_3282 | 299 |
| 1013 | 3300047322 | Ga0495680_0022187 | Ga0495680_0022187_1966_2865 | 299 |
| 1014 | 3300047322 | Ga0495680_0022986 | Ga0495680_0022986_2676_3575 | 299 |
| 1015 | 3300047322 | Ga0495680_0150918 | Ga0495680_0150918_637_1536 | 299 |
| 1016 | 3300047322 | Ga0495680_0198654 | Ga0495680_0198654_136_1035 | 299 |
| 1017 | 3300047323 | Ga0495683_0004276 | Ga0495683_0004276_2358_3257 | 299 |
| 1018 | 3300047323 | Ga0495683_0007387 | Ga0495683_0007387_2407_3306 | 299 |
| 1019 | 3300047323 | Ga0495683_0008977 | Ga0495683_0008977_2138_3037 | 299 |
| 1020 | 3300047323 | Ga0495683_0052923 | Ga0495683_0052923_325_1224 | 299 |
| 1021 | 3300047323 | Ga0495683_0095991 | Ga0495683_0095991_427_1326 | 299 |
| 1022 | 3300047443 | Ga0495687_009435 | Ga0495687_009435_2230_3129 | 299 |
| 1023 | 3300047443 | Ga0495687_013719 | Ga0495687_013719_571_1470 | 299 |
| 1024 | 3300047443 | Ga0495687_027904 | Ga0495687_027904_671_1570 | 299 |
| 1025 | 3300047444 | Ga0495675_0108420 | Ga0495675_0108420_800_1699 | 299 |
| 1026 | 3300047445 | Ga0495677_0016584 | Ga0495677_0016584_59_958 | 299 |
| 1027 | 3300047446 | Ga0495679_012600 | Ga0495679_012600_826_1725 | 299 |
| 1028 | 3300047446 | Ga0495679_021760 | Ga0495679_021760_369_1268 | 299 |
| 1029 | 3300047446 | Ga0495679_027810 | Ga0495679_027810_138_1037 | 299 |
| 1030 | 3300047446 | Ga0495679_036770 | Ga0495679_036770_142_1041 | 299 |
| 1031 | 3300047446 | Ga0495679_043255 | Ga0495679_043255_53_952 | 299 |
| 1032 | 3300047446 | Ga0495679_044623 | Ga0495679_044623_23_922 | 299 |
| 1033 | 3300047469 | Ga0495673_0014003 | Ga0495673_0014003_2373_3272 | 299 |
| 1034 | 3300047469 | Ga0495673_0018172 | Ga0495673_0018172_592_1491 | 299 |
| 1035 | 3300047469 | Ga0495673_0019618 | Ga0495673_0019618_78_977 | 299 |
| 1036 | 3300047469 | Ga0495673_0023534 | Ga0495673_0023534_1212_2111 | 299 |
| 1037 | 3300047469 | Ga0495673_0028726 | Ga0495673_0028726_1147_2046 | 299 |
| 1038 | 3300047469 | Ga0495673_0046606 | Ga0495673_0046606_485_1384 | 299 |
| 1039 | 3300047469 | Ga0495673_0065244 | Ga0495673_0065244_61_960 | 299 |
| 1040 | 3300047469 | Ga0495673_0104504 | Ga0495673_0104504_227_1126 | 299 |
| 1041 | 3300047470 | Ga0495681_0009856 | Ga0495681_0009856_2431_3330 | 299 |
| 1042 | 3300047470 | Ga0495681_0018997 | Ga0495681_0018997_1610_2509 | 299 |
| 1043 | 3300047470 | Ga0495681_0019272 | Ga0495681_0019272_417_1316 | 299 |
| 1044 | 3300047470 | Ga0495681_0020409 | Ga0495681_0020409_2152_3051 | 299 |
| 1045 | 3300047470 | Ga0495681_0021063 | Ga0495681_0021063_1321_2220 | 299 |
| 1046 | 3300047470 | Ga0495681_0021784 | Ga0495681_0021784_1482_2381 | 299 |
| 1047 | 3300047470 | Ga0495681_0023153 | Ga0495681_0023153_1178_2077 | 299 |
| 1048 | 3300047470 | Ga0495681_0036879 | Ga0495681_0036879_1414_2313 | 299 |
| 1049 | 3300047470 | Ga0495681_0070110 | Ga0495681_0070110_245_1144 | 299 |
| 1050 | 3300047470 | Ga0495681_0123485 | Ga0495681_0123485_124_1023 | 299 |
| 1051 | 3300047471 | Ga0495684_0038420 | Ga0495684_0038420_164_1063 | 299 |
| 1052 | 3300047472 | Ga0495686_0012681 | Ga0495686_0012681_2618_3517 | 299 |
| 1053 | 3300047472 | Ga0495686_0024290 | Ga0495686_0024290_2149_3048 | 299 |
| 1054 | 3300047472 | Ga0495686_0026888 | Ga0495686_0026888_2400_3299 | 299 |
| 1055 | 3300047472 | Ga0495686_0081535 | Ga0495686_0081535_951_1850 | 299 |
| 1056 | 3300047673 | Ga0495593_0013908 | Ga0495593_0013908_1143_2042 | 299 |
| 1057 | 3300047673 | Ga0495593_0034872 | Ga0495593_0034872_304_1203 | 299 |
| 1058 | 3300047673 | Ga0495593_0049834 | Ga0495593_0049834_126_1025 | 299 |
| 1059 | 3300048091 | Ga0495626_0005414 | Ga0495626_0005414_4190_5089 | 299 |
| 1060 | 3300048091 | Ga0495626_0016287 | Ga0495626_0016287_258_1157 | 299 |
| 1061 | 3300048091 | Ga0495626_0026943 | Ga0495626_0026943_1821_2720 | 299 |
| 1062 | 3300048091 | Ga0495626_0028535 | Ga0495626_0028535_565_1464 | 299 |
| 1063 | 3300048905 | Ga0496102_0020156 | Ga0496102_0020156_2582_3481 | 299 |
| 1064 | 3300048906 | Ga0496103_0014360 | Ga0496103_0014360_2400_3299 | 299 |
| 1065 | 3300048906 | Ga0496103_0202550 | Ga0496103_0202550_101_1000 | 299 |
| 1066 | 3300048908 | Ga0496105_0108314 | Ga0496105_0108314_990_1889 | 299 |
| 1067 | 3300048909 | Ga0496106_0089174 | Ga0496106_0089174_698_1597 | 299 |
| 1068 | 3300048913 | Ga0496110_0023141 | Ga0496110_0023141_516_1415 | 299 |
| 1069 | 3300048914 | Ga0496111_0111697 | Ga0496111_0111697_135_1034 | 299 |
| 1070 | 3300048919 | Ga0496116_0001725 | Ga0496116_0001725_5767_6666 | 299 |
| 1071 | 3300048919 | Ga0496116_0011675 | Ga0496116_0011675_2319_3218 | 299 |
| 1072 | 3300048919 | Ga0496116_0018429 | Ga0496116_0018429_2084_2983 | 299 |
| 1073 | 3300048919 | Ga0496116_0025706 | Ga0496116_0025706_887_1786 | 299 |
| 1074 | 3300048919 | Ga0496116_0028412 | Ga0496116_0028412_2172_3071 | 299 |
| 1075 | 3300048919 | Ga0496116_0061418 | Ga0496116_0061418_142_1041 | 299 |
| 1076 | 3300048919 | Ga0496116_0171567 | Ga0496116_0171567_32_931 | 299 |
| 1077 | 3300048920 | Ga0496117_0006500 | Ga0496117_0006500_5729_6628 | 299 |
| 1078 | 3300048920 | Ga0496117_0017029 | Ga0496117_0017029_2609_3508 | 299 |
| 1079 | 3300048920 | Ga0496117_0018515 | Ga0496117_0018515_2272_3171 | 299 |
| 1080 | 3300048920 | Ga0496117_0024973 | Ga0496117_0024973_1339_2238 | 299 |
| 1081 | 3300048920 | Ga0496117_0030449 | Ga0496117_0030449_698_1597 | 299 |
| 1082 | 3300048920 | Ga0496117_0036558 | Ga0496117_0036558_2394_3293 | 299 |
| 1083 | 3300048920 | Ga0496117_0037524 | Ga0496117_0037524_1807_2706 | 299 |
| 1084 | 3300048920 | Ga0496117_0050656 | Ga0496117_0050656_1032_1931 | 299 |
| 1085 | 3300048920 | Ga0496117_0067715 | Ga0496117_0067715_1028_1927 | 299 |
| 1086 | 3300048920 | Ga0496117_0092587 | Ga0496117_0092587_87_986 | 299 |
| 1087 | 3300048920 | Ga0496117_0092825 | Ga0496117_0092825_406_1305 | 299 |
| 1088 | 3300048921 | Ga0496118_0031832 | Ga0496118_0031832_2564_3463 | 299 |
| 1089 | 3300048921 | Ga0496118_0033154 | Ga0496118_0033154_727_1626 | 299 |
| 1090 | 3300048921 | Ga0496118_0040995 | Ga0496118_0040995_2394_3293 | 299 |
| 1091 | 3300048921 | Ga0496118_0042110 | Ga0496118_0042110_2548_3447 | 299 |
| 1092 | 3300048921 | Ga0496118_0050786 | Ga0496118_0050786_1361_2260 | 299 |
| 1093 | 3300048921 | Ga0496118_0069336 | Ga0496118_0069336_697_1596 | 299 |
| 1094 | 3300048921 | Ga0496118_0083779 | Ga0496118_0083779_700_1599 | 299 |
| 1095 | 3300048921 | Ga0496118_0113771 | Ga0496118_0113771_382_1281 | 299 |
| 1096 | 3300048922 | Ga0496119_0021440 | Ga0496119_0021440_1326_2225 | 299 |
| 1097 | 3300048922 | Ga0496119_0029940 | Ga0496119_0029940_1178_2077 | 299 |
| 1098 | 3300048923 | Ga0496120_0015048 | Ga0496120_0015048_2465_3364 | 299 |
| 1099 | 3300048923 | Ga0496120_0015699 | Ga0496120_0015699_1528_2427 | 299 |
| 1100 | 3300048924 | Ga0496121_0014652 | Ga0496121_0014652_4934_5833 | 299 |
| 1101 | 3300048924 | Ga0496121_0022108 | Ga0496121_0022108_2178_3077 | 299 |
| 1102 | 3300048924 | Ga0496121_0054583 | Ga0496121_0054583_1401_2300 | 299 |
| 1103 | 3300048924 | Ga0496121_0130328 | Ga0496121_0130328_692_1591 | 299 |
| 1104 | 3300048924 | Ga0496121_0231312 | Ga0496121_0231312_277_1176 | 299 |
| 1105 | 3300048925 | Ga0496122_0021592 | Ga0496122_0021592_2539_3438 | 299 |
| 1106 | 3300048925 | Ga0496122_0049252 | Ga0496122_0049252_1514_2413 | 299 |
| 1107 | 3300048925 | Ga0496122_0061538 | Ga0496122_0061538_497_1396 | 299 |
| 1108 | 3300048925 | Ga0496122_0076976 | Ga0496122_0076976_1271_2170 | 299 |
| 1109 | 3300048925 | Ga0496122_0110047 | Ga0496122_0110047_165_1064 | 299 |
| 1110 | 3300048925 | Ga0496122_0164831 | Ga0496122_0164831_403_1302 | 299 |
| 1111 | 3300048926 | Ga0496123_0022349 | Ga0496123_0022349_2459_3358 | 299 |
| 1112 | 3300048926 | Ga0496123_0024029 | Ga0496123_0024029_1314_2213 | 299 |
| 1113 | 3300048926 | Ga0496123_0043661 | Ga0496123_0043661_1474_2373 | 299 |
| 1114 | 3300048926 | Ga0496123_0069220 | Ga0496123_0069220_1124_2023 | 299 |
| 1115 | 3300048927 | Ga0496124_0013682 | Ga0496124_0013682_5471_6370 | 299 |
| 1116 | 3300048927 | Ga0496124_0053014 | Ga0496124_0053014_1810_2709 | 299 |
| 1117 | 3300048927 | Ga0496124_0079617 | Ga0496124_0079617_46_945 | 299 |
| 1118 | 3300048927 | Ga0496124_0086342 | Ga0496124_0086342_1189_2088 | 299 |
| 1119 | 3300048927 | Ga0496124_0094804 | Ga0496124_0094804_43_942 | 299 |
| 1120 | 3300048927 | Ga0496124_0150082 | Ga0496124_0150082_244_1143 | 299 |
| 1121 | 3300048927 | Ga0496124_0202845 | Ga0496124_0202845_238_1137 | 299 |
| 1122 | 3300048928 | Ga0496125_0015865 | Ga0496125_0015865_3757_4656 | 299 |
| 1123 | 3300048928 | Ga0496125_0026454 | Ga0496125_0026454_2569_3468 | 299 |
| 1124 | 3300048928 | Ga0496125_0032010 | Ga0496125_0032010_2449_3348 | 299 |
| 1125 | 3300048928 | Ga0496125_0040318 | Ga0496125_0040318_1940_2839 | 299 |
| 1126 | 3300048928 | Ga0496125_0040690 | Ga0496125_0040690_2634_3533 | 299 |
| 1127 | 3300048928 | Ga0496125_0049097 | Ga0496125_0049097_1372_2271 | 299 |
| 1128 | 3300048928 | Ga0496125_0096023 | Ga0496125_0096023_683_1582 | 299 |
| 1129 | 3300048928 | Ga0496125_0159557 | Ga0496125_0159557_165_1064 | 299 |
| 1130 | 3300048929 | Ga0496126_0056657 | Ga0496126_0056657_2537_3436 | 299 |
| 1131 | 3300048929 | Ga0496126_0063156 | Ga0496126_0063156_925_1824 | 299 |
| 1132 | 3300048929 | Ga0496126_0074537 | Ga0496126_0074537_1918_2817 | 299 |
| 1133 | 3300048929 | Ga0496126_0115530 | Ga0496126_0115530_1238_2137 | 299 |
| 1134 | 3300049459 | Ga0495678_005003 | Ga0495678_005003_2423_3322 | 299 |
| 1135 | 3300049459 | Ga0495678_006344 | Ga0495678_006344_4863_5762 | 299 |
| 1136 | 3300049459 | Ga0495678_007286 | Ga0495678_007286_2571_3470 | 299 |
| 1137 | 3300049459 | Ga0495678_007969 | Ga0495678_007969_457_1356 | 299 |
| 1138 | 3300049459 | Ga0495678_015351 | Ga0495678_015351_905_1804 | 299 |
| 1139 | 3300049459 | Ga0495678_025182 | Ga0495678_025182_1152_2051 | 299 |
| 1140 | 3300049459 | Ga0495678_040233 | Ga0495678_040233_948_1847 | 299 |
| 1141 | 3300049459 | Ga0495678_051651 | Ga0495678_051651_87_986 | 299 |
| 1142 | 3300049460 | Ga0495682_0001713 | Ga0495682_0001713_7080_7979 | 299 |
| 1143 | 3300049460 | Ga0495682_0011732 | Ga0495682_0011732_1352_2251 | 299 |
| 1144 | 3300049460 | Ga0495682_0015052 | Ga0495682_0015052_418_1317 | 299 |
| 1145 | 3300049460 | Ga0495682_0019726 | Ga0495682_0019726_482_1381 | 299 |
| 1146 | 3300049460 | Ga0495682_0073658 | Ga0495682_0073658_288_1187 | 299 |
| 1147 | 3300049758 | Ga0501241_002825 | Ga0501241_002825_827_1726 | 299 |
| 1148 | 3300050489 | nmdc:mga03683_46565_c1 | nmdc:mga03683_46565_c1_621_1520 | 299 |
| 1149 | 3300050491 | nmdc:mga00v17_87723_c1 | nmdc:mga00v17_87723_c1_873_1772 | 299 |
| 1150 | 3300053111 | Ga0500572_008110 | Ga0500572_008110_1163_2062 | 299 |
| 1151 | 3300053161 | Ga0500634_0026777 | Ga0500634_0026777_1441_2340 | 299 |
| 1152 | iso_pu_bacteria | 3007866637 | 3007871552 | 299 |
| 1153 | iso_pu_bacteria | 637000220 | 637323457 | 299 |
| 1154 | iso_pu_bacteria | 8056143049 | 8056143151 | 299 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2htb-assembly4.cif.gz_D | crystal structure of a putative mutarotase (yead) from salmonella typhimurium in monoclinic form | 0.9167 | 3 | 294 |
| 1jov-assembly1.cif.gz_A | crystal structure analysis of hi1317 | 0.8871 | 3 | 292 |
| 2htb-assembly4.cif.gz_D | crystal structure of a putative mutarotase (yead) from salmonella typhimurium in monoclinic form | 0.8717 | 3 | 294 |
| 2ciq-assembly1.cif.gz_A | structure-based functional annotation: yeast ymr099c codes for a d- hexose-6-phosphate mutarotase. | 0.8567 | 7 | 291 |
| 1jov-assembly1.cif.gz_A | crystal structure analysis of hi1317 | 0.8556 | 3 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1P8BFM5_144_317_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9625 | 132 | 293 | 2.70.98.10 |
| 2htbC00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.917 | 6 | 294 | 2.70.98.10 |
| af_X2JAD3_2_284_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9159 | 22 | 291 | 2.70.98.10 |
| af_A0A1P8BFM5_144_317_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.8925 | 132 | 293 | 2.70.98.10 |
| 1jovA00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.8871 | 3 | 292 | 2.70.98.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A367LVL2-F1-model_v4 | D-hexose-6-phosphate mutarotase | 0.9922 | 169 | 276 |
GO:0005975
GO:0016853 GO:0030246 |
| AF-A0A5C7TRN6-F1-model_v4 | deleted | 0.9895 | 149 | 294 |
|
| AF-A0A8B3GCL7-F1-model_v4 | deleted | 0.9877 | 66 | 294 |
|
| AF-A0A4R0PJ47-F1-model_v4 | deleted | 0.9847 | 3 | 294 |
|
| AF-A0A7C9DYP3-F1-model_v4 | Glucose-6-phosphate 1-epimerase (EC 5.1.3.15) | 0.9844 | 178 | 268 |
GO:0005737
GO:0005975 GO:0030246 GO:0047938 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar