F490915

General Info

Members Datasets Scaffolds Average Seq Length
1154 501 926 297

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|637000220|637323457
Length 327
Sequence ARFRRARAKPDDRSAVHSSPHLANENSSMPTPQVETVKLDELNCWRIRHGDAELLVAQQGAHILSYQVAGQQPLIWLNDEAVFKRGKSIRAGVPVCWPWFGNFARNPQAVQAMRQGTDPAPAHGLVRATDWELLGIESQGDSLLVELRLPCPAGGFPGWPHQVEPRLSIRLDQQLHISLSSHNLGTESVSISQALHSYFAVSDVRQVQVEGVDGLSYIETLEDWKTKVQSGSLHFTGETDRIYLNAPTQLEIVDPDWQRRIRLRSEGSRTAVIWNPWIDRAAQFSDMADDGWQRMLCIETANVMDDIVTLAPGASHTLSVSISAAPL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231021 Pseudomonas sp. GM78 Isolate Nodule
18 2511231022 Pseudomonas sp. GM79 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231024 Pseudomonas sp. GM84 Isolate Nodule
21 2511231031 Pseudomonas sp. GM16 Isolate Nodule
22 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
23 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
24 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
25 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
26 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
27 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
28 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
29 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
30 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
31 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
32 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
33 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
34 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
35 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
36 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
37 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
38 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
39 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
40 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
41 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
42 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
43 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
44 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
45 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
46 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
47 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
48 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
49 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
50 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
51 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
52 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
53 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
54 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
55 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
56 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
57 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
58 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
59 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
60 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
61 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
62 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
63 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
64 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
65 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
66 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
67 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
68 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
69 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
70 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
71 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
72 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
73 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
74 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
75 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
76 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
77 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
78 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
79 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
80 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
81 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
82 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
83 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
84 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
85 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
86 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
87 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
88 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
89 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
90 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
91 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
92 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
93 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
94 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
95 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
96 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
97 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
98 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
99 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
100 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
101 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
102 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
103 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
104 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
105 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
106 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
107 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
108 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
109 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
110 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
111 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
112 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
113 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
114 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
115 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
116 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
117 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
118 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
119 2765235841 Pseudomonas putida AA7 Isolate Unclassified
120 2773857670 Pseudomonas sp. 478 Isolate Unclassified
121 2773857673 Pseudomonas sp. 443 Isolate Unclassified
122 2784132063 Pseudomonas sp. 424 Isolate Unclassified
123 2784132072 Pseudomonas sp. 460 Isolate Unclassified
124 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
125 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
126 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
127 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
128 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
129 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
130 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
131 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
132 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
133 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
134 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
135 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
136 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
137 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
138 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
139 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
140 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
141 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
142 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
143 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
144 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
145 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
146 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
147 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
148 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
149 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
150 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
151 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
152 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
153 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
154 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
155 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
156 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
157 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
158 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
159 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
160 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
161 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
162 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
163 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
164 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
165 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
166 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
167 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
168 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
169 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
170 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
171 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
172 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
173 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
174 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
175 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
176 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
177 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
178 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
179 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
180 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
181 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
182 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
183 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
184 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
185 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
186 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
187 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
188 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
189 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
190 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
191 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
192 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
193 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
194 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
195 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
196 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
197 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
198 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
199 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
200 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
201 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
202 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
203 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
204 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
205 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
206 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
207 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
208 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
209 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
210 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
211 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
212 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
213 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
214 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
215 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
216 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
217 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
218 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
219 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
220 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
221 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
222 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
223 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
224 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
225 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
226 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
227 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
228 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
229 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
230 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
231 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
232 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
233 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
234 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
235 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
236 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
237 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
238 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
239 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
240 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
241 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
242 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
243 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
244 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
245 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
246 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
247 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
248 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
249 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
250 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
251 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
252 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
253 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
254 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
255 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
256 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
257 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
258 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
259 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
260 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
261 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
262 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
263 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
264 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
265 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
266 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
272 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
273 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
275 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
277 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
278 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
299 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
300 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
301 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
302 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
303 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
304 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
305 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
307 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
308 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
309 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
310 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
311 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
312 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
313 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
314 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
315 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
316 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
317 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
318 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
319 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
320 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
321 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
322 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
323 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
324 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
325 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
326 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
327 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
328 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
329 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
330 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
331 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
332 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
333 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
334 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
335 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
336 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
337 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
338 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
339 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
340 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
341 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
342 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
343 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
344 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
345 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
346 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
347 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
348 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
349 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
350 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
351 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
352 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
353 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
354 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
355 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
356 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
357 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
358 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
359 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
360 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
361 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
362 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
363 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
364 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
365 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
366 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
367 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
368 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
369 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
370 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
371 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
372 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
373 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
374 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
375 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
376 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
377 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
378 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
379 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
380 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
381 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
382 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
383 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
384 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
385 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
386 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
387 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
388 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
389 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
390 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
391 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
392 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
393 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
394 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
395 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
396 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
397 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
398 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
399 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
400 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
401 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
402 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
403 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
404 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
405 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
406 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
407 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
408 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
409 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
410 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
411 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
412 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
413 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
414 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
415 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
416 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
417 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
418 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
419 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
420 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
421 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
422 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
423 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
424 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
425 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
426 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
427 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
428 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
429 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
430 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
431 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
432 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
433 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
434 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
435 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
436 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
437 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
438 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
439 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
440 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
441 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
442 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
443 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
444 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
445 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
446 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
447 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
448 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
449 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
450 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
451 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
452 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
453 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
454 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
455 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
456 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
457 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
458 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
459 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
460 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
465 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
467 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
468 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
469 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
470 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
471 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
472 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
473 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
474 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
475 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
476 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
477 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
478 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
479 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
480 8052494512 Pseudomonas putida LD6 Isolate Unclassified
481 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
482 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
483 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
484 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
485 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
486 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
487 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
488 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
489 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
490 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
491 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
492 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
493 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
494 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
495 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
496 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
497 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
498 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
499 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
500 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
501 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.24
Metatranscriptomes 0
Isolates 19.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.81
Nodule 2.34
Rhizoplane 6.33
Rhizosphere 71.58
Stem 0
Stem Tuber 0
Unclassified 13.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_41 2124908027 Bacteria 51011
2 MRS2a_Contig_973 2124908027 Bacteria 3358
3 SwRhRL2b_contig_2143161 2162886007 Bacteria 1188
4 JGI25162J39368_1000082 3300002737 Bacteria 112599
5 JGI25162J39368_1000282 3300002737 Bacteria 47984
6 JGI25163J39215_1001247 3300002771 Bacteria 4660
7 JGI25163J39215_1001473 3300002771 Bacteria 3816
8 JGI25164J39214_1000058 3300002772 Bacteria 112599
9 JGI25164J39214_1000212 3300002772 Bacteria 47984
10 JGI25165J46597_1000154 3300003214 Bacteria 112599
11 JGI25165J46597_1000383 3300003214 Bacteria 47984
12 rootH2_10020520 3300003320 Bacteria 37566
13 rootH1_10191543 3300003323 Bacteria 1338
14 Ga0055539_1000017 3300003752 Bacteria 353873
15 Ga0055533_1000021 3300003756 Bacteria 353826
16 Ga0055532_1000020 3300003758 Bacteria 270853
17 Ga0055525_1000078 3300003759 Bacteria 165788
18 Ga0055536_1004543 3300003781 Bacteria 7053
19 Ga0055536_1009458 3300003781 Bacteria 4031
20 Ga0055536_1010847 3300003781 Bacteria 3561
21 Ga0055530_10005470 3300003791 Bacteria 6021
22 Ga0055530_10008701 3300003791 Bacteria 4019
23 Ga0055530_10013792 3300003791 Bacteria 2736
24 Ga0055530_10015687 3300003791 Bacteria 2460
25 Ga0055540_1004724 3300003792 Bacteria 6021
26 Ga0055540_1007682 3300003792 Bacteria 4019
27 Ga0055540_1007709 3300003792 Bacteria 4009
28 Ga0055541_1000012 3300003841 Bacteria 353826
29 Ga0058692_1002657 3300003856 Bacteria 5886
30 Ga0065714_10000439 3300005288 Bacteria 5396
31 Ga0065714_10002271 3300005288 Bacteria 29440
32 Ga0065714_10006312 3300005288 Bacteria 3356
33 Ga0065714_10008133 3300005288 Bacteria 2642
34 Ga0065714_10066861 3300005288 Bacteria 6187
35 Ga0065714_10072674 3300005288 Bacteria 3322
36 Ga0065704_10075102 3300005289 Bacteria 5789
37 Ga0065704_10082411 3300005289 Bacteria 3604
38 Ga0065704_10088544 3300005289 Bacteria 2931
39 Ga0065704_10096819 3300005289 Bacteria 2419
40 Ga0065704_10139376 3300005289 Bacteria 1522
41 Ga0065712_10087006 3300005290 Bacteria 2603
42 Ga0070670_100009258 3300005331 Bacteria 8414
43 Ga0070670_100032384 3300005331 Bacteria 4502
44 Ga0070661_100004654 3300005344 Bacteria 9450
45 Ga0070668_100342115 3300005347 Bacteria 1264
46 Ga0070669_100000186 3300005353 Bacteria 54020
47 Ga0070669_100005487 3300005353 Bacteria 9155
48 Ga0070675_100355856 3300005354 Unclassified 1299
49 Ga0070674_100194995 3300005356 Bacteria 1560
50 Ga0070663_100300775 3300005455 Bacteria 1284
51 Ga0070662_100112437 3300005457 Bacteria 2076
52 Ga0070665_100046440 3300005548 Bacteria 4363
53 Ga0070665_100144180 3300005548 Bacteria 2385
54 Ga0070664_100000292 3300005564 Bacteria 36276
55 Ga0068854_100013801 3300005578 Bacteria 5312
56 Ga0068851_10000039 3300005834 Bacteria 93193
57 Ga0075364_10071835 3300006051 Bacteria 2280
58 Ga0075364_10080097 3300006051 Bacteria 2159
59 Ga0075364_10087710 3300006051 Bacteria 2062
60 Ga0075364_10310727 3300006051 Bacteria 1073
61 Ga0075432_10005388 3300006058 Bacteria 4361
62 Ga0075432_10007561 3300006058 Bacteria 3702
63 Ga0075432_10024934 3300006058 Bacteria 2051
64 Ga0075432_10037262 3300006058 Bacteria 1692
65 Ga0075432_10120714 3300006058 Bacteria 984
66 Ga0075362_10054894 3300006177 Bacteria 1791
67 Ga0075362_10144102 3300006177 Bacteria 1140
68 Ga0075436_100149243 3300006914 Bacteria 1644
69 Ga0099823_1033941 3300006944 Bacteria 4068
70 Ga0079104_1001850 3300006946 Bacteria 12887
71 Ga0079104_1007967 3300006946 Bacteria 3769
72 Ga0105251_10000089 3300009011 Bacteria 88101
73 Ga0105251_10008371 3300009011 Bacteria 6235
74 Ga0105251_10008839 3300009011 Bacteria 6032
75 Ga0105251_10016631 3300009011 Bacteria 3967
76 Ga0105251_10034558 3300009011 Bacteria 2500
77 Ga0105251_10059337 3300009011 Bacteria 1804
78 Ga0105251_10063703 3300009011 Bacteria 1729
79 Ga0105244_10008948 3300009036 Bacteria 6199
80 Ga0105244_10009039 3300009036 Bacteria 6165
81 Ga0105244_10019248 3300009036 Bacteria 3818
82 Ga0105244_10019839 3300009036 Bacteria 3742
83 Ga0105244_10034337 3300009036 Bacteria 2671
84 Ga0105244_10040258 3300009036 Bacteria 2428
85 Ga0105244_10069281 3300009036 Bacteria 1761
86 Ga0105244_10077974 3300009036 Bacteria 1643
87 Ga0105244_10089195 3300009036 Bacteria 1518
88 Ga0105250_10001135 3300009092 Bacteria 15004
89 Ga0105250_10004905 3300009092 Bacteria 6080
90 Ga0105250_10012182 3300009092 Bacteria 3556
91 Ga0105250_10017305 3300009092 Bacteria 2931
92 Ga0105250_10018249 3300009092 Bacteria 2845
93 Ga0105250_10033111 3300009092 Bacteria 2074
94 Ga0111539_10000054 3300009094 Bacteria 115242
95 Ga0105243_10005333 3300009148 Bacteria 10041
96 Ga0105243_10006305 3300009148 Bacteria 9166
97 Ga0105243_10013497 3300009148 Bacteria 6179
98 Ga0105243_10013630 3300009148 Bacteria 6149
99 Ga0105243_10023427 3300009148 Bacteria 4702
100 Ga0105243_10045133 3300009148 Bacteria 3461
101 Ga0105243_10088764 3300009148 Bacteria 2540
102 Ga0105243_10096892 3300009148 Bacteria 2441
103 Ga0105242_10001069 3300009176 Bacteria 21506
104 Ga0105242_10042069 3300009176 Bacteria 3687
105 Ga0105237_10001100 3300009545 Bacteria 36161
106 Ga0105237_10300209 3300009545 Bacteria 1609
107 Ga0105249_10007620 3300009553 Bacteria 9443
108 Ga0105246_10006273 3300011119 Bacteria 7256
109 Ga0105246_10028338 3300011119 Bacteria 3678
110 Ga0105246_10032290 3300011119 Bacteria 3471
111 Ga0105246_10081744 3300011119 Bacteria 2304
112 Ga0157337_1000334 3300012483 Bacteria 2169
113 Ga0157345_1000279 3300012498 Bacteria 7054
114 Ga0157373_10014293 3300013100 Bacteria 5822
115 Ga0157373_10014510 3300013100 Bacteria 5775
116 Ga0157373_10015661 3300013100 Bacteria 5539
117 Ga0157373_10054780 3300013100 Bacteria 2833
118 Ga0157373_10082138 3300013100 Bacteria 2271
119 Ga0157373_10093502 3300013100 Bacteria 2118
120 Ga0157373_10103609 3300013100 Bacteria 2001
121 Ga0157373_10130352 3300013100 Bacteria 1768
122 Ga0157373_10188610 3300013100 Bacteria 1453
123 Ga0157371_10000109 3300013102 Bacteria 124990
124 Ga0157371_10008323 3300013102 Bacteria 8280
125 Ga0157371_10015185 3300013102 Bacteria 5783
126 Ga0157371_10020452 3300013102 Bacteria 4871
127 Ga0157370_10027707 3300013104 Bacteria 5586
128 Ga0157370_10037357 3300013104 Bacteria 4708
129 Ga0157370_10106867 3300013104 Bacteria 2619
130 Ga0157370_10152461 3300013104 Bacteria 2150
131 Ga0157369_10012771 3300013105 Bacteria 9523
132 Ga0157369_10028227 3300013105 Bacteria 6212
133 Ga0157369_10031841 3300013105 Bacteria 5803
134 Ga0157369_10077343 3300013105 Bacteria 3566
135 Ga0157369_10145778 3300013105 Bacteria 2503
136 Ga0157369_10374681 3300013105 Bacteria 1478
137 Ga0163162_10015186 3300013306 Bacteria 7522
138 Ga0163162_10168413 3300013306 Bacteria 2315
139 Ga0163162_10212584 3300013306 Bacteria 2064
140 Ga0157372_10003284 3300013307 Bacteria 17473
141 Ga0157372_10028128 3300013307 Bacteria 6133
142 Ga0157375_10021950 3300013308 Bacteria 5867
143 Ga0157375_10033370 3300013308 Bacteria 4890
144 Ga0157375_10285399 3300013308 Bacteria 1814
145 Ga0157375_10514152 3300013308 Bacteria 1361
146 Ga0182008_10007384 3300014497 Bacteria 6071
147 Ga0182008_10007985 3300014497 Bacteria 5801
148 Ga0182008_10009595 3300014497 Bacteria 5212
149 Ga0182008_10009942 3300014497 Bacteria 5114
150 Ga0182008_10010565 3300014497 Bacteria 4940
151 Ga0182008_10064150 3300014497 Bacteria 1808
152 Ga0182008_10067524 3300014497 Bacteria 1759
153 Ga0182006_1004263 3300015261 Bacteria 7077
154 Ga0182006_1005362 3300015261 Bacteria 6133
155 Ga0182006_1006516 3300015261 Bacteria 5417
156 Ga0182006_1015408 3300015261 Bacteria 3277
157 Ga0182007_10005678 3300015262 Bacteria 5445
158 Ga0182007_10010392 3300015262 Bacteria 3680
159 Ga0182005_1002764 3300015265 Bacteria 6119
160 Ga0182005_1003401 3300015265 Bacteria 5412
161 Ga0182005_1018358 3300015265 Bacteria 1932
162 Ga0163161_10009183 3300017792 Bacteria 6834
163 Ga0163161_10032067 3300017792 Bacteria 3748
164 Ga0163161_10053254 3300017792 Bacteria 2934
165 Ga0163161_10074015 3300017792 Bacteria 2497
166 Ga0163161_10182217 3300017792 Bacteria 1611
167 Ga0163161_10225644 3300017792 Bacteria 1452
168 Ga0163161_10240801 3300017792 Bacteria 1407
169 Ga0163161_10289252 3300017792 Bacteria 1288
170 Ga0213872_10000383 3300021361 Bacteria 37014
171 Ga0213872_10010717 3300021361 Bacteria 4354
172 Ga0213872_10014578 3300021361 Bacteria 3666
173 Ga0209435_100579 3300025206 Bacteria 6870
174 Ga0209760_100160 3300025207 Bacteria 40397
175 Ga0209760_100475 3300025207 Bacteria 8673
176 Ga0209784_100007 3300025224 Bacteria 747715
177 Ga0209566_100009 3300025225 Bacteria 554018
178 Ga0209674_100021 3300025226 Bacteria 629811
179 Ga0209147_100009 3300025229 Bacteria 747409
180 Ga0209563_100018 3300025230 Bacteria 747850
181 Ga0207427_100005 3300025231 Bacteria 797999
182 Ga0207427_100006 3300025231 Bacteria 785415
183 Ga0209437_100013 3300025233 Bacteria 785457
184 Ga0209437_100018 3300025233 Bacteria 694400
185 Ga0209258_100321 3300025242 Bacteria 72995
186 Ga0209646_1000787 3300025246 Bacteria 10866
187 Ga0209677_100012 3300025253 Bacteria 554018
188 Ga0209759_1021813 3300025256 Bacteria 1447
189 Ga0209233_1000021 3300025261 Bacteria 798078
190 Ga0209233_1000022 3300025261 Bacteria 785415
191 Ga0209675_1002421 3300025291 Bacteria 9611
192 Ga0209676_1000015 3300025292 Bacteria 784458
193 Ga0209676_1000030 3300025292 Bacteria 506421
194 Ga0209676_1000278 3300025292 Bacteria 106516
195 Ga0209676_1004422 3300025292 Bacteria 7842
196 Ga0209676_1008322 3300025292 Bacteria 4644
197 Ga0209676_1013187 3300025292 Bacteria 3193
198 Ga0209050_1000030 3300025298 Bacteria 463381
199 Ga0209050_1000061 3300025298 Bacteria 321435
200 Ga0209050_1000241 3300025298 Bacteria 118446
201 Ga0209050_1007643 3300025298 Bacteria 5991
202 Ga0209051_1000012 3300025303 Bacteria 595474
203 Ga0209051_1000519 3300025303 Bacteria 48314
204 Ga0209051_1000572 3300025303 Bacteria 44529
205 Ga0209051_1011562 3300025303 Bacteria 4348
206 Ga0209257_1000143 3300025304 Bacteria 199975
207 Ga0209257_1008653 3300025304 Bacteria 5705
208 Ga0207656_10000009 3300025321 Bacteria 245637
209 Ga0207696_1000055 3300025711 Bacteria 258289
210 Ga0207696_1000078 3300025711 Bacteria 207623
211 Ga0207696_1000080 3300025711 Bacteria 199217
212 Ga0207696_1000204 3300025711 Bacteria 90602
213 Ga0207696_1001609 3300025711 Bacteria 11938
214 Ga0207696_1009608 3300025711 Bacteria 3600
215 Ga0207696_1020354 3300025711 Bacteria 2143
216 Ga0207696_1027443 3300025711 Bacteria 1754
217 Ga0207655_1000033 3300025728 Bacteria 377066
218 Ga0207655_1000116 3300025728 Bacteria 161950
219 Ga0207655_1000541 3300025728 Bacteria 47787
220 Ga0207655_1002134 3300025728 Bacteria 16488
221 Ga0207655_1003858 3300025728 Bacteria 10912
222 Ga0207655_1004732 3300025728 Bacteria 9511
223 Ga0207655_1006294 3300025728 Bacteria 7894
224 Ga0207655_1010039 3300025728 Bacteria 5797
225 Ga0207655_1016218 3300025728 Bacteria 4089
226 Ga0207655_1017720 3300025728 Bacteria 3826
227 Ga0207655_1018480 3300025728 Bacteria 3693
228 Ga0207655_1022478 3300025728 Bacteria 3160
229 Ga0207655_1025331 3300025728 Bacteria 2882
230 Ga0207655_1028204 3300025728 Bacteria 2653
231 Ga0207713_1000010 3300025735 Bacteria 528374
232 Ga0207713_1000707 3300025735 Bacteria 31256
233 Ga0207713_1000912 3300025735 Bacteria 26556
234 Ga0207713_1001717 3300025735 Bacteria 16907
235 Ga0207713_1002747 3300025735 Bacteria 12500
236 Ga0207713_1004151 3300025735 Bacteria 9518
237 Ga0207713_1004468 3300025735 Bacteria 9059
238 Ga0207713_1005294 3300025735 Bacteria 8115
239 Ga0207713_1005979 3300025735 Bacteria 7507
240 Ga0207713_1010169 3300025735 Bacteria 5227
241 Ga0207713_1025127 3300025735 Bacteria 2758
242 Ga0207713_1026441 3300025735 Bacteria 2659
243 Ga0207713_1039658 3300025735 Bacteria 1984
244 Ga0207713_1045320 3300025735 Bacteria 1797
245 Ga0207713_1057758 3300025735 Bacteria 1498
246 Ga0207671_10000027 3300025914 Bacteria 264907
247 Ga0207671_10190213 3300025914 Bacteria 1600
248 Ga0207649_10000007 3300025920 Bacteria 334217
249 Ga0207681_10000059 3300025923 Bacteria 104079
250 Ga0207650_10000044 3300025925 Bacteria 183146
251 Ga0207650_10000089 3300025925 Bacteria 120962
252 Ga0207706_10002297 3300025933 Bacteria 18648
253 Ga0207706_10077495 3300025933 Bacteria 2923
254 Ga0207686_10003528 3300025934 Bacteria 8397
255 Ga0207709_10000061 3300025935 Bacteria 199097
256 Ga0207709_10000063 3300025935 Bacteria 191397
257 Ga0207709_10000545 3300025935 Bacteria 32259
258 Ga0207709_10005565 3300025935 Bacteria 7135
259 Ga0207709_10011028 3300025935 Bacteria 4983
260 Ga0207709_10047897 3300025935 Bacteria 2601
261 Ga0207679_10000013 3300025945 Bacteria 334197
262 Ga0207679_10019106 3300025945 Bacteria 4599
263 Ga0207712_10010833 3300025961 Bacteria 5801
264 Ga0207640_10434927 3300025981 Bacteria 1077
265 Ga0207639_10000091 3300026041 Bacteria 76122
266 Ga0209281_1000016 3300027111 Bacteria 588107
267 Ga0209281_1002512 3300027111 Bacteria 7222
268 Ga0209281_1006212 3300027111 Bacteria 3155
269 Ga0209389_1000036 3300027296 Bacteria 126146
270 Ga0209371_1000632 3300027312 Bacteria 31121
271 Ga0209996_1002843 3300027395 Bacteria 2153
272 Ga0209982_1004294 3300027552 Bacteria 2040
273 Ga0209970_1003071 3300027614 Bacteria 2814
274 Ga0207428_10106391 3300027907 Bacteria 2163
275 Ga0207428_10215854 3300027907 Bacteria 1440
276 Ga0207428_10226076 3300027907 Bacteria 1402
277 Ga0268266_10039955 3300028379 Bacteria 3997
278 Ga0268266_10240282 3300028379 Bacteria 1671
279 Ga0268266_10338178 3300028379 Bacteria 1412
280 Ga0307517_10058899 3300028786 Bacteria 3689
281 Ga0268256_1000247 3300030500 Bacteria 57439
282 Ga0307511_10035806 3300030521 Bacteria 4328
283 Ga0307511_10110889 3300030521 Bacteria 1747
284 Ga0316177_1091565 3300030731 Bacteria 6654
285 Ga0316179_1002654 3300030734 Bacteria 6862
286 Ga0316178_1047147 3300030735 Bacteria 102800
287 Ga0316183_1191323 3300030742 Bacteria 2861
288 Ga0316181_1001658 3300030744 Bacteria 5430
289 Ga0307408_100000002 3300031548 Bacteria 827227
290 Ga0307408_100000014 3300031548 Bacteria 377369
291 Ga0307408_100014178 3300031548 Bacteria 5295
292 Ga0307408_100030241 3300031548 Bacteria 3759
293 Ga0307408_100316253 3300031548 Bacteria 1313
294 Ga0307516_10307124 3300031730 Bacteria 1260
295 Ga0307405_10014255 3300031731 Bacteria 4268
296 Ga0307405_10014813 3300031731 Bacteria 4204
297 Ga0307405_10103727 3300031731 Bacteria 1912
298 Ga0307410_10089350 3300031852 Bacteria 2183
299 Ga0307407_10000093 3300031903 Bacteria 30798
300 Ga0307407_10013087 3300031903 Bacteria 4012
301 Ga0307407_10081643 3300031903 Bacteria 1957
302 Ga0307412_10006130 3300031911 Bacteria 6775
303 Ga0307412_10097956 3300031911 Bacteria 2067
304 Ga0307416_100174387 3300032002 Unclassified 2006
305 Ga0307416_100181693 3300032002 Bacteria 1972
306 Ga0307416_100198823 3300032002 Bacteria 1899
307 Ga0307414_10005772 3300032004 Bacteria 6842
308 Ga0307414_10086135 3300032004 Bacteria 2317
309 Ga0307414_10145876 3300032004 Bacteria 1859
310 Ga0307411_10020289 3300032005 Bacteria 3861
311 Ga0307411_10031149 3300032005 Bacteria 3278
312 Ga0307411_10078066 3300032005 Bacteria 2268
313 Ga0307510_10024600 3300033180 Bacteria 6955
314 Ga0237819_00416 3300038705 Bacteria 14684
315 Ga0436361_0009597 3300039447 Bacteria 38752
316 Ga0436361_0299334 3300039447 Bacteria 4044
317 Ga0436361_0723713 3300039447 Bacteria 5853
318 Ga0436361_0772260 3300039447 Bacteria 34747
319 Ga0439438_003796 3300041405 Bacteria 5971
320 Ga0439438_004810 3300041405 Bacteria 5091
321 Ga0439438_006281 3300041405 Bacteria 4221
322 Ga0439438_007493 3300041405 Bacteria 3726
323 Ga0439438_011129 3300041405 Bacteria 2816
324 Ga0439438_011217 3300041405 Bacteria 2800
325 Ga0439438_012118 3300041405 Bacteria 2656
326 Ga0439438_013381 3300041405 Bacteria 2476
327 Ga0439438_016490 3300041405 Bacteria 2147
328 Ga0439438_020501 3300041405 Bacteria 1855
329 Ga0439438_027053 3300041405 Bacteria 1551
330 Ga0439438_034184 3300041405 Bacteria 1340
331 Ga0439447_003950 3300041407 Bacteria 5191
332 Ga0439447_004777 3300041407 Bacteria 4611
333 Ga0439447_005109 3300041407 Bacteria 4404
334 Ga0439447_008113 3300041407 Bacteria 3273
335 Ga0439447_010104 3300041407 Bacteria 2817
336 Ga0439453_0001129 3300041408 Bacteria 3333
337 Ga0439466_0002316 3300041411 Bacteria 7474
338 Ga0439466_0006210 3300041411 Bacteria 4548
339 Ga0439466_0008448 3300041411 Bacteria 3882
340 Ga0439466_0009141 3300041411 Bacteria 3714
341 Ga0439466_0010840 3300041411 Bacteria 3381
342 Ga0439466_0015214 3300041411 Bacteria 2795
343 Ga0439466_0018909 3300041411 Bacteria 2467
344 Ga0439466_0022259 3300041411 Bacteria 2238
345 Ga0439466_0022816 3300041411 Bacteria 2205
346 Ga0439465_0008204 3300041413 Bacteria 3297
347 Ga0439431_0005396 3300041997 Bacteria 2824
348 Ga0439437_000861 3300042000 Bacteria 3153
349 Ga0439445_0026105 3300042004 Bacteria 1493
350 Ga0439432_000735 3300042006 Bacteria 12268
351 Ga0439432_001455 3300042006 Bacteria 8885
352 Ga0439432_003124 3300042006 Bacteria 6169
353 Ga0439432_007249 3300042006 Bacteria 3938
354 Ga0439432_012126 3300042006 Bacteria 2957
355 Ga0439432_013741 3300042006 Bacteria 2748
356 Ga0439432_018391 3300042006 Bacteria 2335
357 Ga0439432_041724 3300042006 Bacteria 1452
358 Ga0439452_002183 3300042010 Bacteria 7391
359 Ga0439452_002419 3300042010 Bacteria 6905
360 Ga0439452_003104 3300042010 Bacteria 5888
361 Ga0439452_004107 3300042010 Bacteria 4950
362 Ga0439452_009764 3300042010 Bacteria 2817
363 Ga0439452_012435 3300042010 Bacteria 2421
364 Ga0439452_014704 3300042010 Bacteria 2165
365 Ga0439456_000080 3300042013 Bacteria 33226
366 Ga0439456_000660 3300042013 Bacteria 7118
367 Ga0439456_003704 3300042013 Bacteria 3110
368 Ga0439456_010763 3300042013 Bacteria 1891
369 Ga0439456_034660 3300042013 Bacteria 1087
370 Ga0439463_000477 3300042016 Bacteria 11171
371 Ga0439463_002267 3300042016 Bacteria 4929
372 Ga0439463_036010 3300042016 Bacteria 1253
373 Ga0450911_000011 3300042115 Bacteria 130739
374 Ga0450911_001296 3300042115 Bacteria 5940
375 Ga0450911_002415 3300042115 Bacteria 3668
376 Ga0450911_008467 3300042115 Bacteria 1463
377 Ga0450911_010067 3300042115 Bacteria 1312
378 Ga0450919_001008 3300042121 Bacteria 3640
379 Ga0450919_001388 3300042121 Bacteria 3157
380 Ga0450920_000286 3300042122 Bacteria 7648
381 Ga0450922_000446 3300042124 Bacteria 4426
382 Ga0450922_005333 3300042124 Bacteria 1188
383 Ga0450923_000811 3300042125 Bacteria 3760
384 Ga0450890_001272 3300042127 Bacteria 3651
385 Ga0450900_008597 3300042136 Bacteria 1280
386 Ga0450902_009904 3300042137 Bacteria 1505
387 Ga0450903_001699 3300042138 Bacteria 4059
388 Ga0450903_002152 3300042138 Bacteria 3526
389 Ga0450903_002378 3300042138 Bacteria 3355
390 Ga0450904_000115 3300042139 Bacteria 17804
391 Ga0450904_002906 3300042139 Bacteria 1933
392 Ga0450905_001046 3300042142 Bacteria 3473
393 Ga0450905_001197 3300042142 Bacteria 3287
394 Ga0450905_007282 3300042142 Bacteria 1505
395 Ga0450906_000355 3300042145 Bacteria 9282
396 Ga0450906_000517 3300042145 Bacteria 8109
397 Ga0450906_004065 3300042145 Bacteria 3095
398 Ga0450907_000520 3300042146 Bacteria 10559
399 Ga0450907_000867 3300042146 Bacteria 7244
400 Ga0450907_013384 3300042146 Bacteria 1366
401 Ga0450910_000137 3300042147 Bacteria 7861
402 Ga0439446_0003992 3300042156 Bacteria 3712
403 Ga0439446_0007513 3300042156 Bacteria 2866
404 Ga0439446_0008716 3300042156 Bacteria 2700
405 Ga0450908_000962 3300042184 Bacteria 5546
406 Ga0450908_019263 3300042184 Bacteria 1202
407 Ga0450909_005573 3300042185 Bacteria 1810
408 Ga0450909_005824 3300042185 Bacteria 1776
409 Ga0439434_0001117 3300042435 Bacteria 7759
410 Ga0439464_0055417 3300042439 Bacteria 1153
411 Ga0439460_0000568 3300042461 Bacteria 8092
412 Ga0450916_000390 3300042530 Bacteria 3715
413 Ga0450918_001120 3300042531 Bacteria 5501
414 Ga0450901_000691 3300042533 Bacteria 3994
415 Ga0451577_0453479 3300042876 Bacteria 1165
416 Ga0439440_0001238 3300042993 Bacteria 4602
417 Ga0439440_0006091 3300042993 Bacteria 2417
418 Ga0439440_0023973 3300042993 Bacteria 1395
419 Ga0453684_0004105 3300044712 Bacteria 31580
420 Ga0453684_0004702 3300044712 Bacteria 28256
421 Ga0453684_0307229 3300044712 Unclassified 1801
422 Ga0453684_0648342 3300044712 Unclassified 1152
423 Ga0495617_002371 3300046452 Bacteria 7525
424 Ga0495617_005595 3300046452 Bacteria 4446
425 Ga0495617_006750 3300046452 Bacteria 4014
426 Ga0495617_007712 3300046452 Bacteria 3722
427 Ga0495617_010836 3300046452 Bacteria 3121
428 Ga0495627_002716 3300046453 Bacteria 8271
429 Ga0495627_005780 3300046453 Bacteria 4924
430 Ga0495627_007033 3300046453 Bacteria 4362
431 Ga0495627_010384 3300046453 Bacteria 3387
432 Ga0495627_012080 3300046453 Bacteria 3075
433 Ga0495627_025369 3300046453 Bacteria 1923
434 Ga0495603_0014110 3300046455 Bacteria 4833
435 Ga0495603_0031614 3300046455 Bacteria 3186
436 Ga0495603_0114008 3300046455 Bacteria 1576
437 Ga0495590_0001555 3300046457 Bacteria 9846
438 Ga0495590_0080202 3300046457 Bacteria 1149
439 Ga0495591_006081 3300046458 Bacteria 5424
440 Ga0495591_006163 3300046458 Bacteria 5367
441 Ga0495591_008415 3300046458 Bacteria 4226
442 Ga0495591_009117 3300046458 Bacteria 3973
443 Ga0495591_012038 3300046458 Bacteria 3241
444 Ga0495591_014389 3300046458 Bacteria 2847
445 Ga0495591_021636 3300046458 Bacteria 2094
446 Ga0495591_033354 3300046458 Bacteria 1524
447 Ga0495591_034441 3300046458 Bacteria 1490
448 Ga0495629_0036122 3300046459 Bacteria 3491
449 Ga0495638_0022813 3300046460 Bacteria 4104
450 Ga0495638_0023151 3300046460 Bacteria 4067
451 Ga0495638_0024593 3300046460 Bacteria 3925
452 Ga0495638_0026476 3300046460 Bacteria 3758
453 Ga0495638_0052159 3300046460 Bacteria 2548
454 Ga0495638_0060791 3300046460 Bacteria 2335
455 Ga0495638_0081819 3300046460 Bacteria 1959
456 Ga0495638_0090973 3300046460 Bacteria 1838
457 Ga0495638_0110025 3300046460 Bacteria 1637
458 Ga0495653_0033929 3300046463 Bacteria 4040
459 Ga0495653_0078624 3300046463 Bacteria 2445
460 Ga0495653_0151236 3300046463 Bacteria 1621
461 Ga0495650_0016462 3300046471 Bacteria 3744
462 Ga0495650_0018974 3300046471 Bacteria 3401
463 Ga0495650_0034626 3300046471 Bacteria 2232
464 Ga0495650_0040697 3300046471 Bacteria 1992
465 Ga0495650_0041796 3300046471 Bacteria 1957
466 Ga0495582_0012502 3300046473 Bacteria 4679
467 Ga0495605_0010405 3300046474 Bacteria 5204
468 Ga0495605_0010597 3300046474 Bacteria 5155
469 Ga0495605_0019206 3300046474 Bacteria 3656
470 Ga0495605_0019237 3300046474 Bacteria 3653
471 Ga0495605_0019680 3300046474 Bacteria 3601
472 Ga0495605_0104359 3300046474 Bacteria 1299
473 Ga0495639_0004422 3300046475 Bacteria 6026
474 Ga0495639_0011705 3300046475 Bacteria 3784
475 Ga0495584_0006922 3300046491 Bacteria 5925
476 Ga0495584_0006997 3300046491 Bacteria 5892
477 Ga0495584_0007121 3300046491 Bacteria 5843
478 Ga0495584_0007934 3300046491 Bacteria 5521
479 Ga0495584_0008019 3300046491 Bacteria 5489
480 Ga0495584_0008025 3300046491 Bacteria 5487
481 Ga0495584_0010834 3300046491 Bacteria 4679
482 Ga0495584_0017646 3300046491 Bacteria 3631
483 Ga0495584_0050636 3300046491 Bacteria 2091
484 Ga0495584_0076986 3300046491 Bacteria 1677
485 Ga0495585_0009311 3300046492 Bacteria 5899
486 Ga0495585_0014262 3300046492 Bacteria 4634
487 Ga0495585_0031938 3300046492 Bacteria 2985
488 Ga0495585_0089168 3300046492 Bacteria 1662
489 Ga0495585_0092639 3300046492 Bacteria 1626
490 Ga0495585_0099657 3300046492 Bacteria 1555
491 Ga0495585_0112100 3300046492 Bacteria 1449
492 Ga0495585_0202973 3300046492 Bacteria 1008
493 Ga0495594_0022996 3300046499 Bacteria 3338
494 Ga0495607_0007687 3300046501 Bacteria 7428
495 Ga0495607_0017405 3300046501 Bacteria 4614
496 Ga0495607_0023033 3300046501 Bacteria 3903
497 Ga0495607_0043277 3300046501 Bacteria 2663
498 Ga0495607_0063235 3300046501 Bacteria 2094
499 Ga0495607_0081937 3300046501 Bacteria 1772
500 Ga0495607_0082640 3300046501 Bacteria 1761
501 Ga0495607_0113879 3300046501 Bacteria 1430
502 Ga0495607_0114434 3300046501 Bacteria 1425
503 Ga0495607_0126075 3300046501 Bacteria 1338
504 Ga0495583_0007538 3300046506 Bacteria 6811
505 Ga0495583_0009278 3300046506 Bacteria 5894
506 Ga0495583_0027693 3300046506 Bacteria 2794
507 Ga0495583_0037330 3300046506 Bacteria 2303
508 Ga0495583_0050437 3300046506 Bacteria 1902
509 Ga0495606_0009824 3300046507 Bacteria 8036
510 Ga0495606_0015236 3300046507 Bacteria 5936
511 Ga0495606_0022442 3300046507 Bacteria 4598
512 Ga0495606_0031970 3300046507 Bacteria 3652
513 Ga0495606_0034591 3300046507 Bacteria 3467
514 Ga0495606_0080532 3300046507 Bacteria 2026
515 Ga0495606_0101185 3300046507 Bacteria 1754
516 Ga0495606_0141635 3300046507 Bacteria 1419
517 Ga0495606_0176015 3300046507 Bacteria 1237
518 Ga0495606_0190457 3300046507 Bacteria 1176
519 Ga0495610_0011258 3300046512 Bacteria 5482
520 Ga0495610_0019562 3300046512 Bacteria 3784
521 Ga0495610_0019797 3300046512 Bacteria 3753
522 Ga0495610_0020042 3300046512 Bacteria 3723
523 Ga0495610_0021799 3300046512 Bacteria 3516
524 Ga0495610_0023220 3300046512 Bacteria 3376
525 Ga0495610_0031649 3300046512 Bacteria 2757
526 Ga0495610_0038654 3300046512 Bacteria 2420
527 Ga0495610_0051483 3300046512 Bacteria 2003
528 Ga0495610_0055379 3300046512 Bacteria 1911
529 Ga0495610_0060909 3300046512 Bacteria 1795
530 Ga0495610_0088271 3300046512 Bacteria 1410
531 Ga0495616_0005952 3300046513 Bacteria 7439
532 Ga0495616_0030838 3300046513 Bacteria 2812
533 Ga0495616_0042648 3300046513 Bacteria 2308
534 Ga0495616_0106873 3300046513 Bacteria 1304
535 Ga0495616_0155799 3300046513 Bacteria 1030
536 Ga0495620_0000538 3300046515 Bacteria 24158
537 Ga0495620_0006866 3300046515 Bacteria 6221
538 Ga0495620_0017505 3300046515 Bacteria 3570
539 Ga0495620_0019311 3300046515 Bacteria 3354
540 Ga0495620_0024409 3300046515 Bacteria 2875
541 Ga0495620_0041188 3300046515 Bacteria 2027
542 Ga0495620_0048251 3300046515 Bacteria 1828
543 Ga0495620_0070235 3300046515 Bacteria 1435
544 Ga0495620_0091851 3300046515 Bacteria 1217
545 Ga0495630_0023231 3300046517 Bacteria 4583
546 Ga0495630_0136413 3300046517 Bacteria 1864
547 Ga0495631_0006682 3300046518 Bacteria 5928
548 Ga0495631_0010667 3300046518 Bacteria 4541
549 Ga0495631_0044748 3300046518 Bacteria 1950
550 Ga0495631_0087310 3300046518 Bacteria 1343
551 Ga0495631_0090360 3300046518 Bacteria 1318
552 Ga0495632_0006009 3300046519 Bacteria 7897
553 Ga0495632_0006308 3300046519 Bacteria 7652
554 Ga0495632_0007314 3300046519 Bacteria 6957
555 Ga0495632_0009750 3300046519 Bacteria 5757
556 Ga0495632_0010862 3300046519 Bacteria 5356
557 Ga0495632_0011087 3300046519 Bacteria 5281
558 Ga0495632_0013427 3300046519 Bacteria 4674
559 Ga0495632_0022427 3300046519 Bacteria 3384
560 Ga0495632_0028157 3300046519 Bacteria 2934
561 Ga0495632_0052886 3300046519 Bacteria 1995
562 Ga0495632_0059832 3300046519 Bacteria 1852
563 Ga0495632_0091159 3300046519 Bacteria 1445
564 Ga0495632_0132033 3300046519 Bacteria 1161
565 Ga0495632_0156963 3300046519 Bacteria 1049
566 Ga0495637_0004958 3300046520 Bacteria 6852
567 Ga0495637_0007048 3300046520 Bacteria 5598
568 Ga0495637_0011893 3300046520 Bacteria 4170
569 Ga0495637_0014187 3300046520 Bacteria 3762
570 Ga0495637_0022402 3300046520 Bacteria 2881
571 Ga0495637_0034274 3300046520 Bacteria 2224
572 Ga0495637_0035140 3300046520 Bacteria 2190
573 Ga0495637_0058271 3300046520 Bacteria 1592
574 Ga0495643_0000120 3300046522 Bacteria 126112
575 Ga0495643_0000763 3300046522 Bacteria 36080
576 Ga0495643_0008586 3300046522 Bacteria 6452
577 Ga0495643_0011962 3300046522 Bacteria 5253
578 Ga0495643_0029901 3300046522 Bacteria 3045
579 Ga0495643_0037993 3300046522 Bacteria 2638
580 Ga0495644_0008526 3300046523 Bacteria 3948
581 Ga0495644_0040264 3300046523 Bacteria 1761
582 Ga0495644_0061702 3300046523 Bacteria 1408
583 Ga0495644_0089361 3300046523 Bacteria 1162
584 Ga0495648_0002285 3300046524 Bacteria 17885
585 Ga0495648_0007380 3300046524 Bacteria 8803
586 Ga0495648_0008468 3300046524 Bacteria 8091
587 Ga0495648_0025115 3300046524 Bacteria 4039
588 Ga0495648_0026142 3300046524 Bacteria 3934
589 Ga0495648_0046488 3300046524 Bacteria 2690
590 Ga0495648_0061516 3300046524 Bacteria 2229
591 Ga0495648_0118584 3300046524 Bacteria 1426
592 Ga0495666_0015629 3300046526 Bacteria 3778
593 Ga0495666_0044785 3300046526 Bacteria 2135
594 Ga0495666_0048946 3300046526 Bacteria 2034
595 Ga0495642_0003701 3300046528 Bacteria 5997
596 Ga0495642_0003845 3300046528 Bacteria 5883
597 Ga0495642_0011725 3300046528 Bacteria 3374
598 Ga0495654_0005016 3300046530 Bacteria 7768
599 Ga0495654_0007275 3300046530 Bacteria 6200
600 Ga0495654_0008103 3300046530 Bacteria 5826
601 Ga0495654_0009176 3300046530 Bacteria 5423
602 Ga0495654_0009378 3300046530 Bacteria 5364
603 Ga0495654_0019319 3300046530 Bacteria 3564
604 Ga0495654_0019550 3300046530 Bacteria 3542
605 Ga0495654_0021353 3300046530 Bacteria 3368
606 Ga0495654_0021395 3300046530 Bacteria 3364
607 Ga0495654_0022453 3300046530 Bacteria 3276
608 Ga0495654_0034277 3300046530 Bacteria 2562
609 Ga0495654_0075665 3300046530 Bacteria 1588
610 Ga0495654_0080817 3300046530 Bacteria 1524
611 Ga0495654_0122997 3300046530 Bacteria 1172
612 Ga0495586_0019543 3300046535 Bacteria 3607
613 Ga0495587_0021921 3300046536 Bacteria 3938
614 Ga0495587_0023256 3300046536 Bacteria 3808
615 Ga0495609_0008828 3300046538 Bacteria 4905
616 Ga0495609_0037995 3300046538 Bacteria 2171
617 Ga0495609_0092532 3300046538 Bacteria 1314
618 Ga0495609_0100808 3300046538 Bacteria 1251
619 Ga0495597_0008646 3300046542 Bacteria 5091
620 Ga0495597_0011773 3300046542 Bacteria 4236
621 Ga0495597_0023713 3300046542 Bacteria 2837
622 Ga0495597_0031816 3300046542 Bacteria 2397
623 Ga0495597_0035492 3300046542 Bacteria 2249
624 Ga0495597_0040078 3300046542 Bacteria 2094
625 Ga0495597_0042867 3300046542 Bacteria 2016
626 Ga0495622_0005353 3300046557 Bacteria 5958
627 Ga0495622_0006837 3300046557 Bacteria 5294
628 Ga0495622_0010735 3300046557 Bacteria 4226
629 Ga0495622_0014230 3300046557 Bacteria 3695
630 Ga0495622_0019253 3300046557 Bacteria 3178
631 Ga0495633_0004409 3300046558 Bacteria 8961
632 Ga0495633_0029754 3300046558 Bacteria 2656
633 Ga0495668_0125017 3300046616 Bacteria 1407
634 Ga0495634_0038849 3300046642 Bacteria 3244
635 Ga0495611_0004728 3300046648 Bacteria 5848
636 Ga0495611_0171381 3300046648 Bacteria 1014
637 Ga0495625_0013708 3300046660 Bacteria 6498
638 Ga0495625_0016331 3300046660 Bacteria 5845
639 Ga0495625_0040956 3300046660 Bacteria 3374
640 Ga0495625_0053577 3300046660 Bacteria 2884
641 Ga0495625_0081536 3300046660 Bacteria 2251
642 Ga0495625_0095483 3300046660 Bacteria 2049
643 Ga0495625_0184089 3300046660 Bacteria 1387
644 Ga0495625_0274348 3300046660 Bacteria 1087
645 Ga0495635_0014354 3300046663 Bacteria 5541
646 Ga0495635_0019486 3300046663 Bacteria 4728
647 Ga0495659_0001791 3300046664 Bacteria 7127
648 Ga0495659_0016823 3300046664 Bacteria 2416
649 Ga0495659_0027937 3300046664 Bacteria 1949
650 Ga0495661_0006107 3300046665 Bacteria 8486
651 Ga0495661_0016928 3300046665 Bacteria 4817
652 Ga0495661_0035759 3300046665 Bacteria 3114
653 Ga0495661_0063253 3300046665 Bacteria 2188
654 Ga0495661_0068699 3300046665 Bacteria 2078
655 Ga0495661_0071228 3300046665 Bacteria 2032
656 Ga0495661_0136852 3300046665 Bacteria 1336
657 Ga0495588_0026696 3300046674 Bacteria 2884
658 Ga0495588_0097039 3300046674 Bacteria 1546
659 Ga0495657_0044627 3300046675 Bacteria 3014
660 Ga0495623_0010236 3300046679 Bacteria 6066
661 Ga0495623_0078007 3300046679 Bacteria 2054
662 Ga0495646_0031451 3300046680 Bacteria 3307
663 Ga0495646_0089516 3300046680 Bacteria 1781
664 Ga0495646_0126251 3300046680 Bacteria 1443
665 Ga0495669_0002201 3300046684 Bacteria 8004
666 Ga0495613_0093582 3300046689 Bacteria 2175
667 Ga0495613_0174622 3300046689 Bacteria 1524
668 Ga0495624_0013052 3300046690 Bacteria 5664
669 Ga0495670_0003539 3300046691 Bacteria 7669
670 Ga0495670_0004439 3300046691 Bacteria 6883
671 Ga0495670_0007472 3300046691 Bacteria 5368
672 Ga0495670_0017507 3300046691 Bacteria 3526
673 Ga0495670_0035427 3300046691 Bacteria 2488
674 Ga0495670_0035582 3300046691 Bacteria 2481
675 Ga0495671_0007515 3300046692 Bacteria 6205
676 Ga0495671_0008147 3300046692 Bacteria 5912
677 Ga0495671_0015135 3300046692 Bacteria 4140
678 Ga0495671_0016779 3300046692 Bacteria 3904
679 Ga0495671_0039934 3300046692 Bacteria 2367
680 Ga0495671_0044041 3300046692 Bacteria 2238
681 Ga0495671_0045845 3300046692 Bacteria 2188
682 Ga0495671_0070052 3300046692 Bacteria 1723
683 Ga0495649_0009532 3300046694 Bacteria 5761
684 Ga0495649_0010872 3300046694 Bacteria 5359
685 Ga0495649_0021128 3300046694 Bacteria 3649
686 Ga0495649_0022431 3300046694 Bacteria 3533
687 Ga0495649_0022787 3300046694 Bacteria 3502
688 Ga0495649_0044662 3300046694 Bacteria 2418
689 Ga0495649_0049537 3300046694 Bacteria 2282
690 Ga0495649_0050302 3300046694 Bacteria 2262
691 Ga0495649_0064685 3300046694 Bacteria 1963
692 Ga0495649_0093662 3300046694 Bacteria 1599
693 Ga0495649_0102563 3300046694 Bacteria 1519
694 Ga0495649_0164274 3300046694 Bacteria 1163
695 Ga0495589_0004591 3300046794 Bacteria 7344
696 Ga0495589_0015753 3300046794 Bacteria 3886
697 Ga0495589_0017724 3300046794 Bacteria 3654
698 Ga0495589_0019172 3300046794 Bacteria 3509
699 Ga0495589_0021058 3300046794 Bacteria 3332
700 Ga0495589_0023614 3300046794 Bacteria 3131
701 Ga0495589_0024014 3300046794 Bacteria 3100
702 Ga0495589_0054055 3300046794 Bacteria 1980
703 Ga0495589_0087850 3300046794 Bacteria 1509
704 Ga0495600_0138230 3300046809 Bacteria 1581
705 Ga0495660_0021050 3300046810 Bacteria 3736
706 Ga0495660_0024147 3300046810 Bacteria 3464
707 Ga0495660_0059586 3300046810 Bacteria 2052
708 Ga0495660_0072557 3300046810 Bacteria 1823
709 Ga0495660_0079391 3300046810 Bacteria 1723
710 Ga0495660_0101093 3300046810 Bacteria 1484
711 Ga0495660_0107168 3300046810 Bacteria 1430
712 Ga0495660_0108366 3300046810 Bacteria 1420
713 Ga0495660_0171786 3300046810 Bacteria 1055
714 Ga0495660_0171925 3300046810 Bacteria 1054
715 Ga0495581_0037857 3300047315 Bacteria 2791
716 Ga0495604_0023499 3300047317 Bacteria 4918
717 Ga0495604_0024919 3300047317 Bacteria 4770
718 Ga0495604_0047322 3300047317 Bacteria 3350
719 Ga0495636_0005514 3300047318 Bacteria 4966
720 Ga0495636_0139114 3300047318 Bacteria 1083
721 Ga0495674_0368676 3300047319 Bacteria 1163
722 Ga0495672_0009503 3300047320 Bacteria 7039
723 Ga0495672_0011796 3300047320 Bacteria 6139
724 Ga0495672_0013936 3300047320 Bacteria 5526
725 Ga0495672_0019645 3300047320 Bacteria 4453
726 Ga0495672_0020472 3300047320 Bacteria 4335
727 Ga0495672_0023885 3300047320 Bacteria 3949
728 Ga0495672_0024934 3300047320 Bacteria 3840
729 Ga0495672_0031871 3300047320 Bacteria 3286
730 Ga0495672_0039277 3300047320 Bacteria 2878
731 Ga0495672_0041460 3300047320 Bacteria 2783
732 Ga0495672_0049871 3300047320 Bacteria 2475
733 Ga0495672_0061973 3300047320 Bacteria 2154
734 Ga0495672_0062986 3300047320 Bacteria 2130
735 Ga0495672_0079955 3300047320 Bacteria 1824
736 Ga0495676_0044165 3300047321 Bacteria 3640
737 Ga0495676_0048783 3300047321 Bacteria 3410
738 Ga0495680_0022187 3300047322 Bacteria 5297
739 Ga0495680_0022986 3300047322 Bacteria 5189
740 Ga0495680_0101719 3300047322 Bacteria 2140
741 Ga0495680_0150918 3300047322 Bacteria 1694
742 Ga0495680_0198654 3300047322 Bacteria 1439
743 Ga0495683_0004276 3300047323 Bacteria 8140
744 Ga0495683_0007387 3300047323 Bacteria 5952
745 Ga0495683_0008977 3300047323 Bacteria 5334
746 Ga0495683_0022433 3300047323 Bacteria 3246
747 Ga0495683_0052923 3300047323 Bacteria 2025
748 Ga0495683_0095991 3300047323 Bacteria 1430
749 Ga0495687_009435 3300047443 Bacteria 5452
750 Ga0495687_013719 3300047443 Bacteria 4209
751 Ga0495687_027904 3300047443 Bacteria 2634
752 Ga0495675_0108420 3300047444 Bacteria 1734
753 Ga0495677_0016584 3300047445 Bacteria 2673
754 Ga0495679_012600 3300047446 Bacteria 3208
755 Ga0495679_021760 3300047446 Bacteria 2206
756 Ga0495679_027810 3300047446 Bacteria 1860
757 Ga0495679_036770 3300047446 Bacteria 1545
758 Ga0495679_043255 3300047446 Bacteria 1385
759 Ga0495679_044623 3300047446 Bacteria 1357
760 Ga0495673_0014003 3300047469 Bacteria 4186
761 Ga0495673_0014323 3300047469 Bacteria 4126
762 Ga0495673_0018172 3300047469 Bacteria 3552
763 Ga0495673_0019618 3300047469 Bacteria 3385
764 Ga0495673_0023534 3300047469 Bacteria 2994
765 Ga0495673_0028726 3300047469 Bacteria 2631
766 Ga0495673_0046606 3300047469 Bacteria 1920
767 Ga0495673_0065244 3300047469 Bacteria 1546
768 Ga0495673_0083791 3300047469 Bacteria 1315
769 Ga0495673_0104504 3300047469 Bacteria 1140
770 Ga0495681_0009856 3300047470 Bacteria 5842
771 Ga0495681_0011636 3300047470 Bacteria 5226
772 Ga0495681_0018997 3300047470 Bacteria 3767
773 Ga0495681_0019272 3300047470 Bacteria 3731
774 Ga0495681_0020409 3300047470 Bacteria 3596
775 Ga0495681_0021063 3300047470 Bacteria 3521
776 Ga0495681_0021784 3300047470 Bacteria 3444
777 Ga0495681_0023153 3300047470 Bacteria 3305
778 Ga0495681_0036879 3300047470 Bacteria 2413
779 Ga0495681_0070110 3300047470 Bacteria 1590
780 Ga0495681_0123485 3300047470 Bacteria 1108
781 Ga0495684_0038420 3300047471 Bacteria 3670
782 Ga0495686_0012681 3300047472 Bacteria 5890
783 Ga0495686_0024290 3300047472 Bacteria 3985
784 Ga0495686_0026888 3300047472 Bacteria 3762
785 Ga0495686_0081535 3300047472 Bacteria 1975
786 Ga0495593_0013908 3300047673 Bacteria 4584
787 Ga0495593_0034872 3300047673 Bacteria 2734
788 Ga0495593_0049834 3300047673 Bacteria 2220
789 Ga0495593_0238839 3300047673 Bacteria 910
790 Ga0495602_0057621 3300048088 Bacteria 3406
791 Ga0495626_0004732 3300048091 Bacteria 8236
792 Ga0495626_0005414 3300048091 Bacteria 7482
793 Ga0495626_0016287 3300048091 Bacteria 3779
794 Ga0495626_0026943 3300048091 Bacteria 2796
795 Ga0495626_0028535 3300048091 Bacteria 2704
796 Ga0495626_0045249 3300048091 Bacteria 2055
797 Ga0495626_0076767 3300048091 Bacteria 1491
798 Ga0496102_0020156 3300048905 Bacteria 5887
799 Ga0496103_0014360 3300048906 Bacteria 4704
800 Ga0496103_0202550 3300048906 Bacteria 1276
801 Ga0496105_0108314 3300048908 Bacteria 2294
802 Ga0496106_0089174 3300048909 Bacteria 2378
803 Ga0496110_0023141 3300048913 Bacteria 5284
804 Ga0496110_0406423 3300048913 Bacteria 1241
805 Ga0496111_0111697 3300048914 Bacteria 2013
806 Ga0496114_0061661 3300048917 Bacteria 3137
807 Ga0496114_0070475 3300048917 Bacteria 2936
808 Ga0496116_0001725 3300048919 Bacteria 23879
809 Ga0496116_0011675 3300048919 Bacteria 7240
810 Ga0496116_0018429 3300048919 Bacteria 5383
811 Ga0496116_0025706 3300048919 Bacteria 4323
812 Ga0496116_0028412 3300048919 Bacteria 4052
813 Ga0496116_0061418 3300048919 Bacteria 2433
814 Ga0496116_0171567 3300048919 Bacteria 1174
815 Ga0496117_0006500 3300048920 Bacteria 11789
816 Ga0496117_0007309 3300048920 Bacteria 10841
817 Ga0496117_0008713 3300048920 Bacteria 9585
818 Ga0496117_0009017 3300048920 Bacteria 9382
819 Ga0496117_0017029 3300048920 Bacteria 6088
820 Ga0496117_0018515 3300048920 Bacteria 5762
821 Ga0496117_0024973 3300048920 Bacteria 4707
822 Ga0496117_0030449 3300048920 Bacteria 4141
823 Ga0496117_0036558 3300048920 Bacteria 3672
824 Ga0496117_0037524 3300048920 Bacteria 3608
825 Ga0496117_0050656 3300048920 Bacteria 2943
826 Ga0496117_0067715 3300048920 Bacteria 2414
827 Ga0496117_0092587 3300048920 Bacteria 1941
828 Ga0496117_0092825 3300048920 Bacteria 1937
829 Ga0496117_0314349 3300048920 Bacteria 823
830 Ga0496118_0002317 3300048921 Bacteria 25853
831 Ga0496118_0012115 3300048921 Bacteria 8323
832 Ga0496118_0031832 3300048921 Bacteria 4362
833 Ga0496118_0033154 3300048921 Bacteria 4243
834 Ga0496118_0040995 3300048921 Bacteria 3672
835 Ga0496118_0042110 3300048921 Bacteria 3607
836 Ga0496118_0050786 3300048921 Bacteria 3178
837 Ga0496118_0069336 3300048921 Bacteria 2554
838 Ga0496118_0083779 3300048921 Bacteria 2227
839 Ga0496118_0113771 3300048921 Bacteria 1786
840 Ga0496119_0000506 3300048922 Bacteria 53174
841 Ga0496119_0021440 3300048922 Bacteria 4671
842 Ga0496119_0029940 3300048922 Bacteria 3679
843 Ga0496119_0080186 3300048922 Bacteria 1883
844 Ga0496120_0001362 3300048923 Bacteria 29974
845 Ga0496120_0015048 3300048923 Bacteria 5119
846 Ga0496120_0015699 3300048923 Bacteria 4982
847 Ga0496120_0029448 3300048923 Bacteria 3351
848 Ga0496121_0014652 3300048924 Bacteria 8290
849 Ga0496121_0022108 3300048924 Bacteria 6188
850 Ga0496121_0054583 3300048924 Bacteria 3336
851 Ga0496121_0076594 3300048924 Bacteria 2666
852 Ga0496121_0130328 3300048924 Bacteria 1883
853 Ga0496121_0139478 3300048924 Bacteria 1801
854 Ga0496121_0231312 3300048924 Bacteria 1294
855 Ga0496122_0007408 3300048925 Bacteria 12214
856 Ga0496122_0021592 3300048925 Bacteria 5756
857 Ga0496122_0049252 3300048925 Bacteria 3229
858 Ga0496122_0061538 3300048925 Bacteria 2755
859 Ga0496122_0076976 3300048925 Bacteria 2345
860 Ga0496122_0110047 3300048925 Bacteria 1811
861 Ga0496122_0152576 3300048925 Bacteria 1423
862 Ga0496122_0164831 3300048925 Bacteria 1345
863 Ga0496123_0005881 3300048926 Bacteria 12133
864 Ga0496123_0022349 3300048926 Bacteria 4877
865 Ga0496123_0024029 3300048926 Bacteria 4646
866 Ga0496123_0043661 3300048926 Bacteria 3075
867 Ga0496123_0053521 3300048926 Bacteria 2666
868 Ga0496123_0069220 3300048926 Bacteria 2217
869 Ga0496124_0007177 3300048927 Bacteria 11908
870 Ga0496124_0013682 3300048927 Bacteria 7905
871 Ga0496124_0035067 3300048927 Bacteria 4393
872 Ga0496124_0041751 3300048927 Bacteria 3955
873 Ga0496124_0053014 3300048927 Bacteria 3441
874 Ga0496124_0053428 3300048927 Bacteria 3424
875 Ga0496124_0053454 3300048927 Bacteria 3423
876 Ga0496124_0079617 3300048927 Bacteria 2697
877 Ga0496124_0086342 3300048927 Bacteria 2568
878 Ga0496124_0094804 3300048927 Bacteria 2426
879 Ga0496124_0140762 3300048927 Bacteria 1904
880 Ga0496124_0150082 3300048927 Bacteria 1829
881 Ga0496124_0202845 3300048927 Bacteria 1507
882 Ga0496125_0014065 3300048928 Bacteria 7821
883 Ga0496125_0015865 3300048928 Bacteria 7258
884 Ga0496125_0020727 3300048928 Bacteria 6162
885 Ga0496125_0026454 3300048928 Bacteria 5287
886 Ga0496125_0032010 3300048928 Bacteria 4677
887 Ga0496125_0040318 3300048928 Bacteria 4008
888 Ga0496125_0040690 3300048928 Bacteria 3983
889 Ga0496125_0049097 3300048928 Bacteria 3510
890 Ga0496125_0096023 3300048928 Bacteria 2202
891 Ga0496125_0159557 3300048928 Bacteria 1534
892 Ga0496125_0198684 3300048928 Bacteria 1315
893 Ga0496126_0056657 3300048929 Bacteria 3541
894 Ga0496126_0063156 3300048929 Bacteria 3320
895 Ga0496126_0074537 3300048929 Bacteria 3013
896 Ga0496126_0106470 3300048929 Bacteria 2447
897 Ga0496126_0115530 3300048929 Bacteria 2333
898 Ga0495678_005003 3300049459 Bacteria 7467
899 Ga0495678_006344 3300049459 Bacteria 6305
900 Ga0495678_007286 3300049459 Bacteria 5754
901 Ga0495678_007969 3300049459 Bacteria 5417
902 Ga0495678_015351 3300049459 Bacteria 3527
903 Ga0495678_025182 3300049459 Bacteria 2559
904 Ga0495678_040233 3300049459 Bacteria 1880
905 Ga0495678_051651 3300049459 Bacteria 1587
906 Ga0495678_072721 3300049459 Bacteria 1255
907 Ga0495682_0001713 3300049460 Bacteria 11116
908 Ga0495682_0011732 3300049460 Bacteria 3367
909 Ga0495682_0015052 3300049460 Bacteria 2931
910 Ga0495682_0019726 3300049460 Bacteria 2533
911 Ga0495682_0073658 3300049460 Bacteria 1228
912 Ga0501032_0001964 3300049569 Bacteria 16181
913 Ga0501034_0000136 3300049571 Bacteria 136835
914 Ga0501038_0023398 3300049574 Bacteria 5523
915 Ga0501039_0123006 3300049575 Bacteria 2034
916 Ga0501241_002825 3300049758 Bacteria 3335
917 Ga0501035_0058574 3300049822 Bacteria 3432
918 Ga0501226_000060 3300049853 Bacteria 36795
919 nmdc:mga03683_46565_c1 3300050489 Bacteria 1798
920 nmdc:mga00v17_87723_c1 3300050491 Bacteria 1950
921 nmdc:mga08y16_28_c1 3300050511 Bacteria 201429
922 nmdc:mga08x19_104733_c1 3300050514 Bacteria 1880
923 Ga0500572_008110 3300053111 Bacteria 2447
924 Ga0500595_008482 3300053119 Bacteria 4193
925 Ga0500659_0003173 3300053135 Bacteria 9728
926 Ga0500634_0026777 3300053161 Bacteria 3141

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0314349 Ga0496117_0314349_73_813 232
2 3300046530 Ga0495654_0075665 Ga0495654_0075665_380_1120 246
3 iso_pu_bacteria 2554235231 2555246463 249
4 3300047673 Ga0495593_0238839 Ga0495593_0238839_112_894 260
5 3300042138 Ga0450903_002378 Ga0450903_002378_1162_2085 262
6 3300046460 Ga0495638_0081819 Ga0495638_0081819_939_1862 262
7 3300046452 Ga0495617_002371 Ga0495617_002371_4179_5078 264
8 3300046471 Ga0495650_0016462 Ga0495650_0016462_436_1335 264
9 3300046501 Ga0495607_0007687 Ga0495607_0007687_2387_3286 264
10 3300047318 Ga0495636_0005514 Ga0495636_0005514_1619_2518 264
11 3300047320 Ga0495672_0019645 Ga0495672_0019645_1908_2807 264
12 3300046660 Ga0495625_0040956 Ga0495625_0040956_595_1572 267
13 3300048091 Ga0495626_0076767 Ga0495626_0076767_540_1439 267
14 3300041405 Ga0439438_012118 Ga0439438_012118_1134_2033 268
15 3300021361 Ga0213872_10000383 Ga0213872_1000038325 269
16 3300021361 Ga0213872_10010717 Ga0213872_100107176 269
17 3300039447 Ga0436361_0009597 Ga0436361_0009597_25708_26565 269
18 3300039447 Ga0436361_0772260 Ga0436361_0772260_21589_22446 269
19 3300021361 Ga0213872_10014578 Ga0213872_100145785 271
20 3300039447 Ga0436361_0299334 Ga0436361_0299334_346_1215 271
21 3300039447 Ga0436361_0723713 Ga0436361_0723713_2567_3436 271
22 3300042006 Ga0439432_012126 Ga0439432_012126_1171_2010 271
23 3300046491 Ga0495584_0007121 Ga0495584_0007121_2411_3310 273
24 3300046518 Ga0495631_0044748 Ga0495631_0044748_680_1501 273
25 3300046692 Ga0495671_0008147 Ga0495671_0008147_2411_3310 273
26 3300048091 Ga0495626_0045249 Ga0495626_0045249_213_1112 273
27 3300003320 rootH2_10020520 rootH2_1002052030 278
28 3300005354 Ga0070675_100355856 Ga0070675_1003558561 278
29 3300031548 Ga0307408_100000014 Ga0307408_100000014305 278
30 3300031903 Ga0307407_10000093 Ga0307407_1000009316 278
31 3300032002 Ga0307416_100174387 Ga0307416_1001743871 278
32 3300032005 Ga0307411_10031149 Ga0307411_100311493 278
33 3300046542 Ga0495597_0035492 Ga0495597_0035492_11_907 278
34 3300046471 Ga0495650_0041796 Ga0495650_0041796_496_1395 279
35 3300046519 Ga0495632_0028157 Ga0495632_0028157_1475_2374 279
36 3300046542 Ga0495597_0031816 Ga0495597_0031816_1113_2012 279
37 3300046810 Ga0495660_0171925 Ga0495660_0171925_110_1009 279
38 3300048091 Ga0495626_0004732 Ga0495626_0004732_4976_5875 279
39 3300009094 Ga0111539_10000054 Ga0111539_100000546 280
40 3300050511 nmdc:mga08y16_28_c1 nmdc:mga08y16_28_c1_192459_193337 280
41 3300047469 Ga0495673_0014323 Ga0495673_0014323_2343_3242 281
42 3300041408 Ga0439453_0001129 Ga0439453_0001129_494_1426 282
43 3300044712 Ga0453684_0004105 Ga0453684_0004105_28187_29053 282
44 3300044712 Ga0453684_0307229 Ga0453684_0307229_924_1790 282
45 3300044712 Ga0453684_0648342 Ga0453684_0648342_208_1074 282
46 3300027614 Ga0209970_1003071 Ga0209970_10030712 284
47 3300041997 Ga0439431_0005396 Ga0439431_0005396_1564_2463 284
48 3300042000 Ga0439437_000861 Ga0439437_000861_2197_3096 284
49 3300042115 Ga0450911_000011 Ga0450911_000011_13413_14312 284
50 3300042139 Ga0450904_000115 Ga0450904_000115_10482_11381 284
51 3300042156 Ga0439446_0008716 Ga0439446_0008716_382_1281 284
52 3300042439 Ga0439464_0055417 Ga0439464_0055417_128_1027 284
53 3300003781 Ga0055536_1010847 Ga0055536_10108474 285
54 3300003791 Ga0055530_10013792 Ga0055530_100137922 285
55 3300003792 Ga0055540_1007709 Ga0055540_10077095 285
56 3300006177 Ga0075362_10054894 Ga0075362_100548942 285
57 3300009036 Ga0105244_10089195 Ga0105244_100891952 285
58 3300009148 Ga0105243_10006305 Ga0105243_100063058 285
59 3300011119 Ga0105246_10032290 Ga0105246_100322904 285
60 3300025292 Ga0209676_1000015 Ga0209676_1000015213 285
61 3300025298 Ga0209050_1000030 Ga0209050_1000030225 285
62 3300025303 Ga0209051_1000012 Ga0209051_1000012466 285
63 3300025304 Ga0209257_1000143 Ga0209257_1000143131 285
64 3300025728 Ga0207655_1000116 Ga0207655_100011671 285
65 3300025735 Ga0207713_1004151 Ga0207713_10041513 285
66 3300025935 Ga0207709_10000061 Ga0207709_1000006177 285
67 3300044712 Ga0453684_0004702 Ga0453684_0004702_23770_24672 285
68 3300046522 Ga0495643_0000120 Ga0495643_0000120_31399_32301 285
69 3300048927 Ga0496124_0053454 Ga0496124_0053454_1336_2232 285
70 3300049574 Ga0501038_0023398 Ga0501038_0023398_319_1224 286
71 3300003323 rootH1_10191543 rootH1_101915432 287
72 3300003791 Ga0055530_10015687 Ga0055530_100156874 287
73 3300025292 Ga0209676_1008322 Ga0209676_10083223 287
74 3300025298 Ga0209050_1007643 Ga0209050_10076433 287
75 3300025303 Ga0209051_1011562 Ga0209051_10115624 287
76 3300025735 Ga0207713_1005979 Ga0207713_10059797 287
77 3300042876 Ga0451577_0453479 Ga0451577_0453479_206_1114 287
78 3300049569 Ga0501032_0001964 Ga0501032_0001964_9540_10448 287
79 3300049575 Ga0501039_0123006 Ga0501039_0123006_595_1503 287
80 3300049822 Ga0501035_0058574 Ga0501035_0058574_1947_2855 287
81 3300042013 Ga0439456_003704 Ga0439456_003704_1301_2200 289
82 3300042138 Ga0450903_001699 Ga0450903_001699_2151_3050 289
83 3300046452 Ga0495617_006750 Ga0495617_006750_2935_3834 289
84 3300046458 Ga0495591_021636 Ga0495591_021636_333_1232 289
85 3300046463 Ga0495653_0033929 Ga0495653_0033929_570_1469 289
86 3300046519 Ga0495632_0156963 Ga0495632_0156963_96_995 289
87 3300046542 Ga0495597_0008646 Ga0495597_0008646_2049_2948 289
88 3300046660 Ga0495625_0095483 Ga0495625_0095483_1066_1965 289
89 3300046690 Ga0495624_0013052 Ga0495624_0013052_2567_3466 289
90 3300046691 Ga0495670_0007472 Ga0495670_0007472_2398_3297 289
91 3300046809 Ga0495600_0138230 Ga0495600_0138230_523_1422 289
92 3300047320 Ga0495672_0023885 Ga0495672_0023885_2480_3379 289
93 3300047323 Ga0495683_0022433 Ga0495683_0022433_2104_3003 289
94 3300047470 Ga0495681_0011636 Ga0495681_0011636_2008_2907 289
95 3300048088 Ga0495602_0057621 Ga0495602_0057621_1940_2839 289
96 3300050514 nmdc:mga08x19_104733_c1 nmdc:mga08x19_104733_c1_179_1078 289
97 3300005455 Ga0070663_100300775 Ga0070663_1003007751 291
98 3300013307 Ga0157372_10028128 Ga0157372_100281284 291
99 3300042137 Ga0450902_009904 Ga0450902_009904_537_1412 291
100 3300046518 Ga0495631_0090360 Ga0495631_0090360_427_1302 291
101 3300046692 Ga0495671_0039934 Ga0495671_0039934_1472_2347 291
102 3300047469 Ga0495673_0083791 Ga0495673_0083791_427_1302 291
103 3300048923 Ga0496120_0029448 Ga0496120_0029448_1877_2776 291
104 3300048924 Ga0496121_0076594 Ga0496121_0076594_849_1748 291
105 3300048925 Ga0496122_0152576 Ga0496122_0152576_420_1319 291
106 3300049459 Ga0495678_072721 Ga0495678_072721_338_1237 291
107 3300046680 Ga0495646_0089516 Ga0495646_0089516_726_1625 292
108 3300046689 Ga0495613_0174622 Ga0495613_0174622_178_1077 292
109 3300047321 Ga0495676_0048783 Ga0495676_0048783_1784_2683 292
110 3300047322 Ga0495680_0101719 Ga0495680_0101719_1085_1984 292
111 iso_pu_bacteria 2600255389 2602008139 293
112 iso_pu_bacteria 2823421272 2823426013 293
113 iso_pu_bacteria 2926063275 2926064432 293
114 3300027395 Ga0209996_1002843 Ga0209996_10028433 294
115 3300027552 Ga0209982_1004294 Ga0209982_10042942 294
116 3300032004 Ga0307414_10086135 Ga0307414_100861351 294
117 iso_pu_bacteria 2511231024 2511376587 294
118 iso_pu_bacteria 2728369097 2729146799 294
119 iso_pu_bacteria 2765235841 2765586733 294
120 iso_pu_bacteria 2806310737 2807410927 294
121 iso_pu_bacteria 2806310745 2807459268 294
122 iso_pu_bacteria 2808606373 2808906100 294
123 iso_pu_bacteria 2912963787 2912969051 294
124 iso_pu_bacteria 2919155634 2919156042 294
125 iso_pu_bacteria 2939651529 2939654311 294
126 iso_pu_bacteria 3007803356 3007805912 294
127 iso_pu_bacteria 3007872151 3007873170 294
128 iso_pu_bacteria 8052494512 8052494691 294
129 iso_pu_bacteria 8054929484 8054929737 294
130 iso_pu_bacteria 8055878733 8055881725 294
131 iso_pu_bacteria 8056115690 8056116389 294
132 iso_pu_bacteria 8056120720 8056125842 294
133 iso_pu_bacteria 8056137416 8056142961 294
134 3300053119 Ga0500595_008482 Ga0500595_008482_1940_2854 295
135 iso_pu_bacteria 2511231004 2511253526 295
136 iso_pu_bacteria 2511231006 2511266974 295
137 iso_pu_bacteria 2511231007 2511269897 295
138 iso_pu_bacteria 2511231008 2511275280 295
139 iso_pu_bacteria 2511231010 2511289815 295
140 iso_pu_bacteria 2511231011 2511294317 295
141 iso_pu_bacteria 2511231012 2511300110 295
142 iso_pu_bacteria 2511231014 2511317025 295
143 iso_pu_bacteria 2511231015 2511318622 295
144 iso_pu_bacteria 2511231016 2511325131 295
145 iso_pu_bacteria 2511231017 2511332125 295
146 iso_pu_bacteria 2511231018 2511339227 295
147 iso_pu_bacteria 2511231019 2511343212 295
148 iso_pu_bacteria 2511231020 2511347899 295
149 iso_pu_bacteria 2511231021 2511359069 295
150 iso_pu_bacteria 2511231022 2511364314 295
151 iso_pu_bacteria 2511231023 2511367430 295
152 iso_pu_bacteria 2511231031 2511416436 295
153 iso_pu_bacteria 2511231156 2511822087 295
154 iso_pu_bacteria 2512047018 2512326486 295
155 iso_pu_bacteria 2554235341 2555673027 295
156 iso_pu_bacteria 2582580891 2583795535 295
157 iso_pu_bacteria 2597489887 2597861082 295
158 iso_pu_bacteria 2597489888 2597866816 295
159 iso_pu_bacteria 2597489889 2597872674 295
160 iso_pu_bacteria 2599185160 2599355768 295
161 iso_pu_bacteria 2599185161 2599362830 295
162 iso_pu_bacteria 2599185162 2599368864 295
163 iso_pu_bacteria 2599185163 2599375939 295
164 iso_pu_bacteria 2599185164 2599380874 295
165 iso_pu_bacteria 2599185165 2599387610 295
166 iso_pu_bacteria 2599185166 2599394797 295
167 iso_pu_bacteria 2599185167 2599400981 295
168 iso_pu_bacteria 2599185168 2599406562 295
169 iso_pu_bacteria 2599185179 2599449674 295
170 iso_pu_bacteria 2599185181 2599462602 295
171 iso_pu_bacteria 2599185182 2599467976 295
172 iso_pu_bacteria 2599185185 2599487205 295
173 iso_pu_bacteria 2599185186 2599491619 295
174 iso_pu_bacteria 2599185188 2599503660 295
175 iso_pu_bacteria 2599185189 2599505933 295
176 iso_pu_bacteria 2599185190 2599511746 295
177 iso_pu_bacteria 2599185191 2599516732 295
178 iso_pu_bacteria 2599185212 2599616118 295
179 iso_pu_bacteria 2599185248 2599767727 295
180 iso_pu_bacteria 2599185257 2599804469 295
181 iso_pu_bacteria 2599185288 2599879222 295
182 iso_pu_bacteria 2599185289 2599887959 295
183 iso_pu_bacteria 2599185290 2599893249 295
184 iso_pu_bacteria 2599185291 2599899350 295
185 iso_pu_bacteria 2599185300 2599933089 295
186 iso_pu_bacteria 2599185302 2599942161 295
187 iso_pu_bacteria 2599185303 2599948830 295
188 iso_pu_bacteria 2599185304 2599955141 295
189 iso_pu_bacteria 2599185305 2599963680 295
190 iso_pu_bacteria 2599185306 2599968741 295
191 iso_pu_bacteria 2599185308 2599979884 295
192 iso_pu_bacteria 2599185309 2599984467 295
193 iso_pu_bacteria 2599185310 2599990746 295
194 iso_pu_bacteria 2599185311 2599997258 295
195 iso_pu_bacteria 2599185312 2600000669 295
196 iso_pu_bacteria 2599185313 2600007412 295
197 iso_pu_bacteria 2599185314 2600013709 295
198 iso_pu_bacteria 2599185315 2600021301 295
199 iso_pu_bacteria 2599185316 2600026777 295
200 iso_pu_bacteria 2599185318 2600038591 295
201 iso_pu_bacteria 2599185319 2600043992 295
202 iso_pu_bacteria 2599185320 2600049736 295
203 iso_pu_bacteria 2599185321 2600056373 295
204 iso_pu_bacteria 2599185322 2600062438 295
205 iso_pu_bacteria 2599185323 2600065246 295
206 iso_pu_bacteria 2599185324 2600074324 295
207 iso_pu_bacteria 2599185325 2600080452 295
208 iso_pu_bacteria 2599185356 2600215226 295
209 iso_pu_bacteria 2600254930 2600361620 295
210 iso_pu_bacteria 2600254931 2600363355 295
211 iso_pu_bacteria 2600255296 2601693178 295
212 iso_pu_bacteria 2600255313 2601775392 295
213 iso_pu_bacteria 2600255318 2601798349 295
214 iso_pu_bacteria 2603880185 2606077243 295
215 iso_pu_bacteria 2603880199 2606129511 295
216 iso_pu_bacteria 2619619299 2621296658 295
217 iso_pu_bacteria 2623620443 2624483617 295
218 iso_pu_bacteria 2623620446 2624495195 295
219 iso_pu_bacteria 2643221565 2643843297 295
220 iso_pu_bacteria 2643221571 2643873401 295
221 iso_pu_bacteria 2643221589 2643956146 295
222 iso_pu_bacteria 2643221602 2644020268 295
223 iso_pu_bacteria 2643221633 2644184280 295
224 iso_pu_bacteria 2643221650 2644282800 295
225 iso_pu_bacteria 2643221713 2644621233 295
226 iso_pu_bacteria 2651869719 2652546310 295
227 iso_pu_bacteria 2667528170 2671091854 295
228 iso_pu_bacteria 2667528171 2671099471 295
229 iso_pu_bacteria 2667528176 2671129563 295
230 iso_pu_bacteria 2671180172 2671771477 295
231 iso_pu_bacteria 2675903420 2677900564 295
232 iso_pu_bacteria 2675903515 2678266567 295
233 iso_pu_bacteria 2713897148 2715749628 295
234 iso_pu_bacteria 2713897149 2715754638 295
235 iso_pu_bacteria 2718217725 2718636814 295
236 iso_pu_bacteria 2721755607 2723251547 295
237 iso_pu_bacteria 2738541265 2738673593 295
238 iso_pu_bacteria 2738541282 2738751986 295
239 iso_pu_bacteria 2738541294 2738807440 295
240 iso_pu_bacteria 2738541303 2738861027 295
241 iso_pu_bacteria 2738541309 2738894800 295
242 iso_pu_bacteria 2738543004 2739201064 295
243 iso_pu_bacteria 2738543015 2739260573 295
244 iso_pu_bacteria 2738543025 2739312295 295
245 iso_pu_bacteria 2740892503 2743740621 295
246 iso_pu_bacteria 2744054620 2745007797 295
247 iso_pu_bacteria 2773857670 2774118150 295
248 iso_pu_bacteria 2773857673 2774136391 295
249 iso_pu_bacteria 2784132063 2784261614 295
250 iso_pu_bacteria 2784132072 2784316918 295
251 iso_pu_bacteria 2791355520 2794598970 295
252 iso_pu_bacteria 2808606361 2808856662 295
253 iso_pu_bacteria 2808606376 2808925805 295
254 iso_pu_bacteria 2808606377 2808928242 295
255 iso_pu_bacteria 2808606378 2808936628 295
256 iso_pu_bacteria 2808606380 2808947954 295
257 iso_pu_bacteria 2808606381 2808950576 295
258 iso_pu_bacteria 2808606382 2808961433 295
259 iso_pu_bacteria 2808606383 2808965079 295
260 iso_pu_bacteria 2808606385 2808976343 295
261 iso_pu_bacteria 2808606388 2808994197 295
262 iso_pu_bacteria 2808606389 2808999971 295
263 iso_pu_bacteria 2808606445 2809217427 295
264 iso_pu_bacteria 2816332298 2817494229 295
265 iso_pu_bacteria 2818991456 2819655335 295
266 iso_pu_bacteria 2818991464 2819704617 295
267 iso_pu_bacteria 2825651385 2825654643 295
268 iso_pu_bacteria 2834028612 2834031136 295
269 iso_pu_bacteria 2842826826 2842828586 295
270 iso_pu_bacteria 2842832357 2842833662 295
271 iso_pu_bacteria 2842837860 2842838080 295
272 iso_pu_bacteria 2842843487 2842845894 295
273 iso_pu_bacteria 2842854478 2842855821 295
274 iso_pu_bacteria 2844665904 2844667295 295
275 iso_pu_bacteria 2852612431 2852616538 295
276 iso_pu_bacteria 2852657418 2852660015 295
277 iso_pu_bacteria 2852667396 2852671506 295
278 iso_pu_bacteria 2860339153 2860341919 295
279 iso_pu_bacteria 2860867994 2860873209 295
280 iso_pu_bacteria 2878029506 2878029621 295
281 iso_pu_bacteria 2880230671 2880236201 295
282 iso_pu_bacteria 2904518522 2904518751 295
283 iso_pu_bacteria 2904550169 2904553513 295
284 iso_pu_bacteria 2908446538 2908452806 295
285 iso_pu_bacteria 2913036834 2913042748 295
286 iso_pu_bacteria 2917070673 2917076926 295
287 iso_pu_bacteria 2919063839 2919065305 295
288 iso_pu_bacteria 2919385768 2919388989 295
289 iso_pu_bacteria 2919456309 2919457778 295
290 iso_pu_bacteria 2919481497 2919487166 295
291 iso_pu_bacteria 2919487758 2919487918 295
292 iso_pu_bacteria 2919697872 2919702528 295
293 iso_pu_bacteria 2923153595 2923159717 295
294 iso_pu_bacteria 2923586266 2923589423 295
295 iso_pu_bacteria 2929144301 2929144431 295
296 iso_pu_bacteria 2929189879 2929195336 295
297 iso_pu_bacteria 2931369376 2931372222 295
298 iso_pu_bacteria 2931390751 2931390850 295
299 iso_pu_bacteria 2931396565 2931398316 295
300 iso_pu_bacteria 2935353572 2935358107 295
301 iso_pu_bacteria 2939636861 2939640638 295
302 iso_pu_bacteria 2945928738 2945930727 295
303 iso_pu_bacteria 2945961074 2945967056 295
304 iso_pu_bacteria 2946006987 2946013072 295
305 iso_pu_bacteria 2946027586 2946028086 295
306 iso_pu_bacteria 2947233263 2947234615 295
307 iso_pu_bacteria 2969304461 2969310421 295
308 iso_pu_bacteria 2974289157 2974293878 295
309 iso_pu_bacteria 2984286254 2984286400 295
310 iso_pu_bacteria 2988728565 2988731679 295
311 iso_pu_bacteria 2998139840 2998139951 295
312 iso_pu_bacteria 3007395558 3007399202 295
313 iso_pu_bacteria 3007419365 3007419473 295
314 iso_pu_bacteria 3007511990 3007517377 295
315 iso_pu_bacteria 3007614139 3007615813 295
316 iso_pu_bacteria 3007619802 3007622662 295
317 iso_pu_bacteria 3007718800 3007723075 295
318 iso_pu_bacteria 3007855910 3007859397 295
319 iso_pu_bacteria 3007861166 3007864894 295
320 iso_pu_bacteria 8015687852 8015693810 295
321 iso_pu_bacteria 8019769354 8019769581 295
322 iso_pu_bacteria 8019775933 8019779750 295
323 iso_pu_bacteria 8029995093 8029995302 295
324 iso_pu_bacteria 8054285046 8054287149 295
325 iso_pu_bacteria 8054347763 8054349402 295
326 iso_pu_bacteria 8054503363 8054503457 295
327 iso_pu_bacteria 8055770955 8055777072 295
328 iso_pu_bacteria 8055817908 8055824093 295
329 iso_pu_bacteria 8056125926 8056125987 295
330 iso_pu_bacteria 8056131705 8056131796 295
331 iso_pu_bacteria 8056148874 8056151309 295
332 iso_pu_bacteria 8056155041 8056159949 295
333 iso_pu_bacteria 8056161164 8056163813 295
334 iso_pu_bacteria 8056166840 8056171100 295
335 iso_pu_bacteria 8056172158 8056177222 295
336 iso_pu_bacteria 8056177738 8056182311 295
337 iso_pu_bacteria 8056569372 8056570673 295
338 iso_pu_bacteria 8057798959 8057802134 295
339 3300031548 Ga0307408_100000002 Ga0307408_100000002674 296
340 3300046512 Ga0495610_0060909 Ga0495610_0060909_808_1701 297
341 2162886007 SwRhRL2b_contig_2143161 SwRhRL2b_0105.00000890 298
342 3300003856 Ga0058692_1002657 Ga0058692_10026574 298
343 3300005289 Ga0065704_10096819 Ga0065704_100968193 298
344 3300005289 Ga0065704_10139376 Ga0065704_101393761 298
345 3300005347 Ga0070668_100342115 Ga0070668_1003421151 298
346 3300006944 Ga0099823_1033941 Ga0099823_10339412 298
347 3300009011 Ga0105251_10008371 Ga0105251_100083715 298
348 3300009036 Ga0105244_10019248 Ga0105244_100192483 298
349 3300009036 Ga0105244_10019839 Ga0105244_100198392 298
350 3300009036 Ga0105244_10034337 Ga0105244_100343373 298
351 3300009036 Ga0105244_10040258 Ga0105244_100402583 298
352 3300009092 Ga0105250_10033111 Ga0105250_100331112 298
353 3300009148 Ga0105243_10013630 Ga0105243_100136304 298
354 3300009148 Ga0105243_10023427 Ga0105243_100234274 298
355 3300009148 Ga0105243_10096892 Ga0105243_100968922 298
356 3300013104 Ga0157370_10106867 Ga0157370_101068674 298
357 3300013307 Ga0157372_10003284 Ga0157372_100032849 298
358 3300025292 Ga0209676_1004422 Ga0209676_10044224 298
359 3300025711 Ga0207696_1000055 Ga0207696_100005554 298
360 3300025711 Ga0207696_1009608 Ga0207696_10096082 298
361 3300025728 Ga0207655_1000541 Ga0207655_10005417 298
362 3300025728 Ga0207655_1006294 Ga0207655_10062947 298
363 3300025728 Ga0207655_1010039 Ga0207655_10100394 298
364 3300025728 Ga0207655_1017720 Ga0207655_10177203 298
365 3300025735 Ga0207713_1010169 Ga0207713_10101694 298
366 3300025735 Ga0207713_1025127 Ga0207713_10251273 298
367 3300025735 Ga0207713_1045320 Ga0207713_10453203 298
368 3300025935 Ga0207709_10005565 Ga0207709_100055654 298
369 3300025935 Ga0207709_10011028 Ga0207709_100110282 298
370 3300027296 Ga0209389_1000036 Ga0209389_100003650 298
371 3300027312 Ga0209371_1000632 Ga0209371_10006327 298
372 3300030500 Ga0268256_1000247 Ga0268256_10002477 298
373 3300041405 Ga0439438_034184 Ga0439438_034184_296_1192 298
374 3300042006 Ga0439432_001455 Ga0439432_001455_2876_3772 298
375 3300042013 Ga0439456_000080 Ga0439456_000080_26042_26938 298
376 3300042136 Ga0450900_008597 Ga0450900_008597_365_1261 298
377 3300042142 Ga0450905_001046 Ga0450905_001046_93_989 298
378 3300042142 Ga0450905_001197 Ga0450905_001197_1197_2093 298
379 3300042530 Ga0450916_000390 Ga0450916_000390_1991_2890 298
380 3300046515 Ga0495620_0000538 Ga0495620_0000538_16159_17055 298
381 3300046519 Ga0495632_0006009 Ga0495632_0006009_2257_3153 298
382 3300046522 Ga0495643_0000763 Ga0495643_0000763_30426_31322 298
383 3300046522 Ga0495643_0008586 Ga0495643_0008586_2628_3524 298
384 3300046524 Ga0495648_0002285 Ga0495648_0002285_861_1757 298
385 3300048913 Ga0496110_0406423 Ga0496110_0406423_95_991 298
386 3300048917 Ga0496114_0061661 Ga0496114_0061661_2163_3059 298
387 3300048917 Ga0496114_0070475 Ga0496114_0070475_835_1731 298
388 3300048920 Ga0496117_0007309 Ga0496117_0007309_2524_3420 298
389 3300048920 Ga0496117_0008713 Ga0496117_0008713_2613_3509 298
390 3300048920 Ga0496117_0009017 Ga0496117_0009017_2226_3122 298
391 3300048921 Ga0496118_0002317 Ga0496118_0002317_95_991 298
392 3300048921 Ga0496118_0012115 Ga0496118_0012115_7361_8257 298
393 3300048922 Ga0496119_0000506 Ga0496119_0000506_42551_43456 298
394 3300048922 Ga0496119_0080186 Ga0496119_0080186_925_1821 298
395 3300048923 Ga0496120_0001362 Ga0496120_0001362_4700_5605 298
396 3300048924 Ga0496121_0139478 Ga0496121_0139478_77_973 298
397 3300048925 Ga0496122_0007408 Ga0496122_0007408_7625_8521 298
398 3300048926 Ga0496123_0005881 Ga0496123_0005881_3921_4817 298
399 3300048926 Ga0496123_0053521 Ga0496123_0053521_598_1494 298
400 3300048927 Ga0496124_0007177 Ga0496124_0007177_2631_3527 298
401 3300048927 Ga0496124_0035067 Ga0496124_0035067_2345_3244 298
402 3300048927 Ga0496124_0041751 Ga0496124_0041751_2396_3292 298
403 3300048927 Ga0496124_0053428 Ga0496124_0053428_59_955 298
404 3300048927 Ga0496124_0140762 Ga0496124_0140762_47_943 298
405 3300048928 Ga0496125_0014065 Ga0496125_0014065_4252_5148 298
406 3300048928 Ga0496125_0020727 Ga0496125_0020727_1495_2391 298
407 3300048928 Ga0496125_0198684 Ga0496125_0198684_135_1031 298
408 3300048929 Ga0496126_0106470 Ga0496126_0106470_96_992 298
409 3300049571 Ga0501034_0000136 Ga0501034_0000136_94959_95855 298
410 3300049853 Ga0501226_000060 Ga0501226_000060_17451_18350 298
411 3300053135 Ga0500659_0003173 Ga0500659_0003173_93_989 298
412 2124908027 MRS2a_Contig_41 MRS2a_00299900 299
413 2124908027 MRS2a_Contig_973 MRS2a_00809160 299
414 3300002737 JGI25162J39368_1000082 JGI25162J39368_100008237 299
415 3300002737 JGI25162J39368_1000282 JGI25162J39368_100028222 299
416 3300002771 JGI25163J39215_1001247 JGI25163J39215_10012473 299
417 3300002771 JGI25163J39215_1001473 JGI25163J39215_10014733 299
418 3300002772 JGI25164J39214_1000058 JGI25164J39214_100005837 299
419 3300002772 JGI25164J39214_1000212 JGI25164J39214_100021222 299
420 3300003214 JGI25165J46597_1000154 JGI25165J46597_100015437 299
421 3300003214 JGI25165J46597_1000383 JGI25165J46597_100038323 299
422 3300003752 Ga0055539_1000017 Ga0055539_1000017203 299
423 3300003756 Ga0055533_1000021 Ga0055533_1000021203 299
424 3300003758 Ga0055532_1000020 Ga0055532_100002039 299
425 3300003759 Ga0055525_1000078 Ga0055525_100007875 299
426 3300003781 Ga0055536_1004543 Ga0055536_10045434 299
427 3300003781 Ga0055536_1009458 Ga0055536_10094585 299
428 3300003791 Ga0055530_10005470 Ga0055530_100054705 299
429 3300003791 Ga0055530_10008701 Ga0055530_100087015 299
430 3300003792 Ga0055540_1004724 Ga0055540_10047245 299
431 3300003792 Ga0055540_1007682 Ga0055540_10076822 299
432 3300003841 Ga0055541_1000012 Ga0055541_1000012203 299
433 3300005288 Ga0065714_10000439 Ga0065714_100004392 299
434 3300005288 Ga0065714_10002271 Ga0065714_1000227129 299
435 3300005288 Ga0065714_10006312 Ga0065714_100063123 299
436 3300005288 Ga0065714_10008133 Ga0065714_100081334 299
437 3300005288 Ga0065714_10066861 Ga0065714_100668614 299
438 3300005288 Ga0065714_10072674 Ga0065714_100726743 299
439 3300005289 Ga0065704_10075102 Ga0065704_100751025 299
440 3300005289 Ga0065704_10082411 Ga0065704_100824113 299
441 3300005289 Ga0065704_10088544 Ga0065704_100885442 299
442 3300005290 Ga0065712_10087006 Ga0065712_100870061 299
443 3300005331 Ga0070670_100009258 Ga0070670_1000092586 299
444 3300005331 Ga0070670_100032384 Ga0070670_1000323843 299
445 3300005344 Ga0070661_100004654 Ga0070661_1000046543 299
446 3300005353 Ga0070669_100000186 Ga0070669_10000018623 299
447 3300005353 Ga0070669_100005487 Ga0070669_1000054875 299
448 3300005356 Ga0070674_100194995 Ga0070674_1001949952 299
449 3300005457 Ga0070662_100112437 Ga0070662_1001124371 299
450 3300005548 Ga0070665_100046440 Ga0070665_1000464403 299
451 3300005548 Ga0070665_100144180 Ga0070665_1001441803 299
452 3300005564 Ga0070664_100000292 Ga0070664_10000029227 299
453 3300005578 Ga0068854_100013801 Ga0068854_1000138013 299
454 3300005834 Ga0068851_10000039 Ga0068851_100000397 299
455 3300006051 Ga0075364_10071835 Ga0075364_100718353 299
456 3300006051 Ga0075364_10080097 Ga0075364_100800972 299
457 3300006051 Ga0075364_10087710 Ga0075364_100877102 299
458 3300006051 Ga0075364_10310727 Ga0075364_103107272 299
459 3300006058 Ga0075432_10005388 Ga0075432_100053884 299
460 3300006058 Ga0075432_10007561 Ga0075432_100075614 299
461 3300006058 Ga0075432_10024934 Ga0075432_100249343 299
462 3300006058 Ga0075432_10037262 Ga0075432_100372622 299
463 3300006058 Ga0075432_10120714 Ga0075432_101207141 299
464 3300006177 Ga0075362_10144102 Ga0075362_101441021 299
465 3300006914 Ga0075436_100149243 Ga0075436_1001492432 299
466 3300006946 Ga0079104_1001850 Ga0079104_10018506 299
467 3300006946 Ga0079104_1007967 Ga0079104_10079675 299
468 3300009011 Ga0105251_10000089 Ga0105251_100000899 299
469 3300009011 Ga0105251_10008839 Ga0105251_100088393 299
470 3300009011 Ga0105251_10016631 Ga0105251_100166312 299
471 3300009011 Ga0105251_10034558 Ga0105251_100345584 299
472 3300009011 Ga0105251_10059337 Ga0105251_100593372 299
473 3300009011 Ga0105251_10063703 Ga0105251_100637032 299
474 3300009036 Ga0105244_10008948 Ga0105244_100089484 299
475 3300009036 Ga0105244_10009039 Ga0105244_100090393 299
476 3300009036 Ga0105244_10069281 Ga0105244_100692812 299
477 3300009036 Ga0105244_10077974 Ga0105244_100779741 299
478 3300009092 Ga0105250_10001135 Ga0105250_100011358 299
479 3300009092 Ga0105250_10004905 Ga0105250_100049054 299
480 3300009092 Ga0105250_10012182 Ga0105250_100121822 299
481 3300009092 Ga0105250_10017305 Ga0105250_100173053 299
482 3300009092 Ga0105250_10018249 Ga0105250_100182492 299
483 3300009148 Ga0105243_10005333 Ga0105243_100053335 299
484 3300009148 Ga0105243_10013497 Ga0105243_100134974 299
485 3300009148 Ga0105243_10045133 Ga0105243_100451334 299
486 3300009148 Ga0105243_10088764 Ga0105243_100887644 299
487 3300009176 Ga0105242_10001069 Ga0105242_100010696 299
488 3300009176 Ga0105242_10042069 Ga0105242_100420693 299
489 3300009545 Ga0105237_10001100 Ga0105237_1000110027 299
490 3300009545 Ga0105237_10300209 Ga0105237_103002092 299
491 3300009553 Ga0105249_10007620 Ga0105249_100076206 299
492 3300011119 Ga0105246_10006273 Ga0105246_100062735 299
493 3300011119 Ga0105246_10028338 Ga0105246_100283382 299
494 3300011119 Ga0105246_10081744 Ga0105246_100817443 299
495 3300012483 Ga0157337_1000334 Ga0157337_10003343 299
496 3300012498 Ga0157345_1000279 Ga0157345_10002795 299
497 3300013100 Ga0157373_10014293 Ga0157373_100142934 299
498 3300013100 Ga0157373_10014510 Ga0157373_100145103 299
499 3300013100 Ga0157373_10015661 Ga0157373_100156613 299
500 3300013100 Ga0157373_10054780 Ga0157373_100547802 299
501 3300013100 Ga0157373_10082138 Ga0157373_100821383 299
502 3300013100 Ga0157373_10093502 Ga0157373_100935022 299
503 3300013100 Ga0157373_10103609 Ga0157373_101036092 299
504 3300013100 Ga0157373_10130352 Ga0157373_101303522 299
505 3300013100 Ga0157373_10188610 Ga0157373_101886101 299
506 3300013102 Ga0157371_10000109 Ga0157371_1000010968 299
507 3300013102 Ga0157371_10008323 Ga0157371_100083234 299
508 3300013102 Ga0157371_10015185 Ga0157371_100151855 299
509 3300013102 Ga0157371_10020452 Ga0157371_100204523 299
510 3300013104 Ga0157370_10027707 Ga0157370_100277075 299
511 3300013104 Ga0157370_10037357 Ga0157370_100373573 299
512 3300013104 Ga0157370_10152461 Ga0157370_101524612 299
513 3300013105 Ga0157369_10012771 Ga0157369_100127713 299
514 3300013105 Ga0157369_10028227 Ga0157369_100282275 299
515 3300013105 Ga0157369_10031841 Ga0157369_100318415 299
516 3300013105 Ga0157369_10077343 Ga0157369_100773432 299
517 3300013105 Ga0157369_10145778 Ga0157369_101457782 299
518 3300013105 Ga0157369_10374681 Ga0157369_103746812 299
519 3300013306 Ga0163162_10015186 Ga0163162_100151863 299
520 3300013306 Ga0163162_10168413 Ga0163162_101684132 299
521 3300013306 Ga0163162_10212584 Ga0163162_102125842 299
522 3300013308 Ga0157375_10021950 Ga0157375_100219505 299
523 3300013308 Ga0157375_10033370 Ga0157375_100333703 299
524 3300013308 Ga0157375_10285399 Ga0157375_102853992 299
525 3300013308 Ga0157375_10514152 Ga0157375_105141522 299
526 3300014497 Ga0182008_10007384 Ga0182008_100073845 299
527 3300014497 Ga0182008_10007985 Ga0182008_100079854 299
528 3300014497 Ga0182008_10009595 Ga0182008_100095954 299
529 3300014497 Ga0182008_10009942 Ga0182008_100099423 299
530 3300014497 Ga0182008_10010565 Ga0182008_100105654 299
531 3300014497 Ga0182008_10064150 Ga0182008_100641502 299
532 3300014497 Ga0182008_10067524 Ga0182008_100675241 299
533 3300015261 Ga0182006_1004263 Ga0182006_10042636 299
534 3300015261 Ga0182006_1005362 Ga0182006_10053625 299
535 3300015261 Ga0182006_1006516 Ga0182006_10065164 299
536 3300015261 Ga0182006_1015408 Ga0182006_10154081 299
537 3300015262 Ga0182007_10005678 Ga0182007_100056784 299
538 3300015262 Ga0182007_10010392 Ga0182007_100103924 299
539 3300015265 Ga0182005_1002764 Ga0182005_10027643 299
540 3300015265 Ga0182005_1003401 Ga0182005_10034013 299
541 3300015265 Ga0182005_1018358 Ga0182005_10183582 299
542 3300017792 Ga0163161_10009183 Ga0163161_100091835 299
543 3300017792 Ga0163161_10032067 Ga0163161_100320672 299
544 3300017792 Ga0163161_10053254 Ga0163161_100532542 299
545 3300017792 Ga0163161_10074015 Ga0163161_100740153 299
546 3300017792 Ga0163161_10182217 Ga0163161_101822172 299
547 3300017792 Ga0163161_10225644 Ga0163161_102256442 299
548 3300017792 Ga0163161_10240801 Ga0163161_102408012 299
549 3300017792 Ga0163161_10289252 Ga0163161_102892522 299
550 3300025206 Ga0209435_100579 Ga0209435_1005794 299
551 3300025207 Ga0209760_100160 Ga0209760_10016034 299
552 3300025207 Ga0209760_100475 Ga0209760_1004757 299
553 3300025224 Ga0209784_100007 Ga0209784_100007203 299
554 3300025225 Ga0209566_100009 Ga0209566_100009203 299
555 3300025226 Ga0209674_100021 Ga0209674_100021203 299
556 3300025229 Ga0209147_100009 Ga0209147_100009203 299
557 3300025230 Ga0209563_100018 Ga0209563_100018203 299
558 3300025231 Ga0207427_100005 Ga0207427_100005519 299
559 3300025231 Ga0207427_100006 Ga0207427_100006223 299
560 3300025233 Ga0209437_100013 Ga0209437_100013223 299
561 3300025233 Ga0209437_100018 Ga0209437_100018429 299
562 3300025242 Ga0209258_100321 Ga0209258_10032126 299
563 3300025246 Ga0209646_1000787 Ga0209646_10007876 299
564 3300025253 Ga0209677_100012 Ga0209677_100012203 299
565 3300025256 Ga0209759_1021813 Ga0209759_10218131 299
566 3300025261 Ga0209233_1000021 Ga0209233_1000021519 299
567 3300025261 Ga0209233_1000022 Ga0209233_1000022223 299
568 3300025291 Ga0209675_1002421 Ga0209675_10024216 299
569 3300025292 Ga0209676_1000030 Ga0209676_1000030461 299
570 3300025292 Ga0209676_1000278 Ga0209676_100027872 299
571 3300025292 Ga0209676_1013187 Ga0209676_10131873 299
572 3300025298 Ga0209050_1000061 Ga0209050_100006143 299
573 3300025298 Ga0209050_1000241 Ga0209050_10002416 299
574 3300025303 Ga0209051_1000519 Ga0209051_100051942 299
575 3300025303 Ga0209051_1000572 Ga0209051_100057243 299
576 3300025304 Ga0209257_1008653 Ga0209257_10086535 299
577 3300025321 Ga0207656_10000009 Ga0207656_10000009204 299
578 3300025711 Ga0207696_1000078 Ga0207696_100007875 299
579 3300025711 Ga0207696_1000080 Ga0207696_1000080103 299
580 3300025711 Ga0207696_1000204 Ga0207696_10002048 299
581 3300025711 Ga0207696_1001609 Ga0207696_100160910 299
582 3300025711 Ga0207696_1020354 Ga0207696_10203543 299
583 3300025711 Ga0207696_1027443 Ga0207696_10274432 299
584 3300025728 Ga0207655_1000033 Ga0207655_1000033266 299
585 3300025728 Ga0207655_1002134 Ga0207655_10021343 299
586 3300025728 Ga0207655_1003858 Ga0207655_10038586 299
587 3300025728 Ga0207655_1004732 Ga0207655_10047325 299
588 3300025728 Ga0207655_1016218 Ga0207655_10162183 299
589 3300025728 Ga0207655_1018480 Ga0207655_10184803 299
590 3300025728 Ga0207655_1022478 Ga0207655_10224783 299
591 3300025728 Ga0207655_1025331 Ga0207655_10253313 299
592 3300025728 Ga0207655_1028204 Ga0207655_10282043 299
593 3300025735 Ga0207713_1000010 Ga0207713_1000010430 299
594 3300025735 Ga0207713_1000707 Ga0207713_100070720 299
595 3300025735 Ga0207713_1000912 Ga0207713_10009122 299
596 3300025735 Ga0207713_1001717 Ga0207713_10017171 299
597 3300025735 Ga0207713_1002747 Ga0207713_10027475 299
598 3300025735 Ga0207713_1004468 Ga0207713_10044688 299
599 3300025735 Ga0207713_1005294 Ga0207713_10052945 299
600 3300025735 Ga0207713_1026441 Ga0207713_10264414 299
601 3300025735 Ga0207713_1039658 Ga0207713_10396582 299
602 3300025735 Ga0207713_1057758 Ga0207713_10577582 299
603 3300025914 Ga0207671_10000027 Ga0207671_10000027124 299
604 3300025914 Ga0207671_10190213 Ga0207671_101902132 299
605 3300025920 Ga0207649_10000007 Ga0207649_1000000750 299
606 3300025923 Ga0207681_10000059 Ga0207681_1000005927 299
607 3300025925 Ga0207650_10000044 Ga0207650_1000004487 299
608 3300025925 Ga0207650_10000089 Ga0207650_1000008989 299
609 3300025933 Ga0207706_10002297 Ga0207706_100022976 299
610 3300025933 Ga0207706_10077495 Ga0207706_100774952 299
611 3300025934 Ga0207686_10003528 Ga0207686_100035285 299
612 3300025935 Ga0207709_10000063 Ga0207709_1000006398 299
613 3300025935 Ga0207709_10000545 Ga0207709_1000054513 299
614 3300025935 Ga0207709_10047897 Ga0207709_100478972 299
615 3300025945 Ga0207679_10000013 Ga0207679_10000013254 299
616 3300025945 Ga0207679_10019106 Ga0207679_100191063 299
617 3300025961 Ga0207712_10010833 Ga0207712_100108336 299
618 3300025981 Ga0207640_10434927 Ga0207640_104349271 299
619 3300026041 Ga0207639_10000091 Ga0207639_1000009124 299
620 3300027111 Ga0209281_1000016 Ga0209281_1000016466 299
621 3300027111 Ga0209281_1002512 Ga0209281_10025126 299
622 3300027111 Ga0209281_1006212 Ga0209281_10062122 299
623 3300027907 Ga0207428_10106391 Ga0207428_101063912 299
624 3300027907 Ga0207428_10215854 Ga0207428_102158542 299
625 3300027907 Ga0207428_10226076 Ga0207428_102260762 299
626 3300028379 Ga0268266_10039955 Ga0268266_100399553 299
627 3300028379 Ga0268266_10240282 Ga0268266_102402822 299
628 3300028379 Ga0268266_10338178 Ga0268266_103381781 299
629 3300028786 Ga0307517_10058899 Ga0307517_100588991 299
630 3300030521 Ga0307511_10035806 Ga0307511_100358064 299
631 3300030521 Ga0307511_10110889 Ga0307511_101108891 299
632 3300030731 Ga0316177_1091565 Ga0316177_10915655 299
633 3300030734 Ga0316179_1002654 Ga0316179_10026544 299
634 3300030735 Ga0316178_1047147 Ga0316178_104714789 299
635 3300030742 Ga0316183_1191323 Ga0316183_11913232 299
636 3300030744 Ga0316181_1001658 Ga0316181_10016585 299
637 3300031548 Ga0307408_100014178 Ga0307408_1000141784 299
638 3300031548 Ga0307408_100030241 Ga0307408_1000302411 299
639 3300031548 Ga0307408_100316253 Ga0307408_1003162532 299
640 3300031730 Ga0307516_10307124 Ga0307516_103071242 299
641 3300031731 Ga0307405_10014255 Ga0307405_100142554 299
642 3300031731 Ga0307405_10014813 Ga0307405_100148132 299
643 3300031731 Ga0307405_10103727 Ga0307405_101037273 299
644 3300031852 Ga0307410_10089350 Ga0307410_100893502 299
645 3300031903 Ga0307407_10013087 Ga0307407_100130874 299
646 3300031903 Ga0307407_10081643 Ga0307407_100816433 299
647 3300031911 Ga0307412_10006130 Ga0307412_100061304 299
648 3300031911 Ga0307412_10097956 Ga0307412_100979562 299
649 3300032002 Ga0307416_100181693 Ga0307416_1001816932 299
650 3300032002 Ga0307416_100198823 Ga0307416_1001988232 299
651 3300032004 Ga0307414_10005772 Ga0307414_100057724 299
652 3300032004 Ga0307414_10145876 Ga0307414_101458762 299
653 3300032005 Ga0307411_10020289 Ga0307411_100202894 299
654 3300032005 Ga0307411_10078066 Ga0307411_100780662 299
655 3300033180 Ga0307510_10024600 Ga0307510_100246005 299
656 3300038705 Ga0237819_00416 Ga0237819_00416_11232_12131 299
657 3300041405 Ga0439438_003796 Ga0439438_003796_2282_3181 299
658 3300041405 Ga0439438_004810 Ga0439438_004810_2429_3328 299
659 3300041405 Ga0439438_006281 Ga0439438_006281_920_1819 299
660 3300041405 Ga0439438_007493 Ga0439438_007493_722_1645 299
661 3300041405 Ga0439438_011129 Ga0439438_011129_839_1738 299
662 3300041405 Ga0439438_011217 Ga0439438_011217_722_1645 299
663 3300041405 Ga0439438_013381 Ga0439438_013381_30_929 299
664 3300041405 Ga0439438_016490 Ga0439438_016490_276_1175 299
665 3300041405 Ga0439438_020501 Ga0439438_020501_75_974 299
666 3300041405 Ga0439438_027053 Ga0439438_027053_519_1418 299
667 3300041407 Ga0439447_003950 Ga0439447_003950_1872_2771 299
668 3300041407 Ga0439447_004777 Ga0439447_004777_2319_3218 299
669 3300041407 Ga0439447_005109 Ga0439447_005109_1109_2008 299
670 3300041407 Ga0439447_008113 Ga0439447_008113_936_1835 299
671 3300041407 Ga0439447_010104 Ga0439447_010104_211_1110 299
672 3300041411 Ga0439466_0002316 Ga0439466_0002316_6412_7311 299
673 3300041411 Ga0439466_0006210 Ga0439466_0006210_2550_3449 299
674 3300041411 Ga0439466_0008448 Ga0439466_0008448_380_1279 299
675 3300041411 Ga0439466_0009141 Ga0439466_0009141_1693_2592 299
676 3300041411 Ga0439466_0010840 Ga0439466_0010840_1104_2003 299
677 3300041411 Ga0439466_0015214 Ga0439466_0015214_1822_2721 299
678 3300041411 Ga0439466_0018909 Ga0439466_0018909_53_952 299
679 3300041411 Ga0439466_0022259 Ga0439466_0022259_1139_2038 299
680 3300041411 Ga0439466_0022816 Ga0439466_0022816_1279_2178 299
681 3300041413 Ga0439465_0008204 Ga0439465_0008204_1049_1948 299
682 3300042004 Ga0439445_0026105 Ga0439445_0026105_459_1358 299
683 3300042006 Ga0439432_000735 Ga0439432_000735_9606_10505 299
684 3300042006 Ga0439432_003124 Ga0439432_003124_2555_3454 299
685 3300042006 Ga0439432_007249 Ga0439432_007249_198_1097 299
686 3300042006 Ga0439432_013741 Ga0439432_013741_1667_2566 299
687 3300042006 Ga0439432_018391 Ga0439432_018391_1362_2261 299
688 3300042006 Ga0439432_041724 Ga0439432_041724_110_1009 299
689 3300042010 Ga0439452_002183 Ga0439452_002183_2420_3319 299
690 3300042010 Ga0439452_002419 Ga0439452_002419_2751_3650 299
691 3300042010 Ga0439452_003104 Ga0439452_003104_2405_3304 299
692 3300042010 Ga0439452_004107 Ga0439452_004107_1631_2530 299
693 3300042010 Ga0439452_009764 Ga0439452_009764_1752_2651 299
694 3300042010 Ga0439452_012435 Ga0439452_012435_506_1405 299
695 3300042010 Ga0439452_014704 Ga0439452_014704_39_938 299
696 3300042013 Ga0439456_000660 Ga0439456_000660_5714_6613 299
697 3300042013 Ga0439456_010763 Ga0439456_010763_786_1685 299
698 3300042013 Ga0439456_034660 Ga0439456_034660_124_1023 299
699 3300042016 Ga0439463_000477 Ga0439463_000477_4589_5488 299
700 3300042016 Ga0439463_002267 Ga0439463_002267_1543_2442 299
701 3300042016 Ga0439463_036010 Ga0439463_036010_238_1137 299
702 3300042115 Ga0450911_001296 Ga0450911_001296_2426_3325 299
703 3300042115 Ga0450911_002415 Ga0450911_002415_1578_2477 299
704 3300042115 Ga0450911_008467 Ga0450911_008467_24_923 299
705 3300042115 Ga0450911_010067 Ga0450911_010067_237_1136 299
706 3300042121 Ga0450919_001008 Ga0450919_001008_301_1200 299
707 3300042121 Ga0450919_001388 Ga0450919_001388_1369_2268 299
708 3300042122 Ga0450920_000286 Ga0450920_000286_6002_6901 299
709 3300042124 Ga0450922_000446 Ga0450922_000446_2635_3534 299
710 3300042124 Ga0450922_005333 Ga0450922_005333_195_1094 299
711 3300042125 Ga0450923_000811 Ga0450923_000811_1394_2293 299
712 3300042127 Ga0450890_001272 Ga0450890_001272_2654_3553 299
713 3300042138 Ga0450903_002152 Ga0450903_002152_2611_3510 299
714 3300042139 Ga0450904_002906 Ga0450904_002906_200_1099 299
715 3300042142 Ga0450905_007282 Ga0450905_007282_41_940 299
716 3300042145 Ga0450906_000355 Ga0450906_000355_5984_6883 299
717 3300042145 Ga0450906_000517 Ga0450906_000517_1855_2754 299
718 3300042145 Ga0450906_004065 Ga0450906_004065_816_1715 299
719 3300042146 Ga0450907_000520 Ga0450907_000520_4195_5094 299
720 3300042146 Ga0450907_000867 Ga0450907_000867_2078_2977 299
721 3300042146 Ga0450907_013384 Ga0450907_013384_393_1292 299
722 3300042147 Ga0450910_000137 Ga0450910_000137_6085_6984 299
723 3300042156 Ga0439446_0003992 Ga0439446_0003992_2615_3514 299
724 3300042156 Ga0439446_0007513 Ga0439446_0007513_1375_2274 299
725 3300042184 Ga0450908_000962 Ga0450908_000962_2321_3220 299
726 3300042184 Ga0450908_019263 Ga0450908_019263_44_943 299
727 3300042185 Ga0450909_005573 Ga0450909_005573_92_991 299
728 3300042185 Ga0450909_005824 Ga0450909_005824_762_1661 299
729 3300042435 Ga0439434_0001117 Ga0439434_0001117_4229_5128 299
730 3300042461 Ga0439460_0000568 Ga0439460_0000568_6729_7628 299
731 3300042531 Ga0450918_001120 Ga0450918_001120_2393_3292 299
732 3300042533 Ga0450901_000691 Ga0450901_000691_1323_2222 299
733 3300042993 Ga0439440_0001238 Ga0439440_0001238_1356_2255 299
734 3300042993 Ga0439440_0006091 Ga0439440_0006091_356_1255 299
735 3300042993 Ga0439440_0023973 Ga0439440_0023973_250_1149 299
736 3300046452 Ga0495617_005595 Ga0495617_005595_982_1881 299
737 3300046452 Ga0495617_007712 Ga0495617_007712_2337_3236 299
738 3300046452 Ga0495617_010836 Ga0495617_010836_1130_2032 299
739 3300046453 Ga0495627_002716 Ga0495627_002716_4630_5532 299
740 3300046453 Ga0495627_005780 Ga0495627_005780_1511_2410 299
741 3300046453 Ga0495627_007033 Ga0495627_007033_691_1590 299
742 3300046453 Ga0495627_010384 Ga0495627_010384_110_1009 299
743 3300046453 Ga0495627_012080 Ga0495627_012080_953_1852 299
744 3300046453 Ga0495627_025369 Ga0495627_025369_531_1430 299
745 3300046455 Ga0495603_0014110 Ga0495603_0014110_1391_2290 299
746 3300046455 Ga0495603_0031614 Ga0495603_0031614_49_948 299
747 3300046455 Ga0495603_0114008 Ga0495603_0114008_571_1470 299
748 3300046457 Ga0495590_0001555 Ga0495590_0001555_4023_4922 299
749 3300046457 Ga0495590_0080202 Ga0495590_0080202_86_985 299
750 3300046458 Ga0495591_006081 Ga0495591_006081_2135_3034 299
751 3300046458 Ga0495591_006163 Ga0495591_006163_2956_3855 299
752 3300046458 Ga0495591_008415 Ga0495591_008415_471_1370 299
753 3300046458 Ga0495591_009117 Ga0495591_009117_537_1436 299
754 3300046458 Ga0495591_012038 Ga0495591_012038_295_1194 299
755 3300046458 Ga0495591_014389 Ga0495591_014389_832_1731 299
756 3300046458 Ga0495591_033354 Ga0495591_033354_536_1435 299
757 3300046458 Ga0495591_034441 Ga0495591_034441_233_1132 299
758 3300046459 Ga0495629_0036122 Ga0495629_0036122_1219_2118 299
759 3300046460 Ga0495638_0022813 Ga0495638_0022813_1031_1930 299
760 3300046460 Ga0495638_0023151 Ga0495638_0023151_948_1847 299
761 3300046460 Ga0495638_0024593 Ga0495638_0024593_2962_3861 299
762 3300046460 Ga0495638_0026476 Ga0495638_0026476_1495_2394 299
763 3300046460 Ga0495638_0052159 Ga0495638_0052159_1157_2056 299
764 3300046460 Ga0495638_0060791 Ga0495638_0060791_1327_2226 299
765 3300046460 Ga0495638_0090973 Ga0495638_0090973_434_1333 299
766 3300046460 Ga0495638_0110025 Ga0495638_0110025_364_1263 299
767 3300046463 Ga0495653_0078624 Ga0495653_0078624_672_1571 299
768 3300046463 Ga0495653_0151236 Ga0495653_0151236_445_1344 299
769 3300046471 Ga0495650_0018974 Ga0495650_0018974_1071_1970 299
770 3300046471 Ga0495650_0034626 Ga0495650_0034626_445_1344 299
771 3300046471 Ga0495650_0040697 Ga0495650_0040697_750_1652 299
772 3300046473 Ga0495582_0012502 Ga0495582_0012502_1626_2525 299
773 3300046474 Ga0495605_0010405 Ga0495605_0010405_2704_3603 299
774 3300046474 Ga0495605_0010597 Ga0495605_0010597_1925_2824 299
775 3300046474 Ga0495605_0019206 Ga0495605_0019206_2544_3443 299
776 3300046474 Ga0495605_0019237 Ga0495605_0019237_2356_3255 299
777 3300046474 Ga0495605_0019680 Ga0495605_0019680_2203_3102 299
778 3300046474 Ga0495605_0104359 Ga0495605_0104359_327_1226 299
779 3300046475 Ga0495639_0004422 Ga0495639_0004422_2542_3441 299
780 3300046475 Ga0495639_0011705 Ga0495639_0011705_1773_2672 299
781 3300046491 Ga0495584_0006922 Ga0495584_0006922_2392_3291 299
782 3300046491 Ga0495584_0006997 Ga0495584_0006997_2423_3322 299
783 3300046491 Ga0495584_0007934 Ga0495584_0007934_2239_3138 299
784 3300046491 Ga0495584_0008019 Ga0495584_0008019_2387_3286 299
785 3300046491 Ga0495584_0008025 Ga0495584_0008025_2358_3257 299
786 3300046491 Ga0495584_0010834 Ga0495584_0010834_1407_2306 299
787 3300046491 Ga0495584_0017646 Ga0495584_0017646_1959_2858 299
788 3300046491 Ga0495584_0050636 Ga0495584_0050636_787_1686 299
789 3300046491 Ga0495584_0076986 Ga0495584_0076986_710_1609 299
790 3300046492 Ga0495585_0009311 Ga0495585_0009311_2598_3497 299
791 3300046492 Ga0495585_0014262 Ga0495585_0014262_2369_3268 299
792 3300046492 Ga0495585_0031938 Ga0495585_0031938_2024_2923 299
793 3300046492 Ga0495585_0089168 Ga0495585_0089168_142_1041 299
794 3300046492 Ga0495585_0092639 Ga0495585_0092639_539_1438 299
795 3300046492 Ga0495585_0099657 Ga0495585_0099657_622_1521 299
796 3300046492 Ga0495585_0112100 Ga0495585_0112100_403_1302 299
797 3300046492 Ga0495585_0202973 Ga0495585_0202973_13_912 299
798 3300046499 Ga0495594_0022996 Ga0495594_0022996_1737_2636 299
799 3300046501 Ga0495607_0017405 Ga0495607_0017405_2138_3040 299
800 3300046501 Ga0495607_0023033 Ga0495607_0023033_693_1592 299
801 3300046501 Ga0495607_0043277 Ga0495607_0043277_133_1032 299
802 3300046501 Ga0495607_0063235 Ga0495607_0063235_1129_2028 299
803 3300046501 Ga0495607_0081937 Ga0495607_0081937_542_1468 299
804 3300046501 Ga0495607_0082640 Ga0495607_0082640_335_1234 299
805 3300046501 Ga0495607_0113879 Ga0495607_0113879_465_1364 299
806 3300046501 Ga0495607_0114434 Ga0495607_0114434_486_1385 299
807 3300046501 Ga0495607_0126075 Ga0495607_0126075_166_1065 299
808 3300046506 Ga0495583_0007538 Ga0495583_0007538_3430_4329 299
809 3300046506 Ga0495583_0009278 Ga0495583_0009278_2861_3760 299
810 3300046506 Ga0495583_0027693 Ga0495583_0027693_1557_2456 299
811 3300046506 Ga0495583_0037330 Ga0495583_0037330_708_1607 299
812 3300046506 Ga0495583_0050437 Ga0495583_0050437_75_974 299
813 3300046507 Ga0495606_0009824 Ga0495606_0009824_2142_3041 299
814 3300046507 Ga0495606_0015236 Ga0495606_0015236_4036_4935 299
815 3300046507 Ga0495606_0022442 Ga0495606_0022442_2334_3233 299
816 3300046507 Ga0495606_0031970 Ga0495606_0031970_1198_2097 299
817 3300046507 Ga0495606_0034591 Ga0495606_0034591_492_1391 299
818 3300046507 Ga0495606_0080532 Ga0495606_0080532_976_1875 299
819 3300046507 Ga0495606_0101185 Ga0495606_0101185_745_1644 299
820 3300046507 Ga0495606_0141635 Ga0495606_0141635_450_1349 299
821 3300046507 Ga0495606_0176015 Ga0495606_0176015_242_1141 299
822 3300046507 Ga0495606_0190457 Ga0495606_0190457_50_949 299
823 3300046512 Ga0495610_0011258 Ga0495610_0011258_2188_3087 299
824 3300046512 Ga0495610_0019562 Ga0495610_0019562_276_1175 299
825 3300046512 Ga0495610_0019797 Ga0495610_0019797_1910_2809 299
826 3300046512 Ga0495610_0020042 Ga0495610_0020042_64_963 299
827 3300046512 Ga0495610_0021799 Ga0495610_0021799_1934_2833 299
828 3300046512 Ga0495610_0023220 Ga0495610_0023220_245_1144 299
829 3300046512 Ga0495610_0031649 Ga0495610_0031649_540_1439 299
830 3300046512 Ga0495610_0038654 Ga0495610_0038654_827_1726 299
831 3300046512 Ga0495610_0051483 Ga0495610_0051483_344_1243 299
832 3300046512 Ga0495610_0055379 Ga0495610_0055379_553_1452 299
833 3300046512 Ga0495610_0088271 Ga0495610_0088271_250_1149 299
834 3300046513 Ga0495616_0005952 Ga0495616_0005952_2608_3507 299
835 3300046513 Ga0495616_0030838 Ga0495616_0030838_752_1651 299
836 3300046513 Ga0495616_0042648 Ga0495616_0042648_562_1461 299
837 3300046513 Ga0495616_0106873 Ga0495616_0106873_31_930 299
838 3300046513 Ga0495616_0155799 Ga0495616_0155799_64_963 299
839 3300046515 Ga0495620_0006866 Ga0495620_0006866_4780_5679 299
840 3300046515 Ga0495620_0017505 Ga0495620_0017505_526_1425 299
841 3300046515 Ga0495620_0019311 Ga0495620_0019311_1201_2100 299
842 3300046515 Ga0495620_0024409 Ga0495620_0024409_506_1405 299
843 3300046515 Ga0495620_0041188 Ga0495620_0041188_526_1425 299
844 3300046515 Ga0495620_0048251 Ga0495620_0048251_715_1614 299
845 3300046515 Ga0495620_0070235 Ga0495620_0070235_46_945 299
846 3300046515 Ga0495620_0091851 Ga0495620_0091851_52_951 299
847 3300046517 Ga0495630_0023231 Ga0495630_0023231_1087_1986 299
848 3300046517 Ga0495630_0136413 Ga0495630_0136413_67_966 299
849 3300046518 Ga0495631_0006682 Ga0495631_0006682_2649_3548 299
850 3300046518 Ga0495631_0010667 Ga0495631_0010667_1309_2211 299
851 3300046518 Ga0495631_0087310 Ga0495631_0087310_354_1253 299
852 3300046519 Ga0495632_0006308 Ga0495632_0006308_2482_3381 299
853 3300046519 Ga0495632_0007314 Ga0495632_0007314_2120_3019 299
854 3300046519 Ga0495632_0009750 Ga0495632_0009750_2388_3287 299
855 3300046519 Ga0495632_0010862 Ga0495632_0010862_554_1456 299
856 3300046519 Ga0495632_0011087 Ga0495632_0011087_2872_3771 299
857 3300046519 Ga0495632_0013427 Ga0495632_0013427_984_1883 299
858 3300046519 Ga0495632_0022427 Ga0495632_0022427_49_972 299
859 3300046519 Ga0495632_0052886 Ga0495632_0052886_97_996 299
860 3300046519 Ga0495632_0059832 Ga0495632_0059832_381_1280 299
861 3300046519 Ga0495632_0091159 Ga0495632_0091159_499_1398 299
862 3300046519 Ga0495632_0132033 Ga0495632_0132033_139_1038 299
863 3300046520 Ga0495637_0004958 Ga0495637_0004958_3914_4813 299
864 3300046520 Ga0495637_0007048 Ga0495637_0007048_2578_3477 299
865 3300046520 Ga0495637_0011893 Ga0495637_0011893_2499_3398 299
866 3300046520 Ga0495637_0014187 Ga0495637_0014187_2264_3163 299
867 3300046520 Ga0495637_0022402 Ga0495637_0022402_851_1750 299
868 3300046520 Ga0495637_0034274 Ga0495637_0034274_987_1886 299
869 3300046520 Ga0495637_0035140 Ga0495637_0035140_396_1295 299
870 3300046520 Ga0495637_0058271 Ga0495637_0058271_62_961 299
871 3300046522 Ga0495643_0011962 Ga0495643_0011962_3923_4822 299
872 3300046522 Ga0495643_0029901 Ga0495643_0029901_713_1612 299
873 3300046522 Ga0495643_0037993 Ga0495643_0037993_387_1286 299
874 3300046523 Ga0495644_0008526 Ga0495644_0008526_2077_2976 299
875 3300046523 Ga0495644_0040264 Ga0495644_0040264_804_1703 299
876 3300046523 Ga0495644_0061702 Ga0495644_0061702_118_1017 299
877 3300046523 Ga0495644_0089361 Ga0495644_0089361_168_1067 299
878 3300046524 Ga0495648_0007380 Ga0495648_0007380_4901_5800 299
879 3300046524 Ga0495648_0008468 Ga0495648_0008468_4899_5798 299
880 3300046524 Ga0495648_0025115 Ga0495648_0025115_1372_2271 299
881 3300046524 Ga0495648_0026142 Ga0495648_0026142_2290_3189 299
882 3300046524 Ga0495648_0046488 Ga0495648_0046488_777_1676 299
883 3300046524 Ga0495648_0061516 Ga0495648_0061516_1255_2154 299
884 3300046524 Ga0495648_0118584 Ga0495648_0118584_41_940 299
885 3300046526 Ga0495666_0015629 Ga0495666_0015629_1695_2594 299
886 3300046526 Ga0495666_0044785 Ga0495666_0044785_481_1380 299
887 3300046526 Ga0495666_0048946 Ga0495666_0048946_935_1834 299
888 3300046528 Ga0495642_0003701 Ga0495642_0003701_2705_3604 299
889 3300046528 Ga0495642_0003845 Ga0495642_0003845_2583_3482 299
890 3300046528 Ga0495642_0011725 Ga0495642_0011725_2423_3322 299
891 3300046530 Ga0495654_0005016 Ga0495654_0005016_1019_1918 299
892 3300046530 Ga0495654_0007275 Ga0495654_0007275_3166_4065 299
893 3300046530 Ga0495654_0008103 Ga0495654_0008103_2414_3313 299
894 3300046530 Ga0495654_0009176 Ga0495654_0009176_2400_3299 299
895 3300046530 Ga0495654_0009378 Ga0495654_0009378_2790_3692 299
896 3300046530 Ga0495654_0019319 Ga0495654_0019319_2581_3480 299
897 3300046530 Ga0495654_0019550 Ga0495654_0019550_885_1784 299
898 3300046530 Ga0495654_0021353 Ga0495654_0021353_73_972 299
899 3300046530 Ga0495654_0021395 Ga0495654_0021395_356_1255 299
900 3300046530 Ga0495654_0022453 Ga0495654_0022453_1042_1944 299
901 3300046530 Ga0495654_0034277 Ga0495654_0034277_1530_2429 299
902 3300046530 Ga0495654_0080817 Ga0495654_0080817_487_1386 299
903 3300046530 Ga0495654_0122997 Ga0495654_0122997_169_1068 299
904 3300046535 Ga0495586_0019543 Ga0495586_0019543_1583_2482 299
905 3300046536 Ga0495587_0021921 Ga0495587_0021921_2334_3233 299
906 3300046536 Ga0495587_0023256 Ga0495587_0023256_2416_3315 299
907 3300046538 Ga0495609_0008828 Ga0495609_0008828_2407_3306 299
908 3300046538 Ga0495609_0037995 Ga0495609_0037995_845_1744 299
909 3300046538 Ga0495609_0092532 Ga0495609_0092532_261_1160 299
910 3300046538 Ga0495609_0100808 Ga0495609_0100808_178_1077 299
911 3300046542 Ga0495597_0011773 Ga0495597_0011773_1241_2140 299
912 3300046542 Ga0495597_0023713 Ga0495597_0023713_572_1471 299
913 3300046542 Ga0495597_0040078 Ga0495597_0040078_542_1441 299
914 3300046542 Ga0495597_0042867 Ga0495597_0042867_895_1794 299
915 3300046557 Ga0495622_0005353 Ga0495622_0005353_853_1752 299
916 3300046557 Ga0495622_0006837 Ga0495622_0006837_2297_3196 299
917 3300046557 Ga0495622_0010735 Ga0495622_0010735_2320_3219 299
918 3300046557 Ga0495622_0014230 Ga0495622_0014230_1495_2394 299
919 3300046557 Ga0495622_0019253 Ga0495622_0019253_1767_2666 299
920 3300046558 Ga0495633_0004409 Ga0495633_0004409_4156_5055 299
921 3300046558 Ga0495633_0029754 Ga0495633_0029754_1269_2168 299
922 3300046616 Ga0495668_0125017 Ga0495668_0125017_478_1377 299
923 3300046642 Ga0495634_0038849 Ga0495634_0038849_1411_2310 299
924 3300046648 Ga0495611_0004728 Ga0495611_0004728_2782_3681 299
925 3300046648 Ga0495611_0171381 Ga0495611_0171381_57_956 299
926 3300046660 Ga0495625_0013708 Ga0495625_0013708_5018_5917 299
927 3300046660 Ga0495625_0016331 Ga0495625_0016331_2120_3019 299
928 3300046660 Ga0495625_0053577 Ga0495625_0053577_103_1002 299
929 3300046660 Ga0495625_0081536 Ga0495625_0081536_503_1402 299
930 3300046660 Ga0495625_0184089 Ga0495625_0184089_219_1118 299
931 3300046660 Ga0495625_0274348 Ga0495625_0274348_80_979 299
932 3300046663 Ga0495635_0014354 Ga0495635_0014354_2262_3161 299
933 3300046663 Ga0495635_0019486 Ga0495635_0019486_2408_3307 299
934 3300046664 Ga0495659_0001791 Ga0495659_0001791_2330_3229 299
935 3300046664 Ga0495659_0016823 Ga0495659_0016823_83_982 299
936 3300046664 Ga0495659_0027937 Ga0495659_0027937_944_1843 299
937 3300046665 Ga0495661_0006107 Ga0495661_0006107_5015_5914 299
938 3300046665 Ga0495661_0016928 Ga0495661_0016928_1360_2259 299
939 3300046665 Ga0495661_0035759 Ga0495661_0035759_824_1723 299
940 3300046665 Ga0495661_0063253 Ga0495661_0063253_100_999 299
941 3300046665 Ga0495661_0068699 Ga0495661_0068699_408_1307 299
942 3300046665 Ga0495661_0071228 Ga0495661_0071228_53_952 299
943 3300046665 Ga0495661_0136852 Ga0495661_0136852_356_1255 299
944 3300046674 Ga0495588_0026696 Ga0495588_0026696_830_1729 299
945 3300046674 Ga0495588_0097039 Ga0495588_0097039_602_1501 299
946 3300046675 Ga0495657_0044627 Ga0495657_0044627_549_1448 299
947 3300046679 Ga0495623_0010236 Ga0495623_0010236_2551_3450 299
948 3300046679 Ga0495623_0078007 Ga0495623_0078007_1090_1989 299
949 3300046680 Ga0495646_0031451 Ga0495646_0031451_2342_3241 299
950 3300046680 Ga0495646_0126251 Ga0495646_0126251_333_1232 299
951 3300046684 Ga0495669_0002201 Ga0495669_0002201_2747_3646 299
952 3300046689 Ga0495613_0093582 Ga0495613_0093582_129_1028 299
953 3300046691 Ga0495670_0003539 Ga0495670_0003539_3966_4865 299
954 3300046691 Ga0495670_0004439 Ga0495670_0004439_2061_2960 299
955 3300046691 Ga0495670_0017507 Ga0495670_0017507_250_1149 299
956 3300046691 Ga0495670_0035427 Ga0495670_0035427_781_1680 299
957 3300046691 Ga0495670_0035582 Ga0495670_0035582_94_993 299
958 3300046692 Ga0495671_0007515 Ga0495671_0007515_1091_1990 299
959 3300046692 Ga0495671_0015135 Ga0495671_0015135_922_1821 299
960 3300046692 Ga0495671_0016779 Ga0495671_0016779_2380_3279 299
961 3300046692 Ga0495671_0044041 Ga0495671_0044041_561_1460 299
962 3300046692 Ga0495671_0045845 Ga0495671_0045845_121_1047 299
963 3300046692 Ga0495671_0070052 Ga0495671_0070052_610_1509 299
964 3300046694 Ga0495649_0009532 Ga0495649_0009532_2319_3218 299
965 3300046694 Ga0495649_0010872 Ga0495649_0010872_440_1339 299
966 3300046694 Ga0495649_0021128 Ga0495649_0021128_152_1051 299
967 3300046694 Ga0495649_0022431 Ga0495649_0022431_856_1755 299
968 3300046694 Ga0495649_0022787 Ga0495649_0022787_534_1433 299
969 3300046694 Ga0495649_0044662 Ga0495649_0044662_1021_1920 299
970 3300046694 Ga0495649_0049537 Ga0495649_0049537_1007_1906 299
971 3300046694 Ga0495649_0050302 Ga0495649_0050302_1151_2050 299
972 3300046694 Ga0495649_0064685 Ga0495649_0064685_539_1438 299
973 3300046694 Ga0495649_0093662 Ga0495649_0093662_489_1388 299
974 3300046694 Ga0495649_0102563 Ga0495649_0102563_493_1392 299
975 3300046694 Ga0495649_0164274 Ga0495649_0164274_178_1077 299
976 3300046794 Ga0495589_0004591 Ga0495589_0004591_4063_4962 299
977 3300046794 Ga0495589_0015753 Ga0495589_0015753_1311_2210 299
978 3300046794 Ga0495589_0017724 Ga0495589_0017724_1362_2261 299
979 3300046794 Ga0495589_0019172 Ga0495589_0019172_529_1428 299
980 3300046794 Ga0495589_0021058 Ga0495589_0021058_1931_2830 299
981 3300046794 Ga0495589_0023614 Ga0495589_0023614_1782_2681 299
982 3300046794 Ga0495589_0024014 Ga0495589_0024014_74_973 299
983 3300046794 Ga0495589_0054055 Ga0495589_0054055_739_1638 299
984 3300046794 Ga0495589_0087850 Ga0495589_0087850_540_1439 299
985 3300046810 Ga0495660_0021050 Ga0495660_0021050_2133_3032 299
986 3300046810 Ga0495660_0024147 Ga0495660_0024147_1426_2328 299
987 3300046810 Ga0495660_0059586 Ga0495660_0059586_631_1530 299
988 3300046810 Ga0495660_0072557 Ga0495660_0072557_704_1603 299
989 3300046810 Ga0495660_0079391 Ga0495660_0079391_486_1385 299
990 3300046810 Ga0495660_0101093 Ga0495660_0101093_162_1061 299
991 3300046810 Ga0495660_0107168 Ga0495660_0107168_446_1345 299
992 3300046810 Ga0495660_0108366 Ga0495660_0108366_76_975 299
993 3300046810 Ga0495660_0171786 Ga0495660_0171786_93_992 299
994 3300047315 Ga0495581_0037857 Ga0495581_0037857_1714_2613 299
995 3300047317 Ga0495604_0023499 Ga0495604_0023499_2557_3456 299
996 3300047317 Ga0495604_0024919 Ga0495604_0024919_1507_2406 299
997 3300047317 Ga0495604_0047322 Ga0495604_0047322_743_1642 299
998 3300047318 Ga0495636_0139114 Ga0495636_0139114_81_980 299
999 3300047319 Ga0495674_0368676 Ga0495674_0368676_105_1004 299
1000 3300047320 Ga0495672_0009503 Ga0495672_0009503_4036_4935 299
1001 3300047320 Ga0495672_0011796 Ga0495672_0011796_2649_3551 299
1002 3300047320 Ga0495672_0013936 Ga0495672_0013936_534_1433 299
1003 3300047320 Ga0495672_0020472 Ga0495672_0020472_2584_3483 299
1004 3300047320 Ga0495672_0024934 Ga0495672_0024934_859_1758 299
1005 3300047320 Ga0495672_0031871 Ga0495672_0031871_816_1715 299
1006 3300047320 Ga0495672_0039277 Ga0495672_0039277_602_1501 299
1007 3300047320 Ga0495672_0041460 Ga0495672_0041460_1249_2148 299
1008 3300047320 Ga0495672_0049871 Ga0495672_0049871_99_998 299
1009 3300047320 Ga0495672_0061973 Ga0495672_0061973_196_1095 299
1010 3300047320 Ga0495672_0062986 Ga0495672_0062986_1021_1920 299
1011 3300047320 Ga0495672_0079955 Ga0495672_0079955_416_1315 299
1012 3300047321 Ga0495676_0044165 Ga0495676_0044165_2383_3282 299
1013 3300047322 Ga0495680_0022187 Ga0495680_0022187_1966_2865 299
1014 3300047322 Ga0495680_0022986 Ga0495680_0022986_2676_3575 299
1015 3300047322 Ga0495680_0150918 Ga0495680_0150918_637_1536 299
1016 3300047322 Ga0495680_0198654 Ga0495680_0198654_136_1035 299
1017 3300047323 Ga0495683_0004276 Ga0495683_0004276_2358_3257 299
1018 3300047323 Ga0495683_0007387 Ga0495683_0007387_2407_3306 299
1019 3300047323 Ga0495683_0008977 Ga0495683_0008977_2138_3037 299
1020 3300047323 Ga0495683_0052923 Ga0495683_0052923_325_1224 299
1021 3300047323 Ga0495683_0095991 Ga0495683_0095991_427_1326 299
1022 3300047443 Ga0495687_009435 Ga0495687_009435_2230_3129 299
1023 3300047443 Ga0495687_013719 Ga0495687_013719_571_1470 299
1024 3300047443 Ga0495687_027904 Ga0495687_027904_671_1570 299
1025 3300047444 Ga0495675_0108420 Ga0495675_0108420_800_1699 299
1026 3300047445 Ga0495677_0016584 Ga0495677_0016584_59_958 299
1027 3300047446 Ga0495679_012600 Ga0495679_012600_826_1725 299
1028 3300047446 Ga0495679_021760 Ga0495679_021760_369_1268 299
1029 3300047446 Ga0495679_027810 Ga0495679_027810_138_1037 299
1030 3300047446 Ga0495679_036770 Ga0495679_036770_142_1041 299
1031 3300047446 Ga0495679_043255 Ga0495679_043255_53_952 299
1032 3300047446 Ga0495679_044623 Ga0495679_044623_23_922 299
1033 3300047469 Ga0495673_0014003 Ga0495673_0014003_2373_3272 299
1034 3300047469 Ga0495673_0018172 Ga0495673_0018172_592_1491 299
1035 3300047469 Ga0495673_0019618 Ga0495673_0019618_78_977 299
1036 3300047469 Ga0495673_0023534 Ga0495673_0023534_1212_2111 299
1037 3300047469 Ga0495673_0028726 Ga0495673_0028726_1147_2046 299
1038 3300047469 Ga0495673_0046606 Ga0495673_0046606_485_1384 299
1039 3300047469 Ga0495673_0065244 Ga0495673_0065244_61_960 299
1040 3300047469 Ga0495673_0104504 Ga0495673_0104504_227_1126 299
1041 3300047470 Ga0495681_0009856 Ga0495681_0009856_2431_3330 299
1042 3300047470 Ga0495681_0018997 Ga0495681_0018997_1610_2509 299
1043 3300047470 Ga0495681_0019272 Ga0495681_0019272_417_1316 299
1044 3300047470 Ga0495681_0020409 Ga0495681_0020409_2152_3051 299
1045 3300047470 Ga0495681_0021063 Ga0495681_0021063_1321_2220 299
1046 3300047470 Ga0495681_0021784 Ga0495681_0021784_1482_2381 299
1047 3300047470 Ga0495681_0023153 Ga0495681_0023153_1178_2077 299
1048 3300047470 Ga0495681_0036879 Ga0495681_0036879_1414_2313 299
1049 3300047470 Ga0495681_0070110 Ga0495681_0070110_245_1144 299
1050 3300047470 Ga0495681_0123485 Ga0495681_0123485_124_1023 299
1051 3300047471 Ga0495684_0038420 Ga0495684_0038420_164_1063 299
1052 3300047472 Ga0495686_0012681 Ga0495686_0012681_2618_3517 299
1053 3300047472 Ga0495686_0024290 Ga0495686_0024290_2149_3048 299
1054 3300047472 Ga0495686_0026888 Ga0495686_0026888_2400_3299 299
1055 3300047472 Ga0495686_0081535 Ga0495686_0081535_951_1850 299
1056 3300047673 Ga0495593_0013908 Ga0495593_0013908_1143_2042 299
1057 3300047673 Ga0495593_0034872 Ga0495593_0034872_304_1203 299
1058 3300047673 Ga0495593_0049834 Ga0495593_0049834_126_1025 299
1059 3300048091 Ga0495626_0005414 Ga0495626_0005414_4190_5089 299
1060 3300048091 Ga0495626_0016287 Ga0495626_0016287_258_1157 299
1061 3300048091 Ga0495626_0026943 Ga0495626_0026943_1821_2720 299
1062 3300048091 Ga0495626_0028535 Ga0495626_0028535_565_1464 299
1063 3300048905 Ga0496102_0020156 Ga0496102_0020156_2582_3481 299
1064 3300048906 Ga0496103_0014360 Ga0496103_0014360_2400_3299 299
1065 3300048906 Ga0496103_0202550 Ga0496103_0202550_101_1000 299
1066 3300048908 Ga0496105_0108314 Ga0496105_0108314_990_1889 299
1067 3300048909 Ga0496106_0089174 Ga0496106_0089174_698_1597 299
1068 3300048913 Ga0496110_0023141 Ga0496110_0023141_516_1415 299
1069 3300048914 Ga0496111_0111697 Ga0496111_0111697_135_1034 299
1070 3300048919 Ga0496116_0001725 Ga0496116_0001725_5767_6666 299
1071 3300048919 Ga0496116_0011675 Ga0496116_0011675_2319_3218 299
1072 3300048919 Ga0496116_0018429 Ga0496116_0018429_2084_2983 299
1073 3300048919 Ga0496116_0025706 Ga0496116_0025706_887_1786 299
1074 3300048919 Ga0496116_0028412 Ga0496116_0028412_2172_3071 299
1075 3300048919 Ga0496116_0061418 Ga0496116_0061418_142_1041 299
1076 3300048919 Ga0496116_0171567 Ga0496116_0171567_32_931 299
1077 3300048920 Ga0496117_0006500 Ga0496117_0006500_5729_6628 299
1078 3300048920 Ga0496117_0017029 Ga0496117_0017029_2609_3508 299
1079 3300048920 Ga0496117_0018515 Ga0496117_0018515_2272_3171 299
1080 3300048920 Ga0496117_0024973 Ga0496117_0024973_1339_2238 299
1081 3300048920 Ga0496117_0030449 Ga0496117_0030449_698_1597 299
1082 3300048920 Ga0496117_0036558 Ga0496117_0036558_2394_3293 299
1083 3300048920 Ga0496117_0037524 Ga0496117_0037524_1807_2706 299
1084 3300048920 Ga0496117_0050656 Ga0496117_0050656_1032_1931 299
1085 3300048920 Ga0496117_0067715 Ga0496117_0067715_1028_1927 299
1086 3300048920 Ga0496117_0092587 Ga0496117_0092587_87_986 299
1087 3300048920 Ga0496117_0092825 Ga0496117_0092825_406_1305 299
1088 3300048921 Ga0496118_0031832 Ga0496118_0031832_2564_3463 299
1089 3300048921 Ga0496118_0033154 Ga0496118_0033154_727_1626 299
1090 3300048921 Ga0496118_0040995 Ga0496118_0040995_2394_3293 299
1091 3300048921 Ga0496118_0042110 Ga0496118_0042110_2548_3447 299
1092 3300048921 Ga0496118_0050786 Ga0496118_0050786_1361_2260 299
1093 3300048921 Ga0496118_0069336 Ga0496118_0069336_697_1596 299
1094 3300048921 Ga0496118_0083779 Ga0496118_0083779_700_1599 299
1095 3300048921 Ga0496118_0113771 Ga0496118_0113771_382_1281 299
1096 3300048922 Ga0496119_0021440 Ga0496119_0021440_1326_2225 299
1097 3300048922 Ga0496119_0029940 Ga0496119_0029940_1178_2077 299
1098 3300048923 Ga0496120_0015048 Ga0496120_0015048_2465_3364 299
1099 3300048923 Ga0496120_0015699 Ga0496120_0015699_1528_2427 299
1100 3300048924 Ga0496121_0014652 Ga0496121_0014652_4934_5833 299
1101 3300048924 Ga0496121_0022108 Ga0496121_0022108_2178_3077 299
1102 3300048924 Ga0496121_0054583 Ga0496121_0054583_1401_2300 299
1103 3300048924 Ga0496121_0130328 Ga0496121_0130328_692_1591 299
1104 3300048924 Ga0496121_0231312 Ga0496121_0231312_277_1176 299
1105 3300048925 Ga0496122_0021592 Ga0496122_0021592_2539_3438 299
1106 3300048925 Ga0496122_0049252 Ga0496122_0049252_1514_2413 299
1107 3300048925 Ga0496122_0061538 Ga0496122_0061538_497_1396 299
1108 3300048925 Ga0496122_0076976 Ga0496122_0076976_1271_2170 299
1109 3300048925 Ga0496122_0110047 Ga0496122_0110047_165_1064 299
1110 3300048925 Ga0496122_0164831 Ga0496122_0164831_403_1302 299
1111 3300048926 Ga0496123_0022349 Ga0496123_0022349_2459_3358 299
1112 3300048926 Ga0496123_0024029 Ga0496123_0024029_1314_2213 299
1113 3300048926 Ga0496123_0043661 Ga0496123_0043661_1474_2373 299
1114 3300048926 Ga0496123_0069220 Ga0496123_0069220_1124_2023 299
1115 3300048927 Ga0496124_0013682 Ga0496124_0013682_5471_6370 299
1116 3300048927 Ga0496124_0053014 Ga0496124_0053014_1810_2709 299
1117 3300048927 Ga0496124_0079617 Ga0496124_0079617_46_945 299
1118 3300048927 Ga0496124_0086342 Ga0496124_0086342_1189_2088 299
1119 3300048927 Ga0496124_0094804 Ga0496124_0094804_43_942 299
1120 3300048927 Ga0496124_0150082 Ga0496124_0150082_244_1143 299
1121 3300048927 Ga0496124_0202845 Ga0496124_0202845_238_1137 299
1122 3300048928 Ga0496125_0015865 Ga0496125_0015865_3757_4656 299
1123 3300048928 Ga0496125_0026454 Ga0496125_0026454_2569_3468 299
1124 3300048928 Ga0496125_0032010 Ga0496125_0032010_2449_3348 299
1125 3300048928 Ga0496125_0040318 Ga0496125_0040318_1940_2839 299
1126 3300048928 Ga0496125_0040690 Ga0496125_0040690_2634_3533 299
1127 3300048928 Ga0496125_0049097 Ga0496125_0049097_1372_2271 299
1128 3300048928 Ga0496125_0096023 Ga0496125_0096023_683_1582 299
1129 3300048928 Ga0496125_0159557 Ga0496125_0159557_165_1064 299
1130 3300048929 Ga0496126_0056657 Ga0496126_0056657_2537_3436 299
1131 3300048929 Ga0496126_0063156 Ga0496126_0063156_925_1824 299
1132 3300048929 Ga0496126_0074537 Ga0496126_0074537_1918_2817 299
1133 3300048929 Ga0496126_0115530 Ga0496126_0115530_1238_2137 299
1134 3300049459 Ga0495678_005003 Ga0495678_005003_2423_3322 299
1135 3300049459 Ga0495678_006344 Ga0495678_006344_4863_5762 299
1136 3300049459 Ga0495678_007286 Ga0495678_007286_2571_3470 299
1137 3300049459 Ga0495678_007969 Ga0495678_007969_457_1356 299
1138 3300049459 Ga0495678_015351 Ga0495678_015351_905_1804 299
1139 3300049459 Ga0495678_025182 Ga0495678_025182_1152_2051 299
1140 3300049459 Ga0495678_040233 Ga0495678_040233_948_1847 299
1141 3300049459 Ga0495678_051651 Ga0495678_051651_87_986 299
1142 3300049460 Ga0495682_0001713 Ga0495682_0001713_7080_7979 299
1143 3300049460 Ga0495682_0011732 Ga0495682_0011732_1352_2251 299
1144 3300049460 Ga0495682_0015052 Ga0495682_0015052_418_1317 299
1145 3300049460 Ga0495682_0019726 Ga0495682_0019726_482_1381 299
1146 3300049460 Ga0495682_0073658 Ga0495682_0073658_288_1187 299
1147 3300049758 Ga0501241_002825 Ga0501241_002825_827_1726 299
1148 3300050489 nmdc:mga03683_46565_c1 nmdc:mga03683_46565_c1_621_1520 299
1149 3300050491 nmdc:mga00v17_87723_c1 nmdc:mga00v17_87723_c1_873_1772 299
1150 3300053111 Ga0500572_008110 Ga0500572_008110_1163_2062 299
1151 3300053161 Ga0500634_0026777 Ga0500634_0026777_1441_2340 299
1152 iso_pu_bacteria 3007866637 3007871552 299
1153 iso_pu_bacteria 637000220 637323457 299
1154 iso_pu_bacteria 8056143049 8056143151 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01263

Aldose_epim

Aldose 1-epimerase

43

323

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2htb-assembly4.cif.gz_D crystal structure of a putative mutarotase (yead) from salmonella typhimurium in monoclinic form 0.9167 3 294
1jov-assembly1.cif.gz_A crystal structure analysis of hi1317 0.8871 3 292
2htb-assembly4.cif.gz_D crystal structure of a putative mutarotase (yead) from salmonella typhimurium in monoclinic form 0.8717 3 294
2ciq-assembly1.cif.gz_A structure-based functional annotation: yeast ymr099c codes for a d- hexose-6-phosphate mutarotase. 0.8567 7 291
1jov-assembly1.cif.gz_A crystal structure analysis of hi1317 0.8556 3 292
ID Description Score Start End Superfamily
af_A0A1P8BFM5_144_317_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9625 132 293 2.70.98.10
2htbC00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.917 6 294 2.70.98.10
af_X2JAD3_2_284_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9159 22 291 2.70.98.10
af_A0A1P8BFM5_144_317_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8925 132 293 2.70.98.10
1jovA00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8871 3 292 2.70.98.10
ID Description Score Start End GO Terms
AF-A0A367LVL2-F1-model_v4 D-hexose-6-phosphate mutarotase 0.9922 169 276 GO:0005975
GO:0016853
GO:0030246
AF-A0A5C7TRN6-F1-model_v4 deleted 0.9895 149 294
AF-A0A8B3GCL7-F1-model_v4 deleted 0.9877 66 294
AF-A0A4R0PJ47-F1-model_v4 deleted 0.9847 3 294
AF-A0A7C9DYP3-F1-model_v4 Glucose-6-phosphate 1-epimerase (EC 5.1.3.15) 0.9844 178 268 GO:0005737
GO:0005975
GO:0030246
GO:0047938

Feature Viewer

pLDDT pTM Quality
96.28 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map