F490694

General Info

Members Datasets Scaffolds Average Seq Length
1140 443 1124 291

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10057663|Ga0099794_100576632
Length 330
Sequence LLAFRHAICSVVLSNDVSNFAFARNDQQKNSAMNFFLTIILDGLIQASWLFIVALGLTLVFGVLKILNIAHGSFYALGAYIAATAVTTVAAHSLPPSVGFVAMLVSVALIASAVGLLLERGLLKMFYGRDEVVLLLVTYAVFLILEDVTKLIWGVNPIYATQPYELFGTLQFAGLYYVGYDLVLLPISAAIGFAVWFGLNRTITGKIVLAVIHNEEMSVSMGVRVNRVYAVAFAFGVLLAATAGALTAPKISMQPGLSSDVIILSFAIVVIGGLGSVEGAAVGAILVGLARAASVHLMPQAELFMIYLIMAAVLMFRPEGLFKRETARRI

Samples

Sample ID Description Type Environment
1 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
2 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
3 2791355199
4 2842733646 Variovorax sp. R-72446 Isolate Unclassified
5 2842747753 Variovorax sp. R-72060 Isolate Unclassified
6 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
7 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
8 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
9 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
10 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
11 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
12 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
13 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
118 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
217 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
225 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
237 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
238 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
239 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
245 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
246 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
247 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
248 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
251 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
253 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
255 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
264 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
265 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
266 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
267 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
268 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
269 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
270 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
271 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
272 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
273 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
274 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
275 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
276 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
277 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
278 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
286 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
294 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
295 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
296 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
299 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
300 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
301 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
302 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
303 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
304 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
305 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
306 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
307 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
308 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
309 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
310 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
311 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
312 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
313 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
314 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
315 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
316 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
317 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
318 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
319 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
320 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
325 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
326 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
327 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
328 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
329 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
330 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
333 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
334 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
335 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
336 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
337 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
338 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
339 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
340 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
341 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
342 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
343 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
347 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
348 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
349 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
350 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
351 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
352 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
353 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
354 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
355 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
356 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
357 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
358 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
359 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
360 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
361 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
362 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
363 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
364 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
365 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
366 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
369 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
370 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
374 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
375 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
376 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
377 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
388 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
389 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
390 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
391 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
392 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
393 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
394 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
395 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
396 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
397 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
398 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
399 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
400 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
401 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
402 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
403 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
404 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
405 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
406 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
407 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
408 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
409 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
410 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
411 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
412 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
413 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
414 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
415 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
416 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
417 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
418 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
419 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
420 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
421 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
422 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
423 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
424 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
425 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
426 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
427 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
428 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
429 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
430 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
431 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
432 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
433 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
434 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
435 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
436 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
437 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
438 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
439 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
440 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
441 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
442 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
443 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 0.18
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.56
Nodule 0.26
Rhizoplane 4.56
Rhizosphere 87.37
Stem 0
Stem Tuber 0
Unclassified 3.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1004067 3300002070 Bacteria 1765
2 rootH1_10104906 3300003323 Bacteria 2692
3 JGI25404J52841_10004946 3300003659 Bacteria 2736
4 JGI25404J52841_10006150 3300003659 Bacteria 2500
5 JGI25404J52841_10008111 3300003659 Bacteria 2231
6 JGI25405J52794_10001742 3300003911 Unclassified 3632
7 Ga0070658_10084120 3300005327 Bacteria 2616
8 Ga0070676_10022298 3300005328 Bacteria 3550
9 Ga0070676_10045892 3300005328 Bacteria 2546
10 Ga0070683_100007447 3300005329 Bacteria 9247
11 Ga0070683_100021476 3300005329 Bacteria 5763
12 Ga0070683_100160001 3300005329 Bacteria 2136
13 Ga0070683_100168615 3300005329 Bacteria 2078
14 Ga0070683_100530265 3300005329 Bacteria 1125
15 Ga0070690_100000399 3300005330 Bacteria 21981
16 Ga0070690_100048374 3300005330 Bacteria 2708
17 Ga0070690_100117188 3300005330 Bacteria 1784
18 Ga0070670_100000922 3300005331 Bacteria 23101
19 Ga0070670_100030097 3300005331 Bacteria 4675
20 Ga0070670_100055450 3300005331 Bacteria 3402
21 Ga0070677_10024124 3300005333 Bacteria 2259
22 Ga0070677_10049495 3300005333 Bacteria 1692
23 Ga0068869_100003219 3300005334 Bacteria 9981
24 Ga0068869_100006651 3300005334 Bacteria 7341
25 Ga0068869_100026483 3300005334 Bacteria 4037
26 Ga0068869_100117287 3300005334 Bacteria 2032
27 Ga0068869_100290236 3300005334 Bacteria 1318
28 Ga0070666_10002324 3300005335 Bacteria 11490
29 Ga0070666_10204326 3300005335 Bacteria 1390
30 Ga0070680_100021711 3300005336 Bacteria 5105
31 Ga0070680_100044919 3300005336 Bacteria 3591
32 Ga0070680_100271745 3300005336 Bacteria 1435
33 Ga0070682_100049722 3300005337 Bacteria 2615
34 Ga0070682_100146291 3300005337 Bacteria 1616
35 Ga0070682_100158271 3300005337 Bacteria 1562
36 Ga0068868_100000189 3300005338 Bacteria 41014
37 Ga0068868_100010035 3300005338 Bacteria 6842
38 Ga0068868_100199466 3300005338 Bacteria 1667
39 Ga0068868_100223016 3300005338 Bacteria 1579
40 Ga0068868_100238981 3300005338 Bacteria 1525
41 Ga0070660_100003956 3300005339 Bacteria 10238
42 Ga0070660_100095014 3300005339 Bacteria 2356
43 Ga0070660_100321134 3300005339 Bacteria 1272
44 Ga0070689_100004701 3300005340 Bacteria 9260
45 Ga0070689_100021719 3300005340 Bacteria 4784
46 Ga0070691_10006502 3300005341 Bacteria 5344
47 Ga0070687_100127302 3300005343 Bacteria 1466
48 Ga0070687_100128137 3300005343 Bacteria 1462
49 Ga0070687_100248206 3300005343 Bacteria 1104
50 Ga0070661_100082837 3300005344 Bacteria 2369
51 Ga0070692_10008809 3300005345 Bacteria 4516
52 Ga0070692_10013225 3300005345 Bacteria 3843
53 Ga0070692_10081406 3300005345 Bacteria 1745
54 Ga0070668_100023686 3300005347 Bacteria 4646
55 Ga0070668_100025239 3300005347 Bacteria 4504
56 Ga0070668_100031806 3300005347 Bacteria 4015
57 Ga0070668_100216582 3300005347 Bacteria 1577
58 Ga0070669_100007163 3300005353 Bacteria 8015
59 Ga0070669_100097613 3300005353 Bacteria 2212
60 Ga0070669_100100811 3300005353 Bacteria 2178
61 Ga0070669_100101253 3300005353 Bacteria 2173
62 Ga0070669_100266355 3300005353 Bacteria 1369
63 Ga0070669_100289500 3300005353 Bacteria 1314
64 Ga0070675_100000563 3300005354 Bacteria 25564
65 Ga0070675_100002677 3300005354 Bacteria 13386
66 Ga0070675_100041355 3300005354 Bacteria 3765
67 Ga0070675_100042797 3300005354 Bacteria 3701
68 Ga0070675_100267858 3300005354 Bacteria 1498
69 Ga0070671_100012832 3300005355 Bacteria 6756
70 Ga0070671_100021121 3300005355 Bacteria 5316
71 Ga0070671_100096376 3300005355 Bacteria 2481
72 Ga0070674_100095783 3300005356 Bacteria 2152
73 Ga0070673_100001225 3300005364 Bacteria 14841
74 Ga0070673_100056985 3300005364 Bacteria 3085
75 Ga0070673_100285571 3300005364 Bacteria 1449
76 Ga0070673_100394101 3300005364 Unclassified 1237
77 Ga0070673_100406033 3300005364 Bacteria 1219
78 Ga0070673_100434033 3300005364 Bacteria 1179
79 Ga0070688_100017560 3300005365 Bacteria 4109
80 Ga0070688_100149275 3300005365 Bacteria 1596
81 Ga0070688_100151470 3300005365 Bacteria 1586
82 Ga0070659_100009066 3300005366 Bacteria 7300
83 Ga0070659_100063230 3300005366 Bacteria 2928
84 Ga0070659_100064853 3300005366 Bacteria 2892
85 Ga0070659_100099403 3300005366 Bacteria 2340
86 Ga0070659_100204556 3300005366 Unclassified 1626
87 Ga0070667_100001024 3300005367 Bacteria 25540
88 Ga0070667_100015983 3300005367 Bacteria 6209
89 Ga0070667_100084563 3300005367 Bacteria 2720
90 Ga0070667_100151586 3300005367 Bacteria 2037
91 Ga0070709_10167893 3300005434 Bacteria 1531
92 Ga0070709_10168140 3300005434 Bacteria 1530
93 Ga0070714_100082979 3300005435 Bacteria 2793
94 Ga0070714_100181421 3300005435 Unclassified 1916
95 Ga0070713_100018535 3300005436 Bacteria 5290
96 Ga0070713_100103117 3300005436 Unclassified 2475
97 Ga0070713_100384562 3300005436 Bacteria 1308
98 Ga0070710_10012418 3300005437 Bacteria 4230
99 Ga0070710_10025349 3300005437 Unclassified 3140
100 Ga0070710_10031115 3300005437 Bacteria 2877
101 Ga0070701_10000752 3300005438 Bacteria 11518
102 Ga0070701_10111869 3300005438 Bacteria 1527
103 Ga0070711_100011490 3300005439 Bacteria 5500
104 Ga0070711_100065709 3300005439 Bacteria 2538
105 Ga0070705_100007429 3300005440 Bacteria 5391
106 Ga0070705_100058565 3300005440 Bacteria 2277
107 Ga0070705_100278045 3300005440 Bacteria 1189
108 Ga0070700_100000925 3300005441 Bacteria 14513
109 Ga0070700_100131998 3300005441 Bacteria 1687
110 Ga0070694_100025958 3300005444 Bacteria 3794
111 Ga0070708_100199227 3300005445 Bacteria 1874
112 Ga0070663_100046461 3300005455 Bacteria 3072
113 Ga0070663_100049930 3300005455 Bacteria 2974
114 Ga0070663_100100390 3300005455 Bacteria 2159
115 Ga0070663_100124743 3300005455 Bacteria 1949
116 Ga0070663_100140237 3300005455 Bacteria 1845
117 Ga0070663_100307727 3300005455 Bacteria 1270
118 Ga0070678_100007403 3300005456 Bacteria 6508
119 Ga0070678_100025200 3300005456 Bacteria 3997
120 Ga0070678_100037245 3300005456 Bacteria 3414
121 Ga0070678_100057699 3300005456 Bacteria 2846
122 Ga0070678_100092852 3300005456 Bacteria 2319
123 Ga0070662_100159262 3300005457 Unclassified 1765
124 Ga0070681_10018365 3300005458 Bacteria 6989
125 Ga0070681_10070398 3300005458 Bacteria 3463
126 Ga0070681_10097072 3300005458 Bacteria 2894
127 Ga0070681_10144278 3300005458 Bacteria 2310
128 Ga0070681_10211631 3300005458 Bacteria 1855
129 Ga0068867_100006149 3300005459 Bacteria 8500
130 Ga0068867_100089100 3300005459 Bacteria 2339
131 Ga0068867_100099061 3300005459 Bacteria 2223
132 Ga0068867_100273901 3300005459 Bacteria 1381
133 Ga0070685_10015529 3300005466 Bacteria 4045
134 Ga0070685_10025496 3300005466 Bacteria 3256
135 Ga0070685_10137422 3300005466 Bacteria 1535
136 Ga0070706_100516414 3300005467 Bacteria 1111
137 Ga0070707_100341436 3300005468 Bacteria 1455
138 Ga0070707_100422316 3300005468 Bacteria 1294
139 Ga0070699_100000906 3300005518 Bacteria 27657
140 Ga0070699_100023230 3300005518 Bacteria 5341
141 Ga0070699_100305293 3300005518 Bacteria 1428
142 Ga0070679_100005441 3300005530 Bacteria 11805
143 Ga0070679_100015823 3300005530 Bacteria 7258
144 Ga0070679_100024448 3300005530 Bacteria 5919
145 Ga0070679_100184090 3300005530 Bacteria 2060
146 Ga0070679_100238268 3300005530 Bacteria 1778
147 Ga0070679_100244858 3300005530 Bacteria 1750
148 Ga0070684_100007885 3300005535 Bacteria 8305
149 Ga0070684_100386411 3300005535 Bacteria 1289
150 Ga0070697_100005574 3300005536 Bacteria 9706
151 Ga0070697_100070715 3300005536 Bacteria 2861
152 Ga0068853_100026014 3300005539 Bacteria 4912
153 Ga0068853_100139481 3300005539 Bacteria 2176
154 Ga0070672_100001036 3300005543 Bacteria 16922
155 Ga0070672_100055373 3300005543 Bacteria 3107
156 Ga0070672_100061105 3300005543 Bacteria 2969
157 Ga0070672_100176970 3300005543 Bacteria 1776
158 Ga0070672_100251519 3300005543 Bacteria 1488
159 Ga0070686_100000177 3300005544 Bacteria 44963
160 Ga0070686_100184150 3300005544 Bacteria 1486
161 Ga0070695_100047657 3300005545 Bacteria 2738
162 Ga0070695_100120853 3300005545 Bacteria 1792
163 Ga0070696_100047841 3300005546 Bacteria 2968
164 Ga0070696_100054698 3300005546 Bacteria 2782
165 Ga0070693_100043604 3300005547 Bacteria 2534
166 Ga0070693_100094607 3300005547 Bacteria 1808
167 Ga0070693_100106228 3300005547 Unclassified 1719
168 Ga0070693_100265944 3300005547 Bacteria 1143
169 Ga0070665_100007828 3300005548 Bacteria 10840
170 Ga0070665_100148762 3300005548 Bacteria 2345
171 Ga0070665_100164423 3300005548 Bacteria 2221
172 Ga0070665_100182079 3300005548 Bacteria 2102
173 Ga0070665_100471820 3300005548 Bacteria 1265
174 Ga0070665_100491677 3300005548 Bacteria 1238
175 Ga0070704_100037598 3300005549 Bacteria 3309
176 Ga0068855_100012729 3300005563 Bacteria 10146
177 Ga0068855_100064508 3300005563 Bacteria 4271
178 Ga0068855_100100124 3300005563 Bacteria 3337
179 Ga0068855_100348945 3300005563 Bacteria 1630
180 Ga0070664_100118640 3300005564 Bacteria 2314
181 Ga0070664_100163670 3300005564 Bacteria 1970
182 Ga0070664_100185844 3300005564 Bacteria 1849
183 Ga0068857_100006104 3300005577 Bacteria 10293
184 Ga0068857_100029484 3300005577 Bacteria 4842
185 Ga0068857_100294722 3300005577 Bacteria 1494
186 Ga0068854_100119452 3300005578 Bacteria 1999
187 Ga0068856_100015300 3300005614 Bacteria 7414
188 Ga0068856_100037984 3300005614 Bacteria 4726
189 Ga0068856_100063577 3300005614 Bacteria 3646
190 Ga0068856_100070922 3300005614 Bacteria 3448
191 Ga0068856_100098205 3300005614 Bacteria 2918
192 Ga0068856_100287268 3300005614 Bacteria 1662
193 Ga0068856_100444505 3300005614 Bacteria 1317
194 Ga0070702_100000094 3300005615 Bacteria 26453
195 Ga0070702_100211269 3300005615 Bacteria 1292
196 Ga0068852_100120955 3300005616 Bacteria 2397
197 Ga0068852_100127348 3300005616 Bacteria 2340
198 Ga0068859_100003487 3300005617 Bacteria 16012
199 Ga0068859_100052149 3300005617 Bacteria 4112
200 Ga0068859_100081825 3300005617 Bacteria 3271
201 Ga0068859_100103458 3300005617 Bacteria 2905
202 Ga0068859_100132092 3300005617 Bacteria 2568
203 Ga0068859_100422291 3300005617 Bacteria 1429
204 Ga0068859_100434222 3300005617 Bacteria 1410
205 Ga0068864_100002453 3300005618 Bacteria 15310
206 Ga0068864_100006881 3300005618 Bacteria 9318
207 Ga0068864_100043158 3300005618 Bacteria 3860
208 Ga0068864_100163901 3300005618 Bacteria 2022
209 Ga0068864_100585237 3300005618 Bacteria 1082
210 Ga0068866_10002364 3300005718 Bacteria 7824
211 Ga0068866_10017758 3300005718 Bacteria 3204
212 Ga0068861_100000255 3300005719 Bacteria 29611
213 Ga0068861_100005129 3300005719 Bacteria 8829
214 Ga0068861_100067328 3300005719 Bacteria 2763
215 Ga0068851_10004859 3300005834 Bacteria 6084
216 Ga0068851_10116012 3300005834 Bacteria 1435
217 Ga0068851_10212202 3300005834 Bacteria 1084
218 Ga0068870_10004257 3300005840 Bacteria 6152
219 Ga0068870_10135986 3300005840 Bacteria 1433
220 Ga0068870_10146502 3300005840 Bacteria 1387
221 Ga0068863_100006441 3300005841 Bacteria 11514
222 Ga0068863_100043780 3300005841 Bacteria 4249
223 Ga0068863_100139191 3300005841 Bacteria 2319
224 Ga0068863_100251345 3300005841 Bacteria 1708
225 Ga0068858_100000882 3300005842 Bacteria 31130
226 Ga0068858_100001789 3300005842 Bacteria 21923
227 Ga0068858_100080687 3300005842 Bacteria 3023
228 Ga0068858_100406802 3300005842 Bacteria 1308
229 Ga0068860_100000302 3300005843 Bacteria 68581
230 Ga0068860_100003206 3300005843 Bacteria 16886
231 Ga0068860_100006654 3300005843 Bacteria 11606
232 Ga0068860_100007353 3300005843 Bacteria 11010
233 Ga0068860_100008918 3300005843 Bacteria 9993
234 Ga0068862_100007694 3300005844 Bacteria 8914
235 Ga0068862_100014806 3300005844 Bacteria 6478
236 Ga0068862_100021668 3300005844 Bacteria 5373
237 Ga0068862_100044997 3300005844 Bacteria 3765
238 Ga0068862_100097221 3300005844 Bacteria 2570
239 Ga0068862_100161893 3300005844 Bacteria 1998
240 Ga0068862_100193274 3300005844 Bacteria 1832
241 Ga0081455_10000968 3300005937 Bacteria 36782
242 Ga0081455_10001667 3300005937 Bacteria 26919
243 Ga0081455_10001790 3300005937 Bacteria 25948
244 Ga0081455_10008173 3300005937 Bacteria 10912
245 Ga0081455_10155344 3300005937 Bacteria 1759
246 Ga0081455_10318319 3300005937 Bacteria 1109
247 Ga0081538_10003075 3300005981 Bacteria 15874
248 Ga0081538_10022297 3300005981 Unclassified 4591
249 Ga0081538_10032479 3300005981 Bacteria 3496
250 Ga0081538_10056445 3300005981 Bacteria 2300
251 Ga0081538_10058242 3300005981 Bacteria 2243
252 Ga0081540_1000918 3300005983 Bacteria 26491
253 Ga0081540_1002732 3300005983 Bacteria 14358
254 Ga0081540_1002906 3300005983 Bacteria 13809
255 Ga0081540_1006154 3300005983 Bacteria 8804
256 Ga0081540_1006733 3300005983 Bacteria 8312
257 Ga0081540_1010879 3300005983 Bacteria 6111
258 Ga0081540_1028665 3300005983 Bacteria 3121
259 Ga0081539_10000003 3300005985 Bacteria 594833
260 Ga0081539_10000584 3300005985 Bacteria 74942
261 Ga0081539_10027501 3300005985 Bacteria 3600
262 Ga0081539_10038599 3300005985 Bacteria 2828
263 Ga0070717_10012536 3300006028 Bacteria 6465
264 Ga0075365_10032976 3300006038 Bacteria 3333
265 Ga0075365_10064463 3300006038 Bacteria 2455
266 Ga0075365_10075634 3300006038 Bacteria 2273
267 Ga0075365_10246597 3300006038 Bacteria 1254
268 Ga0075368_10007386 3300006042 Bacteria 3876
269 Ga0075363_100000768 3300006048 Bacteria 11015
270 Ga0075363_100015561 3300006048 Bacteria 3741
271 Ga0075363_100018197 3300006048 Bacteria 3495
272 Ga0070712_100001605 3300006175 Bacteria 13817
273 Ga0070712_100009301 3300006175 Bacteria 6191
274 Ga0070712_100088811 3300006175 Bacteria 2259
275 Ga0070712_100172220 3300006175 Unclassified 1681
276 Ga0070712_100230857 3300006175 Bacteria 1469
277 Ga0075362_10136798 3300006177 Bacteria 1169
278 Ga0075367_10019341 3300006178 Bacteria 3775
279 Ga0075367_10048909 3300006178 Bacteria 2492
280 Ga0075369_10005272 3300006186 Bacteria 4821
281 Ga0075366_10009755 3300006195 Bacteria 5369
282 Ga0075366_10010651 3300006195 Bacteria 5167
283 Ga0075366_10020528 3300006195 Bacteria 3834
284 Ga0075366_10123714 3300006195 Bacteria 1559
285 Ga0097621_100022442 3300006237 Bacteria 4900
286 Ga0097621_100028036 3300006237 Bacteria 4435
287 Ga0097621_100032753 3300006237 Bacteria 4133
288 Ga0097621_100097681 3300006237 Bacteria 2466
289 Ga0097621_100274093 3300006237 Bacteria 1483
290 Ga0075370_10004796 3300006353 Bacteria 6624
291 Ga0075370_10062814 3300006353 Bacteria 2116
292 Ga0075370_10125906 3300006353 Bacteria 1493
293 Ga0068871_100007550 3300006358 Bacteria 7779
294 Ga0068871_100026378 3300006358 Bacteria 4533
295 Ga0068871_100029904 3300006358 Bacteria 4284
296 Ga0068871_100046138 3300006358 Bacteria 3509
297 Ga0068871_100061174 3300006358 Bacteria 3074
298 Ga0068871_100289553 3300006358 Bacteria 1435
299 Ga0068871_100304888 3300006358 Bacteria 1399
300 Ga0075428_100066041 3300006844 Bacteria 3962
301 Ga0075428_100164692 3300006844 Bacteria 2405
302 Ga0075428_100482384 3300006844 Bacteria 1327
303 Ga0075430_100009372 3300006846 Bacteria 8276
304 Ga0075430_100037653 3300006846 Bacteria 4100
305 Ga0075430_100206074 3300006846 Bacteria 1632
306 Ga0075431_100053369 3300006847 Unclassified 4168
307 Ga0075431_100219242 3300006847 Bacteria 1941
308 Ga0075433_10158585 3300006852 Unclassified 2013
309 Ga0075434_100011947 3300006871 Bacteria 8214
310 Ga0075434_100373067 3300006871 Bacteria 1448
311 Ga0075429_100002916 3300006880 Bacteria 14508
312 Ga0075429_100056334 3300006880 Bacteria 3421
313 Ga0068865_100000317 3300006881 Bacteria 26703
314 Ga0068865_100008577 3300006881 Bacteria 6319
315 Ga0068865_100009177 3300006881 Bacteria 6121
316 Ga0068865_100058984 3300006881 Bacteria 2683
317 Ga0068865_100095914 3300006881 Bacteria 2162
318 Ga0068865_100112089 3300006881 Bacteria 2014
319 Ga0068865_100277349 3300006881 Bacteria 1333
320 Ga0075436_100046979 3300006914 Bacteria 2977
321 Ga0097620_100003487 3300006931 Bacteria 16012
322 Ga0097620_100052151 3300006931 Bacteria 4112
323 Ga0097620_100081827 3300006931 Bacteria 3271
324 Ga0097620_100103453 3300006931 Bacteria 2905
325 Ga0097620_100132099 3300006931 Bacteria 2568
326 Ga0097620_100422278 3300006931 Bacteria 1429
327 Ga0097620_100434208 3300006931 Bacteria 1410
328 Ga0075435_100037025 3300007076 Bacteria 3883
329 Ga0075435_100470637 3300007076 Bacteria 1085
330 Ga0099794_10057663 3300007265 Bacteria 1882
331 Ga0099795_10107426 3300007788 Bacteria 1102
332 Ga0105240_10019274 3300009093 Bacteria 9118
333 Ga0105240_10036890 3300009093 Bacteria 6285
334 Ga0105240_10121831 3300009093 Bacteria 3140
335 Ga0105240_10155110 3300009093 Bacteria 2724
336 Ga0111539_10125112 3300009094 Bacteria 3013
337 Ga0111539_10226850 3300009094 Unclassified 2176
338 Ga0111539_10303506 3300009094 Bacteria 1858
339 Ga0111539_10541322 3300009094 Bacteria 1356
340 Ga0105245_10000323 3300009098 Bacteria 45144
341 Ga0105245_10072790 3300009098 Bacteria 3123
342 Ga0105245_10158197 3300009098 Bacteria 2148
343 Ga0105245_10363627 3300009098 Bacteria 1437
344 Ga0105245_10441284 3300009098 Bacteria 1308
345 Ga0105247_10116428 3300009101 Bacteria 1726
346 Ga0105247_10255586 3300009101 Bacteria 1199
347 Ga0114129_10203550 3300009147 Bacteria 2680
348 Ga0114129_10245029 3300009147 Bacteria 2408
349 Ga0105243_10004705 3300009148 Bacteria 10745
350 Ga0105243_10042633 3300009148 Bacteria 3553
351 Ga0105243_10043295 3300009148 Bacteria 3528
352 Ga0105243_10045697 3300009148 Bacteria 3442
353 Ga0105243_10238117 3300009148 Bacteria 1618
354 Ga0105243_10307624 3300009148 Bacteria 1439
355 Ga0105241_10009325 3300009174 Bacteria 7213
356 Ga0105241_10039823 3300009174 Bacteria 3546
357 Ga0105241_10125477 3300009174 Bacteria 2072
358 Ga0105241_10336513 3300009174 Bacteria 1306
359 Ga0105242_10000119 3300009176 Bacteria 57821
360 Ga0105242_10034121 3300009176 Bacteria 4079
361 Ga0105242_10114505 3300009176 Bacteria 2304
362 Ga0105242_10196837 3300009176 Bacteria 1787
363 Ga0105242_10262622 3300009176 Bacteria 1560
364 Ga0105242_10413550 3300009176 Bacteria 1262
365 Ga0105248_10006375 3300009177 Bacteria 12948
366 Ga0105248_10007036 3300009177 Bacteria 12323
367 Ga0105248_10045176 3300009177 Bacteria 4940
368 Ga0105248_10096833 3300009177 Bacteria 3324
369 Ga0105248_10179018 3300009177 Bacteria 2389
370 Ga0105248_10198013 3300009177 Bacteria 2263
371 Ga0105248_10433449 3300009177 Bacteria 1480
372 Ga0105237_10002097 3300009545 Bacteria 25173
373 Ga0105237_10007055 3300009545 Bacteria 12357
374 Ga0105237_10092735 3300009545 Bacteria 3010
375 Ga0105237_10190859 3300009545 Bacteria 2049
376 Ga0105237_10380563 3300009545 Bacteria 1416
377 Ga0105238_10040046 3300009551 Bacteria 4750
378 Ga0105238_10050623 3300009551 Bacteria 4181
379 Ga0105238_10116126 3300009551 Bacteria 2656
380 Ga0105238_10122535 3300009551 Bacteria 2579
381 Ga0105249_10046861 3300009553 Bacteria 3936
382 Ga0105249_10101318 3300009553 Bacteria 2708
383 Ga0105239_10026973 3300010375 Bacteria 6323
384 Ga0105239_10036659 3300010375 Bacteria 5382
385 Ga0105239_10042969 3300010375 Bacteria 4952
386 Ga0105239_10060691 3300010375 Bacteria 4150
387 Ga0105239_10150422 3300010375 Bacteria 2598
388 Ga0105239_10155976 3300010375 Bacteria 2549
389 Ga0105239_10253889 3300010375 Bacteria 1975
390 Ga0105239_10372036 3300010375 Bacteria 1615
391 Ga0105246_10003792 3300011119 Bacteria 9157
392 Ga0105246_10093953 3300011119 Bacteria 2168
393 Ga0105246_10104278 3300011119 Bacteria 2070
394 Ga0157373_10111980 3300013100 Bacteria 1918
395 Ga0157370_10202684 3300013104 Bacteria 1840
396 Ga0157370_10234242 3300013104 Bacteria 1699
397 Ga0157370_10418514 3300013104 Bacteria 1233
398 Ga0157369_10010807 3300013105 Bacteria 10395
399 Ga0157369_10072885 3300013105 Bacteria 3685
400 Ga0157374_10073380 3300013296 Bacteria 3230
401 Ga0157374_10216405 3300013296 Bacteria 1879
402 Ga0157374_10222441 3300013296 Unclassified 1853
403 Ga0157374_10293938 3300013296 Bacteria 1606
404 Ga0157374_10678076 3300013296 Bacteria 1043
405 Ga0157378_10004288 3300013297 Bacteria 12556
406 Ga0157378_10071649 3300013297 Bacteria 3113
407 Ga0157378_10099948 3300013297 Bacteria 2647
408 Ga0157378_10137580 3300013297 Bacteria 2265
409 Ga0163162_10001712 3300013306 Bacteria 20568
410 Ga0163162_10011141 3300013306 Bacteria 8759
411 Ga0163162_10054125 3300013306 Bacteria 4035
412 Ga0163162_10102512 3300013306 Bacteria 2955
413 Ga0163162_10108835 3300013306 Bacteria 2868
414 Ga0163162_10333118 3300013306 Bacteria 1650
415 Ga0163162_10377368 3300013306 Bacteria 1551
416 Ga0163162_10419638 3300013306 Bacteria 1470
417 Ga0157372_10200865 3300013307 Bacteria 2309
418 Ga0157375_10014793 3300013308 Bacteria 6971
419 Ga0157375_10028867 3300013308 Bacteria 5208
420 Ga0157375_10102445 3300013308 Bacteria 2948
421 Ga0157375_10113225 3300013308 Bacteria 2814
422 Ga0157375_10242881 3300013308 Bacteria 1960
423 Ga0163163_10001152 3300014325 Bacteria 22458
424 Ga0163163_10009357 3300014325 Bacteria 8746
425 Ga0157380_10001047 3300014326 Bacteria 17691
426 Ga0157380_10020930 3300014326 Bacteria 4899
427 Ga0157380_10103136 3300014326 Bacteria 2380
428 Ga0157380_10117387 3300014326 Bacteria 2247
429 Ga0157380_10208896 3300014326 Bacteria 1738
430 Ga0157377_10091774 3300014745 Bacteria 1795
431 Ga0157377_10178989 3300014745 Bacteria 1332
432 Ga0157379_10019335 3300014968 Bacteria 6016
433 Ga0157379_10021311 3300014968 Bacteria 5735
434 Ga0157379_10029784 3300014968 Bacteria 4854
435 Ga0157379_10049919 3300014968 Bacteria 3736
436 Ga0157376_10010081 3300014969 Bacteria 6898
437 Ga0157376_10096191 3300014969 Bacteria 2577
438 Ga0157376_10106888 3300014969 Bacteria 2456
439 Ga0157376_10139013 3300014969 Bacteria 2176
440 Ga0182007_10045162 3300015262 Bacteria 1461
441 Ga0163161_10017226 3300017792 Bacteria 5054
442 Ga0163161_10091129 3300017792 Bacteria 2256
443 Ga0163161_10112784 3300017792 Bacteria 2034
444 Ga0163161_10124455 3300017792 Bacteria 1940
445 Ga0163161_10240465 3300017792 Bacteria 1408
446 Ga0206356_11210809 3300020070 Bacteria 1870
447 Ga0209758_1006809 3300025297 Bacteria 8016
448 Ga0209758_1033890 3300025297 Bacteria 2042
449 Ga0207656_10031875 3300025321 Bacteria 2187
450 Ga0207682_10019898 3300025893 Bacteria 2632
451 Ga0207682_10035323 3300025893 Bacteria 2019
452 Ga0207682_10046526 3300025893 Bacteria 1783
453 Ga0207682_10059797 3300025893 Bacteria 1593
454 Ga0207692_10013406 3300025898 Bacteria 3556
455 Ga0207692_10018759 3300025898 Bacteria 3112
456 Ga0207692_10163200 3300025898 Bacteria 1285
457 Ga0207642_10003256 3300025899 Bacteria 5104
458 Ga0207642_10051002 3300025899 Bacteria 1870
459 Ga0207688_10011915 3300025901 Bacteria 4732
460 Ga0207688_10017227 3300025901 Bacteria 3926
461 Ga0207688_10162648 3300025901 Bacteria 1324
462 Ga0207688_10191417 3300025901 Bacteria 1223
463 Ga0207680_10075576 3300025903 Bacteria 2101
464 Ga0207680_10289196 3300025903 Bacteria 1140
465 Ga0207647_10110360 3300025904 Bacteria 1626
466 Ga0207699_10071132 3300025906 Bacteria 2126
467 Ga0207699_10268654 3300025906 Unclassified 1181
468 Ga0207645_10005151 3300025907 Bacteria 9557
469 Ga0207645_10051548 3300025907 Bacteria 2629
470 Ga0207643_10002576 3300025908 Bacteria 9821
471 Ga0207643_10066324 3300025908 Bacteria 2070
472 Ga0207705_10176951 3300025909 Bacteria 1609
473 Ga0207705_10218937 3300025909 Bacteria 1445
474 Ga0207705_10263041 3300025909 Bacteria 1317
475 Ga0207684_10367900 3300025910 Bacteria 1237
476 Ga0207654_10060678 3300025911 Bacteria 2210
477 Ga0207654_10124524 3300025911 Bacteria 1623
478 Ga0207707_10005157 3300025912 Bacteria 11449
479 Ga0207707_10051453 3300025912 Bacteria 3587
480 Ga0207707_10143731 3300025912 Bacteria 2085
481 Ga0207695_10047693 3300025913 Bacteria 4530
482 Ga0207695_10210322 3300025913 Bacteria 1856
483 Ga0207671_10010943 3300025914 Bacteria 7432
484 Ga0207671_10143186 3300025914 Bacteria 1843
485 Ga0207671_10185346 3300025914 Bacteria 1621
486 Ga0207693_10002797 3300025915 Bacteria 15119
487 Ga0207693_10003058 3300025915 Bacteria 14443
488 Ga0207693_10008767 3300025915 Bacteria 8266
489 Ga0207693_10126449 3300025915 Bacteria 2009
490 Ga0207663_10007369 3300025916 Bacteria 5702
491 Ga0207660_10008675 3300025917 Bacteria 6574
492 Ga0207660_10023568 3300025917 Bacteria 4158
493 Ga0207662_10078419 3300025918 Bacteria 2011
494 Ga0207662_10200822 3300025918 Bacteria 1290
495 Ga0207657_10002580 3300025919 Bacteria 19599
496 Ga0207657_10029442 3300025919 Bacteria 4999
497 Ga0207657_10033072 3300025919 Bacteria 4666
498 Ga0207657_10197162 3300025919 Bacteria 1622
499 Ga0207649_10022375 3300025920 Bacteria 3651
500 Ga0207652_10018208 3300025921 Bacteria 5758
501 Ga0207652_10056860 3300025921 Bacteria 3368
502 Ga0207652_10073660 3300025921 Bacteria 2972
503 Ga0207646_10378165 3300025922 Bacteria 1279
504 Ga0207646_10411054 3300025922 Bacteria 1222
505 Ga0207681_10019750 3300025923 Bacteria 4262
506 Ga0207681_10223188 3300025923 Bacteria 1459
507 Ga0207681_10260967 3300025923 Bacteria 1356
508 Ga0207650_10003930 3300025925 Bacteria 10170
509 Ga0207650_10091540 3300025925 Bacteria 2324
510 Ga0207659_10000474 3300025926 Bacteria 24112
511 Ga0207659_10006781 3300025926 Bacteria 7038
512 Ga0207659_10054332 3300025926 Bacteria 2860
513 Ga0207687_10003182 3300025927 Bacteria 11136
514 Ga0207687_10052004 3300025927 Bacteria 2858
515 Ga0207687_10133337 3300025927 Bacteria 1875
516 Ga0207687_10140340 3300025927 Bacteria 1832
517 Ga0207700_10002090 3300025928 Bacteria 11393
518 Ga0207700_10033262 3300025928 Bacteria 3688
519 Ga0207700_10049876 3300025928 Bacteria 3116
520 Ga0207700_10139168 3300025928 Bacteria 1992
521 Ga0207664_10156303 3300025929 Unclassified 1942
522 Ga0207664_10367695 3300025929 Bacteria 1275
523 Ga0207644_10001390 3300025931 Bacteria 15619
524 Ga0207644_10004154 3300025931 Bacteria 9392
525 Ga0207644_10020806 3300025931 Bacteria 4463
526 Ga0207644_10063836 3300025931 Bacteria 2675
527 Ga0207644_10074277 3300025931 Unclassified 2495
528 Ga0207644_10085265 3300025931 Bacteria 2343
529 Ga0207690_10077325 3300025932 Bacteria 2313
530 Ga0207690_10174690 3300025932 Bacteria 1612
531 Ga0207690_10233670 3300025932 Unclassified 1413
532 Ga0207706_10036842 3300025933 Bacteria 4345
533 Ga0207686_10002522 3300025934 Bacteria 9945
534 Ga0207686_10089612 3300025934 Bacteria 2028
535 Ga0207686_10116269 3300025934 Bacteria 1813
536 Ga0207686_10155950 3300025934 Bacteria 1595
537 Ga0207709_10000932 3300025935 Bacteria 22017
538 Ga0207709_10021278 3300025935 Bacteria 3671
539 Ga0207709_10191740 3300025935 Bacteria 1452
540 Ga0207670_10003858 3300025936 Bacteria 7989
541 Ga0207670_10046734 3300025936 Bacteria 2878
542 Ga0207669_10167365 3300025937 Bacteria 1560
543 Ga0207669_10365793 3300025937 Bacteria 1119
544 Ga0207704_10000268 3300025938 Bacteria 25118
545 Ga0207704_10011098 3300025938 Bacteria 4422
546 Ga0207704_10020348 3300025938 Bacteria 3509
547 Ga0207704_10021737 3300025938 Bacteria 3423
548 Ga0207704_10050588 3300025938 Bacteria 2507
549 Ga0207704_10124838 3300025938 Bacteria 1770
550 Ga0207704_10158554 3300025938 Bacteria 1607
551 Ga0207704_10295127 3300025938 Bacteria 1239
552 Ga0207665_10042809 3300025939 Bacteria 3027
553 Ga0207665_10079155 3300025939 Bacteria 2259
554 Ga0207665_10150104 3300025939 Bacteria 1669
555 Ga0207691_10006056 3300025940 Bacteria 11682
556 Ga0207691_10011760 3300025940 Bacteria 8401
557 Ga0207691_10114317 3300025940 Bacteria 2398
558 Ga0207691_10126097 3300025940 Bacteria 2265
559 Ga0207711_10022699 3300025941 Bacteria 5249
560 Ga0207711_10036602 3300025941 Bacteria 4165
561 Ga0207711_10144958 3300025941 Bacteria 2139
562 Ga0207711_10200618 3300025941 Bacteria 1820
563 Ga0207711_10270512 3300025941 Bacteria 1563
564 Ga0207689_10000159 3300025942 Bacteria 58241
565 Ga0207689_10025106 3300025942 Bacteria 4996
566 Ga0207661_10007579 3300025944 Bacteria 7719
567 Ga0207661_10009807 3300025944 Bacteria 6877
568 Ga0207661_10198290 3300025944 Bacteria 1763
569 Ga0207661_10374549 3300025944 Bacteria 1288
570 Ga0207679_10053568 3300025945 Bacteria 2966
571 Ga0207679_10184057 3300025945 Bacteria 1730
572 Ga0207679_10434008 3300025945 Bacteria 1162
573 Ga0207667_10016840 3300025949 Bacteria 8246
574 Ga0207667_10064631 3300025949 Bacteria 3819
575 Ga0207667_10126841 3300025949 Bacteria 2629
576 Ga0207667_10214918 3300025949 Bacteria 1970
577 Ga0207667_10484791 3300025949 Bacteria 1255
578 Ga0207651_10000495 3300025960 Bacteria 16517
579 Ga0207651_10029173 3300025960 Bacteria 3492
580 Ga0207651_10193878 3300025960 Bacteria 1623
581 Ga0207712_10040158 3300025961 Bacteria 3209
582 Ga0207712_10202287 3300025961 Bacteria 1576
583 Ga0207712_10420240 3300025961 Bacteria 1128
584 Ga0207640_10034460 3300025981 Bacteria 3160
585 Ga0207640_10089056 3300025981 Bacteria 2132
586 Ga0207640_10250311 3300025981 Bacteria 1375
587 Ga0207658_10000692 3300025986 Bacteria 29298
588 Ga0207658_10008973 3300025986 Bacteria 6784
589 Ga0207658_10021202 3300025986 Bacteria 4507
590 Ga0207658_10123385 3300025986 Bacteria 2069
591 Ga0207658_10271354 3300025986 Bacteria 1450
592 Ga0207677_10022680 3300026023 Bacteria 3863
593 Ga0207677_10041039 3300026023 Bacteria 3056
594 Ga0207703_10000795 3300026035 Bacteria 31096
595 Ga0207703_10002699 3300026035 Bacteria 15215
596 Ga0207703_10017959 3300026035 Bacteria 5524
597 Ga0207703_10144995 3300026035 Bacteria 2064
598 Ga0207703_10560275 3300026035 Bacteria 1078
599 Ga0207639_10042625 3300026041 Bacteria 3402
600 Ga0207639_10222143 3300026041 Bacteria 1632
601 Ga0207639_10251802 3300026041 Bacteria 1540
602 Ga0207678_10011891 3300026067 Bacteria 7643
603 Ga0207678_10047090 3300026067 Bacteria 3729
604 Ga0207678_10053433 3300026067 Bacteria 3481
605 Ga0207678_10077637 3300026067 Bacteria 2845
606 Ga0207678_10241303 3300026067 Bacteria 1547
607 Ga0207708_10000248 3300026075 Bacteria 42511
608 Ga0207708_10011614 3300026075 Bacteria 6564
609 Ga0207708_10017645 3300026075 Bacteria 5374
610 Ga0207708_10159810 3300026075 Bacteria 1779
611 Ga0207702_10017319 3300026078 Bacteria 5961
612 Ga0207702_10027427 3300026078 Bacteria 4730
613 Ga0207702_10090253 3300026078 Bacteria 2681
614 Ga0207702_10128211 3300026078 Unclassified 2280
615 Ga0207702_10290230 3300026078 Bacteria 1549
616 Ga0207702_10372221 3300026078 Bacteria 1372
617 Ga0207702_10377022 3300026078 Bacteria 1363
618 Ga0207641_10001123 3300026088 Bacteria 26895
619 Ga0207641_10013187 3300026088 Bacteria 6776
620 Ga0207641_10199731 3300026088 Bacteria 1843
621 Ga0207641_10393676 3300026088 Bacteria 1329
622 Ga0207648_10000248 3300026089 Bacteria 58258
623 Ga0207648_10026036 3300026089 Bacteria 5202
624 Ga0207648_10098716 3300026089 Bacteria 2557
625 Ga0207648_10174087 3300026089 Bacteria 1903
626 Ga0207676_10000841 3300026095 Bacteria 23813
627 Ga0207676_10004299 3300026095 Bacteria 10070
628 Ga0207676_10043140 3300026095 Bacteria 3471
629 Ga0207676_10300812 3300026095 Bacteria 1465
630 Ga0207676_10375909 3300026095 Bacteria 1321
631 Ga0207674_10004582 3300026116 Bacteria 16589
632 Ga0207674_10047317 3300026116 Bacteria 4410
633 Ga0207674_10350271 3300026116 Bacteria 1428
634 Ga0207674_10387587 3300026116 Bacteria 1351
635 Ga0207675_100000426 3300026118 Bacteria 40816
636 Ga0207675_100017007 3300026118 Bacteria 6796
637 Ga0207675_100028771 3300026118 Bacteria 5177
638 Ga0207675_100132515 3300026118 Bacteria 2363
639 Ga0207675_100138505 3300026118 Bacteria 2311
640 Ga0207683_10002091 3300026121 Bacteria 17588
641 Ga0207683_10008676 3300026121 Bacteria 8692
642 Ga0207683_10014218 3300026121 Bacteria 6779
643 Ga0207683_10021217 3300026121 Bacteria 5558
644 Ga0207683_10073232 3300026121 Bacteria 3030
645 Ga0207683_10074413 3300026121 Bacteria 3005
646 Ga0207683_10083292 3300026121 Bacteria 2842
647 Ga0207683_10090709 3300026121 Bacteria 2722
648 Ga0207683_10191120 3300026121 Bacteria 1859
649 Ga0207683_10312034 3300026121 Bacteria 1440
650 Ga0207683_10420829 3300026121 Bacteria 1230
651 Ga0207698_10030421 3300026142 Bacteria 3882
652 Ga0209588_1015742 3300027671 Bacteria 2328
653 Ga0268266_10006822 3300028379 Bacteria 10399
654 Ga0268266_10052351 3300028379 Bacteria 3506
655 Ga0268266_10461477 3300028379 Bacteria 1208
656 Ga0268266_10473951 3300028379 Bacteria 1192
657 Ga0268266_10582327 3300028379 Bacteria 1074
658 Ga0268265_10009053 3300028380 Bacteria 6733
659 Ga0268265_10022104 3300028380 Bacteria 4465
660 Ga0268265_10044130 3300028380 Bacteria 3318
661 Ga0268265_10101437 3300028380 Bacteria 2325
662 Ga0268265_10263756 3300028380 Bacteria 1533
663 Ga0268265_10301253 3300028380 Bacteria 1443
664 Ga0268264_10000020 3300028381 Bacteria 483593
665 Ga0268264_10016355 3300028381 Bacteria 6074
666 Ga0268264_10018483 3300028381 Bacteria 5701
667 Ga0268264_10054319 3300028381 Bacteria 3344
668 Ga0268264_10084506 3300028381 Bacteria 2722
669 Ga0268264_10234493 3300028381 Bacteria 1696
670 Ga0268264_10248929 3300028381 Bacteria 1650
671 Ga0268264_10413637 3300028381 Bacteria 1299
672 Ga0307511_10000499 3300030521 Bacteria 42317
673 Ga0307511_10062819 3300030521 Bacteria 2813
674 Ga0265760_10031980 3300031090 Bacteria 1553
675 Ga0265332_10007361 3300031238 Bacteria 4980
676 Ga0265339_10006651 3300031249 Bacteria 7563
677 Ga0265331_10005102 3300031250 Bacteria 8007
678 Ga0265331_10024550 3300031250 Bacteria 3048
679 Ga0307513_10058673 3300031456 Bacteria 4088
680 Ga0307513_10178889 3300031456 Bacteria 1987
681 Ga0307509_10122293 3300031507 Bacteria 2577
682 Ga0307408_100017923 3300031548 Bacteria 4748
683 Ga0307408_100062663 3300031548 Bacteria 2718
684 Ga0307408_100485697 3300031548 Bacteria 1078
685 Ga0307508_10000058 3300031616 Bacteria 125293
686 Ga0307508_10088793 3300031616 Bacteria 2675
687 Ga0307514_10152433 3300031649 Bacteria 1548
688 Ga0265342_10000035 3300031712 Bacteria 142886
689 Ga0307405_10007368 3300031731 Bacteria 5495
690 Ga0307405_10012696 3300031731 Bacteria 4471
691 Ga0307413_10061387 3300031824 Bacteria 2319
692 Ga0307413_10076937 3300031824 Bacteria 2123
693 Ga0307410_10001424 3300031852 Bacteria 10766
694 Ga0307406_10003267 3300031901 Bacteria 8834
695 Ga0307406_10024568 3300031901 Bacteria 3601
696 Ga0307406_10087089 3300031901 Bacteria 2093
697 Ga0307412_10016495 3300031911 Bacteria 4401
698 Ga0307412_10233548 3300031911 Bacteria 1418
699 Ga0307412_10275493 3300031911 Bacteria 1319
700 Ga0307409_100003569 3300031995 Bacteria 8487
701 Ga0307409_100014701 3300031995 Bacteria 5104
702 Ga0307409_100490894 3300031995 Bacteria 1194
703 Ga0307416_100049692 3300032002 Bacteria 3337
704 Ga0307416_100064996 3300032002 Bacteria 2995
705 Ga0307416_100250153 3300032002 Bacteria 1724
706 Ga0307416_100636203 3300032002 Bacteria 1150
707 Ga0307416_100640447 3300032002 Bacteria 1147
708 Ga0307411_10000547 3300032005 Bacteria 13327
709 Ga0307415_100001658 3300032126 Bacteria 10804
710 Ga0307507_10033714 3300033179 Bacteria 5309
711 Ga0307510_10019237 3300033180 Bacteria 8013
712 Ga0307510_10038138 3300033180 Bacteria 5317
713 Ga0373934_0078851 3300035086 Bacteria 1322
714 Ga0373944_0027834 3300035089 Bacteria 1679
715 Ga0373923_0041756 3300035111 Bacteria 1892
716 Ga0373932_0008089 3300035112 Bacteria 2510
717 Ga0373936_0005672 3300035113 Bacteria 4709
718 Ga0373936_0012592 3300035113 Bacteria 3220
719 Ga0373936_0082790 3300035113 Bacteria 1338
720 Ga0373945_0004379 3300035116 Bacteria 4485
721 Ga0373945_0019656 3300035116 Bacteria 2307
722 Ga0373945_0074518 3300035116 Bacteria 1290
723 Ga0373954_0007360 3300035118 Bacteria 4816
724 Ga0373954_0026478 3300035118 Bacteria 2658
725 Ga0373954_0099745 3300035118 Bacteria 1400
726 Ga0373954_0102936 3300035118 Bacteria 1379
727 Ga0373956_0099419 3300035119 Bacteria 1348
728 Ga0373956_0128676 3300035119 Bacteria 1185
729 Ga0373957_0001261 3300035120 Bacteria 6772
730 Ga0373957_0009030 3300035120 Bacteria 3252
731 Ga0373957_0030947 3300035120 Bacteria 1964
732 Ga0373957_0076518 3300035120 Bacteria 1316
733 Ga0373943_0016917 3300035170 Bacteria 3333
734 Ga0373946_0013304 3300035171 Bacteria 3092
735 Ga0373946_0068210 3300035171 Bacteria 1529
736 Ga0373955_0040834 3300035172 Bacteria 2483
737 Ga0316574_0233619 3300035398 Bacteria 1176
738 Ga0373924_0088359 3300035410 Bacteria 1324
739 Ga0373924_0115457 3300035410 Bacteria 1163
740 Ga0373931_0016732 3300035691 Bacteria 3614
741 Ga0373931_0075378 3300035691 Bacteria 1850
742 Ga0373931_0126984 3300035691 Bacteria 1464
743 Ga0373935_0006803 3300035692 Bacteria 6830
744 Ga0373935_0013290 3300035692 Bacteria 4967
745 Ga0373935_0058628 3300035692 Bacteria 2459
746 Ga0373935_0070502 3300035692 Bacteria 2253
747 Ga0373927_0013193 3300035695 Bacteria 5495
748 Ga0373927_0016649 3300035695 Bacteria 4850
749 Ga0373927_0037203 3300035695 Bacteria 3164
750 Ga0373927_0059921 3300035695 Bacteria 2462
751 Ga0373927_0062712 3300035695 Bacteria 2404
752 Ga0373927_0152253 3300035695 Bacteria 1514
753 Ga0373927_0202006 3300035695 Unclassified 1305
754 Ga0373933_0000052 3300035724 Bacteria 70592
755 Ga0373933_0007808 3300035724 Bacteria 5844
756 Ga0373933_0056217 3300035724 Bacteria 2362
757 Ga0373947_0006320 3300035725 Bacteria 6885
758 Ga0373947_0022644 3300035725 Bacteria 3645
759 Ga0373947_0034033 3300035725 Bacteria 3013
760 Ga0373937_0007266 3300036401 Bacteria 9587
761 Ga0373937_0047530 3300036401 Bacteria 3926
762 Ga0373937_0090756 3300036401 Bacteria 2830
763 Ga0373937_0161815 3300036401 Bacteria 2098
764 Ga0373937_0163926 3300036401 Bacteria 2084
765 Ga0373937_0270668 3300036401 Bacteria 1603
766 Ga0316584_0010473 3300036712 Bacteria 6480
767 Ga0373925_0002569 3300037068 Bacteria 14454
768 Ga0373925_0017689 3300037068 Bacteria 5172
769 Ga0373925_0040773 3300037068 Bacteria 3438
770 Ga0373925_0049942 3300037068 Bacteria 3119
771 Ga0373925_0127754 3300037068 Bacteria 1979
772 Ga0373925_0143060 3300037068 Bacteria 1873
773 Ga0373925_0215827 3300037068 Bacteria 1530
774 Ga0395898_0097244 3300037466 Unclassified 2828
775 Ga0395905_0114673 3300037471 Bacteria 2532
776 Ga0395901_0068861 3300038443 Bacteria 3686
777 Ga0400483_013851 3300039062 Bacteria 8477
778 Ga0400483_176221 3300039062 Bacteria 9966
779 Ga0439436_0000165 3300041404 Bacteria 15608
780 Ga0439436_0001548 3300041404 Bacteria 6692
781 Ga0439438_025746 3300041405 Bacteria 1600
782 Ga0439447_014312 3300041407 Bacteria 2229
783 Ga0439447_026681 3300041407 Bacteria 1479
784 Ga0439465_0000774 3300041413 Bacteria 9959
785 Ga0439431_0000394 3300041997 Bacteria 9201
786 Ga0439445_0001136 3300042004 Bacteria 5704
787 Ga0439445_0026192 3300042004 Bacteria 1491
788 Ga0439432_001228 3300042006 Bacteria 9682
789 Ga0439449_0026601 3300042007 Bacteria 2159
790 Ga0439452_003157 3300042010 Bacteria 5836
791 Ga0439462_0016318 3300042015 Bacteria 1918
792 Ga0450911_000712 3300042115 Bacteria 9689
793 Ga0450898_010215 3300042134 Bacteria 1516
794 Ga0450909_001959 3300042185 Bacteria 2904
795 Ga0439434_0000875 3300042435 Bacteria 8694
796 Ga0439464_0006709 3300042439 Bacteria 3002
797 Ga0451577_0018003 3300042876 Bacteria 6513
798 Ga0453683_0002262 3300044673 Bacteria 15209
799 Ga0453683_0080698 3300044673 Bacteria 2038
800 Ga0451576_0014155 3300045051 Bacteria 8888
801 Ga0451576_0048819 3300045051 Bacteria 4444
802 Ga0466967_0061237 3300045976 Bacteria 3338
803 Ga0466967_0069688 3300045976 Bacteria 3144
804 Ga0495592_0032113 3300046454 Bacteria 3965
805 Ga0495592_0079820 3300046454 Bacteria 2368
806 Ga0495592_0106108 3300046454 Bacteria 1994
807 Ga0495592_0170871 3300046454 Bacteria 1489
808 Ga0495603_0011507 3300046455 Bacteria 5355
809 Ga0495603_0013515 3300046455 Bacteria 4939
810 Ga0495603_0061395 3300046455 Bacteria 2219
811 Ga0495603_0069911 3300046455 Bacteria 2064
812 Ga0495629_0033060 3300046459 Bacteria 3659
813 Ga0495629_0065657 3300046459 Bacteria 2533
814 Ga0495629_0074705 3300046459 Bacteria 2366
815 Ga0495629_0085896 3300046459 Unclassified 2195
816 Ga0495641_0016211 3300046461 Bacteria 3935
817 Ga0495641_0023065 3300046461 Bacteria 3100
818 Ga0495651_0007700 3300046462 Bacteria 8237
819 Ga0495653_0088256 3300046463 Bacteria 2275
820 Ga0495653_0150993 3300046463 Bacteria 1623
821 Ga0495580_0004026 3300046472 Bacteria 12402
822 Ga0495580_0021531 3300046472 Bacteria 4754
823 Ga0495580_0133187 3300046472 Bacteria 1723
824 Ga0495582_0006646 3300046473 Bacteria 6425
825 Ga0495582_0008224 3300046473 Bacteria 5756
826 Ga0495582_0044103 3300046473 Bacteria 2456
827 Ga0495605_0022588 3300046474 Bacteria 3320
828 Ga0495605_0024779 3300046474 Bacteria 3136
829 Ga0495605_0100546 3300046474 Bacteria 1330
830 Ga0495639_0000899 3300046475 Bacteria 13445
831 Ga0495639_0005803 3300046475 Bacteria 5313
832 Ga0495639_0027461 3300046475 Bacteria 2520
833 Ga0495662_0012692 3300046476 Bacteria 4109
834 Ga0495662_0049497 3300046476 Unclassified 2028
835 Ga0495664_0007063 3300046477 Bacteria 6221
836 Ga0495664_0011150 3300046477 Bacteria 5058
837 Ga0495664_0028972 3300046477 Bacteria 3236
838 Ga0495664_0126198 3300046477 Bacteria 1548
839 Ga0495584_0062928 3300046491 Unclassified 1865
840 Ga0495585_0082939 3300046492 Bacteria 1735
841 Ga0495594_0022497 3300046499 Bacteria 3372
842 Ga0495594_0030099 3300046499 Bacteria 2935
843 Ga0495607_0083054 3300046501 Bacteria 1756
844 Ga0495606_0003921 3300046507 Bacteria 15312
845 Ga0495608_0042278 3300046511 Bacteria 3047
846 Ga0495618_0052343 3300046514 Bacteria 2580
847 Ga0495618_0081113 3300046514 Bacteria 2071
848 Ga0495618_0164826 3300046514 Bacteria 1411
849 Ga0495620_0067547 3300046515 Bacteria 1471
850 Ga0495628_0118016 3300046516 Bacteria 2037
851 Ga0495628_0124038 3300046516 Bacteria 1979
852 Ga0495630_0038724 3300046517 Bacteria 3567
853 Ga0495630_0053234 3300046517 Bacteria 3030
854 Ga0495630_0094393 3300046517 Bacteria 2261
855 Ga0495630_0163830 3300046517 Bacteria 1692
856 Ga0495631_0092989 3300046518 Bacteria 1298
857 Ga0495632_0072267 3300046519 Bacteria 1656
858 Ga0495666_0016941 3300046526 Bacteria 3628
859 Ga0495666_0074564 3300046526 Bacteria 1609
860 Ga0495652_0036311 3300046529 Bacteria 4287
861 Ga0495652_0079246 3300046529 Bacteria 2716
862 Ga0495652_0086761 3300046529 Bacteria 2568
863 Ga0495652_0165899 3300046529 Bacteria 1709
864 Ga0495654_0027390 3300046530 Bacteria 2923
865 Ga0495665_0004419 3300046531 Bacteria 7592
866 Ga0495665_0042616 3300046531 Bacteria 2415
867 Ga0495665_0081597 3300046531 Bacteria 1700
868 Ga0495640_0018841 3300046533 Bacteria 5108
869 Ga0495640_0122787 3300046533 Bacteria 1686
870 Ga0495587_0002956 3300046536 Bacteria 11364
871 Ga0495598_0012440 3300046537 Bacteria 2089
872 Ga0495598_0032353 3300046537 Bacteria 1477
873 Ga0495598_0045923 3300046537 Bacteria 1296
874 Ga0495609_0082195 3300046538 Bacteria 1407
875 Ga0495621_0013313 3300046539 Bacteria 2581
876 Ga0495645_0009466 3300046543 Bacteria 6805
877 Ga0495645_0014210 3300046543 Bacteria 5646
878 Ga0495645_0070240 3300046543 Bacteria 2527
879 Ga0495622_0013015 3300046557 Bacteria 3861
880 Ga0495622_0050722 3300046557 Bacteria 1925
881 Ga0495622_0054725 3300046557 Bacteria 1851
882 Ga0495622_0164244 3300046557 Bacteria 1000
883 Ga0495633_0051427 3300046558 Bacteria 1941
884 Ga0495633_0089316 3300046558 Bacteria 1433
885 Ga0495667_0001799 3300046559 Bacteria 14228
886 Ga0495667_0173375 3300046559 Bacteria 1385
887 Ga0495656_0010426 3300046615 Bacteria 3379
888 Ga0495668_0220097 3300046616 Bacteria 1039
889 Ga0495634_0053488 3300046642 Bacteria 2704
890 Ga0495634_0064264 3300046642 Bacteria 2433
891 Ga0495634_0099285 3300046642 Bacteria 1882
892 Ga0495611_0031066 3300046648 Bacteria 2349
893 Ga0495635_0007523 3300046663 Bacteria 7601
894 Ga0495635_0011519 3300046663 Bacteria 6199
895 Ga0495635_0020966 3300046663 Bacteria 4554
896 Ga0495635_0141313 3300046663 Bacteria 1639
897 Ga0495588_0033752 3300046674 Bacteria 2586
898 Ga0495588_0097710 3300046674 Bacteria 1541
899 Ga0495588_0154618 3300046674 Bacteria 1212
900 Ga0495657_0011744 3300046675 Bacteria 6532
901 Ga0495599_0075301 3300046678 Bacteria 2107
902 Ga0495599_0126985 3300046678 Bacteria 1585
903 Ga0495599_0268941 3300046678 Bacteria 1034
904 Ga0495623_0010736 3300046679 Bacteria 5929
905 Ga0495646_0074353 3300046680 Bacteria 1994
906 Ga0495646_0092676 3300046680 Bacteria 1742
907 Ga0495646_0133682 3300046680 Bacteria 1394
908 Ga0495647_0005461 3300046681 Bacteria 4164
909 Ga0495647_0015089 3300046681 Bacteria 2701
910 Ga0495647_0081884 3300046681 Bacteria 1310
911 Ga0495658_0010654 3300046683 Bacteria 4602
912 Ga0495658_0181050 3300046683 Bacteria 1308
913 Ga0495669_0107997 3300046684 Bacteria 1297
914 Ga0495613_0009283 3300046689 Bacteria 7296
915 Ga0495613_0085486 3300046689 Bacteria 2289
916 Ga0495613_0188525 3300046689 Bacteria 1458
917 Ga0495613_0293721 3300046689 Bacteria 1126
918 Ga0495624_0016396 3300046690 Bacteria 4986
919 Ga0495624_0244147 3300046690 Bacteria 1086
920 Ga0495670_0018387 3300046691 Bacteria 3441
921 Ga0495670_0058671 3300046691 Bacteria 1932
922 Ga0495671_0217070 3300046692 Bacteria 926
923 Ga0495600_0022899 3300046809 Bacteria 4015
924 Ga0495581_0013837 3300047315 Bacteria 4676
925 Ga0495581_0027369 3300047315 Bacteria 3306
926 Ga0495604_0026889 3300047317 Bacteria 4578
927 Ga0495604_0118972 3300047317 Bacteria 1914
928 Ga0495636_0009131 3300047318 Bacteria 3900
929 Ga0495674_0039213 3300047319 Bacteria 4248
930 Ga0495674_0055416 3300047319 Bacteria 3477
931 Ga0495674_0103983 3300047319 Bacteria 2414
932 Ga0495672_0125570 3300047320 Bacteria 1357
933 Ga0495676_0031851 3300047321 Bacteria 4454
934 Ga0495676_0053814 3300047321 Bacteria 3204
935 Ga0495680_0029429 3300047322 Bacteria 4497
936 Ga0495680_0155761 3300047322 Bacteria 1662
937 Ga0495675_0020619 3300047444 Bacteria 4195
938 Ga0495675_0180742 3300047444 Bacteria 1291
939 Ga0495681_0090403 3300047470 Bacteria 1353
940 Ga0495681_0096190 3300047470 Bacteria 1301
941 Ga0495684_0011564 3300047471 Bacteria 6816
942 Ga0495684_0147381 3300047471 Bacteria 1762
943 Ga0495684_0204241 3300047471 Bacteria 1455
944 Ga0495686_0029299 3300047472 Bacteria 3582
945 Ga0495686_0084660 3300047472 Bacteria 1932
946 Ga0495593_0020360 3300047673 Bacteria 3715
947 Ga0495593_0027076 3300047673 Bacteria 3158
948 Ga0495593_0201857 3300047673 Bacteria 999
949 Ga0495602_0055496 3300048088 Bacteria 3488
950 Ga0495602_0208100 3300048088 Bacteria 1487
951 Ga0495614_0042248 3300048089 Bacteria 1955
952 Ga0495615_0002153 3300048090 Bacteria 3103
953 Ga0496100_0010350 3300048903 Bacteria 5278
954 Ga0496101_0032479 3300048904 Bacteria 3675
955 Ga0496101_0045426 3300048904 Bacteria 3146
956 Ga0496101_0129729 3300048904 Unclassified 1913
957 Ga0496102_0004752 3300048905 Bacteria 11497
958 Ga0496102_0068893 3300048905 Bacteria 3247
959 Ga0496102_0167254 3300048905 Bacteria 2069
960 Ga0496102_0300715 3300048905 Bacteria 1512
961 Ga0496103_0034432 3300048906 Bacteria 3097
962 Ga0496103_0048138 3300048906 Bacteria 2634
963 Ga0496104_0039316 3300048907 Bacteria 4429
964 Ga0496104_0043776 3300048907 Bacteria 4205
965 Ga0496104_0102687 3300048907 Bacteria 2738
966 Ga0496105_0012986 3300048908 Bacteria 6598
967 Ga0496105_0033643 3300048908 Bacteria 4211
968 Ga0496106_0010427 3300048909 Bacteria 6862
969 Ga0496106_0028968 3300048909 Bacteria 4126
970 Ga0496106_0042668 3300048909 Bacteria 3402
971 Ga0496106_0054028 3300048909 Bacteria 3034
972 Ga0496106_0166440 3300048909 Bacteria 1745
973 Ga0496106_0198156 3300048909 Bacteria 1598
974 Ga0496106_0250786 3300048909 Bacteria 1415
975 Ga0496106_0419053 3300048909 Bacteria 1076
976 Ga0496107_0001189 3300048910 Bacteria 15840
977 Ga0496107_0007743 3300048910 Bacteria 7421
978 Ga0496108_0009386 3300048911 Bacteria 7921
979 Ga0496108_0131862 3300048911 Bacteria 2148
980 Ga0496108_0189318 3300048911 Bacteria 1783
981 Ga0496108_0491898 3300048911 Bacteria 1071
982 Ga0496109_0013303 3300048912 Bacteria 7129
983 Ga0496109_0031307 3300048912 Bacteria 4773
984 Ga0496109_0111811 3300048912 Bacteria 2540
985 Ga0496109_0283842 3300048912 Bacteria 1560
986 Ga0496109_0486899 3300048912 Bacteria 1164
987 Ga0496109_0631024 3300048912 Bacteria 1008
988 Ga0496110_0026032 3300048913 Bacteria 5002
989 Ga0496110_0027726 3300048913 Bacteria 4857
990 Ga0496110_0159373 3300048913 Bacteria 2045
991 Ga0496111_0048970 3300048914 Bacteria 3046
992 Ga0496111_0232733 3300048914 Bacteria 1368
993 Ga0496112_0005654 3300048915 Bacteria 10854
994 Ga0496112_0070168 3300048915 Bacteria 3462
995 Ga0496112_0121449 3300048915 Bacteria 2582
996 Ga0496112_0157628 3300048915 Unclassified 2237
997 Ga0496112_0193064 3300048915 Bacteria 1997
998 Ga0496113_0003249 3300048916 Bacteria 9694
999 Ga0496113_0017767 3300048916 Bacteria 4945
1000 Ga0496113_0026946 3300048916 Bacteria 4114
1001 Ga0496114_0007527 3300048917 Bacteria 8611
1002 Ga0496115_0002391 3300048918 Bacteria 13453
1003 Ga0496115_0006943 3300048918 Bacteria 8322
1004 Ga0496115_0173250 3300048918 Bacteria 1784
1005 Ga0496117_0088182 3300048920 Bacteria 2008
1006 Ga0496121_0006615 3300048924 Bacteria 14295
1007 Ga0496121_0035578 3300048924 Bacteria 4460
1008 Ga0496121_0043929 3300048924 Bacteria 3862
1009 Ga0496122_0000039 3300048925 Bacteria 295352
1010 Ga0496123_0000026 3300048926 Bacteria 318040
1011 Ga0496124_0047240 3300048927 Bacteria 3684
1012 Ga0496125_0014317 3300048928 Bacteria 7729
1013 Ga0496125_0102183 3300048928 Bacteria 2107
1014 Ga0496126_0010044 3300048929 Bacteria 9989
1015 Ga0496126_0017497 3300048929 Bacteria 7139
1016 Ga0496126_0234043 3300048929 Bacteria 1538
1017 Ga0495682_0022688 3300049460 Bacteria 2347
1018 Ga0501033_0129881 3300049570 Bacteria 1826
1019 Ga0501033_0333237 3300049570 Bacteria 1065
1020 Ga0501034_0000812 3300049571 Bacteria 46479
1021 Ga0501037_0089904 3300049573 Bacteria 2222
1022 Ga0501038_0115806 3300049574 Bacteria 2216
1023 Ga0501038_0166855 3300049574 Bacteria 1785
1024 Ga0501038_0263661 3300049574 Bacteria 1361
1025 Ga0501038_0417720 3300049574 Bacteria 1035
1026 Ga0501039_0056152 3300049575 Bacteria 3050
1027 Ga0501039_0155189 3300049575 Bacteria 1798
1028 Ga0501039_0258413 3300049575 Bacteria 1369
1029 Ga0501040_0105476 3300049576 Bacteria 1969
1030 Ga0501041_0050928 3300049577 Bacteria 2523
1031 Ga0501043_0361134 3300049579 Bacteria 1102
1032 Ga0501047_0040031 3300049581 Bacteria 4532
1033 Ga0501047_0351735 3300049581 Bacteria 1310
1034 Ga0501048_0107272 3300049582 Bacteria 1972
1035 Ga0501068_0000043 3300049584 Bacteria 47781
1036 Ga0501070_0009132 3300049586 Bacteria 8385
1037 Ga0501072_0000134 3300049588 Bacteria 55491
1038 Ga0501073_0000125 3300049589 Bacteria 50056
1039 Ga0501074_0004617 3300049590 Bacteria 9864
1040 Ga0501075_0150048 3300049591 Bacteria 1777
1041 Ga0501076_0032788 3300049592 Bacteria 4056
1042 Ga0501076_0033230 3300049592 Bacteria 4028
1043 Ga0501079_0022288 3300049741 Bacteria 4857
1044 Ga0501079_0162137 3300049741 Bacteria 1744
1045 Ga0501079_0195273 3300049741 Bacteria 1580
1046 Ga0501080_0000091 3300049742 Bacteria 61566
1047 Ga0501080_0129307 3300049742 Bacteria 2338
1048 Ga0501083_0321892 3300049744 Bacteria 1006
1049 Ga0501268_027319 3300049765 Bacteria 1014
1050 Ga0501044_0013050 3300049823 Bacteria 8990
1051 nmdc:mga03683_109980_c1 3300050489 Bacteria 1218
1052 nmdc:mga03n38_11045_c1 3300050490 Bacteria 3349
1053 nmdc:mga03n38_22436_c1 3300050490 Bacteria 2555
1054 nmdc:mga0yw44_25794_c1 3300050492 Bacteria 3348
1055 nmdc:mga0yw44_59912_c1 3300050492 Bacteria 2331
1056 nmdc:mga0k408_13027_c1 3300050493 Bacteria 4554
1057 nmdc:mga07m45_20026_c1 3300050496 Bacteria 3631
1058 nmdc:mga05p37_22464_c1 3300050507 Bacteria 7650
1059 nmdc:mga09592_1120_c1 3300050508 Bacteria 21354
1060 nmdc:mga09592_193327_c1 3300050508 Bacteria 1761
1061 nmdc:mga09592_30694_c1 3300050508 Unclassified 4473
1062 nmdc:mga0qj67_198000_c1 3300050509 Unclassified 1632
1063 nmdc:mga0qj67_22457_c1 3300050509 Bacteria 4846
1064 nmdc:mga0qj67_372961_c1 3300050509 Bacteria 1152
1065 nmdc:mga0qj67_3746_c1 3300050509 Bacteria 10979
1066 nmdc:mga06r32_239650_c1 3300050510 Bacteria 1801
1067 nmdc:mga06r32_344124_c1 3300050510 Bacteria 1476
1068 nmdc:mga08y16_279756_c1 3300050511 Bacteria 1721
1069 nmdc:mga08y16_48970_c1 3300050511 Unclassified 4422
1070 nmdc:mga08y16_494119_c1 3300050511 Bacteria 1244
1071 nmdc:mga0n895_188748_c1 3300050512 Bacteria 2092
1072 nmdc:mga0n895_44749_c1 3300050512 Bacteria 4317
1073 nmdc:mga0n895_82990_c1 3300050512 Bacteria 3195
1074 nmdc:mga0rr50_17123_c1 3300050513 Bacteria 4829
1075 nmdc:mga0rr50_234870_c1 3300050513 Bacteria 1518
1076 nmdc:mga08x19_5023_c1 3300050514 Bacteria 7824
1077 nmdc:mga0a205_590441_c1 3300050515 Bacteria 964
1078 Ga0495601_0030239 3300053077 Bacteria 3362
1079 Ga0495601_0037659 3300053077 Unclassified 3024
1080 Ga0495601_0140052 3300053077 Bacteria 1578
1081 Ga0495601_0166548 3300053077 Bacteria 1440
1082 Ga0495601_0213176 3300053077 Bacteria 1261
1083 Ga0495612_0011987 3300053078 Bacteria 3494
1084 Ga0495612_0022519 3300053078 Bacteria 2524
1085 Ga0495612_0023469 3300053078 Bacteria 2475
1086 Ga0495655_0053578 3300053083 Bacteria 1077
1087 Ga0495595_0001423 3300053084 Bacteria 9303
1088 Ga0495595_0072209 3300053084 Bacteria 1633
1089 Ga0495619_0040773 3300053085 Bacteria 3035
1090 Ga0495619_0045250 3300053085 Bacteria 2891
1091 Ga0495619_0117994 3300053085 Bacteria 1817
1092 Ga0500646_0000464 3300053090 Bacteria 11970
1093 Ga0500651_0117053 3300053093 Unclassified 1621
1094 Ga0500566_0099399 3300053094 Bacteria 1597
1095 Ga0500641_0160744 3300053096 Bacteria 968
1096 Ga0500595_009912 3300053119 Bacteria 3815
1097 Ga0500595_014358 3300053119 Bacteria 3005
1098 Ga0500655_005291 3300053133 Bacteria 2331
1099 Ga0500658_0054348 3300053134 Bacteria 1645
1100 Ga0500559_0005515 3300053136 Bacteria 5817
1101 Ga0500568_0083298 3300053139 Bacteria 1212
1102 Ga0500573_0008795 3300053140 Bacteria 5575
1103 Ga0500577_0137315 3300053142 Bacteria 1029
1104 Ga0500590_047748 3300053148 Bacteria 2184
1105 Ga0500590_084523 3300053148 Bacteria 1553
1106 Ga0500603_000717 3300053150 Bacteria 8058
1107 Ga0500604_0000243 3300053151 Bacteria 15638
1108 Ga0500633_0065580 3300053160 Bacteria 1287
1109 Ga0500634_0089323 3300053161 Bacteria 1568
1110 Ga0500636_0168929 3300053177 Bacteria 1184
1111 Ga0500636_0210549 3300053177 Bacteria 1021
1112 Ga0500637_0001020 3300053178 Bacteria 11473
1113 Ga0500637_0068220 3300053178 Bacteria 2043
1114 Ga0500552_003478 3300053733 Bacteria 1603
1115 Ga0500596_006291 3300053735 Bacteria 2023
1116 Ga0501084_0088468 3300054114 Bacteria 2600
1117 Ga0501084_0127458 3300054114 Bacteria 2142
1118 Ga0501084_0262080 3300054114 Bacteria 1459
1119 Ga0501084_0273119 3300054114 Bacteria 1427
1120 Ga0501082_0043167 3300060353 Bacteria 3887
1121 Ga0501082_0060982 3300060353 Bacteria 3247
1122 Ga0501082_0168319 3300060353 Bacteria 1905
1123 Ga0530510_0035949 3300061734 Bacteria 3571
1124 Ga0530510_0083032 3300061734 Bacteria 2333

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0088256 Ga0495653_0088256_1460_2263 235
2 3300047319 Ga0495674_0103983 Ga0495674_0103983_317_1150 235
3 3300050508 nmdc:mga09592_193327_c1 nmdc:mga09592_193327_c1_968_1729 248
4 3300046531 Ga0495665_0081597 Ga0495665_0081597_809_1684 250
5 3300006175 Ga0070712_100230857 Ga0070712_1002308572 257
6 3300025898 Ga0207692_10163200 Ga0207692_101632002 257
7 3300035086 Ga0373934_0078851 Ga0373934_0078851_366_1265 257
8 3300035113 Ga0373936_0012592 Ga0373936_0012592_636_1535 257
9 3300035116 Ga0373945_0019656 Ga0373945_0019656_759_1658 257
10 3300035171 Ga0373946_0013304 Ga0373946_0013304_1976_2875 257
11 3300035410 Ga0373924_0088359 Ga0373924_0088359_191_1090 257
12 3300035691 Ga0373931_0126984 Ga0373931_0126984_266_1165 257
13 3300035692 Ga0373935_0058628 Ga0373935_0058628_253_1152 257
14 3300037068 Ga0373925_0040773 Ga0373925_0040773_1043_1942 257
15 3300046455 Ga0495603_0061395 Ga0495603_0061395_791_1690 257
16 3300046459 Ga0495629_0033060 Ga0495629_0033060_168_1067 257
17 3300046461 Ga0495641_0023065 Ga0495641_0023065_2105_3004 257
18 3300046463 Ga0495653_0150993 Ga0495653_0150993_598_1497 257
19 3300046472 Ga0495580_0133187 Ga0495580_0133187_154_1053 257
20 3300046473 Ga0495582_0044103 Ga0495582_0044103_1174_2073 257
21 3300046477 Ga0495664_0028972 Ga0495664_0028972_405_1304 257
22 3300046499 Ga0495594_0022497 Ga0495594_0022497_1285_2184 257
23 3300046514 Ga0495618_0052343 Ga0495618_0052343_463_1362 257
24 3300046517 Ga0495630_0094393 Ga0495630_0094393_397_1296 257
25 3300046526 Ga0495666_0074564 Ga0495666_0074564_330_1229 257
26 3300046529 Ga0495652_0165899 Ga0495652_0165899_222_1121 257
27 3300046557 Ga0495622_0054725 Ga0495622_0054725_200_1099 257
28 3300046642 Ga0495634_0053488 Ga0495634_0053488_1286_2185 257
29 3300046663 Ga0495635_0007523 Ga0495635_0007523_6624_7523 257
30 3300046674 Ga0495588_0033752 Ga0495588_0033752_140_1039 257
31 3300046680 Ga0495646_0133682 Ga0495646_0133682_106_1005 257
32 3300046681 Ga0495647_0015089 Ga0495647_0015089_655_1554 257
33 3300047315 Ga0495581_0027369 Ga0495581_0027369_1060_1959 257
34 3300047321 Ga0495676_0053814 Ga0495676_0053814_2218_3117 257
35 3300047322 Ga0495680_0155761 Ga0495680_0155761_487_1386 257
36 3300048918 Ga0496115_0173250 Ga0496115_0173250_256_1155 257
37 3300053077 Ga0495601_0030239 Ga0495601_0030239_2046_2945 257
38 3300053078 Ga0495612_0023469 Ga0495612_0023469_418_1317 257
39 3300053085 Ga0495619_0045250 Ga0495619_0045250_697_1596 257
40 3300009176 Ga0105242_10114505 Ga0105242_101145052 259
41 3300047444 Ga0495675_0020619 Ga0495675_0020619_1023_1898 259
42 3300049741 Ga0501079_0162137 Ga0501079_0162137_617_1513 259
43 3300054114 Ga0501084_0262080 Ga0501084_0262080_277_1173 259
44 3300005436 Ga0070713_100384562 Ga0070713_1003845622 263
45 3300013297 Ga0157378_10137580 Ga0157378_101375802 265
46 3300053083 Ga0495655_0053578 Ga0495655_0053578_88_984 265
47 3300005330 Ga0070690_100048374 Ga0070690_1000483742 266
48 3300005364 Ga0070673_100394101 Ga0070673_1003941011 266
49 3300005366 Ga0070659_100204556 Ga0070659_1002045562 266
50 3300005367 Ga0070667_100084563 Ga0070667_1000845632 266
51 3300005435 Ga0070714_100181421 Ga0070714_1001814212 266
52 3300005437 Ga0070710_10012418 Ga0070710_100124181 266
53 3300005439 Ga0070711_100065709 Ga0070711_1000657092 266
54 3300005457 Ga0070662_100159262 Ga0070662_1001592622 266
55 3300005547 Ga0070693_100106228 Ga0070693_1001062282 266
56 3300005614 Ga0068856_100098205 Ga0068856_1000982052 266
57 3300006175 Ga0070712_100172220 Ga0070712_1001722202 266
58 3300006237 Ga0097621_100032753 Ga0097621_1000327535 266
59 3300006358 Ga0068871_100029904 Ga0068871_1000299045 266
60 3300006914 Ga0075436_100046979 Ga0075436_1000469792 266
61 3300007788 Ga0099795_10107426 Ga0099795_101074262 266
62 3300009098 Ga0105245_10072790 Ga0105245_100727902 266
63 3300009148 Ga0105243_10042633 Ga0105243_100426332 266
64 3300009176 Ga0105242_10034121 Ga0105242_100341212 266
65 3300009177 Ga0105248_10045176 Ga0105248_100451763 266
66 3300010375 Ga0105239_10150422 Ga0105239_101504222 266
67 3300013296 Ga0157374_10222441 Ga0157374_102224412 266
68 3300013306 Ga0163162_10108835 Ga0163162_101088352 266
69 3300013308 Ga0157375_10028867 Ga0157375_100288672 266
70 3300014968 Ga0157379_10019335 Ga0157379_100193357 266
71 3300014969 Ga0157376_10096191 Ga0157376_100961912 266
72 3300025906 Ga0207699_10268654 Ga0207699_102686542 266
73 3300025916 Ga0207663_10007369 Ga0207663_100073693 266
74 3300025928 Ga0207700_10139168 Ga0207700_101391682 266
75 3300025929 Ga0207664_10156303 Ga0207664_101563034 266
76 3300025931 Ga0207644_10074277 Ga0207644_100742772 266
77 3300025932 Ga0207690_10233670 Ga0207690_102336702 266
78 3300025933 Ga0207706_10036842 Ga0207706_100368425 266
79 3300025939 Ga0207665_10042809 Ga0207665_100428093 266
80 3300025941 Ga0207711_10270512 Ga0207711_102705122 266
81 3300026067 Ga0207678_10241303 Ga0207678_102413032 266
82 3300026078 Ga0207702_10128211 Ga0207702_101282112 266
83 3300026121 Ga0207683_10008676 Ga0207683_100086763 266
84 3300035111 Ga0373923_0041756 Ga0373923_0041756_627_1526 266
85 3300035118 Ga0373954_0026478 Ga0373954_0026478_198_1097 266
86 3300035119 Ga0373956_0099419 Ga0373956_0099419_25_924 266
87 3300035120 Ga0373957_0001261 Ga0373957_0001261_5050_5949 266
88 3300035172 Ga0373955_0040834 Ga0373955_0040834_1320_2219 266
89 3300035695 Ga0373927_0202006 Ga0373927_0202006_393_1292 266
90 3300035724 Ga0373933_0007808 Ga0373933_0007808_1803_2702 266
91 3300036401 Ga0373937_0007266 Ga0373937_0007266_852_1751 266
92 3300046454 Ga0495592_0106108 Ga0495592_0106108_97_996 266
93 3300046459 Ga0495629_0085896 Ga0495629_0085896_365_1264 266
94 3300046462 Ga0495651_0007700 Ga0495651_0007700_4592_5491 266
95 3300046476 Ga0495662_0049497 Ga0495662_0049497_470_1369 266
96 3300046477 Ga0495664_0011150 Ga0495664_0011150_3755_4654 266
97 3300046511 Ga0495608_0042278 Ga0495608_0042278_1924_2823 266
98 3300046514 Ga0495618_0164826 Ga0495618_0164826_40_939 266
99 3300046516 Ga0495628_0124038 Ga0495628_0124038_384_1283 266
100 3300046517 Ga0495630_0163830 Ga0495630_0163830_183_1082 266
101 3300046529 Ga0495652_0079246 Ga0495652_0079246_1306_2205 266
102 3300046533 Ga0495640_0122787 Ga0495640_0122787_404_1303 266
103 3300046536 Ga0495587_0002956 Ga0495587_0002956_5953_6852 266
104 3300046543 Ga0495645_0009466 Ga0495645_0009466_2770_3669 266
105 3300046559 Ga0495667_0001799 Ga0495667_0001799_4770_5669 266
106 3300046642 Ga0495634_0064264 Ga0495634_0064264_1134_2033 266
107 3300046663 Ga0495635_0141313 Ga0495635_0141313_176_1075 266
108 3300046675 Ga0495657_0011744 Ga0495657_0011744_2954_3853 266
109 3300046678 Ga0495599_0075301 Ga0495599_0075301_384_1283 266
110 3300046679 Ga0495623_0010736 Ga0495623_0010736_1964_2863 266
111 3300046680 Ga0495646_0074353 Ga0495646_0074353_999_1898 266
112 3300046689 Ga0495613_0188525 Ga0495613_0188525_390_1289 266
113 3300046690 Ga0495624_0244147 Ga0495624_0244147_130_1029 266
114 3300046809 Ga0495600_0022899 Ga0495600_0022899_755_1654 266
115 3300047317 Ga0495604_0026889 Ga0495604_0026889_2554_3453 266
116 3300047319 Ga0495674_0055416 Ga0495674_0055416_1580_2479 266
117 3300047322 Ga0495680_0029429 Ga0495680_0029429_2139_3038 266
118 3300047471 Ga0495684_0204241 Ga0495684_0204241_403_1302 266
119 3300048088 Ga0495602_0055496 Ga0495602_0055496_1434_2333 266
120 3300048904 Ga0496101_0129729 Ga0496101_0129729_648_1547 266
121 3300048906 Ga0496103_0048138 Ga0496103_0048138_292_1191 266
122 3300048907 Ga0496104_0039316 Ga0496104_0039316_3320_4219 266
123 3300048908 Ga0496105_0012986 Ga0496105_0012986_3631_4530 266
124 3300048909 Ga0496106_0028968 Ga0496106_0028968_2797_3696 266
125 3300048910 Ga0496107_0001189 Ga0496107_0001189_6362_7261 266
126 3300048911 Ga0496108_0131862 Ga0496108_0131862_1126_2025 266
127 3300048913 Ga0496110_0159373 Ga0496110_0159373_325_1224 266
128 3300048915 Ga0496112_0157628 Ga0496112_0157628_281_1180 266
129 3300049575 Ga0501039_0056152 Ga0501039_0056152_1026_1940 266
130 3300049584 Ga0501068_0000043 Ga0501068_0000043_23659_24573 266
131 3300049586 Ga0501070_0009132 Ga0501070_0009132_5048_5962 266
132 3300049589 Ga0501073_0000125 Ga0501073_0000125_19666_20580 266
133 3300049590 Ga0501074_0004617 Ga0501074_0004617_5377_6291 266
134 3300049741 Ga0501079_0022288 Ga0501079_0022288_493_1407 266
135 3300049742 Ga0501080_0000091 Ga0501080_0000091_19666_20580 266
136 3300050514 nmdc:mga08x19_5023_c1 nmdc:mga08x19_5023_c1_4887_5783 266
137 3300053077 Ga0495601_0213176 Ga0495601_0213176_138_1037 266
138 3300053078 Ga0495612_0022519 Ga0495612_0022519_138_1037 266
139 3300053084 Ga0495595_0001423 Ga0495595_0001423_489_1388 266
140 3300053085 Ga0495619_0117994 Ga0495619_0117994_407_1306 266
141 3300054114 Ga0501084_0088468 Ga0501084_0088468_579_1493 266
142 3300060353 Ga0501082_0060982 Ga0501082_0060982_890_1804 266
143 3300005339 Ga0070660_100095014 Ga0070660_1000950142 267
144 3300005455 Ga0070663_100140237 Ga0070663_1001402372 267
145 3300005458 Ga0070681_10097072 Ga0070681_100970721 267
146 3300005530 Ga0070679_100244858 Ga0070679_1002448582 267
147 3300005545 Ga0070695_100120853 Ga0070695_1001208531 267
148 3300005546 Ga0070696_100047841 Ga0070696_1000478412 267
149 3300005564 Ga0070664_100185844 Ga0070664_1001858442 267
150 3300005616 Ga0068852_100127348 Ga0068852_1001273482 267
151 3300006358 Ga0068871_100289553 Ga0068871_1002895532 267
152 3300006881 Ga0068865_100095914 Ga0068865_1000959142 267
153 3300010375 Ga0105239_10155976 Ga0105239_101559762 267
154 3300013297 Ga0157378_10071649 Ga0157378_100716493 267
155 3300025912 Ga0207707_10051453 Ga0207707_100514533 267
156 3300025919 Ga0207657_10033072 Ga0207657_100330723 267
157 3300025927 Ga0207687_10140340 Ga0207687_101403402 267
158 3300025934 Ga0207686_10155950 Ga0207686_101559502 267
159 3300025938 Ga0207704_10020348 Ga0207704_100203484 267
160 3300026041 Ga0207639_10222143 Ga0207639_102221432 267
161 3300028381 Ga0268264_10413637 Ga0268264_104136371 267
162 3300039062 Ga0400483_176221 Ga0400483_176221_5886_6791 267
163 3300048909 Ga0496106_0054028 Ga0496106_0054028_1126_2025 267
164 3300049574 Ga0501038_0417720 Ga0501038_0417720_172_1008 267
165 3300005617 Ga0068859_100103458 Ga0068859_1001034583 268
166 3300006931 Ga0097620_100103453 Ga0097620_1001034533 268
167 3300014969 Ga0157376_10139013 Ga0157376_101390132 268
168 3300045976 Ga0466967_0069688 Ga0466967_0069688_846_1742 268
169 3300005547 Ga0070693_100265944 Ga0070693_1002659442 269
170 3300009177 Ga0105248_10433449 Ga0105248_104334492 269
171 3300049744 Ga0501083_0321892 Ga0501083_0321892_27_923 269
172 3300053119 Ga0500595_009912 Ga0500595_009912_2261_3181 271
173 3300025934 Ga0207686_10116269 Ga0207686_101162691 272
174 3300031090 Ga0265760_10031980 Ga0265760_100319802 272
175 3300039062 Ga0400483_013851 Ga0400483_013851_6324_7229 272
176 3300005434 Ga0070709_10168140 Ga0070709_101681401 273
177 3300049570 Ga0501033_0333237 Ga0501033_0333237_155_1051 273
178 3300049581 Ga0501047_0040031 Ga0501047_0040031_1132_2034 273
179 3300060353 Ga0501082_0043167 Ga0501082_0043167_2152_3048 273
180 3300025297 Ga0209758_1006809 Ga0209758_10068095 274
181 3300025931 Ga0207644_10020806 Ga0207644_100208062 274
182 3300032002 Ga0307416_100049692 Ga0307416_1000496922 274
183 3300048911 Ga0496108_0189318 Ga0496108_0189318_478_1374 274
184 3300005331 Ga0070670_100000922 Ga0070670_10000092210 275
185 3300005354 Ga0070675_100002677 Ga0070675_1000026773 275
186 3300005364 Ga0070673_100056985 Ga0070673_1000569852 275
187 3300005367 Ga0070667_100151586 Ga0070667_1001515862 275
188 3300005543 Ga0070672_100001036 Ga0070672_10000103610 275
189 3300005618 Ga0068864_100006881 Ga0068864_1000068812 275
190 3300005841 Ga0068863_100043780 Ga0068863_1000437802 275
191 3300006237 Ga0097621_100022442 Ga0097621_1000224424 275
192 3300006358 Ga0068871_100026378 Ga0068871_1000263784 275
193 3300025915 Ga0207693_10126449 Ga0207693_101264492 275
194 3300025925 Ga0207650_10003930 Ga0207650_100039308 275
195 3300025926 Ga0207659_10006781 Ga0207659_100067814 275
196 3300025928 Ga0207700_10033262 Ga0207700_100332622 275
197 3300025940 Ga0207691_10006056 Ga0207691_100060566 275
198 3300025960 Ga0207651_10029173 Ga0207651_100291731 275
199 3300025986 Ga0207658_10123385 Ga0207658_101233852 275
200 3300026095 Ga0207676_10004299 Ga0207676_100042998 275
201 3300026121 Ga0207683_10021217 Ga0207683_100212174 275
202 3300046507 Ga0495606_0003921 Ga0495606_0003921_14357_15253 275
203 3300014969 Ga0157376_10010081 Ga0157376_100100815 277
204 3300005543 Ga0070672_100176970 Ga0070672_1001769702 278
205 3300017792 Ga0163161_10240465 Ga0163161_102404652 278
206 3300041404 Ga0439436_0000165 Ga0439436_0000165_12889_13791 278
207 3300041405 Ga0439438_025746 Ga0439438_025746_529_1431 278
208 3300041407 Ga0439447_026681 Ga0439447_026681_349_1251 278
209 3300042015 Ga0439462_0016318 Ga0439462_0016318_703_1605 278
210 3300049570 Ga0501033_0129881 Ga0501033_0129881_327_1229 278
211 3300049573 Ga0501037_0089904 Ga0501037_0089904_558_1460 278
212 3300049575 Ga0501039_0155189 Ga0501039_0155189_666_1568 278
213 3300049577 Ga0501041_0050928 Ga0501041_0050928_1053_1955 278
214 3300054114 Ga0501084_0127458 Ga0501084_0127458_914_1816 278
215 3300006195 Ga0075366_10010651 Ga0075366_100106515 280
216 3300006038 Ga0075365_10075634 Ga0075365_100756342 281
217 3300006048 Ga0075363_100000768 Ga0075363_10000076810 281
218 3300006178 Ga0075367_10019341 Ga0075367_100193413 281
219 3300006195 Ga0075366_10020528 Ga0075366_100205281 281
220 3300013105 Ga0157369_10072885 Ga0157369_100728853 281
221 3300050489 nmdc:mga03683_109980_c1 nmdc:mga03683_109980_c1_93_989 281
222 3300050490 nmdc:mga03n38_22436_c1 nmdc:mga03n38_22436_c1_890_1786 281
223 3300050492 nmdc:mga0yw44_59912_c1 nmdc:mga0yw44_59912_c1_93_989 281
224 3300050493 nmdc:mga0k408_13027_c1 nmdc:mga0k408_13027_c1_2117_3013 281
225 3300005329 Ga0070683_100160001 Ga0070683_1001600012 282
226 3300005337 Ga0070682_100146291 Ga0070682_1001462911 282
227 3300005366 Ga0070659_100099403 Ga0070659_1000994032 282
228 3300005577 Ga0068857_100294722 Ga0068857_1002947222 282
229 3300013100 Ga0157373_10111980 Ga0157373_101119802 282
230 3300015262 Ga0182007_10045162 Ga0182007_100451622 282
231 3300025909 Ga0207705_10218937 Ga0207705_102189371 282
232 3300025932 Ga0207690_10174690 Ga0207690_101746902 282
233 3300025944 Ga0207661_10198290 Ga0207661_101982902 282
234 3300026078 Ga0207702_10090253 Ga0207702_100902533 282
235 3300037466 Ga0395898_0097244 Ga0395898_0097244_623_1519 282
236 3300038443 Ga0395901_0068861 Ga0395901_0068861_2417_3313 282
237 3300042876 Ga0451577_0018003 Ga0451577_0018003_3200_4096 282
238 3300048909 Ga0496106_0010427 Ga0496106_0010427_32_928 282
239 3300053077 Ga0495601_0037659 Ga0495601_0037659_348_1244 282
240 3300005334 Ga0068869_100117287 Ga0068869_1001172871 283
241 3300005335 Ga0070666_10002324 Ga0070666_1000232410 283
242 3300005338 Ga0068868_100000189 Ga0068868_10000018941 283
243 3300005354 Ga0070675_100000563 Ga0070675_10000056311 283
244 3300005364 Ga0070673_100001225 Ga0070673_1000012258 283
245 3300005365 Ga0070688_100017560 Ga0070688_1000175603 283
246 3300005367 Ga0070667_100015983 Ga0070667_1000159832 283
247 3300005456 Ga0070678_100025200 Ga0070678_1000252003 283
248 3300005466 Ga0070685_10025496 Ga0070685_100254962 283
249 3300005548 Ga0070665_100182079 Ga0070665_1001820792 283
250 3300005617 Ga0068859_100081825 Ga0068859_1000818252 283
251 3300005618 Ga0068864_100002453 Ga0068864_1000024534 283
252 3300005834 Ga0068851_10116012 Ga0068851_101160122 283
253 3300005841 Ga0068863_100006441 Ga0068863_1000064413 283
254 3300005842 Ga0068858_100000882 Ga0068858_10000088224 283
255 3300006358 Ga0068871_100061174 Ga0068871_1000611743 283
256 3300006931 Ga0097620_100081827 Ga0097620_1000818272 283
257 3300009177 Ga0105248_10096833 Ga0105248_100968333 283
258 3300013306 Ga0163162_10054125 Ga0163162_100541253 283
259 3300014325 Ga0163163_10001152 Ga0163163_1000115212 283
260 3300014968 Ga0157379_10021311 Ga0157379_100213115 283
261 3300025321 Ga0207656_10031875 Ga0207656_100318752 283
262 3300025893 Ga0207682_10059797 Ga0207682_100597972 283
263 3300025926 Ga0207659_10000474 Ga0207659_100004748 283
264 3300025931 Ga0207644_10001390 Ga0207644_1000139011 283
265 3300025941 Ga0207711_10144958 Ga0207711_101449582 283
266 3300025944 Ga0207661_10374549 Ga0207661_103745492 283
267 3300025960 Ga0207651_10000495 Ga0207651_100004953 283
268 3300026023 Ga0207677_10022680 Ga0207677_100226802 283
269 3300026035 Ga0207703_10000795 Ga0207703_1000079511 283
270 3300026075 Ga0207708_10159810 Ga0207708_101598102 283
271 3300026088 Ga0207641_10001123 Ga0207641_100011238 283
272 3300026089 Ga0207648_10098716 Ga0207648_100987162 283
273 3300026095 Ga0207676_10000841 Ga0207676_1000084123 283
274 3300028381 Ga0268264_10054319 Ga0268264_100543192 283
275 3300036401 Ga0373937_0270668 Ga0373937_0270668_661_1557 283
276 3300042134 Ga0450898_010215 Ga0450898_010215_10_912 283
277 3300048909 Ga0496106_0042668 Ga0496106_0042668_425_1321 283
278 3300048911 Ga0496108_0009386 Ga0496108_0009386_1611_2507 283
279 3300061734 Ga0530510_0035949 Ga0530510_0035949_1602_2498 283
280 3300005844 Ga0068862_100097221 Ga0068862_1000972213 284
281 3300009098 Ga0105245_10441284 Ga0105245_104412841 284
282 3300009148 Ga0105243_10043295 Ga0105243_100432954 284
283 3300025935 Ga0207709_10021278 Ga0207709_100212783 284
284 3300031616 Ga0307508_10000058 Ga0307508_1000005833 284
285 3300005367 Ga0070667_100001024 Ga0070667_1000010245 285
286 3300005548 Ga0070665_100491677 Ga0070665_1004916772 285
287 3300005614 Ga0068856_100070922 Ga0068856_1000709223 285
288 3300013306 Ga0163162_10419638 Ga0163162_104196382 285
289 3300025927 Ga0207687_10133337 Ga0207687_101333372 285
290 3300025938 Ga0207704_10295127 Ga0207704_102951271 285
291 3300025986 Ga0207658_10000692 Ga0207658_100006925 285
292 3300026078 Ga0207702_10027427 Ga0207702_100274273 285
293 3300028381 Ga0268264_10248929 Ga0268264_102489292 285
294 3300005844 Ga0068862_100044997 Ga0068862_1000449974 286
295 3300028380 Ga0268265_10101437 Ga0268265_101014372 286
296 3300031238 Ga0265332_10007361 Ga0265332_100073611 286
297 3300031249 Ga0265339_10006651 Ga0265339_100066514 286
298 3300031250 Ga0265331_10005102 Ga0265331_100051025 286
299 3300031712 Ga0265342_10000035 Ga0265342_1000003570 286
300 3300042439 Ga0439464_0006709 Ga0439464_0006709_2084_2980 286
301 3300005329 Ga0070683_100530265 Ga0070683_1005302651 287
302 3300005333 Ga0070677_10024124 Ga0070677_100241242 287
303 3300005334 Ga0068869_100290236 Ga0068869_1002902362 287
304 3300005338 Ga0068868_100010035 Ga0068868_1000100351 287
305 3300005343 Ga0070687_100248206 Ga0070687_1002482061 287
306 3300005366 Ga0070659_100064853 Ga0070659_1000648533 287
307 3300005535 Ga0070684_100386411 Ga0070684_1003864112 287
308 3300005578 Ga0068854_100119452 Ga0068854_1001194522 287
309 3300005614 Ga0068856_100015300 Ga0068856_1000153005 287
310 3300005834 Ga0068851_10212202 Ga0068851_102122022 287
311 3300005844 Ga0068862_100161893 Ga0068862_1001618932 287
312 3300005981 Ga0081538_10003075 Ga0081538_1000307514 287
313 3300009174 Ga0105241_10336513 Ga0105241_103365131 287
314 3300010375 Ga0105239_10253889 Ga0105239_102538892 287
315 3300013296 Ga0157374_10678076 Ga0157374_106780762 287
316 3300013297 Ga0157378_10099948 Ga0157378_100999481 287
317 3300013307 Ga0157372_10200865 Ga0157372_102008652 287
318 3300025932 Ga0207690_10077325 Ga0207690_100773252 287
319 3300025981 Ga0207640_10089056 Ga0207640_100890562 287
320 3300026078 Ga0207702_10017319 Ga0207702_100173195 287
321 3300026116 Ga0207674_10350271 Ga0207674_103502712 287
322 3300031548 Ga0307408_100485697 Ga0307408_1004856971 287
323 3300031824 Ga0307413_10076937 Ga0307413_100769372 287
324 3300048905 Ga0496102_0300715 Ga0496102_0300715_95_991 287
325 3300048909 Ga0496106_0419053 Ga0496106_0419053_27_923 287
326 3300048912 Ga0496109_0111811 Ga0496109_0111811_126_1022 287
327 3300048915 Ga0496112_0005654 Ga0496112_0005654_9840_10736 287
328 3300049574 Ga0501038_0166855 Ga0501038_0166855_420_1316 287
329 3300049579 Ga0501043_0361134 Ga0501043_0361134_76_972 287
330 3300049581 Ga0501047_0351735 Ga0501047_0351735_324_1220 287
331 3300049742 Ga0501080_0129307 Ga0501080_0129307_1412_2308 287
332 3300049823 Ga0501044_0013050 Ga0501044_0013050_7487_8383 287
333 3300005614 Ga0068856_100287268 Ga0068856_1002872682 288
334 3300005981 Ga0081538_10056445 Ga0081538_100564453 288
335 3300005981 Ga0081538_10058242 Ga0081538_100582422 288
336 3300031456 Ga0307513_10058673 Ga0307513_100586733 288
337 3300031911 Ga0307412_10275493 Ga0307412_102754932 288
338 3300005436 Ga0070713_100103117 Ga0070713_1001031172 289
339 3300005437 Ga0070710_10031115 Ga0070710_100311152 289
340 3300005439 Ga0070711_100011490 Ga0070711_1000114904 289
341 3300006175 Ga0070712_100088811 Ga0070712_1000888113 289
342 3300025898 Ga0207692_10013406 Ga0207692_100134062 289
343 3300025915 Ga0207693_10003058 Ga0207693_1000305815 289
344 3300035691 Ga0373931_0075378 Ga0373931_0075378_881_1774 289
345 3300037068 Ga0373925_0143060 Ga0373925_0143060_22_915 289
346 3300003911 JGI25405J52794_10001742 JGI25405J52794_100017425 290
347 3300005937 Ga0081455_10001790 Ga0081455_1000179018 290
348 3300005981 Ga0081538_10022297 Ga0081538_100222974 290
349 3300005985 Ga0081539_10038599 Ga0081539_100385993 290
350 3300006844 Ga0075428_100164692 Ga0075428_1001646922 290
351 3300006847 Ga0075431_100053369 Ga0075431_1000533695 290
352 3300006852 Ga0075433_10158585 Ga0075433_101585852 290
353 3300009094 Ga0111539_10226850 Ga0111539_102268502 290
354 3300009147 Ga0114129_10203550 Ga0114129_102035502 290
355 3300035410 Ga0373924_0115457 Ga0373924_0115457_17_913 290
356 3300035724 Ga0373933_0056217 Ga0373933_0056217_1035_1931 290
357 3300036401 Ga0373937_0090756 Ga0373937_0090756_1203_2099 290
358 3300049574 Ga0501038_0115806 Ga0501038_0115806_418_1311 290
359 3300050507 nmdc:mga05p37_22464_c1 nmdc:mga05p37_22464_c1_4671_5567 290
360 3300050508 nmdc:mga09592_30694_c1 nmdc:mga09592_30694_c1_335_1231 290
361 3300050509 nmdc:mga0qj67_198000_c1 nmdc:mga0qj67_198000_c1_454_1350 290
362 3300050510 nmdc:mga06r32_344124_c1 nmdc:mga06r32_344124_c1_27_923 290
363 3300050511 nmdc:mga08y16_48970_c1 nmdc:mga08y16_48970_c1_966_1862 290
364 3300053093 Ga0500651_0117053 Ga0500651_0117053_668_1564 290
365 3300061734 Ga0530510_0083032 Ga0530510_0083032_1239_2132 290
366 3300005353 Ga0070669_100100811 Ga0070669_1001008112 291
367 3300005459 Ga0068867_100006149 Ga0068867_1000061497 291
368 3300005544 Ga0070686_100184150 Ga0070686_1001841502 291
369 3300005617 Ga0068859_100434222 Ga0068859_1004342221 291
370 3300005719 Ga0068861_100005129 Ga0068861_10000512912 291
371 3300005843 Ga0068860_100007353 Ga0068860_10000735311 291
372 3300006881 Ga0068865_100009177 Ga0068865_1000091777 291
373 3300006931 Ga0097620_100434208 Ga0097620_1004342082 291
374 3300009176 Ga0105242_10413550 Ga0105242_104135501 291
375 3300009553 Ga0105249_10101318 Ga0105249_101013183 291
376 3300013306 Ga0163162_10001712 Ga0163162_1000171216 291
377 3300025893 Ga0207682_10046526 Ga0207682_100465261 291
378 3300025938 Ga0207704_10021737 Ga0207704_100217372 291
379 3300026075 Ga0207708_10017645 Ga0207708_100176457 291
380 3300028380 Ga0268265_10044130 Ga0268265_100441302 291
381 3300028381 Ga0268264_10016355 Ga0268264_100163552 291
382 3300049574 Ga0501038_0263661 Ga0501038_0263661_378_1274 291
383 3300049592 Ga0501076_0032788 Ga0501076_0032788_105_1001 291
384 3300060353 Ga0501082_0168319 Ga0501082_0168319_762_1658 291
385 3300013104 Ga0157370_10418514 Ga0157370_104185142 292
386 3300031250 Ga0265331_10024550 Ga0265331_100245503 292
387 3300033179 Ga0307507_10033714 Ga0307507_100337147 292
388 3300035692 Ga0373935_0070502 Ga0373935_0070502_557_1453 292
389 3300037068 Ga0373925_0049942 Ga0373925_0049942_754_1650 292
390 3300053094 Ga0500566_0099399 Ga0500566_0099399_432_1328 292
391 3300053178 Ga0500637_0068220 Ga0500637_0068220_868_1764 292
392 3300005337 Ga0070682_100049722 Ga0070682_1000497223 293
393 3300005458 Ga0070681_10144278 Ga0070681_101442782 293
394 3300006358 Ga0068871_100046138 Ga0068871_1000461384 293
395 3300009174 Ga0105241_10039823 Ga0105241_100398232 293
396 3300013308 Ga0157375_10014793 Ga0157375_100147936 293
397 3300025911 Ga0207654_10124524 Ga0207654_101245242 293
398 iso_pu_bacteria 2643221603 2644029199 294
399 iso_pu_bacteria 2791355199 2793081329 294
400 iso_pu_bacteria 2842733646 2842737135 294
401 iso_pu_bacteria 2842747753 2842750383 294
402 iso_pu_bacteria 2876808645 2876817061 294
403 iso_pu_bacteria 2879110137 2879117554 294
404 iso_pu_bacteria 2885192300 2885193348 294
405 iso_pu_bacteria 2889033259 2889042269 294
406 iso_pu_bacteria 8006964411 8006968185 294
407 iso_pu_bacteria 8006984368 8006985451 294
408 3300005327 Ga0070658_10084120 Ga0070658_100841202 295
409 3300005336 Ga0070680_100271745 Ga0070680_1002717452 295
410 3300005339 Ga0070660_100003956 Ga0070660_1000039565 295
411 3300005530 Ga0070679_100005441 Ga0070679_10000544111 295
412 3300005563 Ga0068855_100012729 Ga0068855_1000127295 295
413 3300005614 Ga0068856_100444505 Ga0068856_1004445052 295
414 3300009093 Ga0105240_10036890 Ga0105240_100368907 295
415 3300009551 Ga0105238_10050623 Ga0105238_100506235 295
416 3300025909 Ga0207705_10176951 Ga0207705_101769512 295
417 3300025913 Ga0207695_10047693 Ga0207695_100476932 295
418 3300025919 Ga0207657_10029442 Ga0207657_100294423 295
419 3300025921 Ga0207652_10073660 Ga0207652_100736602 295
420 3300025949 Ga0207667_10214918 Ga0207667_102149182 295
421 3300026078 Ga0207702_10372221 Ga0207702_103722212 295
422 3300035089 Ga0373944_0027834 Ga0373944_0027834_723_1610 295
423 3300035695 Ga0373927_0062712 Ga0373927_0062712_756_1643 295
424 3300037068 Ga0373925_0002569 Ga0373925_0002569_7343_8230 295
425 3300049765 Ga0501268_027319 Ga0501268_027319_88_975 295
426 3300006846 Ga0075430_100009372 Ga0075430_1000093724 296
427 3300006846 Ga0075430_100037653 Ga0075430_1000376532 296
428 3300006880 Ga0075429_100002916 Ga0075429_1000029162 296
429 3300006880 Ga0075429_100056334 Ga0075429_1000563342 296
430 3300050509 nmdc:mga0qj67_3746_c1 nmdc:mga0qj67_3746_c1_2558_3463 296
431 iso_pu_bacteria 2885366525 2885373920 297
432 3300002070 JGI24750J21931_1004067 JGI24750J21931_10040672 298
433 3300003323 rootH1_10104906 rootH1_101049063 298
434 3300003659 JGI25404J52841_10004946 JGI25404J52841_100049462 298
435 3300003659 JGI25404J52841_10006150 JGI25404J52841_100061503 298
436 3300003659 JGI25404J52841_10008111 JGI25404J52841_100081112 298
437 3300005328 Ga0070676_10022298 Ga0070676_100222982 298
438 3300005328 Ga0070676_10045892 Ga0070676_100458922 298
439 3300005329 Ga0070683_100007447 Ga0070683_1000074475 298
440 3300005329 Ga0070683_100021476 Ga0070683_1000214765 298
441 3300005329 Ga0070683_100168615 Ga0070683_1001686152 298
442 3300005330 Ga0070690_100000399 Ga0070690_1000003993 298
443 3300005330 Ga0070690_100117188 Ga0070690_1001171881 298
444 3300005331 Ga0070670_100030097 Ga0070670_1000300972 298
445 3300005331 Ga0070670_100055450 Ga0070670_1000554504 298
446 3300005333 Ga0070677_10049495 Ga0070677_100494952 298
447 3300005334 Ga0068869_100003219 Ga0068869_1000032197 298
448 3300005334 Ga0068869_100006651 Ga0068869_1000066519 298
449 3300005334 Ga0068869_100026483 Ga0068869_1000264833 298
450 3300005335 Ga0070666_10204326 Ga0070666_102043262 298
451 3300005336 Ga0070680_100021711 Ga0070680_1000217112 298
452 3300005336 Ga0070680_100044919 Ga0070680_1000449193 298
453 3300005337 Ga0070682_100158271 Ga0070682_1001582712 298
454 3300005338 Ga0068868_100199466 Ga0068868_1001994662 298
455 3300005338 Ga0068868_100223016 Ga0068868_1002230161 298
456 3300005338 Ga0068868_100238981 Ga0068868_1002389812 298
457 3300005339 Ga0070660_100321134 Ga0070660_1003211342 298
458 3300005340 Ga0070689_100004701 Ga0070689_1000047016 298
459 3300005340 Ga0070689_100021719 Ga0070689_1000217192 298
460 3300005341 Ga0070691_10006502 Ga0070691_100065023 298
461 3300005343 Ga0070687_100127302 Ga0070687_1001273022 298
462 3300005343 Ga0070687_100128137 Ga0070687_1001281372 298
463 3300005344 Ga0070661_100082837 Ga0070661_1000828373 298
464 3300005345 Ga0070692_10008809 Ga0070692_100088096 298
465 3300005345 Ga0070692_10013225 Ga0070692_100132253 298
466 3300005345 Ga0070692_10081406 Ga0070692_100814062 298
467 3300005347 Ga0070668_100023686 Ga0070668_1000236865 298
468 3300005347 Ga0070668_100025239 Ga0070668_1000252395 298
469 3300005347 Ga0070668_100031806 Ga0070668_1000318064 298
470 3300005347 Ga0070668_100216582 Ga0070668_1002165822 298
471 3300005353 Ga0070669_100007163 Ga0070669_1000071638 298
472 3300005353 Ga0070669_100097613 Ga0070669_1000976132 298
473 3300005353 Ga0070669_100101253 Ga0070669_1001012532 298
474 3300005353 Ga0070669_100266355 Ga0070669_1002663552 298
475 3300005353 Ga0070669_100289500 Ga0070669_1002895002 298
476 3300005354 Ga0070675_100041355 Ga0070675_1000413552 298
477 3300005354 Ga0070675_100042797 Ga0070675_1000427973 298
478 3300005354 Ga0070675_100267858 Ga0070675_1002678582 298
479 3300005355 Ga0070671_100012832 Ga0070671_1000128327 298
480 3300005355 Ga0070671_100021121 Ga0070671_1000211212 298
481 3300005355 Ga0070671_100096376 Ga0070671_1000963762 298
482 3300005356 Ga0070674_100095783 Ga0070674_1000957832 298
483 3300005364 Ga0070673_100285571 Ga0070673_1002855712 298
484 3300005364 Ga0070673_100406033 Ga0070673_1004060331 298
485 3300005364 Ga0070673_100434033 Ga0070673_1004340332 298
486 3300005365 Ga0070688_100149275 Ga0070688_1001492752 298
487 3300005365 Ga0070688_100151470 Ga0070688_1001514702 298
488 3300005366 Ga0070659_100009066 Ga0070659_1000090663 298
489 3300005366 Ga0070659_100063230 Ga0070659_1000632303 298
490 3300005434 Ga0070709_10167893 Ga0070709_101678931 298
491 3300005435 Ga0070714_100082979 Ga0070714_1000829792 298
492 3300005436 Ga0070713_100018535 Ga0070713_1000185354 298
493 3300005437 Ga0070710_10025349 Ga0070710_100253493 298
494 3300005438 Ga0070701_10000752 Ga0070701_100007527 298
495 3300005438 Ga0070701_10111869 Ga0070701_101118692 298
496 3300005440 Ga0070705_100007429 Ga0070705_1000074295 298
497 3300005440 Ga0070705_100058565 Ga0070705_1000585651 298
498 3300005440 Ga0070705_100278045 Ga0070705_1002780451 298
499 3300005441 Ga0070700_100000925 Ga0070700_10000092510 298
500 3300005441 Ga0070700_100131998 Ga0070700_1001319982 298
501 3300005444 Ga0070694_100025958 Ga0070694_1000259582 298
502 3300005445 Ga0070708_100199227 Ga0070708_1001992271 298
503 3300005455 Ga0070663_100046461 Ga0070663_1000464612 298
504 3300005455 Ga0070663_100049930 Ga0070663_1000499303 298
505 3300005455 Ga0070663_100100390 Ga0070663_1001003901 298
506 3300005455 Ga0070663_100124743 Ga0070663_1001247432 298
507 3300005455 Ga0070663_100307727 Ga0070663_1003077271 298
508 3300005456 Ga0070678_100007403 Ga0070678_1000074035 298
509 3300005456 Ga0070678_100037245 Ga0070678_1000372452 298
510 3300005456 Ga0070678_100057699 Ga0070678_1000576992 298
511 3300005456 Ga0070678_100092852 Ga0070678_1000928522 298
512 3300005458 Ga0070681_10018365 Ga0070681_100183654 298
513 3300005458 Ga0070681_10070398 Ga0070681_100703984 298
514 3300005458 Ga0070681_10211631 Ga0070681_102116312 298
515 3300005459 Ga0068867_100089100 Ga0068867_1000891002 298
516 3300005459 Ga0068867_100099061 Ga0068867_1000990612 298
517 3300005459 Ga0068867_100273901 Ga0068867_1002739012 298
518 3300005466 Ga0070685_10015529 Ga0070685_100155292 298
519 3300005466 Ga0070685_10137422 Ga0070685_101374221 298
520 3300005467 Ga0070706_100516414 Ga0070706_1005164141 298
521 3300005468 Ga0070707_100341436 Ga0070707_1003414362 298
522 3300005468 Ga0070707_100422316 Ga0070707_1004223161 298
523 3300005518 Ga0070699_100000906 Ga0070699_10000090616 298
524 3300005518 Ga0070699_100023230 Ga0070699_1000232304 298
525 3300005518 Ga0070699_100305293 Ga0070699_1003052932 298
526 3300005530 Ga0070679_100015823 Ga0070679_1000158234 298
527 3300005530 Ga0070679_100024448 Ga0070679_1000244482 298
528 3300005530 Ga0070679_100184090 Ga0070679_1001840902 298
529 3300005530 Ga0070679_100238268 Ga0070679_1002382682 298
530 3300005535 Ga0070684_100007885 Ga0070684_1000078855 298
531 3300005536 Ga0070697_100005574 Ga0070697_1000055743 298
532 3300005536 Ga0070697_100070715 Ga0070697_1000707152 298
533 3300005539 Ga0068853_100026014 Ga0068853_1000260142 298
534 3300005539 Ga0068853_100139481 Ga0068853_1001394812 298
535 3300005543 Ga0070672_100055373 Ga0070672_1000553732 298
536 3300005543 Ga0070672_100061105 Ga0070672_1000611052 298
537 3300005543 Ga0070672_100251519 Ga0070672_1002515192 298
538 3300005544 Ga0070686_100000177 Ga0070686_10000017720 298
539 3300005545 Ga0070695_100047657 Ga0070695_1000476572 298
540 3300005546 Ga0070696_100054698 Ga0070696_1000546982 298
541 3300005547 Ga0070693_100043604 Ga0070693_1000436042 298
542 3300005547 Ga0070693_100094607 Ga0070693_1000946072 298
543 3300005548 Ga0070665_100007828 Ga0070665_1000078283 298
544 3300005548 Ga0070665_100148762 Ga0070665_1001487622 298
545 3300005548 Ga0070665_100164423 Ga0070665_1001644232 298
546 3300005548 Ga0070665_100471820 Ga0070665_1004718202 298
547 3300005549 Ga0070704_100037598 Ga0070704_1000375982 298
548 3300005563 Ga0068855_100064508 Ga0068855_1000645082 298
549 3300005563 Ga0068855_100100124 Ga0068855_1001001244 298
550 3300005563 Ga0068855_100348945 Ga0068855_1003489452 298
551 3300005564 Ga0070664_100118640 Ga0070664_1001186402 298
552 3300005564 Ga0070664_100163670 Ga0070664_1001636702 298
553 3300005577 Ga0068857_100006104 Ga0068857_1000061045 298
554 3300005577 Ga0068857_100029484 Ga0068857_1000294842 298
555 3300005614 Ga0068856_100037984 Ga0068856_1000379844 298
556 3300005614 Ga0068856_100063577 Ga0068856_1000635775 298
557 3300005615 Ga0070702_100000094 Ga0070702_1000000946 298
558 3300005615 Ga0070702_100211269 Ga0070702_1002112691 298
559 3300005616 Ga0068852_100120955 Ga0068852_1001209552 298
560 3300005617 Ga0068859_100003487 Ga0068859_10000348715 298
561 3300005617 Ga0068859_100052149 Ga0068859_1000521495 298
562 3300005617 Ga0068859_100132092 Ga0068859_1001320922 298
563 3300005617 Ga0068859_100422291 Ga0068859_1004222912 298
564 3300005618 Ga0068864_100043158 Ga0068864_1000431582 298
565 3300005618 Ga0068864_100163901 Ga0068864_1001639012 298
566 3300005618 Ga0068864_100585237 Ga0068864_1005852371 298
567 3300005718 Ga0068866_10002364 Ga0068866_100023648 298
568 3300005718 Ga0068866_10017758 Ga0068866_100177581 298
569 3300005719 Ga0068861_100000255 Ga0068861_10000025516 298
570 3300005719 Ga0068861_100067328 Ga0068861_1000673282 298
571 3300005834 Ga0068851_10004859 Ga0068851_100048597 298
572 3300005840 Ga0068870_10004257 Ga0068870_100042572 298
573 3300005840 Ga0068870_10135986 Ga0068870_101359862 298
574 3300005840 Ga0068870_10146502 Ga0068870_101465022 298
575 3300005841 Ga0068863_100139191 Ga0068863_1001391912 298
576 3300005841 Ga0068863_100251345 Ga0068863_1002513451 298
577 3300005842 Ga0068858_100001789 Ga0068858_10000178917 298
578 3300005842 Ga0068858_100080687 Ga0068858_1000806871 298
579 3300005842 Ga0068858_100406802 Ga0068858_1004068021 298
580 3300005843 Ga0068860_100000302 Ga0068860_10000030210 298
581 3300005843 Ga0068860_100003206 Ga0068860_1000032062 298
582 3300005843 Ga0068860_100006654 Ga0068860_10000665413 298
583 3300005843 Ga0068860_100008918 Ga0068860_1000089187 298
584 3300005844 Ga0068862_100007694 Ga0068862_1000076945 298
585 3300005844 Ga0068862_100014806 Ga0068862_1000148066 298
586 3300005844 Ga0068862_100021668 Ga0068862_1000216685 298
587 3300005844 Ga0068862_100193274 Ga0068862_1001932741 298
588 3300005937 Ga0081455_10000968 Ga0081455_100009684 298
589 3300005937 Ga0081455_10001667 Ga0081455_1000166716 298
590 3300005937 Ga0081455_10008173 Ga0081455_100081738 298
591 3300005937 Ga0081455_10155344 Ga0081455_101553442 298
592 3300005937 Ga0081455_10318319 Ga0081455_103183192 298
593 3300005981 Ga0081538_10032479 Ga0081538_100324794 298
594 3300005983 Ga0081540_1000918 Ga0081540_10009188 298
595 3300005983 Ga0081540_1002732 Ga0081540_10027328 298
596 3300005983 Ga0081540_1002906 Ga0081540_100290612 298
597 3300005983 Ga0081540_1006154 Ga0081540_10061542 298
598 3300005983 Ga0081540_1006733 Ga0081540_10067332 298
599 3300005983 Ga0081540_1010879 Ga0081540_10108794 298
600 3300005983 Ga0081540_1028665 Ga0081540_10286652 298
601 3300005985 Ga0081539_10000003 Ga0081539_10000003154 298
602 3300005985 Ga0081539_10000584 Ga0081539_100005843 298
603 3300005985 Ga0081539_10027501 Ga0081539_100275013 298
604 3300006028 Ga0070717_10012536 Ga0070717_100125362 298
605 3300006038 Ga0075365_10032976 Ga0075365_100329762 298
606 3300006038 Ga0075365_10064463 Ga0075365_100644632 298
607 3300006038 Ga0075365_10246597 Ga0075365_102465972 298
608 3300006042 Ga0075368_10007386 Ga0075368_100073864 298
609 3300006048 Ga0075363_100015561 Ga0075363_1000155612 298
610 3300006048 Ga0075363_100018197 Ga0075363_1000181973 298
611 3300006175 Ga0070712_100001605 Ga0070712_1000016059 298
612 3300006175 Ga0070712_100009301 Ga0070712_1000093014 298
613 3300006177 Ga0075362_10136798 Ga0075362_101367982 298
614 3300006178 Ga0075367_10048909 Ga0075367_100489092 298
615 3300006186 Ga0075369_10005272 Ga0075369_100052724 298
616 3300006195 Ga0075366_10009755 Ga0075366_100097553 298
617 3300006195 Ga0075366_10123714 Ga0075366_101237142 298
618 3300006237 Ga0097621_100028036 Ga0097621_1000280362 298
619 3300006237 Ga0097621_100097681 Ga0097621_1000976812 298
620 3300006237 Ga0097621_100274093 Ga0097621_1002740932 298
621 3300006353 Ga0075370_10004796 Ga0075370_100047966 298
622 3300006353 Ga0075370_10062814 Ga0075370_100628142 298
623 3300006353 Ga0075370_10125906 Ga0075370_101259062 298
624 3300006358 Ga0068871_100007550 Ga0068871_1000075503 298
625 3300006358 Ga0068871_100304888 Ga0068871_1003048881 298
626 3300006844 Ga0075428_100066041 Ga0075428_1000660412 298
627 3300006844 Ga0075428_100482384 Ga0075428_1004823842 298
628 3300006846 Ga0075430_100206074 Ga0075430_1002060742 298
629 3300006847 Ga0075431_100219242 Ga0075431_1002192422 298
630 3300006871 Ga0075434_100011947 Ga0075434_1000119473 298
631 3300006871 Ga0075434_100373067 Ga0075434_1003730672 298
632 3300006881 Ga0068865_100000317 Ga0068865_10000031720 298
633 3300006881 Ga0068865_100008577 Ga0068865_1000085772 298
634 3300006881 Ga0068865_100058984 Ga0068865_1000589842 298
635 3300006881 Ga0068865_100112089 Ga0068865_1001120892 298
636 3300006881 Ga0068865_100277349 Ga0068865_1002773492 298
637 3300006931 Ga0097620_100003487 Ga0097620_10000348715 298
638 3300006931 Ga0097620_100052151 Ga0097620_1000521515 298
639 3300006931 Ga0097620_100132099 Ga0097620_1001320992 298
640 3300006931 Ga0097620_100422278 Ga0097620_1004222782 298
641 3300007076 Ga0075435_100037025 Ga0075435_1000370252 298
642 3300007076 Ga0075435_100470637 Ga0075435_1004706371 298
643 3300007265 Ga0099794_10057663 Ga0099794_100576632 298
644 3300009093 Ga0105240_10019274 Ga0105240_100192741 298
645 3300009093 Ga0105240_10121831 Ga0105240_101218312 298
646 3300009093 Ga0105240_10155110 Ga0105240_101551102 298
647 3300009094 Ga0111539_10125112 Ga0111539_101251122 298
648 3300009094 Ga0111539_10303506 Ga0111539_103035062 298
649 3300009094 Ga0111539_10541322 Ga0111539_105413222 298
650 3300009098 Ga0105245_10000323 Ga0105245_1000032325 298
651 3300009098 Ga0105245_10158197 Ga0105245_101581972 298
652 3300009098 Ga0105245_10363627 Ga0105245_103636272 298
653 3300009101 Ga0105247_10116428 Ga0105247_101164281 298
654 3300009101 Ga0105247_10255586 Ga0105247_102555861 298
655 3300009147 Ga0114129_10245029 Ga0114129_102450292 298
656 3300009148 Ga0105243_10004705 Ga0105243_1000470510 298
657 3300009148 Ga0105243_10045697 Ga0105243_100456974 298
658 3300009148 Ga0105243_10238117 Ga0105243_102381172 298
659 3300009148 Ga0105243_10307624 Ga0105243_103076242 298
660 3300009174 Ga0105241_10009325 Ga0105241_100093255 298
661 3300009174 Ga0105241_10125477 Ga0105241_101254772 298
662 3300009176 Ga0105242_10000119 Ga0105242_1000011925 298
663 3300009176 Ga0105242_10196837 Ga0105242_101968371 298
664 3300009176 Ga0105242_10262622 Ga0105242_102626222 298
665 3300009177 Ga0105248_10006375 Ga0105248_1000637511 298
666 3300009177 Ga0105248_10007036 Ga0105248_100070367 298
667 3300009177 Ga0105248_10179018 Ga0105248_101790182 298
668 3300009177 Ga0105248_10198013 Ga0105248_101980132 298
669 3300009545 Ga0105237_10002097 Ga0105237_100020973 298
670 3300009545 Ga0105237_10007055 Ga0105237_100070553 298
671 3300009545 Ga0105237_10092735 Ga0105237_100927351 298
672 3300009545 Ga0105237_10190859 Ga0105237_101908591 298
673 3300009545 Ga0105237_10380563 Ga0105237_103805632 298
674 3300009551 Ga0105238_10040046 Ga0105238_100400464 298
675 3300009551 Ga0105238_10116126 Ga0105238_101161263 298
676 3300009551 Ga0105238_10122535 Ga0105238_101225352 298
677 3300009553 Ga0105249_10046861 Ga0105249_100468612 298
678 3300010375 Ga0105239_10026973 Ga0105239_100269737 298
679 3300010375 Ga0105239_10036659 Ga0105239_100366591 298
680 3300010375 Ga0105239_10042969 Ga0105239_100429694 298
681 3300010375 Ga0105239_10060691 Ga0105239_100606914 298
682 3300010375 Ga0105239_10372036 Ga0105239_103720362 298
683 3300011119 Ga0105246_10003792 Ga0105246_100037924 298
684 3300011119 Ga0105246_10093953 Ga0105246_100939532 298
685 3300011119 Ga0105246_10104278 Ga0105246_101042782 298
686 3300013104 Ga0157370_10202684 Ga0157370_102026842 298
687 3300013104 Ga0157370_10234242 Ga0157370_102342422 298
688 3300013105 Ga0157369_10010807 Ga0157369_1001080710 298
689 3300013296 Ga0157374_10073380 Ga0157374_100733802 298
690 3300013296 Ga0157374_10216405 Ga0157374_102164052 298
691 3300013296 Ga0157374_10293938 Ga0157374_102939382 298
692 3300013297 Ga0157378_10004288 Ga0157378_100042882 298
693 3300013306 Ga0163162_10011141 Ga0163162_100111412 298
694 3300013306 Ga0163162_10102512 Ga0163162_101025122 298
695 3300013306 Ga0163162_10333118 Ga0163162_103331182 298
696 3300013306 Ga0163162_10377368 Ga0163162_103773681 298
697 3300013308 Ga0157375_10102445 Ga0157375_101024452 298
698 3300013308 Ga0157375_10113225 Ga0157375_101132251 298
699 3300013308 Ga0157375_10242881 Ga0157375_102428812 298
700 3300014325 Ga0163163_10009357 Ga0163163_100093578 298
701 3300014326 Ga0157380_10001047 Ga0157380_100010472 298
702 3300014326 Ga0157380_10020930 Ga0157380_100209305 298
703 3300014326 Ga0157380_10103136 Ga0157380_101031362 298
704 3300014326 Ga0157380_10117387 Ga0157380_101173872 298
705 3300014326 Ga0157380_10208896 Ga0157380_102088962 298
706 3300014745 Ga0157377_10091774 Ga0157377_100917742 298
707 3300014745 Ga0157377_10178989 Ga0157377_101789892 298
708 3300014968 Ga0157379_10029784 Ga0157379_100297843 298
709 3300014968 Ga0157379_10049919 Ga0157379_100499192 298
710 3300014969 Ga0157376_10106888 Ga0157376_101068882 298
711 3300017792 Ga0163161_10017226 Ga0163161_100172265 298
712 3300017792 Ga0163161_10091129 Ga0163161_100911292 298
713 3300017792 Ga0163161_10112784 Ga0163161_101127842 298
714 3300017792 Ga0163161_10124455 Ga0163161_101244552 298
715 3300020070 Ga0206356_11210809 Ga0206356_112108091 298
716 3300025297 Ga0209758_1033890 Ga0209758_10338902 298
717 3300025893 Ga0207682_10019898 Ga0207682_100198982 298
718 3300025893 Ga0207682_10035323 Ga0207682_100353232 298
719 3300025898 Ga0207692_10018759 Ga0207692_100187593 298
720 3300025899 Ga0207642_10003256 Ga0207642_100032562 298
721 3300025899 Ga0207642_10051002 Ga0207642_100510022 298
722 3300025901 Ga0207688_10011915 Ga0207688_100119153 298
723 3300025901 Ga0207688_10017227 Ga0207688_100172272 298
724 3300025901 Ga0207688_10162648 Ga0207688_101626482 298
725 3300025901 Ga0207688_10191417 Ga0207688_101914172 298
726 3300025903 Ga0207680_10075576 Ga0207680_100755762 298
727 3300025903 Ga0207680_10289196 Ga0207680_102891961 298
728 3300025904 Ga0207647_10110360 Ga0207647_101103602 298
729 3300025906 Ga0207699_10071132 Ga0207699_100711322 298
730 3300025907 Ga0207645_10005151 Ga0207645_100051517 298
731 3300025907 Ga0207645_10051548 Ga0207645_100515482 298
732 3300025908 Ga0207643_10002576 Ga0207643_1000257610 298
733 3300025908 Ga0207643_10066324 Ga0207643_100663242 298
734 3300025909 Ga0207705_10263041 Ga0207705_102630412 298
735 3300025910 Ga0207684_10367900 Ga0207684_103679001 298
736 3300025911 Ga0207654_10060678 Ga0207654_100606782 298
737 3300025912 Ga0207707_10005157 Ga0207707_100051576 298
738 3300025912 Ga0207707_10143731 Ga0207707_101437312 298
739 3300025913 Ga0207695_10210322 Ga0207695_102103222 298
740 3300025914 Ga0207671_10010943 Ga0207671_100109432 298
741 3300025914 Ga0207671_10143186 Ga0207671_101431862 298
742 3300025914 Ga0207671_10185346 Ga0207671_101853461 298
743 3300025915 Ga0207693_10002797 Ga0207693_100027978 298
744 3300025915 Ga0207693_10008767 Ga0207693_100087674 298
745 3300025917 Ga0207660_10008675 Ga0207660_100086756 298
746 3300025917 Ga0207660_10023568 Ga0207660_100235683 298
747 3300025918 Ga0207662_10078419 Ga0207662_100784192 298
748 3300025918 Ga0207662_10200822 Ga0207662_102008222 298
749 3300025919 Ga0207657_10002580 Ga0207657_1000258013 298
750 3300025919 Ga0207657_10197162 Ga0207657_101971622 298
751 3300025920 Ga0207649_10022375 Ga0207649_100223752 298
752 3300025921 Ga0207652_10018208 Ga0207652_100182086 298
753 3300025921 Ga0207652_10056860 Ga0207652_100568604 298
754 3300025922 Ga0207646_10378165 Ga0207646_103781651 298
755 3300025922 Ga0207646_10411054 Ga0207646_104110542 298
756 3300025923 Ga0207681_10019750 Ga0207681_100197505 298
757 3300025923 Ga0207681_10223188 Ga0207681_102231881 298
758 3300025923 Ga0207681_10260967 Ga0207681_102609672 298
759 3300025925 Ga0207650_10091540 Ga0207650_100915402 298
760 3300025926 Ga0207659_10054332 Ga0207659_100543322 298
761 3300025927 Ga0207687_10003182 Ga0207687_1000318211 298
762 3300025927 Ga0207687_10052004 Ga0207687_100520042 298
763 3300025928 Ga0207700_10002090 Ga0207700_100020905 298
764 3300025928 Ga0207700_10049876 Ga0207700_100498762 298
765 3300025929 Ga0207664_10367695 Ga0207664_103676951 298
766 3300025931 Ga0207644_10004154 Ga0207644_100041542 298
767 3300025931 Ga0207644_10063836 Ga0207644_100638362 298
768 3300025931 Ga0207644_10085265 Ga0207644_100852652 298
769 3300025934 Ga0207686_10002522 Ga0207686_100025221 298
770 3300025934 Ga0207686_10089612 Ga0207686_100896122 298
771 3300025935 Ga0207709_10000932 Ga0207709_100009326 298
772 3300025935 Ga0207709_10191740 Ga0207709_101917402 298
773 3300025936 Ga0207670_10003858 Ga0207670_100038583 298
774 3300025936 Ga0207670_10046734 Ga0207670_100467342 298
775 3300025937 Ga0207669_10167365 Ga0207669_101673652 298
776 3300025937 Ga0207669_10365793 Ga0207669_103657931 298
777 3300025938 Ga0207704_10000268 Ga0207704_1000026821 298
778 3300025938 Ga0207704_10011098 Ga0207704_100110983 298
779 3300025938 Ga0207704_10050588 Ga0207704_100505882 298
780 3300025938 Ga0207704_10124838 Ga0207704_101248382 298
781 3300025938 Ga0207704_10158554 Ga0207704_101585542 298
782 3300025939 Ga0207665_10079155 Ga0207665_100791552 298
783 3300025939 Ga0207665_10150104 Ga0207665_101501041 298
784 3300025940 Ga0207691_10011760 Ga0207691_100117602 298
785 3300025940 Ga0207691_10114317 Ga0207691_101143172 298
786 3300025940 Ga0207691_10126097 Ga0207691_101260971 298
787 3300025941 Ga0207711_10022699 Ga0207711_100226995 298
788 3300025941 Ga0207711_10036602 Ga0207711_100366022 298
789 3300025941 Ga0207711_10200618 Ga0207711_102006182 298
790 3300025942 Ga0207689_10000159 Ga0207689_1000015925 298
791 3300025942 Ga0207689_10025106 Ga0207689_100251064 298
792 3300025944 Ga0207661_10007579 Ga0207661_100075793 298
793 3300025944 Ga0207661_10009807 Ga0207661_100098072 298
794 3300025945 Ga0207679_10053568 Ga0207679_100535682 298
795 3300025945 Ga0207679_10184057 Ga0207679_101840572 298
796 3300025945 Ga0207679_10434008 Ga0207679_104340082 298
797 3300025949 Ga0207667_10016840 Ga0207667_100168402 298
798 3300025949 Ga0207667_10064631 Ga0207667_100646314 298
799 3300025949 Ga0207667_10126841 Ga0207667_101268412 298
800 3300025949 Ga0207667_10484791 Ga0207667_104847912 298
801 3300025960 Ga0207651_10193878 Ga0207651_101938782 298
802 3300025961 Ga0207712_10040158 Ga0207712_100401582 298
803 3300025961 Ga0207712_10202287 Ga0207712_102022872 298
804 3300025961 Ga0207712_10420240 Ga0207712_104202401 298
805 3300025981 Ga0207640_10034460 Ga0207640_100344603 298
806 3300025981 Ga0207640_10250311 Ga0207640_102503112 298
807 3300025986 Ga0207658_10008973 Ga0207658_100089736 298
808 3300025986 Ga0207658_10021202 Ga0207658_100212025 298
809 3300025986 Ga0207658_10271354 Ga0207658_102713542 298
810 3300026023 Ga0207677_10041039 Ga0207677_100410392 298
811 3300026035 Ga0207703_10002699 Ga0207703_1000269916 298
812 3300026035 Ga0207703_10017959 Ga0207703_100179595 298
813 3300026035 Ga0207703_10144995 Ga0207703_101449952 298
814 3300026035 Ga0207703_10560275 Ga0207703_105602751 298
815 3300026041 Ga0207639_10042625 Ga0207639_100426252 298
816 3300026041 Ga0207639_10251802 Ga0207639_102518022 298
817 3300026067 Ga0207678_10011891 Ga0207678_100118918 298
818 3300026067 Ga0207678_10047090 Ga0207678_100470902 298
819 3300026067 Ga0207678_10053433 Ga0207678_100534333 298
820 3300026067 Ga0207678_10077637 Ga0207678_100776372 298
821 3300026075 Ga0207708_10000248 Ga0207708_1000024830 298
822 3300026075 Ga0207708_10011614 Ga0207708_100116144 298
823 3300026078 Ga0207702_10290230 Ga0207702_102902301 298
824 3300026078 Ga0207702_10377022 Ga0207702_103770222 298
825 3300026088 Ga0207641_10013187 Ga0207641_100131875 298
826 3300026088 Ga0207641_10199731 Ga0207641_101997311 298
827 3300026088 Ga0207641_10393676 Ga0207641_103936762 298
828 3300026089 Ga0207648_10000248 Ga0207648_1000024830 298
829 3300026089 Ga0207648_10026036 Ga0207648_100260364 298
830 3300026089 Ga0207648_10174087 Ga0207648_101740873 298
831 3300026095 Ga0207676_10043140 Ga0207676_100431402 298
832 3300026095 Ga0207676_10300812 Ga0207676_103008122 298
833 3300026095 Ga0207676_10375909 Ga0207676_103759092 298
834 3300026116 Ga0207674_10004582 Ga0207674_100045825 298
835 3300026116 Ga0207674_10047317 Ga0207674_100473171 298
836 3300026116 Ga0207674_10387587 Ga0207674_103875871 298
837 3300026118 Ga0207675_100000426 Ga0207675_10000042615 298
838 3300026118 Ga0207675_100017007 Ga0207675_1000170073 298
839 3300026118 Ga0207675_100028771 Ga0207675_1000287714 298
840 3300026118 Ga0207675_100132515 Ga0207675_1001325152 298
841 3300026118 Ga0207675_100138505 Ga0207675_1001385052 298
842 3300026121 Ga0207683_10002091 Ga0207683_100020911 298
843 3300026121 Ga0207683_10014218 Ga0207683_100142182 298
844 3300026121 Ga0207683_10073232 Ga0207683_100732322 298
845 3300026121 Ga0207683_10074413 Ga0207683_100744132 298
846 3300026121 Ga0207683_10083292 Ga0207683_100832922 298
847 3300026121 Ga0207683_10090709 Ga0207683_100907092 298
848 3300026121 Ga0207683_10191120 Ga0207683_101911202 298
849 3300026121 Ga0207683_10312034 Ga0207683_103120342 298
850 3300026121 Ga0207683_10420829 Ga0207683_104208292 298
851 3300026142 Ga0207698_10030421 Ga0207698_100304214 298
852 3300027671 Ga0209588_1015742 Ga0209588_10157422 298
853 3300028379 Ga0268266_10006822 Ga0268266_100068224 298
854 3300028379 Ga0268266_10052351 Ga0268266_100523513 298
855 3300028379 Ga0268266_10461477 Ga0268266_104614772 298
856 3300028379 Ga0268266_10473951 Ga0268266_104739512 298
857 3300028379 Ga0268266_10582327 Ga0268266_105823271 298
858 3300028380 Ga0268265_10009053 Ga0268265_100090532 298
859 3300028380 Ga0268265_10022104 Ga0268265_100221042 298
860 3300028380 Ga0268265_10263756 Ga0268265_102637561 298
861 3300028380 Ga0268265_10301253 Ga0268265_103012532 298
862 3300028381 Ga0268264_10000020 Ga0268264_10000020112 298
863 3300028381 Ga0268264_10018483 Ga0268264_100184835 298
864 3300028381 Ga0268264_10084506 Ga0268264_100845063 298
865 3300028381 Ga0268264_10234493 Ga0268264_102344932 298
866 3300030521 Ga0307511_10000499 Ga0307511_1000049927 298
867 3300030521 Ga0307511_10062819 Ga0307511_100628193 298
868 3300031456 Ga0307513_10178889 Ga0307513_101788892 298
869 3300031507 Ga0307509_10122293 Ga0307509_101222932 298
870 3300031548 Ga0307408_100017923 Ga0307408_1000179232 298
871 3300031548 Ga0307408_100062663 Ga0307408_1000626632 298
872 3300031616 Ga0307508_10088793 Ga0307508_100887931 298
873 3300031649 Ga0307514_10152433 Ga0307514_101524331 298
874 3300031731 Ga0307405_10007368 Ga0307405_100073685 298
875 3300031731 Ga0307405_10012696 Ga0307405_100126963 298
876 3300031824 Ga0307413_10061387 Ga0307413_100613871 298
877 3300031852 Ga0307410_10001424 Ga0307410_100014242 298
878 3300031901 Ga0307406_10003267 Ga0307406_100032676 298
879 3300031901 Ga0307406_10024568 Ga0307406_100245683 298
880 3300031901 Ga0307406_10087089 Ga0307406_100870892 298
881 3300031911 Ga0307412_10016495 Ga0307412_100164953 298
882 3300031911 Ga0307412_10233548 Ga0307412_102335482 298
883 3300031995 Ga0307409_100003569 Ga0307409_1000035696 298
884 3300031995 Ga0307409_100014701 Ga0307409_1000147014 298
885 3300031995 Ga0307409_100490894 Ga0307409_1004908942 298
886 3300032002 Ga0307416_100064996 Ga0307416_1000649962 298
887 3300032002 Ga0307416_100250153 Ga0307416_1002501532 298
888 3300032002 Ga0307416_100636203 Ga0307416_1006362032 298
889 3300032002 Ga0307416_100640447 Ga0307416_1006404472 298
890 3300032005 Ga0307411_10000547 Ga0307411_100005475 298
891 3300032126 Ga0307415_100001658 Ga0307415_1000016585 298
892 3300033180 Ga0307510_10019237 Ga0307510_100192373 298
893 3300033180 Ga0307510_10038138 Ga0307510_100381383 298
894 3300035112 Ga0373932_0008089 Ga0373932_0008089_1000_1896 298
895 3300035113 Ga0373936_0005672 Ga0373936_0005672_2783_3679 298
896 3300035113 Ga0373936_0082790 Ga0373936_0082790_291_1187 298
897 3300035116 Ga0373945_0004379 Ga0373945_0004379_428_1324 298
898 3300035116 Ga0373945_0074518 Ga0373945_0074518_200_1096 298
899 3300035118 Ga0373954_0007360 Ga0373954_0007360_691_1587 298
900 3300035118 Ga0373954_0099745 Ga0373954_0099745_37_933 298
901 3300035118 Ga0373954_0102936 Ga0373954_0102936_400_1296 298
902 3300035119 Ga0373956_0128676 Ga0373956_0128676_257_1153 298
903 3300035120 Ga0373957_0009030 Ga0373957_0009030_1770_2666 298
904 3300035120 Ga0373957_0030947 Ga0373957_0030947_1058_1954 298
905 3300035120 Ga0373957_0076518 Ga0373957_0076518_315_1211 298
906 3300035170 Ga0373943_0016917 Ga0373943_0016917_620_1516 298
907 3300035171 Ga0373946_0068210 Ga0373946_0068210_406_1302 298
908 3300035398 Ga0316574_0233619 Ga0316574_0233619_138_1034 298
909 3300035691 Ga0373931_0016732 Ga0373931_0016732_2204_3100 298
910 3300035692 Ga0373935_0006803 Ga0373935_0006803_1885_2781 298
911 3300035692 Ga0373935_0013290 Ga0373935_0013290_3587_4483 298
912 3300035695 Ga0373927_0013193 Ga0373927_0013193_2776_3672 298
913 3300035695 Ga0373927_0016649 Ga0373927_0016649_2601_3497 298
914 3300035695 Ga0373927_0037203 Ga0373927_0037203_267_1163 298
915 3300035695 Ga0373927_0059921 Ga0373927_0059921_1370_2266 298
916 3300035695 Ga0373927_0152253 Ga0373927_0152253_431_1327 298
917 3300035724 Ga0373933_0000052 Ga0373933_0000052_36534_37430 298
918 3300035725 Ga0373947_0006320 Ga0373947_0006320_2448_3344 298
919 3300035725 Ga0373947_0022644 Ga0373947_0022644_99_995 298
920 3300035725 Ga0373947_0034033 Ga0373947_0034033_1205_2101 298
921 3300036401 Ga0373937_0047530 Ga0373937_0047530_2634_3530 298
922 3300036401 Ga0373937_0161815 Ga0373937_0161815_1151_2047 298
923 3300036401 Ga0373937_0163926 Ga0373937_0163926_273_1169 298
924 3300036712 Ga0316584_0010473 Ga0316584_0010473_4704_5600 298
925 3300037068 Ga0373925_0017689 Ga0373925_0017689_3866_4762 298
926 3300037068 Ga0373925_0127754 Ga0373925_0127754_406_1302 298
927 3300037068 Ga0373925_0215827 Ga0373925_0215827_470_1366 298
928 3300037471 Ga0395905_0114673 Ga0395905_0114673_816_1712 298
929 3300041404 Ga0439436_0001548 Ga0439436_0001548_3945_4841 298
930 3300041407 Ga0439447_014312 Ga0439447_014312_112_1008 298
931 3300041413 Ga0439465_0000774 Ga0439465_0000774_6009_6905 298
932 3300041997 Ga0439431_0000394 Ga0439431_0000394_2355_3251 298
933 3300042004 Ga0439445_0001136 Ga0439445_0001136_1705_2601 298
934 3300042004 Ga0439445_0026192 Ga0439445_0026192_333_1229 298
935 3300042006 Ga0439432_001228 Ga0439432_001228_5621_6517 298
936 3300042007 Ga0439449_0026601 Ga0439449_0026601_968_1864 298
937 3300042010 Ga0439452_003157 Ga0439452_003157_2140_3036 298
938 3300042115 Ga0450911_000712 Ga0450911_000712_2983_3879 298
939 3300042185 Ga0450909_001959 Ga0450909_001959_402_1298 298
940 3300042435 Ga0439434_0000875 Ga0439434_0000875_1799_2695 298
941 3300044673 Ga0453683_0002262 Ga0453683_0002262_8370_9266 298
942 3300044673 Ga0453683_0080698 Ga0453683_0080698_157_1053 298
943 3300045051 Ga0451576_0014155 Ga0451576_0014155_2479_3375 298
944 3300045051 Ga0451576_0048819 Ga0451576_0048819_2721_3617 298
945 3300045976 Ga0466967_0061237 Ga0466967_0061237_1473_2369 298
946 3300046454 Ga0495592_0032113 Ga0495592_0032113_2818_3714 298
947 3300046454 Ga0495592_0079820 Ga0495592_0079820_1069_1965 298
948 3300046454 Ga0495592_0170871 Ga0495592_0170871_379_1275 298
949 3300046455 Ga0495603_0011507 Ga0495603_0011507_2034_2930 298
950 3300046455 Ga0495603_0013515 Ga0495603_0013515_3728_4624 298
951 3300046455 Ga0495603_0069911 Ga0495603_0069911_274_1170 298
952 3300046459 Ga0495629_0065657 Ga0495629_0065657_1557_2453 298
953 3300046459 Ga0495629_0074705 Ga0495629_0074705_1279_2175 298
954 3300046461 Ga0495641_0016211 Ga0495641_0016211_525_1421 298
955 3300046472 Ga0495580_0004026 Ga0495580_0004026_2954_3850 298
956 3300046472 Ga0495580_0021531 Ga0495580_0021531_2540_3436 298
957 3300046473 Ga0495582_0006646 Ga0495582_0006646_2656_3552 298
958 3300046473 Ga0495582_0008224 Ga0495582_0008224_842_1738 298
959 3300046474 Ga0495605_0022588 Ga0495605_0022588_2281_3177 298
960 3300046474 Ga0495605_0024779 Ga0495605_0024779_1711_2607 298
961 3300046474 Ga0495605_0100546 Ga0495605_0100546_252_1148 298
962 3300046475 Ga0495639_0000899 Ga0495639_0000899_6014_6910 298
963 3300046475 Ga0495639_0005803 Ga0495639_0005803_3914_4810 298
964 3300046475 Ga0495639_0027461 Ga0495639_0027461_333_1229 298
965 3300046476 Ga0495662_0012692 Ga0495662_0012692_789_1685 298
966 3300046477 Ga0495664_0007063 Ga0495664_0007063_1621_2517 298
967 3300046477 Ga0495664_0126198 Ga0495664_0126198_592_1488 298
968 3300046491 Ga0495584_0062928 Ga0495584_0062928_523_1419 298
969 3300046492 Ga0495585_0082939 Ga0495585_0082939_747_1643 298
970 3300046499 Ga0495594_0030099 Ga0495594_0030099_1725_2621 298
971 3300046501 Ga0495607_0083054 Ga0495607_0083054_377_1273 298
972 3300046514 Ga0495618_0081113 Ga0495618_0081113_1096_1992 298
973 3300046515 Ga0495620_0067547 Ga0495620_0067547_51_947 298
974 3300046516 Ga0495628_0118016 Ga0495628_0118016_1017_1913 298
975 3300046517 Ga0495630_0038724 Ga0495630_0038724_1882_2778 298
976 3300046517 Ga0495630_0053234 Ga0495630_0053234_1683_2579 298
977 3300046518 Ga0495631_0092989 Ga0495631_0092989_197_1093 298
978 3300046519 Ga0495632_0072267 Ga0495632_0072267_453_1349 298
979 3300046526 Ga0495666_0016941 Ga0495666_0016941_1942_2838 298
980 3300046529 Ga0495652_0036311 Ga0495652_0036311_2756_3652 298
981 3300046529 Ga0495652_0086761 Ga0495652_0086761_883_1779 298
982 3300046530 Ga0495654_0027390 Ga0495654_0027390_1980_2876 298
983 3300046531 Ga0495665_0004419 Ga0495665_0004419_171_1067 298
984 3300046531 Ga0495665_0042616 Ga0495665_0042616_908_1804 298
985 3300046533 Ga0495640_0018841 Ga0495640_0018841_395_1291 298
986 3300046537 Ga0495598_0012440 Ga0495598_0012440_198_1094 298
987 3300046537 Ga0495598_0032353 Ga0495598_0032353_36_932 298
988 3300046537 Ga0495598_0045923 Ga0495598_0045923_212_1108 298
989 3300046538 Ga0495609_0082195 Ga0495609_0082195_469_1365 298
990 3300046539 Ga0495621_0013313 Ga0495621_0013313_998_1894 298
991 3300046543 Ga0495645_0014210 Ga0495645_0014210_586_1482 298
992 3300046543 Ga0495645_0070240 Ga0495645_0070240_1615_2511 298
993 3300046557 Ga0495622_0013015 Ga0495622_0013015_1163_2059 298
994 3300046557 Ga0495622_0050722 Ga0495622_0050722_236_1132 298
995 3300046557 Ga0495622_0164244 Ga0495622_0164244_40_936 298
996 3300046558 Ga0495633_0051427 Ga0495633_0051427_952_1848 298
997 3300046558 Ga0495633_0089316 Ga0495633_0089316_502_1398 298
998 3300046559 Ga0495667_0173375 Ga0495667_0173375_224_1120 298
999 3300046615 Ga0495656_0010426 Ga0495656_0010426_1772_2668 298
1000 3300046616 Ga0495668_0220097 Ga0495668_0220097_27_923 298
1001 3300046642 Ga0495634_0099285 Ga0495634_0099285_786_1682 298
1002 3300046648 Ga0495611_0031066 Ga0495611_0031066_569_1465 298
1003 3300046663 Ga0495635_0011519 Ga0495635_0011519_664_1560 298
1004 3300046663 Ga0495635_0020966 Ga0495635_0020966_3624_4520 298
1005 3300046674 Ga0495588_0097710 Ga0495588_0097710_275_1171 298
1006 3300046674 Ga0495588_0154618 Ga0495588_0154618_176_1072 298
1007 3300046678 Ga0495599_0126985 Ga0495599_0126985_148_1044 298
1008 3300046678 Ga0495599_0268941 Ga0495599_0268941_60_956 298
1009 3300046680 Ga0495646_0092676 Ga0495646_0092676_358_1254 298
1010 3300046681 Ga0495647_0005461 Ga0495647_0005461_1166_2062 298
1011 3300046681 Ga0495647_0081884 Ga0495647_0081884_232_1128 298
1012 3300046683 Ga0495658_0010654 Ga0495658_0010654_637_1533 298
1013 3300046683 Ga0495658_0181050 Ga0495658_0181050_174_1070 298
1014 3300046684 Ga0495669_0107997 Ga0495669_0107997_248_1144 298
1015 3300046689 Ga0495613_0009283 Ga0495613_0009283_3715_4611 298
1016 3300046689 Ga0495613_0085486 Ga0495613_0085486_209_1105 298
1017 3300046689 Ga0495613_0293721 Ga0495613_0293721_220_1116 298
1018 3300046690 Ga0495624_0016396 Ga0495624_0016396_208_1104 298
1019 3300046691 Ga0495670_0018387 Ga0495670_0018387_1616_2512 298
1020 3300046691 Ga0495670_0058671 Ga0495670_0058671_141_1037 298
1021 3300046692 Ga0495671_0217070 Ga0495671_0217070_10_906 298
1022 3300047315 Ga0495581_0013837 Ga0495581_0013837_1163_2059 298
1023 3300047317 Ga0495604_0118972 Ga0495604_0118972_41_937 298
1024 3300047318 Ga0495636_0009131 Ga0495636_0009131_1854_2750 298
1025 3300047319 Ga0495674_0039213 Ga0495674_0039213_517_1413 298
1026 3300047320 Ga0495672_0125570 Ga0495672_0125570_361_1257 298
1027 3300047321 Ga0495676_0031851 Ga0495676_0031851_2219_3115 298
1028 3300047444 Ga0495675_0180742 Ga0495675_0180742_217_1113 298
1029 3300047470 Ga0495681_0090403 Ga0495681_0090403_231_1127 298
1030 3300047470 Ga0495681_0096190 Ga0495681_0096190_372_1268 298
1031 3300047471 Ga0495684_0011564 Ga0495684_0011564_415_1311 298
1032 3300047471 Ga0495684_0147381 Ga0495684_0147381_269_1165 298
1033 3300047472 Ga0495686_0029299 Ga0495686_0029299_244_1140 298
1034 3300047472 Ga0495686_0084660 Ga0495686_0084660_35_931 298
1035 3300047673 Ga0495593_0020360 Ga0495593_0020360_255_1151 298
1036 3300047673 Ga0495593_0027076 Ga0495593_0027076_509_1405 298
1037 3300047673 Ga0495593_0201857 Ga0495593_0201857_14_985 298
1038 3300048088 Ga0495602_0208100 Ga0495602_0208100_218_1114 298
1039 3300048089 Ga0495614_0042248 Ga0495614_0042248_421_1317 298
1040 3300048090 Ga0495615_0002153 Ga0495615_0002153_1197_2093 298
1041 3300048903 Ga0496100_0010350 Ga0496100_0010350_2931_3827 298
1042 3300048904 Ga0496101_0032479 Ga0496101_0032479_308_1204 298
1043 3300048904 Ga0496101_0045426 Ga0496101_0045426_781_1677 298
1044 3300048905 Ga0496102_0004752 Ga0496102_0004752_5186_6082 298
1045 3300048905 Ga0496102_0068893 Ga0496102_0068893_1693_2589 298
1046 3300048905 Ga0496102_0167254 Ga0496102_0167254_1024_1920 298
1047 3300048906 Ga0496103_0034432 Ga0496103_0034432_1157_2053 298
1048 3300048907 Ga0496104_0043776 Ga0496104_0043776_680_1576 298
1049 3300048907 Ga0496104_0102687 Ga0496104_0102687_887_1783 298
1050 3300048908 Ga0496105_0033643 Ga0496105_0033643_2353_3249 298
1051 3300048909 Ga0496106_0166440 Ga0496106_0166440_159_1055 298
1052 3300048909 Ga0496106_0198156 Ga0496106_0198156_267_1163 298
1053 3300048909 Ga0496106_0250786 Ga0496106_0250786_502_1398 298
1054 3300048910 Ga0496107_0007743 Ga0496107_0007743_2376_3272 298
1055 3300048911 Ga0496108_0491898 Ga0496108_0491898_126_1022 298
1056 3300048912 Ga0496109_0013303 Ga0496109_0013303_488_1384 298
1057 3300048912 Ga0496109_0031307 Ga0496109_0031307_3099_3995 298
1058 3300048912 Ga0496109_0283842 Ga0496109_0283842_152_1048 298
1059 3300048912 Ga0496109_0486899 Ga0496109_0486899_163_1059 298
1060 3300048912 Ga0496109_0631024 Ga0496109_0631024_28_924 298
1061 3300048913 Ga0496110_0026032 Ga0496110_0026032_260_1156 298
1062 3300048913 Ga0496110_0027726 Ga0496110_0027726_1438_2334 298
1063 3300048914 Ga0496111_0048970 Ga0496111_0048970_1829_2725 298
1064 3300048914 Ga0496111_0232733 Ga0496111_0232733_308_1204 298
1065 3300048915 Ga0496112_0070168 Ga0496112_0070168_1128_2024 298
1066 3300048915 Ga0496112_0121449 Ga0496112_0121449_365_1261 298
1067 3300048915 Ga0496112_0193064 Ga0496112_0193064_901_1797 298
1068 3300048916 Ga0496113_0003249 Ga0496113_0003249_1111_2007 298
1069 3300048916 Ga0496113_0017767 Ga0496113_0017767_751_1647 298
1070 3300048916 Ga0496113_0026946 Ga0496113_0026946_2431_3327 298
1071 3300048917 Ga0496114_0007527 Ga0496114_0007527_1313_2209 298
1072 3300048918 Ga0496115_0002391 Ga0496115_0002391_11140_12036 298
1073 3300048918 Ga0496115_0006943 Ga0496115_0006943_4687_5583 298
1074 3300048920 Ga0496117_0088182 Ga0496117_0088182_339_1235 298
1075 3300048924 Ga0496121_0006615 Ga0496121_0006615_13084_13980 298
1076 3300048924 Ga0496121_0035578 Ga0496121_0035578_966_1862 298
1077 3300048924 Ga0496121_0043929 Ga0496121_0043929_2334_3230 298
1078 3300048925 Ga0496122_0000039 Ga0496122_0000039_119696_120592 298
1079 3300048926 Ga0496123_0000026 Ga0496123_0000026_119792_120688 298
1080 3300048927 Ga0496124_0047240 Ga0496124_0047240_1196_2092 298
1081 3300048928 Ga0496125_0014317 Ga0496125_0014317_4173_5069 298
1082 3300048928 Ga0496125_0102183 Ga0496125_0102183_879_1775 298
1083 3300048929 Ga0496126_0010044 Ga0496126_0010044_7173_8072 298
1084 3300048929 Ga0496126_0017497 Ga0496126_0017497_2840_3736 298
1085 3300048929 Ga0496126_0234043 Ga0496126_0234043_53_949 298
1086 3300049460 Ga0495682_0022688 Ga0495682_0022688_858_1754 298
1087 3300049571 Ga0501034_0000812 Ga0501034_0000812_15757_16653 298
1088 3300049575 Ga0501039_0258413 Ga0501039_0258413_50_946 298
1089 3300049576 Ga0501040_0105476 Ga0501040_0105476_534_1430 298
1090 3300049582 Ga0501048_0107272 Ga0501048_0107272_14_910 298
1091 3300049588 Ga0501072_0000134 Ga0501072_0000134_35963_36859 298
1092 3300049591 Ga0501075_0150048 Ga0501075_0150048_271_1167 298
1093 3300049592 Ga0501076_0033230 Ga0501076_0033230_151_1047 298
1094 3300049741 Ga0501079_0195273 Ga0501079_0195273_320_1216 298
1095 3300050490 nmdc:mga03n38_11045_c1 nmdc:mga03n38_11045_c1_1507_2403 298
1096 3300050492 nmdc:mga0yw44_25794_c1 nmdc:mga0yw44_25794_c1_1976_2872 298
1097 3300050496 nmdc:mga07m45_20026_c1 nmdc:mga07m45_20026_c1_2375_3271 298
1098 3300050508 nmdc:mga09592_1120_c1 nmdc:mga09592_1120_c1_983_1918 298
1099 3300050509 nmdc:mga0qj67_22457_c1 nmdc:mga0qj67_22457_c1_1387_2322 298
1100 3300050509 nmdc:mga0qj67_372961_c1 nmdc:mga0qj67_372961_c1_114_1010 298
1101 3300050510 nmdc:mga06r32_239650_c1 nmdc:mga06r32_239650_c1_784_1680 298
1102 3300050511 nmdc:mga08y16_279756_c1 nmdc:mga08y16_279756_c1_457_1353 298
1103 3300050511 nmdc:mga08y16_494119_c1 nmdc:mga08y16_494119_c1_99_995 298
1104 3300050512 nmdc:mga0n895_188748_c1 nmdc:mga0n895_188748_c1_356_1252 298
1105 3300050512 nmdc:mga0n895_44749_c1 nmdc:mga0n895_44749_c1_1313_2209 298
1106 3300050512 nmdc:mga0n895_82990_c1 nmdc:mga0n895_82990_c1_449_1345 298
1107 3300050513 nmdc:mga0rr50_17123_c1 nmdc:mga0rr50_17123_c1_387_1283 298
1108 3300050513 nmdc:mga0rr50_234870_c1 nmdc:mga0rr50_234870_c1_168_1064 298
1109 3300050515 nmdc:mga0a205_590441_c1 nmdc:mga0a205_590441_c1_21_917 298
1110 3300053077 Ga0495601_0140052 Ga0495601_0140052_124_1020 298
1111 3300053077 Ga0495601_0166548 Ga0495601_0166548_201_1097 298
1112 3300053078 Ga0495612_0011987 Ga0495612_0011987_2153_3049 298
1113 3300053084 Ga0495595_0072209 Ga0495595_0072209_371_1267 298
1114 3300053085 Ga0495619_0040773 Ga0495619_0040773_2063_2959 298
1115 3300053090 Ga0500646_0000464 Ga0500646_0000464_4673_5569 298
1116 3300053096 Ga0500641_0160744 Ga0500641_0160744_32_928 298
1117 3300053119 Ga0500595_014358 Ga0500595_014358_63_959 298
1118 3300053133 Ga0500655_005291 Ga0500655_005291_689_1585 298
1119 3300053134 Ga0500658_0054348 Ga0500658_0054348_432_1328 298
1120 3300053136 Ga0500559_0005515 Ga0500559_0005515_1941_2837 298
1121 3300053139 Ga0500568_0083298 Ga0500568_0083298_54_950 298
1122 3300053140 Ga0500573_0008795 Ga0500573_0008795_2958_3854 298
1123 3300053142 Ga0500577_0137315 Ga0500577_0137315_16_912 298
1124 3300053148 Ga0500590_047748 Ga0500590_047748_838_1734 298
1125 3300053148 Ga0500590_084523 Ga0500590_084523_18_914 298
1126 3300053150 Ga0500603_000717 Ga0500603_000717_2312_3208 298
1127 3300053151 Ga0500604_0000243 Ga0500604_0000243_6026_6922 298
1128 3300053160 Ga0500633_0065580 Ga0500633_0065580_227_1123 298
1129 3300053161 Ga0500634_0089323 Ga0500634_0089323_416_1312 298
1130 3300053177 Ga0500636_0168929 Ga0500636_0168929_75_971 298
1131 3300053177 Ga0500636_0210549 Ga0500636_0210549_99_995 298
1132 3300053178 Ga0500637_0001020 Ga0500637_0001020_3043_3939 298
1133 3300053733 Ga0500552_003478 Ga0500552_003478_540_1436 298
1134 3300053735 Ga0500596_006291 Ga0500596_006291_901_1797 298
1135 3300054114 Ga0501084_0273119 Ga0501084_0273119_176_1072 298
1136 iso_pu_bacteria 2545555834 2545679551 298
1137 iso_pu_bacteria 2883577096 2883577268 298
1138 iso_pu_bacteria 2929199973 2929204150 298
1139 iso_pu_bacteria 3003665799 3003671402 298
1140 iso_pu_bacteria 8055909800 8055911322 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

39

315

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5547 5 284
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5498 4 288
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5443 10 284
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5434 4 288
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.5372 11 276
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9283 8 282 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9031 8 282 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8127 8 283 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7947 8 283 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7833 9 283 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A537UZA7-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9758 72 298 GO:0005886
GO:0006865
GO:0022857
AF-A0A537V1Q1-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9691 1 272 GO:0005886
GO:0006865
GO:0022857
AF-A0A520W5B1-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9687 1 298 GO:0005886
GO:0006865
GO:0022857
AF-A0A847DRL4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9682 5 247 GO:0005886
GO:0006865
GO:0022857
AF-A0A537UZA7-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9675 72 298 GO:0005886
GO:0006865
GO:0022857

Feature Viewer

pLDDT pTM Quality
85.62 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map