F490694
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1140 | 443 | 1124 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10057663|Ga0099794_100576632 |
| Length | 330 |
| Sequence | LLAFRHAICSVVLSNDVSNFAFARNDQQKNSAMNFFLTIILDGLIQASWLFIVALGLTLVFGVLKILNIAHGSFYALGAYIAATAVTTVAAHSLPPSVGFVAMLVSVALIASAVGLLLERGLLKMFYGRDEVVLLLVTYAVFLILEDVTKLIWGVNPIYATQPYELFGTLQFAGLYYVGYDLVLLPISAAIGFAVWFGLNRTITGKIVLAVIHNEEMSVSMGVRVNRVYAVAFAFGVLLAATAGALTAPKISMQPGLSSDVIILSFAIVVIGGLGSVEGAAVGAILVGLARAASVHLMPQAELFMIYLIMAAVLMFRPEGLFKRETARRI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 2 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 3 | 2791355199 | |||
| 4 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 5 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 6 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 7 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 8 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 9 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 10 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 11 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 12 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 13 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 14 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 17 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 94 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 97 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 103 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 108 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 109 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 110 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 111 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 112 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 113 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 114 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 118 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 217 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 222 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 223 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 224 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 225 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 226 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 229 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 230 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 231 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 235 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 236 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 237 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 238 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 247 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 251 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 252 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 255 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 256 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 261 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 264 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 265 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 266 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 267 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 268 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 269 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 270 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 271 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 272 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 273 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 274 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 275 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 276 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 277 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 278 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 279 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 280 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 281 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 282 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 356 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 357 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 358 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 359 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 360 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 361 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 364 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 365 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 366 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 369 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 370 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 371 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 372 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 373 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 374 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 375 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 376 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 398 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 401 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 403 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 419 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 420 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 422 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 423 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 424 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 426 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 427 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 428 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 429 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 430 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 431 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 432 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 433 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 434 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 435 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 436 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 437 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 438 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 441 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 442 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 443 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.51 |
| Metatranscriptomes | 0.18 |
| Isolates | 1.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.56 |
| Nodule | 0.26 |
| Rhizoplane | 4.56 |
| Rhizosphere | 87.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1004067 | 3300002070 | Bacteria | 1765 |
| 2 | rootH1_10104906 | 3300003323 | Bacteria | 2692 |
| 3 | JGI25404J52841_10004946 | 3300003659 | Bacteria | 2736 |
| 4 | JGI25404J52841_10006150 | 3300003659 | Bacteria | 2500 |
| 5 | JGI25404J52841_10008111 | 3300003659 | Bacteria | 2231 |
| 6 | JGI25405J52794_10001742 | 3300003911 | Unclassified | 3632 |
| 7 | Ga0070658_10084120 | 3300005327 | Bacteria | 2616 |
| 8 | Ga0070676_10022298 | 3300005328 | Bacteria | 3550 |
| 9 | Ga0070676_10045892 | 3300005328 | Bacteria | 2546 |
| 10 | Ga0070683_100007447 | 3300005329 | Bacteria | 9247 |
| 11 | Ga0070683_100021476 | 3300005329 | Bacteria | 5763 |
| 12 | Ga0070683_100160001 | 3300005329 | Bacteria | 2136 |
| 13 | Ga0070683_100168615 | 3300005329 | Bacteria | 2078 |
| 14 | Ga0070683_100530265 | 3300005329 | Bacteria | 1125 |
| 15 | Ga0070690_100000399 | 3300005330 | Bacteria | 21981 |
| 16 | Ga0070690_100048374 | 3300005330 | Bacteria | 2708 |
| 17 | Ga0070690_100117188 | 3300005330 | Bacteria | 1784 |
| 18 | Ga0070670_100000922 | 3300005331 | Bacteria | 23101 |
| 19 | Ga0070670_100030097 | 3300005331 | Bacteria | 4675 |
| 20 | Ga0070670_100055450 | 3300005331 | Bacteria | 3402 |
| 21 | Ga0070677_10024124 | 3300005333 | Bacteria | 2259 |
| 22 | Ga0070677_10049495 | 3300005333 | Bacteria | 1692 |
| 23 | Ga0068869_100003219 | 3300005334 | Bacteria | 9981 |
| 24 | Ga0068869_100006651 | 3300005334 | Bacteria | 7341 |
| 25 | Ga0068869_100026483 | 3300005334 | Bacteria | 4037 |
| 26 | Ga0068869_100117287 | 3300005334 | Bacteria | 2032 |
| 27 | Ga0068869_100290236 | 3300005334 | Bacteria | 1318 |
| 28 | Ga0070666_10002324 | 3300005335 | Bacteria | 11490 |
| 29 | Ga0070666_10204326 | 3300005335 | Bacteria | 1390 |
| 30 | Ga0070680_100021711 | 3300005336 | Bacteria | 5105 |
| 31 | Ga0070680_100044919 | 3300005336 | Bacteria | 3591 |
| 32 | Ga0070680_100271745 | 3300005336 | Bacteria | 1435 |
| 33 | Ga0070682_100049722 | 3300005337 | Bacteria | 2615 |
| 34 | Ga0070682_100146291 | 3300005337 | Bacteria | 1616 |
| 35 | Ga0070682_100158271 | 3300005337 | Bacteria | 1562 |
| 36 | Ga0068868_100000189 | 3300005338 | Bacteria | 41014 |
| 37 | Ga0068868_100010035 | 3300005338 | Bacteria | 6842 |
| 38 | Ga0068868_100199466 | 3300005338 | Bacteria | 1667 |
| 39 | Ga0068868_100223016 | 3300005338 | Bacteria | 1579 |
| 40 | Ga0068868_100238981 | 3300005338 | Bacteria | 1525 |
| 41 | Ga0070660_100003956 | 3300005339 | Bacteria | 10238 |
| 42 | Ga0070660_100095014 | 3300005339 | Bacteria | 2356 |
| 43 | Ga0070660_100321134 | 3300005339 | Bacteria | 1272 |
| 44 | Ga0070689_100004701 | 3300005340 | Bacteria | 9260 |
| 45 | Ga0070689_100021719 | 3300005340 | Bacteria | 4784 |
| 46 | Ga0070691_10006502 | 3300005341 | Bacteria | 5344 |
| 47 | Ga0070687_100127302 | 3300005343 | Bacteria | 1466 |
| 48 | Ga0070687_100128137 | 3300005343 | Bacteria | 1462 |
| 49 | Ga0070687_100248206 | 3300005343 | Bacteria | 1104 |
| 50 | Ga0070661_100082837 | 3300005344 | Bacteria | 2369 |
| 51 | Ga0070692_10008809 | 3300005345 | Bacteria | 4516 |
| 52 | Ga0070692_10013225 | 3300005345 | Bacteria | 3843 |
| 53 | Ga0070692_10081406 | 3300005345 | Bacteria | 1745 |
| 54 | Ga0070668_100023686 | 3300005347 | Bacteria | 4646 |
| 55 | Ga0070668_100025239 | 3300005347 | Bacteria | 4504 |
| 56 | Ga0070668_100031806 | 3300005347 | Bacteria | 4015 |
| 57 | Ga0070668_100216582 | 3300005347 | Bacteria | 1577 |
| 58 | Ga0070669_100007163 | 3300005353 | Bacteria | 8015 |
| 59 | Ga0070669_100097613 | 3300005353 | Bacteria | 2212 |
| 60 | Ga0070669_100100811 | 3300005353 | Bacteria | 2178 |
| 61 | Ga0070669_100101253 | 3300005353 | Bacteria | 2173 |
| 62 | Ga0070669_100266355 | 3300005353 | Bacteria | 1369 |
| 63 | Ga0070669_100289500 | 3300005353 | Bacteria | 1314 |
| 64 | Ga0070675_100000563 | 3300005354 | Bacteria | 25564 |
| 65 | Ga0070675_100002677 | 3300005354 | Bacteria | 13386 |
| 66 | Ga0070675_100041355 | 3300005354 | Bacteria | 3765 |
| 67 | Ga0070675_100042797 | 3300005354 | Bacteria | 3701 |
| 68 | Ga0070675_100267858 | 3300005354 | Bacteria | 1498 |
| 69 | Ga0070671_100012832 | 3300005355 | Bacteria | 6756 |
| 70 | Ga0070671_100021121 | 3300005355 | Bacteria | 5316 |
| 71 | Ga0070671_100096376 | 3300005355 | Bacteria | 2481 |
| 72 | Ga0070674_100095783 | 3300005356 | Bacteria | 2152 |
| 73 | Ga0070673_100001225 | 3300005364 | Bacteria | 14841 |
| 74 | Ga0070673_100056985 | 3300005364 | Bacteria | 3085 |
| 75 | Ga0070673_100285571 | 3300005364 | Bacteria | 1449 |
| 76 | Ga0070673_100394101 | 3300005364 | Unclassified | 1237 |
| 77 | Ga0070673_100406033 | 3300005364 | Bacteria | 1219 |
| 78 | Ga0070673_100434033 | 3300005364 | Bacteria | 1179 |
| 79 | Ga0070688_100017560 | 3300005365 | Bacteria | 4109 |
| 80 | Ga0070688_100149275 | 3300005365 | Bacteria | 1596 |
| 81 | Ga0070688_100151470 | 3300005365 | Bacteria | 1586 |
| 82 | Ga0070659_100009066 | 3300005366 | Bacteria | 7300 |
| 83 | Ga0070659_100063230 | 3300005366 | Bacteria | 2928 |
| 84 | Ga0070659_100064853 | 3300005366 | Bacteria | 2892 |
| 85 | Ga0070659_100099403 | 3300005366 | Bacteria | 2340 |
| 86 | Ga0070659_100204556 | 3300005366 | Unclassified | 1626 |
| 87 | Ga0070667_100001024 | 3300005367 | Bacteria | 25540 |
| 88 | Ga0070667_100015983 | 3300005367 | Bacteria | 6209 |
| 89 | Ga0070667_100084563 | 3300005367 | Bacteria | 2720 |
| 90 | Ga0070667_100151586 | 3300005367 | Bacteria | 2037 |
| 91 | Ga0070709_10167893 | 3300005434 | Bacteria | 1531 |
| 92 | Ga0070709_10168140 | 3300005434 | Bacteria | 1530 |
| 93 | Ga0070714_100082979 | 3300005435 | Bacteria | 2793 |
| 94 | Ga0070714_100181421 | 3300005435 | Unclassified | 1916 |
| 95 | Ga0070713_100018535 | 3300005436 | Bacteria | 5290 |
| 96 | Ga0070713_100103117 | 3300005436 | Unclassified | 2475 |
| 97 | Ga0070713_100384562 | 3300005436 | Bacteria | 1308 |
| 98 | Ga0070710_10012418 | 3300005437 | Bacteria | 4230 |
| 99 | Ga0070710_10025349 | 3300005437 | Unclassified | 3140 |
| 100 | Ga0070710_10031115 | 3300005437 | Bacteria | 2877 |
| 101 | Ga0070701_10000752 | 3300005438 | Bacteria | 11518 |
| 102 | Ga0070701_10111869 | 3300005438 | Bacteria | 1527 |
| 103 | Ga0070711_100011490 | 3300005439 | Bacteria | 5500 |
| 104 | Ga0070711_100065709 | 3300005439 | Bacteria | 2538 |
| 105 | Ga0070705_100007429 | 3300005440 | Bacteria | 5391 |
| 106 | Ga0070705_100058565 | 3300005440 | Bacteria | 2277 |
| 107 | Ga0070705_100278045 | 3300005440 | Bacteria | 1189 |
| 108 | Ga0070700_100000925 | 3300005441 | Bacteria | 14513 |
| 109 | Ga0070700_100131998 | 3300005441 | Bacteria | 1687 |
| 110 | Ga0070694_100025958 | 3300005444 | Bacteria | 3794 |
| 111 | Ga0070708_100199227 | 3300005445 | Bacteria | 1874 |
| 112 | Ga0070663_100046461 | 3300005455 | Bacteria | 3072 |
| 113 | Ga0070663_100049930 | 3300005455 | Bacteria | 2974 |
| 114 | Ga0070663_100100390 | 3300005455 | Bacteria | 2159 |
| 115 | Ga0070663_100124743 | 3300005455 | Bacteria | 1949 |
| 116 | Ga0070663_100140237 | 3300005455 | Bacteria | 1845 |
| 117 | Ga0070663_100307727 | 3300005455 | Bacteria | 1270 |
| 118 | Ga0070678_100007403 | 3300005456 | Bacteria | 6508 |
| 119 | Ga0070678_100025200 | 3300005456 | Bacteria | 3997 |
| 120 | Ga0070678_100037245 | 3300005456 | Bacteria | 3414 |
| 121 | Ga0070678_100057699 | 3300005456 | Bacteria | 2846 |
| 122 | Ga0070678_100092852 | 3300005456 | Bacteria | 2319 |
| 123 | Ga0070662_100159262 | 3300005457 | Unclassified | 1765 |
| 124 | Ga0070681_10018365 | 3300005458 | Bacteria | 6989 |
| 125 | Ga0070681_10070398 | 3300005458 | Bacteria | 3463 |
| 126 | Ga0070681_10097072 | 3300005458 | Bacteria | 2894 |
| 127 | Ga0070681_10144278 | 3300005458 | Bacteria | 2310 |
| 128 | Ga0070681_10211631 | 3300005458 | Bacteria | 1855 |
| 129 | Ga0068867_100006149 | 3300005459 | Bacteria | 8500 |
| 130 | Ga0068867_100089100 | 3300005459 | Bacteria | 2339 |
| 131 | Ga0068867_100099061 | 3300005459 | Bacteria | 2223 |
| 132 | Ga0068867_100273901 | 3300005459 | Bacteria | 1381 |
| 133 | Ga0070685_10015529 | 3300005466 | Bacteria | 4045 |
| 134 | Ga0070685_10025496 | 3300005466 | Bacteria | 3256 |
| 135 | Ga0070685_10137422 | 3300005466 | Bacteria | 1535 |
| 136 | Ga0070706_100516414 | 3300005467 | Bacteria | 1111 |
| 137 | Ga0070707_100341436 | 3300005468 | Bacteria | 1455 |
| 138 | Ga0070707_100422316 | 3300005468 | Bacteria | 1294 |
| 139 | Ga0070699_100000906 | 3300005518 | Bacteria | 27657 |
| 140 | Ga0070699_100023230 | 3300005518 | Bacteria | 5341 |
| 141 | Ga0070699_100305293 | 3300005518 | Bacteria | 1428 |
| 142 | Ga0070679_100005441 | 3300005530 | Bacteria | 11805 |
| 143 | Ga0070679_100015823 | 3300005530 | Bacteria | 7258 |
| 144 | Ga0070679_100024448 | 3300005530 | Bacteria | 5919 |
| 145 | Ga0070679_100184090 | 3300005530 | Bacteria | 2060 |
| 146 | Ga0070679_100238268 | 3300005530 | Bacteria | 1778 |
| 147 | Ga0070679_100244858 | 3300005530 | Bacteria | 1750 |
| 148 | Ga0070684_100007885 | 3300005535 | Bacteria | 8305 |
| 149 | Ga0070684_100386411 | 3300005535 | Bacteria | 1289 |
| 150 | Ga0070697_100005574 | 3300005536 | Bacteria | 9706 |
| 151 | Ga0070697_100070715 | 3300005536 | Bacteria | 2861 |
| 152 | Ga0068853_100026014 | 3300005539 | Bacteria | 4912 |
| 153 | Ga0068853_100139481 | 3300005539 | Bacteria | 2176 |
| 154 | Ga0070672_100001036 | 3300005543 | Bacteria | 16922 |
| 155 | Ga0070672_100055373 | 3300005543 | Bacteria | 3107 |
| 156 | Ga0070672_100061105 | 3300005543 | Bacteria | 2969 |
| 157 | Ga0070672_100176970 | 3300005543 | Bacteria | 1776 |
| 158 | Ga0070672_100251519 | 3300005543 | Bacteria | 1488 |
| 159 | Ga0070686_100000177 | 3300005544 | Bacteria | 44963 |
| 160 | Ga0070686_100184150 | 3300005544 | Bacteria | 1486 |
| 161 | Ga0070695_100047657 | 3300005545 | Bacteria | 2738 |
| 162 | Ga0070695_100120853 | 3300005545 | Bacteria | 1792 |
| 163 | Ga0070696_100047841 | 3300005546 | Bacteria | 2968 |
| 164 | Ga0070696_100054698 | 3300005546 | Bacteria | 2782 |
| 165 | Ga0070693_100043604 | 3300005547 | Bacteria | 2534 |
| 166 | Ga0070693_100094607 | 3300005547 | Bacteria | 1808 |
| 167 | Ga0070693_100106228 | 3300005547 | Unclassified | 1719 |
| 168 | Ga0070693_100265944 | 3300005547 | Bacteria | 1143 |
| 169 | Ga0070665_100007828 | 3300005548 | Bacteria | 10840 |
| 170 | Ga0070665_100148762 | 3300005548 | Bacteria | 2345 |
| 171 | Ga0070665_100164423 | 3300005548 | Bacteria | 2221 |
| 172 | Ga0070665_100182079 | 3300005548 | Bacteria | 2102 |
| 173 | Ga0070665_100471820 | 3300005548 | Bacteria | 1265 |
| 174 | Ga0070665_100491677 | 3300005548 | Bacteria | 1238 |
| 175 | Ga0070704_100037598 | 3300005549 | Bacteria | 3309 |
| 176 | Ga0068855_100012729 | 3300005563 | Bacteria | 10146 |
| 177 | Ga0068855_100064508 | 3300005563 | Bacteria | 4271 |
| 178 | Ga0068855_100100124 | 3300005563 | Bacteria | 3337 |
| 179 | Ga0068855_100348945 | 3300005563 | Bacteria | 1630 |
| 180 | Ga0070664_100118640 | 3300005564 | Bacteria | 2314 |
| 181 | Ga0070664_100163670 | 3300005564 | Bacteria | 1970 |
| 182 | Ga0070664_100185844 | 3300005564 | Bacteria | 1849 |
| 183 | Ga0068857_100006104 | 3300005577 | Bacteria | 10293 |
| 184 | Ga0068857_100029484 | 3300005577 | Bacteria | 4842 |
| 185 | Ga0068857_100294722 | 3300005577 | Bacteria | 1494 |
| 186 | Ga0068854_100119452 | 3300005578 | Bacteria | 1999 |
| 187 | Ga0068856_100015300 | 3300005614 | Bacteria | 7414 |
| 188 | Ga0068856_100037984 | 3300005614 | Bacteria | 4726 |
| 189 | Ga0068856_100063577 | 3300005614 | Bacteria | 3646 |
| 190 | Ga0068856_100070922 | 3300005614 | Bacteria | 3448 |
| 191 | Ga0068856_100098205 | 3300005614 | Bacteria | 2918 |
| 192 | Ga0068856_100287268 | 3300005614 | Bacteria | 1662 |
| 193 | Ga0068856_100444505 | 3300005614 | Bacteria | 1317 |
| 194 | Ga0070702_100000094 | 3300005615 | Bacteria | 26453 |
| 195 | Ga0070702_100211269 | 3300005615 | Bacteria | 1292 |
| 196 | Ga0068852_100120955 | 3300005616 | Bacteria | 2397 |
| 197 | Ga0068852_100127348 | 3300005616 | Bacteria | 2340 |
| 198 | Ga0068859_100003487 | 3300005617 | Bacteria | 16012 |
| 199 | Ga0068859_100052149 | 3300005617 | Bacteria | 4112 |
| 200 | Ga0068859_100081825 | 3300005617 | Bacteria | 3271 |
| 201 | Ga0068859_100103458 | 3300005617 | Bacteria | 2905 |
| 202 | Ga0068859_100132092 | 3300005617 | Bacteria | 2568 |
| 203 | Ga0068859_100422291 | 3300005617 | Bacteria | 1429 |
| 204 | Ga0068859_100434222 | 3300005617 | Bacteria | 1410 |
| 205 | Ga0068864_100002453 | 3300005618 | Bacteria | 15310 |
| 206 | Ga0068864_100006881 | 3300005618 | Bacteria | 9318 |
| 207 | Ga0068864_100043158 | 3300005618 | Bacteria | 3860 |
| 208 | Ga0068864_100163901 | 3300005618 | Bacteria | 2022 |
| 209 | Ga0068864_100585237 | 3300005618 | Bacteria | 1082 |
| 210 | Ga0068866_10002364 | 3300005718 | Bacteria | 7824 |
| 211 | Ga0068866_10017758 | 3300005718 | Bacteria | 3204 |
| 212 | Ga0068861_100000255 | 3300005719 | Bacteria | 29611 |
| 213 | Ga0068861_100005129 | 3300005719 | Bacteria | 8829 |
| 214 | Ga0068861_100067328 | 3300005719 | Bacteria | 2763 |
| 215 | Ga0068851_10004859 | 3300005834 | Bacteria | 6084 |
| 216 | Ga0068851_10116012 | 3300005834 | Bacteria | 1435 |
| 217 | Ga0068851_10212202 | 3300005834 | Bacteria | 1084 |
| 218 | Ga0068870_10004257 | 3300005840 | Bacteria | 6152 |
| 219 | Ga0068870_10135986 | 3300005840 | Bacteria | 1433 |
| 220 | Ga0068870_10146502 | 3300005840 | Bacteria | 1387 |
| 221 | Ga0068863_100006441 | 3300005841 | Bacteria | 11514 |
| 222 | Ga0068863_100043780 | 3300005841 | Bacteria | 4249 |
| 223 | Ga0068863_100139191 | 3300005841 | Bacteria | 2319 |
| 224 | Ga0068863_100251345 | 3300005841 | Bacteria | 1708 |
| 225 | Ga0068858_100000882 | 3300005842 | Bacteria | 31130 |
| 226 | Ga0068858_100001789 | 3300005842 | Bacteria | 21923 |
| 227 | Ga0068858_100080687 | 3300005842 | Bacteria | 3023 |
| 228 | Ga0068858_100406802 | 3300005842 | Bacteria | 1308 |
| 229 | Ga0068860_100000302 | 3300005843 | Bacteria | 68581 |
| 230 | Ga0068860_100003206 | 3300005843 | Bacteria | 16886 |
| 231 | Ga0068860_100006654 | 3300005843 | Bacteria | 11606 |
| 232 | Ga0068860_100007353 | 3300005843 | Bacteria | 11010 |
| 233 | Ga0068860_100008918 | 3300005843 | Bacteria | 9993 |
| 234 | Ga0068862_100007694 | 3300005844 | Bacteria | 8914 |
| 235 | Ga0068862_100014806 | 3300005844 | Bacteria | 6478 |
| 236 | Ga0068862_100021668 | 3300005844 | Bacteria | 5373 |
| 237 | Ga0068862_100044997 | 3300005844 | Bacteria | 3765 |
| 238 | Ga0068862_100097221 | 3300005844 | Bacteria | 2570 |
| 239 | Ga0068862_100161893 | 3300005844 | Bacteria | 1998 |
| 240 | Ga0068862_100193274 | 3300005844 | Bacteria | 1832 |
| 241 | Ga0081455_10000968 | 3300005937 | Bacteria | 36782 |
| 242 | Ga0081455_10001667 | 3300005937 | Bacteria | 26919 |
| 243 | Ga0081455_10001790 | 3300005937 | Bacteria | 25948 |
| 244 | Ga0081455_10008173 | 3300005937 | Bacteria | 10912 |
| 245 | Ga0081455_10155344 | 3300005937 | Bacteria | 1759 |
| 246 | Ga0081455_10318319 | 3300005937 | Bacteria | 1109 |
| 247 | Ga0081538_10003075 | 3300005981 | Bacteria | 15874 |
| 248 | Ga0081538_10022297 | 3300005981 | Unclassified | 4591 |
| 249 | Ga0081538_10032479 | 3300005981 | Bacteria | 3496 |
| 250 | Ga0081538_10056445 | 3300005981 | Bacteria | 2300 |
| 251 | Ga0081538_10058242 | 3300005981 | Bacteria | 2243 |
| 252 | Ga0081540_1000918 | 3300005983 | Bacteria | 26491 |
| 253 | Ga0081540_1002732 | 3300005983 | Bacteria | 14358 |
| 254 | Ga0081540_1002906 | 3300005983 | Bacteria | 13809 |
| 255 | Ga0081540_1006154 | 3300005983 | Bacteria | 8804 |
| 256 | Ga0081540_1006733 | 3300005983 | Bacteria | 8312 |
| 257 | Ga0081540_1010879 | 3300005983 | Bacteria | 6111 |
| 258 | Ga0081540_1028665 | 3300005983 | Bacteria | 3121 |
| 259 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 260 | Ga0081539_10000584 | 3300005985 | Bacteria | 74942 |
| 261 | Ga0081539_10027501 | 3300005985 | Bacteria | 3600 |
| 262 | Ga0081539_10038599 | 3300005985 | Bacteria | 2828 |
| 263 | Ga0070717_10012536 | 3300006028 | Bacteria | 6465 |
| 264 | Ga0075365_10032976 | 3300006038 | Bacteria | 3333 |
| 265 | Ga0075365_10064463 | 3300006038 | Bacteria | 2455 |
| 266 | Ga0075365_10075634 | 3300006038 | Bacteria | 2273 |
| 267 | Ga0075365_10246597 | 3300006038 | Bacteria | 1254 |
| 268 | Ga0075368_10007386 | 3300006042 | Bacteria | 3876 |
| 269 | Ga0075363_100000768 | 3300006048 | Bacteria | 11015 |
| 270 | Ga0075363_100015561 | 3300006048 | Bacteria | 3741 |
| 271 | Ga0075363_100018197 | 3300006048 | Bacteria | 3495 |
| 272 | Ga0070712_100001605 | 3300006175 | Bacteria | 13817 |
| 273 | Ga0070712_100009301 | 3300006175 | Bacteria | 6191 |
| 274 | Ga0070712_100088811 | 3300006175 | Bacteria | 2259 |
| 275 | Ga0070712_100172220 | 3300006175 | Unclassified | 1681 |
| 276 | Ga0070712_100230857 | 3300006175 | Bacteria | 1469 |
| 277 | Ga0075362_10136798 | 3300006177 | Bacteria | 1169 |
| 278 | Ga0075367_10019341 | 3300006178 | Bacteria | 3775 |
| 279 | Ga0075367_10048909 | 3300006178 | Bacteria | 2492 |
| 280 | Ga0075369_10005272 | 3300006186 | Bacteria | 4821 |
| 281 | Ga0075366_10009755 | 3300006195 | Bacteria | 5369 |
| 282 | Ga0075366_10010651 | 3300006195 | Bacteria | 5167 |
| 283 | Ga0075366_10020528 | 3300006195 | Bacteria | 3834 |
| 284 | Ga0075366_10123714 | 3300006195 | Bacteria | 1559 |
| 285 | Ga0097621_100022442 | 3300006237 | Bacteria | 4900 |
| 286 | Ga0097621_100028036 | 3300006237 | Bacteria | 4435 |
| 287 | Ga0097621_100032753 | 3300006237 | Bacteria | 4133 |
| 288 | Ga0097621_100097681 | 3300006237 | Bacteria | 2466 |
| 289 | Ga0097621_100274093 | 3300006237 | Bacteria | 1483 |
| 290 | Ga0075370_10004796 | 3300006353 | Bacteria | 6624 |
| 291 | Ga0075370_10062814 | 3300006353 | Bacteria | 2116 |
| 292 | Ga0075370_10125906 | 3300006353 | Bacteria | 1493 |
| 293 | Ga0068871_100007550 | 3300006358 | Bacteria | 7779 |
| 294 | Ga0068871_100026378 | 3300006358 | Bacteria | 4533 |
| 295 | Ga0068871_100029904 | 3300006358 | Bacteria | 4284 |
| 296 | Ga0068871_100046138 | 3300006358 | Bacteria | 3509 |
| 297 | Ga0068871_100061174 | 3300006358 | Bacteria | 3074 |
| 298 | Ga0068871_100289553 | 3300006358 | Bacteria | 1435 |
| 299 | Ga0068871_100304888 | 3300006358 | Bacteria | 1399 |
| 300 | Ga0075428_100066041 | 3300006844 | Bacteria | 3962 |
| 301 | Ga0075428_100164692 | 3300006844 | Bacteria | 2405 |
| 302 | Ga0075428_100482384 | 3300006844 | Bacteria | 1327 |
| 303 | Ga0075430_100009372 | 3300006846 | Bacteria | 8276 |
| 304 | Ga0075430_100037653 | 3300006846 | Bacteria | 4100 |
| 305 | Ga0075430_100206074 | 3300006846 | Bacteria | 1632 |
| 306 | Ga0075431_100053369 | 3300006847 | Unclassified | 4168 |
| 307 | Ga0075431_100219242 | 3300006847 | Bacteria | 1941 |
| 308 | Ga0075433_10158585 | 3300006852 | Unclassified | 2013 |
| 309 | Ga0075434_100011947 | 3300006871 | Bacteria | 8214 |
| 310 | Ga0075434_100373067 | 3300006871 | Bacteria | 1448 |
| 311 | Ga0075429_100002916 | 3300006880 | Bacteria | 14508 |
| 312 | Ga0075429_100056334 | 3300006880 | Bacteria | 3421 |
| 313 | Ga0068865_100000317 | 3300006881 | Bacteria | 26703 |
| 314 | Ga0068865_100008577 | 3300006881 | Bacteria | 6319 |
| 315 | Ga0068865_100009177 | 3300006881 | Bacteria | 6121 |
| 316 | Ga0068865_100058984 | 3300006881 | Bacteria | 2683 |
| 317 | Ga0068865_100095914 | 3300006881 | Bacteria | 2162 |
| 318 | Ga0068865_100112089 | 3300006881 | Bacteria | 2014 |
| 319 | Ga0068865_100277349 | 3300006881 | Bacteria | 1333 |
| 320 | Ga0075436_100046979 | 3300006914 | Bacteria | 2977 |
| 321 | Ga0097620_100003487 | 3300006931 | Bacteria | 16012 |
| 322 | Ga0097620_100052151 | 3300006931 | Bacteria | 4112 |
| 323 | Ga0097620_100081827 | 3300006931 | Bacteria | 3271 |
| 324 | Ga0097620_100103453 | 3300006931 | Bacteria | 2905 |
| 325 | Ga0097620_100132099 | 3300006931 | Bacteria | 2568 |
| 326 | Ga0097620_100422278 | 3300006931 | Bacteria | 1429 |
| 327 | Ga0097620_100434208 | 3300006931 | Bacteria | 1410 |
| 328 | Ga0075435_100037025 | 3300007076 | Bacteria | 3883 |
| 329 | Ga0075435_100470637 | 3300007076 | Bacteria | 1085 |
| 330 | Ga0099794_10057663 | 3300007265 | Bacteria | 1882 |
| 331 | Ga0099795_10107426 | 3300007788 | Bacteria | 1102 |
| 332 | Ga0105240_10019274 | 3300009093 | Bacteria | 9118 |
| 333 | Ga0105240_10036890 | 3300009093 | Bacteria | 6285 |
| 334 | Ga0105240_10121831 | 3300009093 | Bacteria | 3140 |
| 335 | Ga0105240_10155110 | 3300009093 | Bacteria | 2724 |
| 336 | Ga0111539_10125112 | 3300009094 | Bacteria | 3013 |
| 337 | Ga0111539_10226850 | 3300009094 | Unclassified | 2176 |
| 338 | Ga0111539_10303506 | 3300009094 | Bacteria | 1858 |
| 339 | Ga0111539_10541322 | 3300009094 | Bacteria | 1356 |
| 340 | Ga0105245_10000323 | 3300009098 | Bacteria | 45144 |
| 341 | Ga0105245_10072790 | 3300009098 | Bacteria | 3123 |
| 342 | Ga0105245_10158197 | 3300009098 | Bacteria | 2148 |
| 343 | Ga0105245_10363627 | 3300009098 | Bacteria | 1437 |
| 344 | Ga0105245_10441284 | 3300009098 | Bacteria | 1308 |
| 345 | Ga0105247_10116428 | 3300009101 | Bacteria | 1726 |
| 346 | Ga0105247_10255586 | 3300009101 | Bacteria | 1199 |
| 347 | Ga0114129_10203550 | 3300009147 | Bacteria | 2680 |
| 348 | Ga0114129_10245029 | 3300009147 | Bacteria | 2408 |
| 349 | Ga0105243_10004705 | 3300009148 | Bacteria | 10745 |
| 350 | Ga0105243_10042633 | 3300009148 | Bacteria | 3553 |
| 351 | Ga0105243_10043295 | 3300009148 | Bacteria | 3528 |
| 352 | Ga0105243_10045697 | 3300009148 | Bacteria | 3442 |
| 353 | Ga0105243_10238117 | 3300009148 | Bacteria | 1618 |
| 354 | Ga0105243_10307624 | 3300009148 | Bacteria | 1439 |
| 355 | Ga0105241_10009325 | 3300009174 | Bacteria | 7213 |
| 356 | Ga0105241_10039823 | 3300009174 | Bacteria | 3546 |
| 357 | Ga0105241_10125477 | 3300009174 | Bacteria | 2072 |
| 358 | Ga0105241_10336513 | 3300009174 | Bacteria | 1306 |
| 359 | Ga0105242_10000119 | 3300009176 | Bacteria | 57821 |
| 360 | Ga0105242_10034121 | 3300009176 | Bacteria | 4079 |
| 361 | Ga0105242_10114505 | 3300009176 | Bacteria | 2304 |
| 362 | Ga0105242_10196837 | 3300009176 | Bacteria | 1787 |
| 363 | Ga0105242_10262622 | 3300009176 | Bacteria | 1560 |
| 364 | Ga0105242_10413550 | 3300009176 | Bacteria | 1262 |
| 365 | Ga0105248_10006375 | 3300009177 | Bacteria | 12948 |
| 366 | Ga0105248_10007036 | 3300009177 | Bacteria | 12323 |
| 367 | Ga0105248_10045176 | 3300009177 | Bacteria | 4940 |
| 368 | Ga0105248_10096833 | 3300009177 | Bacteria | 3324 |
| 369 | Ga0105248_10179018 | 3300009177 | Bacteria | 2389 |
| 370 | Ga0105248_10198013 | 3300009177 | Bacteria | 2263 |
| 371 | Ga0105248_10433449 | 3300009177 | Bacteria | 1480 |
| 372 | Ga0105237_10002097 | 3300009545 | Bacteria | 25173 |
| 373 | Ga0105237_10007055 | 3300009545 | Bacteria | 12357 |
| 374 | Ga0105237_10092735 | 3300009545 | Bacteria | 3010 |
| 375 | Ga0105237_10190859 | 3300009545 | Bacteria | 2049 |
| 376 | Ga0105237_10380563 | 3300009545 | Bacteria | 1416 |
| 377 | Ga0105238_10040046 | 3300009551 | Bacteria | 4750 |
| 378 | Ga0105238_10050623 | 3300009551 | Bacteria | 4181 |
| 379 | Ga0105238_10116126 | 3300009551 | Bacteria | 2656 |
| 380 | Ga0105238_10122535 | 3300009551 | Bacteria | 2579 |
| 381 | Ga0105249_10046861 | 3300009553 | Bacteria | 3936 |
| 382 | Ga0105249_10101318 | 3300009553 | Bacteria | 2708 |
| 383 | Ga0105239_10026973 | 3300010375 | Bacteria | 6323 |
| 384 | Ga0105239_10036659 | 3300010375 | Bacteria | 5382 |
| 385 | Ga0105239_10042969 | 3300010375 | Bacteria | 4952 |
| 386 | Ga0105239_10060691 | 3300010375 | Bacteria | 4150 |
| 387 | Ga0105239_10150422 | 3300010375 | Bacteria | 2598 |
| 388 | Ga0105239_10155976 | 3300010375 | Bacteria | 2549 |
| 389 | Ga0105239_10253889 | 3300010375 | Bacteria | 1975 |
| 390 | Ga0105239_10372036 | 3300010375 | Bacteria | 1615 |
| 391 | Ga0105246_10003792 | 3300011119 | Bacteria | 9157 |
| 392 | Ga0105246_10093953 | 3300011119 | Bacteria | 2168 |
| 393 | Ga0105246_10104278 | 3300011119 | Bacteria | 2070 |
| 394 | Ga0157373_10111980 | 3300013100 | Bacteria | 1918 |
| 395 | Ga0157370_10202684 | 3300013104 | Bacteria | 1840 |
| 396 | Ga0157370_10234242 | 3300013104 | Bacteria | 1699 |
| 397 | Ga0157370_10418514 | 3300013104 | Bacteria | 1233 |
| 398 | Ga0157369_10010807 | 3300013105 | Bacteria | 10395 |
| 399 | Ga0157369_10072885 | 3300013105 | Bacteria | 3685 |
| 400 | Ga0157374_10073380 | 3300013296 | Bacteria | 3230 |
| 401 | Ga0157374_10216405 | 3300013296 | Bacteria | 1879 |
| 402 | Ga0157374_10222441 | 3300013296 | Unclassified | 1853 |
| 403 | Ga0157374_10293938 | 3300013296 | Bacteria | 1606 |
| 404 | Ga0157374_10678076 | 3300013296 | Bacteria | 1043 |
| 405 | Ga0157378_10004288 | 3300013297 | Bacteria | 12556 |
| 406 | Ga0157378_10071649 | 3300013297 | Bacteria | 3113 |
| 407 | Ga0157378_10099948 | 3300013297 | Bacteria | 2647 |
| 408 | Ga0157378_10137580 | 3300013297 | Bacteria | 2265 |
| 409 | Ga0163162_10001712 | 3300013306 | Bacteria | 20568 |
| 410 | Ga0163162_10011141 | 3300013306 | Bacteria | 8759 |
| 411 | Ga0163162_10054125 | 3300013306 | Bacteria | 4035 |
| 412 | Ga0163162_10102512 | 3300013306 | Bacteria | 2955 |
| 413 | Ga0163162_10108835 | 3300013306 | Bacteria | 2868 |
| 414 | Ga0163162_10333118 | 3300013306 | Bacteria | 1650 |
| 415 | Ga0163162_10377368 | 3300013306 | Bacteria | 1551 |
| 416 | Ga0163162_10419638 | 3300013306 | Bacteria | 1470 |
| 417 | Ga0157372_10200865 | 3300013307 | Bacteria | 2309 |
| 418 | Ga0157375_10014793 | 3300013308 | Bacteria | 6971 |
| 419 | Ga0157375_10028867 | 3300013308 | Bacteria | 5208 |
| 420 | Ga0157375_10102445 | 3300013308 | Bacteria | 2948 |
| 421 | Ga0157375_10113225 | 3300013308 | Bacteria | 2814 |
| 422 | Ga0157375_10242881 | 3300013308 | Bacteria | 1960 |
| 423 | Ga0163163_10001152 | 3300014325 | Bacteria | 22458 |
| 424 | Ga0163163_10009357 | 3300014325 | Bacteria | 8746 |
| 425 | Ga0157380_10001047 | 3300014326 | Bacteria | 17691 |
| 426 | Ga0157380_10020930 | 3300014326 | Bacteria | 4899 |
| 427 | Ga0157380_10103136 | 3300014326 | Bacteria | 2380 |
| 428 | Ga0157380_10117387 | 3300014326 | Bacteria | 2247 |
| 429 | Ga0157380_10208896 | 3300014326 | Bacteria | 1738 |
| 430 | Ga0157377_10091774 | 3300014745 | Bacteria | 1795 |
| 431 | Ga0157377_10178989 | 3300014745 | Bacteria | 1332 |
| 432 | Ga0157379_10019335 | 3300014968 | Bacteria | 6016 |
| 433 | Ga0157379_10021311 | 3300014968 | Bacteria | 5735 |
| 434 | Ga0157379_10029784 | 3300014968 | Bacteria | 4854 |
| 435 | Ga0157379_10049919 | 3300014968 | Bacteria | 3736 |
| 436 | Ga0157376_10010081 | 3300014969 | Bacteria | 6898 |
| 437 | Ga0157376_10096191 | 3300014969 | Bacteria | 2577 |
| 438 | Ga0157376_10106888 | 3300014969 | Bacteria | 2456 |
| 439 | Ga0157376_10139013 | 3300014969 | Bacteria | 2176 |
| 440 | Ga0182007_10045162 | 3300015262 | Bacteria | 1461 |
| 441 | Ga0163161_10017226 | 3300017792 | Bacteria | 5054 |
| 442 | Ga0163161_10091129 | 3300017792 | Bacteria | 2256 |
| 443 | Ga0163161_10112784 | 3300017792 | Bacteria | 2034 |
| 444 | Ga0163161_10124455 | 3300017792 | Bacteria | 1940 |
| 445 | Ga0163161_10240465 | 3300017792 | Bacteria | 1408 |
| 446 | Ga0206356_11210809 | 3300020070 | Bacteria | 1870 |
| 447 | Ga0209758_1006809 | 3300025297 | Bacteria | 8016 |
| 448 | Ga0209758_1033890 | 3300025297 | Bacteria | 2042 |
| 449 | Ga0207656_10031875 | 3300025321 | Bacteria | 2187 |
| 450 | Ga0207682_10019898 | 3300025893 | Bacteria | 2632 |
| 451 | Ga0207682_10035323 | 3300025893 | Bacteria | 2019 |
| 452 | Ga0207682_10046526 | 3300025893 | Bacteria | 1783 |
| 453 | Ga0207682_10059797 | 3300025893 | Bacteria | 1593 |
| 454 | Ga0207692_10013406 | 3300025898 | Bacteria | 3556 |
| 455 | Ga0207692_10018759 | 3300025898 | Bacteria | 3112 |
| 456 | Ga0207692_10163200 | 3300025898 | Bacteria | 1285 |
| 457 | Ga0207642_10003256 | 3300025899 | Bacteria | 5104 |
| 458 | Ga0207642_10051002 | 3300025899 | Bacteria | 1870 |
| 459 | Ga0207688_10011915 | 3300025901 | Bacteria | 4732 |
| 460 | Ga0207688_10017227 | 3300025901 | Bacteria | 3926 |
| 461 | Ga0207688_10162648 | 3300025901 | Bacteria | 1324 |
| 462 | Ga0207688_10191417 | 3300025901 | Bacteria | 1223 |
| 463 | Ga0207680_10075576 | 3300025903 | Bacteria | 2101 |
| 464 | Ga0207680_10289196 | 3300025903 | Bacteria | 1140 |
| 465 | Ga0207647_10110360 | 3300025904 | Bacteria | 1626 |
| 466 | Ga0207699_10071132 | 3300025906 | Bacteria | 2126 |
| 467 | Ga0207699_10268654 | 3300025906 | Unclassified | 1181 |
| 468 | Ga0207645_10005151 | 3300025907 | Bacteria | 9557 |
| 469 | Ga0207645_10051548 | 3300025907 | Bacteria | 2629 |
| 470 | Ga0207643_10002576 | 3300025908 | Bacteria | 9821 |
| 471 | Ga0207643_10066324 | 3300025908 | Bacteria | 2070 |
| 472 | Ga0207705_10176951 | 3300025909 | Bacteria | 1609 |
| 473 | Ga0207705_10218937 | 3300025909 | Bacteria | 1445 |
| 474 | Ga0207705_10263041 | 3300025909 | Bacteria | 1317 |
| 475 | Ga0207684_10367900 | 3300025910 | Bacteria | 1237 |
| 476 | Ga0207654_10060678 | 3300025911 | Bacteria | 2210 |
| 477 | Ga0207654_10124524 | 3300025911 | Bacteria | 1623 |
| 478 | Ga0207707_10005157 | 3300025912 | Bacteria | 11449 |
| 479 | Ga0207707_10051453 | 3300025912 | Bacteria | 3587 |
| 480 | Ga0207707_10143731 | 3300025912 | Bacteria | 2085 |
| 481 | Ga0207695_10047693 | 3300025913 | Bacteria | 4530 |
| 482 | Ga0207695_10210322 | 3300025913 | Bacteria | 1856 |
| 483 | Ga0207671_10010943 | 3300025914 | Bacteria | 7432 |
| 484 | Ga0207671_10143186 | 3300025914 | Bacteria | 1843 |
| 485 | Ga0207671_10185346 | 3300025914 | Bacteria | 1621 |
| 486 | Ga0207693_10002797 | 3300025915 | Bacteria | 15119 |
| 487 | Ga0207693_10003058 | 3300025915 | Bacteria | 14443 |
| 488 | Ga0207693_10008767 | 3300025915 | Bacteria | 8266 |
| 489 | Ga0207693_10126449 | 3300025915 | Bacteria | 2009 |
| 490 | Ga0207663_10007369 | 3300025916 | Bacteria | 5702 |
| 491 | Ga0207660_10008675 | 3300025917 | Bacteria | 6574 |
| 492 | Ga0207660_10023568 | 3300025917 | Bacteria | 4158 |
| 493 | Ga0207662_10078419 | 3300025918 | Bacteria | 2011 |
| 494 | Ga0207662_10200822 | 3300025918 | Bacteria | 1290 |
| 495 | Ga0207657_10002580 | 3300025919 | Bacteria | 19599 |
| 496 | Ga0207657_10029442 | 3300025919 | Bacteria | 4999 |
| 497 | Ga0207657_10033072 | 3300025919 | Bacteria | 4666 |
| 498 | Ga0207657_10197162 | 3300025919 | Bacteria | 1622 |
| 499 | Ga0207649_10022375 | 3300025920 | Bacteria | 3651 |
| 500 | Ga0207652_10018208 | 3300025921 | Bacteria | 5758 |
| 501 | Ga0207652_10056860 | 3300025921 | Bacteria | 3368 |
| 502 | Ga0207652_10073660 | 3300025921 | Bacteria | 2972 |
| 503 | Ga0207646_10378165 | 3300025922 | Bacteria | 1279 |
| 504 | Ga0207646_10411054 | 3300025922 | Bacteria | 1222 |
| 505 | Ga0207681_10019750 | 3300025923 | Bacteria | 4262 |
| 506 | Ga0207681_10223188 | 3300025923 | Bacteria | 1459 |
| 507 | Ga0207681_10260967 | 3300025923 | Bacteria | 1356 |
| 508 | Ga0207650_10003930 | 3300025925 | Bacteria | 10170 |
| 509 | Ga0207650_10091540 | 3300025925 | Bacteria | 2324 |
| 510 | Ga0207659_10000474 | 3300025926 | Bacteria | 24112 |
| 511 | Ga0207659_10006781 | 3300025926 | Bacteria | 7038 |
| 512 | Ga0207659_10054332 | 3300025926 | Bacteria | 2860 |
| 513 | Ga0207687_10003182 | 3300025927 | Bacteria | 11136 |
| 514 | Ga0207687_10052004 | 3300025927 | Bacteria | 2858 |
| 515 | Ga0207687_10133337 | 3300025927 | Bacteria | 1875 |
| 516 | Ga0207687_10140340 | 3300025927 | Bacteria | 1832 |
| 517 | Ga0207700_10002090 | 3300025928 | Bacteria | 11393 |
| 518 | Ga0207700_10033262 | 3300025928 | Bacteria | 3688 |
| 519 | Ga0207700_10049876 | 3300025928 | Bacteria | 3116 |
| 520 | Ga0207700_10139168 | 3300025928 | Bacteria | 1992 |
| 521 | Ga0207664_10156303 | 3300025929 | Unclassified | 1942 |
| 522 | Ga0207664_10367695 | 3300025929 | Bacteria | 1275 |
| 523 | Ga0207644_10001390 | 3300025931 | Bacteria | 15619 |
| 524 | Ga0207644_10004154 | 3300025931 | Bacteria | 9392 |
| 525 | Ga0207644_10020806 | 3300025931 | Bacteria | 4463 |
| 526 | Ga0207644_10063836 | 3300025931 | Bacteria | 2675 |
| 527 | Ga0207644_10074277 | 3300025931 | Unclassified | 2495 |
| 528 | Ga0207644_10085265 | 3300025931 | Bacteria | 2343 |
| 529 | Ga0207690_10077325 | 3300025932 | Bacteria | 2313 |
| 530 | Ga0207690_10174690 | 3300025932 | Bacteria | 1612 |
| 531 | Ga0207690_10233670 | 3300025932 | Unclassified | 1413 |
| 532 | Ga0207706_10036842 | 3300025933 | Bacteria | 4345 |
| 533 | Ga0207686_10002522 | 3300025934 | Bacteria | 9945 |
| 534 | Ga0207686_10089612 | 3300025934 | Bacteria | 2028 |
| 535 | Ga0207686_10116269 | 3300025934 | Bacteria | 1813 |
| 536 | Ga0207686_10155950 | 3300025934 | Bacteria | 1595 |
| 537 | Ga0207709_10000932 | 3300025935 | Bacteria | 22017 |
| 538 | Ga0207709_10021278 | 3300025935 | Bacteria | 3671 |
| 539 | Ga0207709_10191740 | 3300025935 | Bacteria | 1452 |
| 540 | Ga0207670_10003858 | 3300025936 | Bacteria | 7989 |
| 541 | Ga0207670_10046734 | 3300025936 | Bacteria | 2878 |
| 542 | Ga0207669_10167365 | 3300025937 | Bacteria | 1560 |
| 543 | Ga0207669_10365793 | 3300025937 | Bacteria | 1119 |
| 544 | Ga0207704_10000268 | 3300025938 | Bacteria | 25118 |
| 545 | Ga0207704_10011098 | 3300025938 | Bacteria | 4422 |
| 546 | Ga0207704_10020348 | 3300025938 | Bacteria | 3509 |
| 547 | Ga0207704_10021737 | 3300025938 | Bacteria | 3423 |
| 548 | Ga0207704_10050588 | 3300025938 | Bacteria | 2507 |
| 549 | Ga0207704_10124838 | 3300025938 | Bacteria | 1770 |
| 550 | Ga0207704_10158554 | 3300025938 | Bacteria | 1607 |
| 551 | Ga0207704_10295127 | 3300025938 | Bacteria | 1239 |
| 552 | Ga0207665_10042809 | 3300025939 | Bacteria | 3027 |
| 553 | Ga0207665_10079155 | 3300025939 | Bacteria | 2259 |
| 554 | Ga0207665_10150104 | 3300025939 | Bacteria | 1669 |
| 555 | Ga0207691_10006056 | 3300025940 | Bacteria | 11682 |
| 556 | Ga0207691_10011760 | 3300025940 | Bacteria | 8401 |
| 557 | Ga0207691_10114317 | 3300025940 | Bacteria | 2398 |
| 558 | Ga0207691_10126097 | 3300025940 | Bacteria | 2265 |
| 559 | Ga0207711_10022699 | 3300025941 | Bacteria | 5249 |
| 560 | Ga0207711_10036602 | 3300025941 | Bacteria | 4165 |
| 561 | Ga0207711_10144958 | 3300025941 | Bacteria | 2139 |
| 562 | Ga0207711_10200618 | 3300025941 | Bacteria | 1820 |
| 563 | Ga0207711_10270512 | 3300025941 | Bacteria | 1563 |
| 564 | Ga0207689_10000159 | 3300025942 | Bacteria | 58241 |
| 565 | Ga0207689_10025106 | 3300025942 | Bacteria | 4996 |
| 566 | Ga0207661_10007579 | 3300025944 | Bacteria | 7719 |
| 567 | Ga0207661_10009807 | 3300025944 | Bacteria | 6877 |
| 568 | Ga0207661_10198290 | 3300025944 | Bacteria | 1763 |
| 569 | Ga0207661_10374549 | 3300025944 | Bacteria | 1288 |
| 570 | Ga0207679_10053568 | 3300025945 | Bacteria | 2966 |
| 571 | Ga0207679_10184057 | 3300025945 | Bacteria | 1730 |
| 572 | Ga0207679_10434008 | 3300025945 | Bacteria | 1162 |
| 573 | Ga0207667_10016840 | 3300025949 | Bacteria | 8246 |
| 574 | Ga0207667_10064631 | 3300025949 | Bacteria | 3819 |
| 575 | Ga0207667_10126841 | 3300025949 | Bacteria | 2629 |
| 576 | Ga0207667_10214918 | 3300025949 | Bacteria | 1970 |
| 577 | Ga0207667_10484791 | 3300025949 | Bacteria | 1255 |
| 578 | Ga0207651_10000495 | 3300025960 | Bacteria | 16517 |
| 579 | Ga0207651_10029173 | 3300025960 | Bacteria | 3492 |
| 580 | Ga0207651_10193878 | 3300025960 | Bacteria | 1623 |
| 581 | Ga0207712_10040158 | 3300025961 | Bacteria | 3209 |
| 582 | Ga0207712_10202287 | 3300025961 | Bacteria | 1576 |
| 583 | Ga0207712_10420240 | 3300025961 | Bacteria | 1128 |
| 584 | Ga0207640_10034460 | 3300025981 | Bacteria | 3160 |
| 585 | Ga0207640_10089056 | 3300025981 | Bacteria | 2132 |
| 586 | Ga0207640_10250311 | 3300025981 | Bacteria | 1375 |
| 587 | Ga0207658_10000692 | 3300025986 | Bacteria | 29298 |
| 588 | Ga0207658_10008973 | 3300025986 | Bacteria | 6784 |
| 589 | Ga0207658_10021202 | 3300025986 | Bacteria | 4507 |
| 590 | Ga0207658_10123385 | 3300025986 | Bacteria | 2069 |
| 591 | Ga0207658_10271354 | 3300025986 | Bacteria | 1450 |
| 592 | Ga0207677_10022680 | 3300026023 | Bacteria | 3863 |
| 593 | Ga0207677_10041039 | 3300026023 | Bacteria | 3056 |
| 594 | Ga0207703_10000795 | 3300026035 | Bacteria | 31096 |
| 595 | Ga0207703_10002699 | 3300026035 | Bacteria | 15215 |
| 596 | Ga0207703_10017959 | 3300026035 | Bacteria | 5524 |
| 597 | Ga0207703_10144995 | 3300026035 | Bacteria | 2064 |
| 598 | Ga0207703_10560275 | 3300026035 | Bacteria | 1078 |
| 599 | Ga0207639_10042625 | 3300026041 | Bacteria | 3402 |
| 600 | Ga0207639_10222143 | 3300026041 | Bacteria | 1632 |
| 601 | Ga0207639_10251802 | 3300026041 | Bacteria | 1540 |
| 602 | Ga0207678_10011891 | 3300026067 | Bacteria | 7643 |
| 603 | Ga0207678_10047090 | 3300026067 | Bacteria | 3729 |
| 604 | Ga0207678_10053433 | 3300026067 | Bacteria | 3481 |
| 605 | Ga0207678_10077637 | 3300026067 | Bacteria | 2845 |
| 606 | Ga0207678_10241303 | 3300026067 | Bacteria | 1547 |
| 607 | Ga0207708_10000248 | 3300026075 | Bacteria | 42511 |
| 608 | Ga0207708_10011614 | 3300026075 | Bacteria | 6564 |
| 609 | Ga0207708_10017645 | 3300026075 | Bacteria | 5374 |
| 610 | Ga0207708_10159810 | 3300026075 | Bacteria | 1779 |
| 611 | Ga0207702_10017319 | 3300026078 | Bacteria | 5961 |
| 612 | Ga0207702_10027427 | 3300026078 | Bacteria | 4730 |
| 613 | Ga0207702_10090253 | 3300026078 | Bacteria | 2681 |
| 614 | Ga0207702_10128211 | 3300026078 | Unclassified | 2280 |
| 615 | Ga0207702_10290230 | 3300026078 | Bacteria | 1549 |
| 616 | Ga0207702_10372221 | 3300026078 | Bacteria | 1372 |
| 617 | Ga0207702_10377022 | 3300026078 | Bacteria | 1363 |
| 618 | Ga0207641_10001123 | 3300026088 | Bacteria | 26895 |
| 619 | Ga0207641_10013187 | 3300026088 | Bacteria | 6776 |
| 620 | Ga0207641_10199731 | 3300026088 | Bacteria | 1843 |
| 621 | Ga0207641_10393676 | 3300026088 | Bacteria | 1329 |
| 622 | Ga0207648_10000248 | 3300026089 | Bacteria | 58258 |
| 623 | Ga0207648_10026036 | 3300026089 | Bacteria | 5202 |
| 624 | Ga0207648_10098716 | 3300026089 | Bacteria | 2557 |
| 625 | Ga0207648_10174087 | 3300026089 | Bacteria | 1903 |
| 626 | Ga0207676_10000841 | 3300026095 | Bacteria | 23813 |
| 627 | Ga0207676_10004299 | 3300026095 | Bacteria | 10070 |
| 628 | Ga0207676_10043140 | 3300026095 | Bacteria | 3471 |
| 629 | Ga0207676_10300812 | 3300026095 | Bacteria | 1465 |
| 630 | Ga0207676_10375909 | 3300026095 | Bacteria | 1321 |
| 631 | Ga0207674_10004582 | 3300026116 | Bacteria | 16589 |
| 632 | Ga0207674_10047317 | 3300026116 | Bacteria | 4410 |
| 633 | Ga0207674_10350271 | 3300026116 | Bacteria | 1428 |
| 634 | Ga0207674_10387587 | 3300026116 | Bacteria | 1351 |
| 635 | Ga0207675_100000426 | 3300026118 | Bacteria | 40816 |
| 636 | Ga0207675_100017007 | 3300026118 | Bacteria | 6796 |
| 637 | Ga0207675_100028771 | 3300026118 | Bacteria | 5177 |
| 638 | Ga0207675_100132515 | 3300026118 | Bacteria | 2363 |
| 639 | Ga0207675_100138505 | 3300026118 | Bacteria | 2311 |
| 640 | Ga0207683_10002091 | 3300026121 | Bacteria | 17588 |
| 641 | Ga0207683_10008676 | 3300026121 | Bacteria | 8692 |
| 642 | Ga0207683_10014218 | 3300026121 | Bacteria | 6779 |
| 643 | Ga0207683_10021217 | 3300026121 | Bacteria | 5558 |
| 644 | Ga0207683_10073232 | 3300026121 | Bacteria | 3030 |
| 645 | Ga0207683_10074413 | 3300026121 | Bacteria | 3005 |
| 646 | Ga0207683_10083292 | 3300026121 | Bacteria | 2842 |
| 647 | Ga0207683_10090709 | 3300026121 | Bacteria | 2722 |
| 648 | Ga0207683_10191120 | 3300026121 | Bacteria | 1859 |
| 649 | Ga0207683_10312034 | 3300026121 | Bacteria | 1440 |
| 650 | Ga0207683_10420829 | 3300026121 | Bacteria | 1230 |
| 651 | Ga0207698_10030421 | 3300026142 | Bacteria | 3882 |
| 652 | Ga0209588_1015742 | 3300027671 | Bacteria | 2328 |
| 653 | Ga0268266_10006822 | 3300028379 | Bacteria | 10399 |
| 654 | Ga0268266_10052351 | 3300028379 | Bacteria | 3506 |
| 655 | Ga0268266_10461477 | 3300028379 | Bacteria | 1208 |
| 656 | Ga0268266_10473951 | 3300028379 | Bacteria | 1192 |
| 657 | Ga0268266_10582327 | 3300028379 | Bacteria | 1074 |
| 658 | Ga0268265_10009053 | 3300028380 | Bacteria | 6733 |
| 659 | Ga0268265_10022104 | 3300028380 | Bacteria | 4465 |
| 660 | Ga0268265_10044130 | 3300028380 | Bacteria | 3318 |
| 661 | Ga0268265_10101437 | 3300028380 | Bacteria | 2325 |
| 662 | Ga0268265_10263756 | 3300028380 | Bacteria | 1533 |
| 663 | Ga0268265_10301253 | 3300028380 | Bacteria | 1443 |
| 664 | Ga0268264_10000020 | 3300028381 | Bacteria | 483593 |
| 665 | Ga0268264_10016355 | 3300028381 | Bacteria | 6074 |
| 666 | Ga0268264_10018483 | 3300028381 | Bacteria | 5701 |
| 667 | Ga0268264_10054319 | 3300028381 | Bacteria | 3344 |
| 668 | Ga0268264_10084506 | 3300028381 | Bacteria | 2722 |
| 669 | Ga0268264_10234493 | 3300028381 | Bacteria | 1696 |
| 670 | Ga0268264_10248929 | 3300028381 | Bacteria | 1650 |
| 671 | Ga0268264_10413637 | 3300028381 | Bacteria | 1299 |
| 672 | Ga0307511_10000499 | 3300030521 | Bacteria | 42317 |
| 673 | Ga0307511_10062819 | 3300030521 | Bacteria | 2813 |
| 674 | Ga0265760_10031980 | 3300031090 | Bacteria | 1553 |
| 675 | Ga0265332_10007361 | 3300031238 | Bacteria | 4980 |
| 676 | Ga0265339_10006651 | 3300031249 | Bacteria | 7563 |
| 677 | Ga0265331_10005102 | 3300031250 | Bacteria | 8007 |
| 678 | Ga0265331_10024550 | 3300031250 | Bacteria | 3048 |
| 679 | Ga0307513_10058673 | 3300031456 | Bacteria | 4088 |
| 680 | Ga0307513_10178889 | 3300031456 | Bacteria | 1987 |
| 681 | Ga0307509_10122293 | 3300031507 | Bacteria | 2577 |
| 682 | Ga0307408_100017923 | 3300031548 | Bacteria | 4748 |
| 683 | Ga0307408_100062663 | 3300031548 | Bacteria | 2718 |
| 684 | Ga0307408_100485697 | 3300031548 | Bacteria | 1078 |
| 685 | Ga0307508_10000058 | 3300031616 | Bacteria | 125293 |
| 686 | Ga0307508_10088793 | 3300031616 | Bacteria | 2675 |
| 687 | Ga0307514_10152433 | 3300031649 | Bacteria | 1548 |
| 688 | Ga0265342_10000035 | 3300031712 | Bacteria | 142886 |
| 689 | Ga0307405_10007368 | 3300031731 | Bacteria | 5495 |
| 690 | Ga0307405_10012696 | 3300031731 | Bacteria | 4471 |
| 691 | Ga0307413_10061387 | 3300031824 | Bacteria | 2319 |
| 692 | Ga0307413_10076937 | 3300031824 | Bacteria | 2123 |
| 693 | Ga0307410_10001424 | 3300031852 | Bacteria | 10766 |
| 694 | Ga0307406_10003267 | 3300031901 | Bacteria | 8834 |
| 695 | Ga0307406_10024568 | 3300031901 | Bacteria | 3601 |
| 696 | Ga0307406_10087089 | 3300031901 | Bacteria | 2093 |
| 697 | Ga0307412_10016495 | 3300031911 | Bacteria | 4401 |
| 698 | Ga0307412_10233548 | 3300031911 | Bacteria | 1418 |
| 699 | Ga0307412_10275493 | 3300031911 | Bacteria | 1319 |
| 700 | Ga0307409_100003569 | 3300031995 | Bacteria | 8487 |
| 701 | Ga0307409_100014701 | 3300031995 | Bacteria | 5104 |
| 702 | Ga0307409_100490894 | 3300031995 | Bacteria | 1194 |
| 703 | Ga0307416_100049692 | 3300032002 | Bacteria | 3337 |
| 704 | Ga0307416_100064996 | 3300032002 | Bacteria | 2995 |
| 705 | Ga0307416_100250153 | 3300032002 | Bacteria | 1724 |
| 706 | Ga0307416_100636203 | 3300032002 | Bacteria | 1150 |
| 707 | Ga0307416_100640447 | 3300032002 | Bacteria | 1147 |
| 708 | Ga0307411_10000547 | 3300032005 | Bacteria | 13327 |
| 709 | Ga0307415_100001658 | 3300032126 | Bacteria | 10804 |
| 710 | Ga0307507_10033714 | 3300033179 | Bacteria | 5309 |
| 711 | Ga0307510_10019237 | 3300033180 | Bacteria | 8013 |
| 712 | Ga0307510_10038138 | 3300033180 | Bacteria | 5317 |
| 713 | Ga0373934_0078851 | 3300035086 | Bacteria | 1322 |
| 714 | Ga0373944_0027834 | 3300035089 | Bacteria | 1679 |
| 715 | Ga0373923_0041756 | 3300035111 | Bacteria | 1892 |
| 716 | Ga0373932_0008089 | 3300035112 | Bacteria | 2510 |
| 717 | Ga0373936_0005672 | 3300035113 | Bacteria | 4709 |
| 718 | Ga0373936_0012592 | 3300035113 | Bacteria | 3220 |
| 719 | Ga0373936_0082790 | 3300035113 | Bacteria | 1338 |
| 720 | Ga0373945_0004379 | 3300035116 | Bacteria | 4485 |
| 721 | Ga0373945_0019656 | 3300035116 | Bacteria | 2307 |
| 722 | Ga0373945_0074518 | 3300035116 | Bacteria | 1290 |
| 723 | Ga0373954_0007360 | 3300035118 | Bacteria | 4816 |
| 724 | Ga0373954_0026478 | 3300035118 | Bacteria | 2658 |
| 725 | Ga0373954_0099745 | 3300035118 | Bacteria | 1400 |
| 726 | Ga0373954_0102936 | 3300035118 | Bacteria | 1379 |
| 727 | Ga0373956_0099419 | 3300035119 | Bacteria | 1348 |
| 728 | Ga0373956_0128676 | 3300035119 | Bacteria | 1185 |
| 729 | Ga0373957_0001261 | 3300035120 | Bacteria | 6772 |
| 730 | Ga0373957_0009030 | 3300035120 | Bacteria | 3252 |
| 731 | Ga0373957_0030947 | 3300035120 | Bacteria | 1964 |
| 732 | Ga0373957_0076518 | 3300035120 | Bacteria | 1316 |
| 733 | Ga0373943_0016917 | 3300035170 | Bacteria | 3333 |
| 734 | Ga0373946_0013304 | 3300035171 | Bacteria | 3092 |
| 735 | Ga0373946_0068210 | 3300035171 | Bacteria | 1529 |
| 736 | Ga0373955_0040834 | 3300035172 | Bacteria | 2483 |
| 737 | Ga0316574_0233619 | 3300035398 | Bacteria | 1176 |
| 738 | Ga0373924_0088359 | 3300035410 | Bacteria | 1324 |
| 739 | Ga0373924_0115457 | 3300035410 | Bacteria | 1163 |
| 740 | Ga0373931_0016732 | 3300035691 | Bacteria | 3614 |
| 741 | Ga0373931_0075378 | 3300035691 | Bacteria | 1850 |
| 742 | Ga0373931_0126984 | 3300035691 | Bacteria | 1464 |
| 743 | Ga0373935_0006803 | 3300035692 | Bacteria | 6830 |
| 744 | Ga0373935_0013290 | 3300035692 | Bacteria | 4967 |
| 745 | Ga0373935_0058628 | 3300035692 | Bacteria | 2459 |
| 746 | Ga0373935_0070502 | 3300035692 | Bacteria | 2253 |
| 747 | Ga0373927_0013193 | 3300035695 | Bacteria | 5495 |
| 748 | Ga0373927_0016649 | 3300035695 | Bacteria | 4850 |
| 749 | Ga0373927_0037203 | 3300035695 | Bacteria | 3164 |
| 750 | Ga0373927_0059921 | 3300035695 | Bacteria | 2462 |
| 751 | Ga0373927_0062712 | 3300035695 | Bacteria | 2404 |
| 752 | Ga0373927_0152253 | 3300035695 | Bacteria | 1514 |
| 753 | Ga0373927_0202006 | 3300035695 | Unclassified | 1305 |
| 754 | Ga0373933_0000052 | 3300035724 | Bacteria | 70592 |
| 755 | Ga0373933_0007808 | 3300035724 | Bacteria | 5844 |
| 756 | Ga0373933_0056217 | 3300035724 | Bacteria | 2362 |
| 757 | Ga0373947_0006320 | 3300035725 | Bacteria | 6885 |
| 758 | Ga0373947_0022644 | 3300035725 | Bacteria | 3645 |
| 759 | Ga0373947_0034033 | 3300035725 | Bacteria | 3013 |
| 760 | Ga0373937_0007266 | 3300036401 | Bacteria | 9587 |
| 761 | Ga0373937_0047530 | 3300036401 | Bacteria | 3926 |
| 762 | Ga0373937_0090756 | 3300036401 | Bacteria | 2830 |
| 763 | Ga0373937_0161815 | 3300036401 | Bacteria | 2098 |
| 764 | Ga0373937_0163926 | 3300036401 | Bacteria | 2084 |
| 765 | Ga0373937_0270668 | 3300036401 | Bacteria | 1603 |
| 766 | Ga0316584_0010473 | 3300036712 | Bacteria | 6480 |
| 767 | Ga0373925_0002569 | 3300037068 | Bacteria | 14454 |
| 768 | Ga0373925_0017689 | 3300037068 | Bacteria | 5172 |
| 769 | Ga0373925_0040773 | 3300037068 | Bacteria | 3438 |
| 770 | Ga0373925_0049942 | 3300037068 | Bacteria | 3119 |
| 771 | Ga0373925_0127754 | 3300037068 | Bacteria | 1979 |
| 772 | Ga0373925_0143060 | 3300037068 | Bacteria | 1873 |
| 773 | Ga0373925_0215827 | 3300037068 | Bacteria | 1530 |
| 774 | Ga0395898_0097244 | 3300037466 | Unclassified | 2828 |
| 775 | Ga0395905_0114673 | 3300037471 | Bacteria | 2532 |
| 776 | Ga0395901_0068861 | 3300038443 | Bacteria | 3686 |
| 777 | Ga0400483_013851 | 3300039062 | Bacteria | 8477 |
| 778 | Ga0400483_176221 | 3300039062 | Bacteria | 9966 |
| 779 | Ga0439436_0000165 | 3300041404 | Bacteria | 15608 |
| 780 | Ga0439436_0001548 | 3300041404 | Bacteria | 6692 |
| 781 | Ga0439438_025746 | 3300041405 | Bacteria | 1600 |
| 782 | Ga0439447_014312 | 3300041407 | Bacteria | 2229 |
| 783 | Ga0439447_026681 | 3300041407 | Bacteria | 1479 |
| 784 | Ga0439465_0000774 | 3300041413 | Bacteria | 9959 |
| 785 | Ga0439431_0000394 | 3300041997 | Bacteria | 9201 |
| 786 | Ga0439445_0001136 | 3300042004 | Bacteria | 5704 |
| 787 | Ga0439445_0026192 | 3300042004 | Bacteria | 1491 |
| 788 | Ga0439432_001228 | 3300042006 | Bacteria | 9682 |
| 789 | Ga0439449_0026601 | 3300042007 | Bacteria | 2159 |
| 790 | Ga0439452_003157 | 3300042010 | Bacteria | 5836 |
| 791 | Ga0439462_0016318 | 3300042015 | Bacteria | 1918 |
| 792 | Ga0450911_000712 | 3300042115 | Bacteria | 9689 |
| 793 | Ga0450898_010215 | 3300042134 | Bacteria | 1516 |
| 794 | Ga0450909_001959 | 3300042185 | Bacteria | 2904 |
| 795 | Ga0439434_0000875 | 3300042435 | Bacteria | 8694 |
| 796 | Ga0439464_0006709 | 3300042439 | Bacteria | 3002 |
| 797 | Ga0451577_0018003 | 3300042876 | Bacteria | 6513 |
| 798 | Ga0453683_0002262 | 3300044673 | Bacteria | 15209 |
| 799 | Ga0453683_0080698 | 3300044673 | Bacteria | 2038 |
| 800 | Ga0451576_0014155 | 3300045051 | Bacteria | 8888 |
| 801 | Ga0451576_0048819 | 3300045051 | Bacteria | 4444 |
| 802 | Ga0466967_0061237 | 3300045976 | Bacteria | 3338 |
| 803 | Ga0466967_0069688 | 3300045976 | Bacteria | 3144 |
| 804 | Ga0495592_0032113 | 3300046454 | Bacteria | 3965 |
| 805 | Ga0495592_0079820 | 3300046454 | Bacteria | 2368 |
| 806 | Ga0495592_0106108 | 3300046454 | Bacteria | 1994 |
| 807 | Ga0495592_0170871 | 3300046454 | Bacteria | 1489 |
| 808 | Ga0495603_0011507 | 3300046455 | Bacteria | 5355 |
| 809 | Ga0495603_0013515 | 3300046455 | Bacteria | 4939 |
| 810 | Ga0495603_0061395 | 3300046455 | Bacteria | 2219 |
| 811 | Ga0495603_0069911 | 3300046455 | Bacteria | 2064 |
| 812 | Ga0495629_0033060 | 3300046459 | Bacteria | 3659 |
| 813 | Ga0495629_0065657 | 3300046459 | Bacteria | 2533 |
| 814 | Ga0495629_0074705 | 3300046459 | Bacteria | 2366 |
| 815 | Ga0495629_0085896 | 3300046459 | Unclassified | 2195 |
| 816 | Ga0495641_0016211 | 3300046461 | Bacteria | 3935 |
| 817 | Ga0495641_0023065 | 3300046461 | Bacteria | 3100 |
| 818 | Ga0495651_0007700 | 3300046462 | Bacteria | 8237 |
| 819 | Ga0495653_0088256 | 3300046463 | Bacteria | 2275 |
| 820 | Ga0495653_0150993 | 3300046463 | Bacteria | 1623 |
| 821 | Ga0495580_0004026 | 3300046472 | Bacteria | 12402 |
| 822 | Ga0495580_0021531 | 3300046472 | Bacteria | 4754 |
| 823 | Ga0495580_0133187 | 3300046472 | Bacteria | 1723 |
| 824 | Ga0495582_0006646 | 3300046473 | Bacteria | 6425 |
| 825 | Ga0495582_0008224 | 3300046473 | Bacteria | 5756 |
| 826 | Ga0495582_0044103 | 3300046473 | Bacteria | 2456 |
| 827 | Ga0495605_0022588 | 3300046474 | Bacteria | 3320 |
| 828 | Ga0495605_0024779 | 3300046474 | Bacteria | 3136 |
| 829 | Ga0495605_0100546 | 3300046474 | Bacteria | 1330 |
| 830 | Ga0495639_0000899 | 3300046475 | Bacteria | 13445 |
| 831 | Ga0495639_0005803 | 3300046475 | Bacteria | 5313 |
| 832 | Ga0495639_0027461 | 3300046475 | Bacteria | 2520 |
| 833 | Ga0495662_0012692 | 3300046476 | Bacteria | 4109 |
| 834 | Ga0495662_0049497 | 3300046476 | Unclassified | 2028 |
| 835 | Ga0495664_0007063 | 3300046477 | Bacteria | 6221 |
| 836 | Ga0495664_0011150 | 3300046477 | Bacteria | 5058 |
| 837 | Ga0495664_0028972 | 3300046477 | Bacteria | 3236 |
| 838 | Ga0495664_0126198 | 3300046477 | Bacteria | 1548 |
| 839 | Ga0495584_0062928 | 3300046491 | Unclassified | 1865 |
| 840 | Ga0495585_0082939 | 3300046492 | Bacteria | 1735 |
| 841 | Ga0495594_0022497 | 3300046499 | Bacteria | 3372 |
| 842 | Ga0495594_0030099 | 3300046499 | Bacteria | 2935 |
| 843 | Ga0495607_0083054 | 3300046501 | Bacteria | 1756 |
| 844 | Ga0495606_0003921 | 3300046507 | Bacteria | 15312 |
| 845 | Ga0495608_0042278 | 3300046511 | Bacteria | 3047 |
| 846 | Ga0495618_0052343 | 3300046514 | Bacteria | 2580 |
| 847 | Ga0495618_0081113 | 3300046514 | Bacteria | 2071 |
| 848 | Ga0495618_0164826 | 3300046514 | Bacteria | 1411 |
| 849 | Ga0495620_0067547 | 3300046515 | Bacteria | 1471 |
| 850 | Ga0495628_0118016 | 3300046516 | Bacteria | 2037 |
| 851 | Ga0495628_0124038 | 3300046516 | Bacteria | 1979 |
| 852 | Ga0495630_0038724 | 3300046517 | Bacteria | 3567 |
| 853 | Ga0495630_0053234 | 3300046517 | Bacteria | 3030 |
| 854 | Ga0495630_0094393 | 3300046517 | Bacteria | 2261 |
| 855 | Ga0495630_0163830 | 3300046517 | Bacteria | 1692 |
| 856 | Ga0495631_0092989 | 3300046518 | Bacteria | 1298 |
| 857 | Ga0495632_0072267 | 3300046519 | Bacteria | 1656 |
| 858 | Ga0495666_0016941 | 3300046526 | Bacteria | 3628 |
| 859 | Ga0495666_0074564 | 3300046526 | Bacteria | 1609 |
| 860 | Ga0495652_0036311 | 3300046529 | Bacteria | 4287 |
| 861 | Ga0495652_0079246 | 3300046529 | Bacteria | 2716 |
| 862 | Ga0495652_0086761 | 3300046529 | Bacteria | 2568 |
| 863 | Ga0495652_0165899 | 3300046529 | Bacteria | 1709 |
| 864 | Ga0495654_0027390 | 3300046530 | Bacteria | 2923 |
| 865 | Ga0495665_0004419 | 3300046531 | Bacteria | 7592 |
| 866 | Ga0495665_0042616 | 3300046531 | Bacteria | 2415 |
| 867 | Ga0495665_0081597 | 3300046531 | Bacteria | 1700 |
| 868 | Ga0495640_0018841 | 3300046533 | Bacteria | 5108 |
| 869 | Ga0495640_0122787 | 3300046533 | Bacteria | 1686 |
| 870 | Ga0495587_0002956 | 3300046536 | Bacteria | 11364 |
| 871 | Ga0495598_0012440 | 3300046537 | Bacteria | 2089 |
| 872 | Ga0495598_0032353 | 3300046537 | Bacteria | 1477 |
| 873 | Ga0495598_0045923 | 3300046537 | Bacteria | 1296 |
| 874 | Ga0495609_0082195 | 3300046538 | Bacteria | 1407 |
| 875 | Ga0495621_0013313 | 3300046539 | Bacteria | 2581 |
| 876 | Ga0495645_0009466 | 3300046543 | Bacteria | 6805 |
| 877 | Ga0495645_0014210 | 3300046543 | Bacteria | 5646 |
| 878 | Ga0495645_0070240 | 3300046543 | Bacteria | 2527 |
| 879 | Ga0495622_0013015 | 3300046557 | Bacteria | 3861 |
| 880 | Ga0495622_0050722 | 3300046557 | Bacteria | 1925 |
| 881 | Ga0495622_0054725 | 3300046557 | Bacteria | 1851 |
| 882 | Ga0495622_0164244 | 3300046557 | Bacteria | 1000 |
| 883 | Ga0495633_0051427 | 3300046558 | Bacteria | 1941 |
| 884 | Ga0495633_0089316 | 3300046558 | Bacteria | 1433 |
| 885 | Ga0495667_0001799 | 3300046559 | Bacteria | 14228 |
| 886 | Ga0495667_0173375 | 3300046559 | Bacteria | 1385 |
| 887 | Ga0495656_0010426 | 3300046615 | Bacteria | 3379 |
| 888 | Ga0495668_0220097 | 3300046616 | Bacteria | 1039 |
| 889 | Ga0495634_0053488 | 3300046642 | Bacteria | 2704 |
| 890 | Ga0495634_0064264 | 3300046642 | Bacteria | 2433 |
| 891 | Ga0495634_0099285 | 3300046642 | Bacteria | 1882 |
| 892 | Ga0495611_0031066 | 3300046648 | Bacteria | 2349 |
| 893 | Ga0495635_0007523 | 3300046663 | Bacteria | 7601 |
| 894 | Ga0495635_0011519 | 3300046663 | Bacteria | 6199 |
| 895 | Ga0495635_0020966 | 3300046663 | Bacteria | 4554 |
| 896 | Ga0495635_0141313 | 3300046663 | Bacteria | 1639 |
| 897 | Ga0495588_0033752 | 3300046674 | Bacteria | 2586 |
| 898 | Ga0495588_0097710 | 3300046674 | Bacteria | 1541 |
| 899 | Ga0495588_0154618 | 3300046674 | Bacteria | 1212 |
| 900 | Ga0495657_0011744 | 3300046675 | Bacteria | 6532 |
| 901 | Ga0495599_0075301 | 3300046678 | Bacteria | 2107 |
| 902 | Ga0495599_0126985 | 3300046678 | Bacteria | 1585 |
| 903 | Ga0495599_0268941 | 3300046678 | Bacteria | 1034 |
| 904 | Ga0495623_0010736 | 3300046679 | Bacteria | 5929 |
| 905 | Ga0495646_0074353 | 3300046680 | Bacteria | 1994 |
| 906 | Ga0495646_0092676 | 3300046680 | Bacteria | 1742 |
| 907 | Ga0495646_0133682 | 3300046680 | Bacteria | 1394 |
| 908 | Ga0495647_0005461 | 3300046681 | Bacteria | 4164 |
| 909 | Ga0495647_0015089 | 3300046681 | Bacteria | 2701 |
| 910 | Ga0495647_0081884 | 3300046681 | Bacteria | 1310 |
| 911 | Ga0495658_0010654 | 3300046683 | Bacteria | 4602 |
| 912 | Ga0495658_0181050 | 3300046683 | Bacteria | 1308 |
| 913 | Ga0495669_0107997 | 3300046684 | Bacteria | 1297 |
| 914 | Ga0495613_0009283 | 3300046689 | Bacteria | 7296 |
| 915 | Ga0495613_0085486 | 3300046689 | Bacteria | 2289 |
| 916 | Ga0495613_0188525 | 3300046689 | Bacteria | 1458 |
| 917 | Ga0495613_0293721 | 3300046689 | Bacteria | 1126 |
| 918 | Ga0495624_0016396 | 3300046690 | Bacteria | 4986 |
| 919 | Ga0495624_0244147 | 3300046690 | Bacteria | 1086 |
| 920 | Ga0495670_0018387 | 3300046691 | Bacteria | 3441 |
| 921 | Ga0495670_0058671 | 3300046691 | Bacteria | 1932 |
| 922 | Ga0495671_0217070 | 3300046692 | Bacteria | 926 |
| 923 | Ga0495600_0022899 | 3300046809 | Bacteria | 4015 |
| 924 | Ga0495581_0013837 | 3300047315 | Bacteria | 4676 |
| 925 | Ga0495581_0027369 | 3300047315 | Bacteria | 3306 |
| 926 | Ga0495604_0026889 | 3300047317 | Bacteria | 4578 |
| 927 | Ga0495604_0118972 | 3300047317 | Bacteria | 1914 |
| 928 | Ga0495636_0009131 | 3300047318 | Bacteria | 3900 |
| 929 | Ga0495674_0039213 | 3300047319 | Bacteria | 4248 |
| 930 | Ga0495674_0055416 | 3300047319 | Bacteria | 3477 |
| 931 | Ga0495674_0103983 | 3300047319 | Bacteria | 2414 |
| 932 | Ga0495672_0125570 | 3300047320 | Bacteria | 1357 |
| 933 | Ga0495676_0031851 | 3300047321 | Bacteria | 4454 |
| 934 | Ga0495676_0053814 | 3300047321 | Bacteria | 3204 |
| 935 | Ga0495680_0029429 | 3300047322 | Bacteria | 4497 |
| 936 | Ga0495680_0155761 | 3300047322 | Bacteria | 1662 |
| 937 | Ga0495675_0020619 | 3300047444 | Bacteria | 4195 |
| 938 | Ga0495675_0180742 | 3300047444 | Bacteria | 1291 |
| 939 | Ga0495681_0090403 | 3300047470 | Bacteria | 1353 |
| 940 | Ga0495681_0096190 | 3300047470 | Bacteria | 1301 |
| 941 | Ga0495684_0011564 | 3300047471 | Bacteria | 6816 |
| 942 | Ga0495684_0147381 | 3300047471 | Bacteria | 1762 |
| 943 | Ga0495684_0204241 | 3300047471 | Bacteria | 1455 |
| 944 | Ga0495686_0029299 | 3300047472 | Bacteria | 3582 |
| 945 | Ga0495686_0084660 | 3300047472 | Bacteria | 1932 |
| 946 | Ga0495593_0020360 | 3300047673 | Bacteria | 3715 |
| 947 | Ga0495593_0027076 | 3300047673 | Bacteria | 3158 |
| 948 | Ga0495593_0201857 | 3300047673 | Bacteria | 999 |
| 949 | Ga0495602_0055496 | 3300048088 | Bacteria | 3488 |
| 950 | Ga0495602_0208100 | 3300048088 | Bacteria | 1487 |
| 951 | Ga0495614_0042248 | 3300048089 | Bacteria | 1955 |
| 952 | Ga0495615_0002153 | 3300048090 | Bacteria | 3103 |
| 953 | Ga0496100_0010350 | 3300048903 | Bacteria | 5278 |
| 954 | Ga0496101_0032479 | 3300048904 | Bacteria | 3675 |
| 955 | Ga0496101_0045426 | 3300048904 | Bacteria | 3146 |
| 956 | Ga0496101_0129729 | 3300048904 | Unclassified | 1913 |
| 957 | Ga0496102_0004752 | 3300048905 | Bacteria | 11497 |
| 958 | Ga0496102_0068893 | 3300048905 | Bacteria | 3247 |
| 959 | Ga0496102_0167254 | 3300048905 | Bacteria | 2069 |
| 960 | Ga0496102_0300715 | 3300048905 | Bacteria | 1512 |
| 961 | Ga0496103_0034432 | 3300048906 | Bacteria | 3097 |
| 962 | Ga0496103_0048138 | 3300048906 | Bacteria | 2634 |
| 963 | Ga0496104_0039316 | 3300048907 | Bacteria | 4429 |
| 964 | Ga0496104_0043776 | 3300048907 | Bacteria | 4205 |
| 965 | Ga0496104_0102687 | 3300048907 | Bacteria | 2738 |
| 966 | Ga0496105_0012986 | 3300048908 | Bacteria | 6598 |
| 967 | Ga0496105_0033643 | 3300048908 | Bacteria | 4211 |
| 968 | Ga0496106_0010427 | 3300048909 | Bacteria | 6862 |
| 969 | Ga0496106_0028968 | 3300048909 | Bacteria | 4126 |
| 970 | Ga0496106_0042668 | 3300048909 | Bacteria | 3402 |
| 971 | Ga0496106_0054028 | 3300048909 | Bacteria | 3034 |
| 972 | Ga0496106_0166440 | 3300048909 | Bacteria | 1745 |
| 973 | Ga0496106_0198156 | 3300048909 | Bacteria | 1598 |
| 974 | Ga0496106_0250786 | 3300048909 | Bacteria | 1415 |
| 975 | Ga0496106_0419053 | 3300048909 | Bacteria | 1076 |
| 976 | Ga0496107_0001189 | 3300048910 | Bacteria | 15840 |
| 977 | Ga0496107_0007743 | 3300048910 | Bacteria | 7421 |
| 978 | Ga0496108_0009386 | 3300048911 | Bacteria | 7921 |
| 979 | Ga0496108_0131862 | 3300048911 | Bacteria | 2148 |
| 980 | Ga0496108_0189318 | 3300048911 | Bacteria | 1783 |
| 981 | Ga0496108_0491898 | 3300048911 | Bacteria | 1071 |
| 982 | Ga0496109_0013303 | 3300048912 | Bacteria | 7129 |
| 983 | Ga0496109_0031307 | 3300048912 | Bacteria | 4773 |
| 984 | Ga0496109_0111811 | 3300048912 | Bacteria | 2540 |
| 985 | Ga0496109_0283842 | 3300048912 | Bacteria | 1560 |
| 986 | Ga0496109_0486899 | 3300048912 | Bacteria | 1164 |
| 987 | Ga0496109_0631024 | 3300048912 | Bacteria | 1008 |
| 988 | Ga0496110_0026032 | 3300048913 | Bacteria | 5002 |
| 989 | Ga0496110_0027726 | 3300048913 | Bacteria | 4857 |
| 990 | Ga0496110_0159373 | 3300048913 | Bacteria | 2045 |
| 991 | Ga0496111_0048970 | 3300048914 | Bacteria | 3046 |
| 992 | Ga0496111_0232733 | 3300048914 | Bacteria | 1368 |
| 993 | Ga0496112_0005654 | 3300048915 | Bacteria | 10854 |
| 994 | Ga0496112_0070168 | 3300048915 | Bacteria | 3462 |
| 995 | Ga0496112_0121449 | 3300048915 | Bacteria | 2582 |
| 996 | Ga0496112_0157628 | 3300048915 | Unclassified | 2237 |
| 997 | Ga0496112_0193064 | 3300048915 | Bacteria | 1997 |
| 998 | Ga0496113_0003249 | 3300048916 | Bacteria | 9694 |
| 999 | Ga0496113_0017767 | 3300048916 | Bacteria | 4945 |
| 1000 | Ga0496113_0026946 | 3300048916 | Bacteria | 4114 |
| 1001 | Ga0496114_0007527 | 3300048917 | Bacteria | 8611 |
| 1002 | Ga0496115_0002391 | 3300048918 | Bacteria | 13453 |
| 1003 | Ga0496115_0006943 | 3300048918 | Bacteria | 8322 |
| 1004 | Ga0496115_0173250 | 3300048918 | Bacteria | 1784 |
| 1005 | Ga0496117_0088182 | 3300048920 | Bacteria | 2008 |
| 1006 | Ga0496121_0006615 | 3300048924 | Bacteria | 14295 |
| 1007 | Ga0496121_0035578 | 3300048924 | Bacteria | 4460 |
| 1008 | Ga0496121_0043929 | 3300048924 | Bacteria | 3862 |
| 1009 | Ga0496122_0000039 | 3300048925 | Bacteria | 295352 |
| 1010 | Ga0496123_0000026 | 3300048926 | Bacteria | 318040 |
| 1011 | Ga0496124_0047240 | 3300048927 | Bacteria | 3684 |
| 1012 | Ga0496125_0014317 | 3300048928 | Bacteria | 7729 |
| 1013 | Ga0496125_0102183 | 3300048928 | Bacteria | 2107 |
| 1014 | Ga0496126_0010044 | 3300048929 | Bacteria | 9989 |
| 1015 | Ga0496126_0017497 | 3300048929 | Bacteria | 7139 |
| 1016 | Ga0496126_0234043 | 3300048929 | Bacteria | 1538 |
| 1017 | Ga0495682_0022688 | 3300049460 | Bacteria | 2347 |
| 1018 | Ga0501033_0129881 | 3300049570 | Bacteria | 1826 |
| 1019 | Ga0501033_0333237 | 3300049570 | Bacteria | 1065 |
| 1020 | Ga0501034_0000812 | 3300049571 | Bacteria | 46479 |
| 1021 | Ga0501037_0089904 | 3300049573 | Bacteria | 2222 |
| 1022 | Ga0501038_0115806 | 3300049574 | Bacteria | 2216 |
| 1023 | Ga0501038_0166855 | 3300049574 | Bacteria | 1785 |
| 1024 | Ga0501038_0263661 | 3300049574 | Bacteria | 1361 |
| 1025 | Ga0501038_0417720 | 3300049574 | Bacteria | 1035 |
| 1026 | Ga0501039_0056152 | 3300049575 | Bacteria | 3050 |
| 1027 | Ga0501039_0155189 | 3300049575 | Bacteria | 1798 |
| 1028 | Ga0501039_0258413 | 3300049575 | Bacteria | 1369 |
| 1029 | Ga0501040_0105476 | 3300049576 | Bacteria | 1969 |
| 1030 | Ga0501041_0050928 | 3300049577 | Bacteria | 2523 |
| 1031 | Ga0501043_0361134 | 3300049579 | Bacteria | 1102 |
| 1032 | Ga0501047_0040031 | 3300049581 | Bacteria | 4532 |
| 1033 | Ga0501047_0351735 | 3300049581 | Bacteria | 1310 |
| 1034 | Ga0501048_0107272 | 3300049582 | Bacteria | 1972 |
| 1035 | Ga0501068_0000043 | 3300049584 | Bacteria | 47781 |
| 1036 | Ga0501070_0009132 | 3300049586 | Bacteria | 8385 |
| 1037 | Ga0501072_0000134 | 3300049588 | Bacteria | 55491 |
| 1038 | Ga0501073_0000125 | 3300049589 | Bacteria | 50056 |
| 1039 | Ga0501074_0004617 | 3300049590 | Bacteria | 9864 |
| 1040 | Ga0501075_0150048 | 3300049591 | Bacteria | 1777 |
| 1041 | Ga0501076_0032788 | 3300049592 | Bacteria | 4056 |
| 1042 | Ga0501076_0033230 | 3300049592 | Bacteria | 4028 |
| 1043 | Ga0501079_0022288 | 3300049741 | Bacteria | 4857 |
| 1044 | Ga0501079_0162137 | 3300049741 | Bacteria | 1744 |
| 1045 | Ga0501079_0195273 | 3300049741 | Bacteria | 1580 |
| 1046 | Ga0501080_0000091 | 3300049742 | Bacteria | 61566 |
| 1047 | Ga0501080_0129307 | 3300049742 | Bacteria | 2338 |
| 1048 | Ga0501083_0321892 | 3300049744 | Bacteria | 1006 |
| 1049 | Ga0501268_027319 | 3300049765 | Bacteria | 1014 |
| 1050 | Ga0501044_0013050 | 3300049823 | Bacteria | 8990 |
| 1051 | nmdc:mga03683_109980_c1 | 3300050489 | Bacteria | 1218 |
| 1052 | nmdc:mga03n38_11045_c1 | 3300050490 | Bacteria | 3349 |
| 1053 | nmdc:mga03n38_22436_c1 | 3300050490 | Bacteria | 2555 |
| 1054 | nmdc:mga0yw44_25794_c1 | 3300050492 | Bacteria | 3348 |
| 1055 | nmdc:mga0yw44_59912_c1 | 3300050492 | Bacteria | 2331 |
| 1056 | nmdc:mga0k408_13027_c1 | 3300050493 | Bacteria | 4554 |
| 1057 | nmdc:mga07m45_20026_c1 | 3300050496 | Bacteria | 3631 |
| 1058 | nmdc:mga05p37_22464_c1 | 3300050507 | Bacteria | 7650 |
| 1059 | nmdc:mga09592_1120_c1 | 3300050508 | Bacteria | 21354 |
| 1060 | nmdc:mga09592_193327_c1 | 3300050508 | Bacteria | 1761 |
| 1061 | nmdc:mga09592_30694_c1 | 3300050508 | Unclassified | 4473 |
| 1062 | nmdc:mga0qj67_198000_c1 | 3300050509 | Unclassified | 1632 |
| 1063 | nmdc:mga0qj67_22457_c1 | 3300050509 | Bacteria | 4846 |
| 1064 | nmdc:mga0qj67_372961_c1 | 3300050509 | Bacteria | 1152 |
| 1065 | nmdc:mga0qj67_3746_c1 | 3300050509 | Bacteria | 10979 |
| 1066 | nmdc:mga06r32_239650_c1 | 3300050510 | Bacteria | 1801 |
| 1067 | nmdc:mga06r32_344124_c1 | 3300050510 | Bacteria | 1476 |
| 1068 | nmdc:mga08y16_279756_c1 | 3300050511 | Bacteria | 1721 |
| 1069 | nmdc:mga08y16_48970_c1 | 3300050511 | Unclassified | 4422 |
| 1070 | nmdc:mga08y16_494119_c1 | 3300050511 | Bacteria | 1244 |
| 1071 | nmdc:mga0n895_188748_c1 | 3300050512 | Bacteria | 2092 |
| 1072 | nmdc:mga0n895_44749_c1 | 3300050512 | Bacteria | 4317 |
| 1073 | nmdc:mga0n895_82990_c1 | 3300050512 | Bacteria | 3195 |
| 1074 | nmdc:mga0rr50_17123_c1 | 3300050513 | Bacteria | 4829 |
| 1075 | nmdc:mga0rr50_234870_c1 | 3300050513 | Bacteria | 1518 |
| 1076 | nmdc:mga08x19_5023_c1 | 3300050514 | Bacteria | 7824 |
| 1077 | nmdc:mga0a205_590441_c1 | 3300050515 | Bacteria | 964 |
| 1078 | Ga0495601_0030239 | 3300053077 | Bacteria | 3362 |
| 1079 | Ga0495601_0037659 | 3300053077 | Unclassified | 3024 |
| 1080 | Ga0495601_0140052 | 3300053077 | Bacteria | 1578 |
| 1081 | Ga0495601_0166548 | 3300053077 | Bacteria | 1440 |
| 1082 | Ga0495601_0213176 | 3300053077 | Bacteria | 1261 |
| 1083 | Ga0495612_0011987 | 3300053078 | Bacteria | 3494 |
| 1084 | Ga0495612_0022519 | 3300053078 | Bacteria | 2524 |
| 1085 | Ga0495612_0023469 | 3300053078 | Bacteria | 2475 |
| 1086 | Ga0495655_0053578 | 3300053083 | Bacteria | 1077 |
| 1087 | Ga0495595_0001423 | 3300053084 | Bacteria | 9303 |
| 1088 | Ga0495595_0072209 | 3300053084 | Bacteria | 1633 |
| 1089 | Ga0495619_0040773 | 3300053085 | Bacteria | 3035 |
| 1090 | Ga0495619_0045250 | 3300053085 | Bacteria | 2891 |
| 1091 | Ga0495619_0117994 | 3300053085 | Bacteria | 1817 |
| 1092 | Ga0500646_0000464 | 3300053090 | Bacteria | 11970 |
| 1093 | Ga0500651_0117053 | 3300053093 | Unclassified | 1621 |
| 1094 | Ga0500566_0099399 | 3300053094 | Bacteria | 1597 |
| 1095 | Ga0500641_0160744 | 3300053096 | Bacteria | 968 |
| 1096 | Ga0500595_009912 | 3300053119 | Bacteria | 3815 |
| 1097 | Ga0500595_014358 | 3300053119 | Bacteria | 3005 |
| 1098 | Ga0500655_005291 | 3300053133 | Bacteria | 2331 |
| 1099 | Ga0500658_0054348 | 3300053134 | Bacteria | 1645 |
| 1100 | Ga0500559_0005515 | 3300053136 | Bacteria | 5817 |
| 1101 | Ga0500568_0083298 | 3300053139 | Bacteria | 1212 |
| 1102 | Ga0500573_0008795 | 3300053140 | Bacteria | 5575 |
| 1103 | Ga0500577_0137315 | 3300053142 | Bacteria | 1029 |
| 1104 | Ga0500590_047748 | 3300053148 | Bacteria | 2184 |
| 1105 | Ga0500590_084523 | 3300053148 | Bacteria | 1553 |
| 1106 | Ga0500603_000717 | 3300053150 | Bacteria | 8058 |
| 1107 | Ga0500604_0000243 | 3300053151 | Bacteria | 15638 |
| 1108 | Ga0500633_0065580 | 3300053160 | Bacteria | 1287 |
| 1109 | Ga0500634_0089323 | 3300053161 | Bacteria | 1568 |
| 1110 | Ga0500636_0168929 | 3300053177 | Bacteria | 1184 |
| 1111 | Ga0500636_0210549 | 3300053177 | Bacteria | 1021 |
| 1112 | Ga0500637_0001020 | 3300053178 | Bacteria | 11473 |
| 1113 | Ga0500637_0068220 | 3300053178 | Bacteria | 2043 |
| 1114 | Ga0500552_003478 | 3300053733 | Bacteria | 1603 |
| 1115 | Ga0500596_006291 | 3300053735 | Bacteria | 2023 |
| 1116 | Ga0501084_0088468 | 3300054114 | Bacteria | 2600 |
| 1117 | Ga0501084_0127458 | 3300054114 | Bacteria | 2142 |
| 1118 | Ga0501084_0262080 | 3300054114 | Bacteria | 1459 |
| 1119 | Ga0501084_0273119 | 3300054114 | Bacteria | 1427 |
| 1120 | Ga0501082_0043167 | 3300060353 | Bacteria | 3887 |
| 1121 | Ga0501082_0060982 | 3300060353 | Bacteria | 3247 |
| 1122 | Ga0501082_0168319 | 3300060353 | Bacteria | 1905 |
| 1123 | Ga0530510_0035949 | 3300061734 | Bacteria | 3571 |
| 1124 | Ga0530510_0083032 | 3300061734 | Bacteria | 2333 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046463 | Ga0495653_0088256 | Ga0495653_0088256_1460_2263 | 235 |
| 2 | 3300047319 | Ga0495674_0103983 | Ga0495674_0103983_317_1150 | 235 |
| 3 | 3300050508 | nmdc:mga09592_193327_c1 | nmdc:mga09592_193327_c1_968_1729 | 248 |
| 4 | 3300046531 | Ga0495665_0081597 | Ga0495665_0081597_809_1684 | 250 |
| 5 | 3300006175 | Ga0070712_100230857 | Ga0070712_1002308572 | 257 |
| 6 | 3300025898 | Ga0207692_10163200 | Ga0207692_101632002 | 257 |
| 7 | 3300035086 | Ga0373934_0078851 | Ga0373934_0078851_366_1265 | 257 |
| 8 | 3300035113 | Ga0373936_0012592 | Ga0373936_0012592_636_1535 | 257 |
| 9 | 3300035116 | Ga0373945_0019656 | Ga0373945_0019656_759_1658 | 257 |
| 10 | 3300035171 | Ga0373946_0013304 | Ga0373946_0013304_1976_2875 | 257 |
| 11 | 3300035410 | Ga0373924_0088359 | Ga0373924_0088359_191_1090 | 257 |
| 12 | 3300035691 | Ga0373931_0126984 | Ga0373931_0126984_266_1165 | 257 |
| 13 | 3300035692 | Ga0373935_0058628 | Ga0373935_0058628_253_1152 | 257 |
| 14 | 3300037068 | Ga0373925_0040773 | Ga0373925_0040773_1043_1942 | 257 |
| 15 | 3300046455 | Ga0495603_0061395 | Ga0495603_0061395_791_1690 | 257 |
| 16 | 3300046459 | Ga0495629_0033060 | Ga0495629_0033060_168_1067 | 257 |
| 17 | 3300046461 | Ga0495641_0023065 | Ga0495641_0023065_2105_3004 | 257 |
| 18 | 3300046463 | Ga0495653_0150993 | Ga0495653_0150993_598_1497 | 257 |
| 19 | 3300046472 | Ga0495580_0133187 | Ga0495580_0133187_154_1053 | 257 |
| 20 | 3300046473 | Ga0495582_0044103 | Ga0495582_0044103_1174_2073 | 257 |
| 21 | 3300046477 | Ga0495664_0028972 | Ga0495664_0028972_405_1304 | 257 |
| 22 | 3300046499 | Ga0495594_0022497 | Ga0495594_0022497_1285_2184 | 257 |
| 23 | 3300046514 | Ga0495618_0052343 | Ga0495618_0052343_463_1362 | 257 |
| 24 | 3300046517 | Ga0495630_0094393 | Ga0495630_0094393_397_1296 | 257 |
| 25 | 3300046526 | Ga0495666_0074564 | Ga0495666_0074564_330_1229 | 257 |
| 26 | 3300046529 | Ga0495652_0165899 | Ga0495652_0165899_222_1121 | 257 |
| 27 | 3300046557 | Ga0495622_0054725 | Ga0495622_0054725_200_1099 | 257 |
| 28 | 3300046642 | Ga0495634_0053488 | Ga0495634_0053488_1286_2185 | 257 |
| 29 | 3300046663 | Ga0495635_0007523 | Ga0495635_0007523_6624_7523 | 257 |
| 30 | 3300046674 | Ga0495588_0033752 | Ga0495588_0033752_140_1039 | 257 |
| 31 | 3300046680 | Ga0495646_0133682 | Ga0495646_0133682_106_1005 | 257 |
| 32 | 3300046681 | Ga0495647_0015089 | Ga0495647_0015089_655_1554 | 257 |
| 33 | 3300047315 | Ga0495581_0027369 | Ga0495581_0027369_1060_1959 | 257 |
| 34 | 3300047321 | Ga0495676_0053814 | Ga0495676_0053814_2218_3117 | 257 |
| 35 | 3300047322 | Ga0495680_0155761 | Ga0495680_0155761_487_1386 | 257 |
| 36 | 3300048918 | Ga0496115_0173250 | Ga0496115_0173250_256_1155 | 257 |
| 37 | 3300053077 | Ga0495601_0030239 | Ga0495601_0030239_2046_2945 | 257 |
| 38 | 3300053078 | Ga0495612_0023469 | Ga0495612_0023469_418_1317 | 257 |
| 39 | 3300053085 | Ga0495619_0045250 | Ga0495619_0045250_697_1596 | 257 |
| 40 | 3300009176 | Ga0105242_10114505 | Ga0105242_101145052 | 259 |
| 41 | 3300047444 | Ga0495675_0020619 | Ga0495675_0020619_1023_1898 | 259 |
| 42 | 3300049741 | Ga0501079_0162137 | Ga0501079_0162137_617_1513 | 259 |
| 43 | 3300054114 | Ga0501084_0262080 | Ga0501084_0262080_277_1173 | 259 |
| 44 | 3300005436 | Ga0070713_100384562 | Ga0070713_1003845622 | 263 |
| 45 | 3300013297 | Ga0157378_10137580 | Ga0157378_101375802 | 265 |
| 46 | 3300053083 | Ga0495655_0053578 | Ga0495655_0053578_88_984 | 265 |
| 47 | 3300005330 | Ga0070690_100048374 | Ga0070690_1000483742 | 266 |
| 48 | 3300005364 | Ga0070673_100394101 | Ga0070673_1003941011 | 266 |
| 49 | 3300005366 | Ga0070659_100204556 | Ga0070659_1002045562 | 266 |
| 50 | 3300005367 | Ga0070667_100084563 | Ga0070667_1000845632 | 266 |
| 51 | 3300005435 | Ga0070714_100181421 | Ga0070714_1001814212 | 266 |
| 52 | 3300005437 | Ga0070710_10012418 | Ga0070710_100124181 | 266 |
| 53 | 3300005439 | Ga0070711_100065709 | Ga0070711_1000657092 | 266 |
| 54 | 3300005457 | Ga0070662_100159262 | Ga0070662_1001592622 | 266 |
| 55 | 3300005547 | Ga0070693_100106228 | Ga0070693_1001062282 | 266 |
| 56 | 3300005614 | Ga0068856_100098205 | Ga0068856_1000982052 | 266 |
| 57 | 3300006175 | Ga0070712_100172220 | Ga0070712_1001722202 | 266 |
| 58 | 3300006237 | Ga0097621_100032753 | Ga0097621_1000327535 | 266 |
| 59 | 3300006358 | Ga0068871_100029904 | Ga0068871_1000299045 | 266 |
| 60 | 3300006914 | Ga0075436_100046979 | Ga0075436_1000469792 | 266 |
| 61 | 3300007788 | Ga0099795_10107426 | Ga0099795_101074262 | 266 |
| 62 | 3300009098 | Ga0105245_10072790 | Ga0105245_100727902 | 266 |
| 63 | 3300009148 | Ga0105243_10042633 | Ga0105243_100426332 | 266 |
| 64 | 3300009176 | Ga0105242_10034121 | Ga0105242_100341212 | 266 |
| 65 | 3300009177 | Ga0105248_10045176 | Ga0105248_100451763 | 266 |
| 66 | 3300010375 | Ga0105239_10150422 | Ga0105239_101504222 | 266 |
| 67 | 3300013296 | Ga0157374_10222441 | Ga0157374_102224412 | 266 |
| 68 | 3300013306 | Ga0163162_10108835 | Ga0163162_101088352 | 266 |
| 69 | 3300013308 | Ga0157375_10028867 | Ga0157375_100288672 | 266 |
| 70 | 3300014968 | Ga0157379_10019335 | Ga0157379_100193357 | 266 |
| 71 | 3300014969 | Ga0157376_10096191 | Ga0157376_100961912 | 266 |
| 72 | 3300025906 | Ga0207699_10268654 | Ga0207699_102686542 | 266 |
| 73 | 3300025916 | Ga0207663_10007369 | Ga0207663_100073693 | 266 |
| 74 | 3300025928 | Ga0207700_10139168 | Ga0207700_101391682 | 266 |
| 75 | 3300025929 | Ga0207664_10156303 | Ga0207664_101563034 | 266 |
| 76 | 3300025931 | Ga0207644_10074277 | Ga0207644_100742772 | 266 |
| 77 | 3300025932 | Ga0207690_10233670 | Ga0207690_102336702 | 266 |
| 78 | 3300025933 | Ga0207706_10036842 | Ga0207706_100368425 | 266 |
| 79 | 3300025939 | Ga0207665_10042809 | Ga0207665_100428093 | 266 |
| 80 | 3300025941 | Ga0207711_10270512 | Ga0207711_102705122 | 266 |
| 81 | 3300026067 | Ga0207678_10241303 | Ga0207678_102413032 | 266 |
| 82 | 3300026078 | Ga0207702_10128211 | Ga0207702_101282112 | 266 |
| 83 | 3300026121 | Ga0207683_10008676 | Ga0207683_100086763 | 266 |
| 84 | 3300035111 | Ga0373923_0041756 | Ga0373923_0041756_627_1526 | 266 |
| 85 | 3300035118 | Ga0373954_0026478 | Ga0373954_0026478_198_1097 | 266 |
| 86 | 3300035119 | Ga0373956_0099419 | Ga0373956_0099419_25_924 | 266 |
| 87 | 3300035120 | Ga0373957_0001261 | Ga0373957_0001261_5050_5949 | 266 |
| 88 | 3300035172 | Ga0373955_0040834 | Ga0373955_0040834_1320_2219 | 266 |
| 89 | 3300035695 | Ga0373927_0202006 | Ga0373927_0202006_393_1292 | 266 |
| 90 | 3300035724 | Ga0373933_0007808 | Ga0373933_0007808_1803_2702 | 266 |
| 91 | 3300036401 | Ga0373937_0007266 | Ga0373937_0007266_852_1751 | 266 |
| 92 | 3300046454 | Ga0495592_0106108 | Ga0495592_0106108_97_996 | 266 |
| 93 | 3300046459 | Ga0495629_0085896 | Ga0495629_0085896_365_1264 | 266 |
| 94 | 3300046462 | Ga0495651_0007700 | Ga0495651_0007700_4592_5491 | 266 |
| 95 | 3300046476 | Ga0495662_0049497 | Ga0495662_0049497_470_1369 | 266 |
| 96 | 3300046477 | Ga0495664_0011150 | Ga0495664_0011150_3755_4654 | 266 |
| 97 | 3300046511 | Ga0495608_0042278 | Ga0495608_0042278_1924_2823 | 266 |
| 98 | 3300046514 | Ga0495618_0164826 | Ga0495618_0164826_40_939 | 266 |
| 99 | 3300046516 | Ga0495628_0124038 | Ga0495628_0124038_384_1283 | 266 |
| 100 | 3300046517 | Ga0495630_0163830 | Ga0495630_0163830_183_1082 | 266 |
| 101 | 3300046529 | Ga0495652_0079246 | Ga0495652_0079246_1306_2205 | 266 |
| 102 | 3300046533 | Ga0495640_0122787 | Ga0495640_0122787_404_1303 | 266 |
| 103 | 3300046536 | Ga0495587_0002956 | Ga0495587_0002956_5953_6852 | 266 |
| 104 | 3300046543 | Ga0495645_0009466 | Ga0495645_0009466_2770_3669 | 266 |
| 105 | 3300046559 | Ga0495667_0001799 | Ga0495667_0001799_4770_5669 | 266 |
| 106 | 3300046642 | Ga0495634_0064264 | Ga0495634_0064264_1134_2033 | 266 |
| 107 | 3300046663 | Ga0495635_0141313 | Ga0495635_0141313_176_1075 | 266 |
| 108 | 3300046675 | Ga0495657_0011744 | Ga0495657_0011744_2954_3853 | 266 |
| 109 | 3300046678 | Ga0495599_0075301 | Ga0495599_0075301_384_1283 | 266 |
| 110 | 3300046679 | Ga0495623_0010736 | Ga0495623_0010736_1964_2863 | 266 |
| 111 | 3300046680 | Ga0495646_0074353 | Ga0495646_0074353_999_1898 | 266 |
| 112 | 3300046689 | Ga0495613_0188525 | Ga0495613_0188525_390_1289 | 266 |
| 113 | 3300046690 | Ga0495624_0244147 | Ga0495624_0244147_130_1029 | 266 |
| 114 | 3300046809 | Ga0495600_0022899 | Ga0495600_0022899_755_1654 | 266 |
| 115 | 3300047317 | Ga0495604_0026889 | Ga0495604_0026889_2554_3453 | 266 |
| 116 | 3300047319 | Ga0495674_0055416 | Ga0495674_0055416_1580_2479 | 266 |
| 117 | 3300047322 | Ga0495680_0029429 | Ga0495680_0029429_2139_3038 | 266 |
| 118 | 3300047471 | Ga0495684_0204241 | Ga0495684_0204241_403_1302 | 266 |
| 119 | 3300048088 | Ga0495602_0055496 | Ga0495602_0055496_1434_2333 | 266 |
| 120 | 3300048904 | Ga0496101_0129729 | Ga0496101_0129729_648_1547 | 266 |
| 121 | 3300048906 | Ga0496103_0048138 | Ga0496103_0048138_292_1191 | 266 |
| 122 | 3300048907 | Ga0496104_0039316 | Ga0496104_0039316_3320_4219 | 266 |
| 123 | 3300048908 | Ga0496105_0012986 | Ga0496105_0012986_3631_4530 | 266 |
| 124 | 3300048909 | Ga0496106_0028968 | Ga0496106_0028968_2797_3696 | 266 |
| 125 | 3300048910 | Ga0496107_0001189 | Ga0496107_0001189_6362_7261 | 266 |
| 126 | 3300048911 | Ga0496108_0131862 | Ga0496108_0131862_1126_2025 | 266 |
| 127 | 3300048913 | Ga0496110_0159373 | Ga0496110_0159373_325_1224 | 266 |
| 128 | 3300048915 | Ga0496112_0157628 | Ga0496112_0157628_281_1180 | 266 |
| 129 | 3300049575 | Ga0501039_0056152 | Ga0501039_0056152_1026_1940 | 266 |
| 130 | 3300049584 | Ga0501068_0000043 | Ga0501068_0000043_23659_24573 | 266 |
| 131 | 3300049586 | Ga0501070_0009132 | Ga0501070_0009132_5048_5962 | 266 |
| 132 | 3300049589 | Ga0501073_0000125 | Ga0501073_0000125_19666_20580 | 266 |
| 133 | 3300049590 | Ga0501074_0004617 | Ga0501074_0004617_5377_6291 | 266 |
| 134 | 3300049741 | Ga0501079_0022288 | Ga0501079_0022288_493_1407 | 266 |
| 135 | 3300049742 | Ga0501080_0000091 | Ga0501080_0000091_19666_20580 | 266 |
| 136 | 3300050514 | nmdc:mga08x19_5023_c1 | nmdc:mga08x19_5023_c1_4887_5783 | 266 |
| 137 | 3300053077 | Ga0495601_0213176 | Ga0495601_0213176_138_1037 | 266 |
| 138 | 3300053078 | Ga0495612_0022519 | Ga0495612_0022519_138_1037 | 266 |
| 139 | 3300053084 | Ga0495595_0001423 | Ga0495595_0001423_489_1388 | 266 |
| 140 | 3300053085 | Ga0495619_0117994 | Ga0495619_0117994_407_1306 | 266 |
| 141 | 3300054114 | Ga0501084_0088468 | Ga0501084_0088468_579_1493 | 266 |
| 142 | 3300060353 | Ga0501082_0060982 | Ga0501082_0060982_890_1804 | 266 |
| 143 | 3300005339 | Ga0070660_100095014 | Ga0070660_1000950142 | 267 |
| 144 | 3300005455 | Ga0070663_100140237 | Ga0070663_1001402372 | 267 |
| 145 | 3300005458 | Ga0070681_10097072 | Ga0070681_100970721 | 267 |
| 146 | 3300005530 | Ga0070679_100244858 | Ga0070679_1002448582 | 267 |
| 147 | 3300005545 | Ga0070695_100120853 | Ga0070695_1001208531 | 267 |
| 148 | 3300005546 | Ga0070696_100047841 | Ga0070696_1000478412 | 267 |
| 149 | 3300005564 | Ga0070664_100185844 | Ga0070664_1001858442 | 267 |
| 150 | 3300005616 | Ga0068852_100127348 | Ga0068852_1001273482 | 267 |
| 151 | 3300006358 | Ga0068871_100289553 | Ga0068871_1002895532 | 267 |
| 152 | 3300006881 | Ga0068865_100095914 | Ga0068865_1000959142 | 267 |
| 153 | 3300010375 | Ga0105239_10155976 | Ga0105239_101559762 | 267 |
| 154 | 3300013297 | Ga0157378_10071649 | Ga0157378_100716493 | 267 |
| 155 | 3300025912 | Ga0207707_10051453 | Ga0207707_100514533 | 267 |
| 156 | 3300025919 | Ga0207657_10033072 | Ga0207657_100330723 | 267 |
| 157 | 3300025927 | Ga0207687_10140340 | Ga0207687_101403402 | 267 |
| 158 | 3300025934 | Ga0207686_10155950 | Ga0207686_101559502 | 267 |
| 159 | 3300025938 | Ga0207704_10020348 | Ga0207704_100203484 | 267 |
| 160 | 3300026041 | Ga0207639_10222143 | Ga0207639_102221432 | 267 |
| 161 | 3300028381 | Ga0268264_10413637 | Ga0268264_104136371 | 267 |
| 162 | 3300039062 | Ga0400483_176221 | Ga0400483_176221_5886_6791 | 267 |
| 163 | 3300048909 | Ga0496106_0054028 | Ga0496106_0054028_1126_2025 | 267 |
| 164 | 3300049574 | Ga0501038_0417720 | Ga0501038_0417720_172_1008 | 267 |
| 165 | 3300005617 | Ga0068859_100103458 | Ga0068859_1001034583 | 268 |
| 166 | 3300006931 | Ga0097620_100103453 | Ga0097620_1001034533 | 268 |
| 167 | 3300014969 | Ga0157376_10139013 | Ga0157376_101390132 | 268 |
| 168 | 3300045976 | Ga0466967_0069688 | Ga0466967_0069688_846_1742 | 268 |
| 169 | 3300005547 | Ga0070693_100265944 | Ga0070693_1002659442 | 269 |
| 170 | 3300009177 | Ga0105248_10433449 | Ga0105248_104334492 | 269 |
| 171 | 3300049744 | Ga0501083_0321892 | Ga0501083_0321892_27_923 | 269 |
| 172 | 3300053119 | Ga0500595_009912 | Ga0500595_009912_2261_3181 | 271 |
| 173 | 3300025934 | Ga0207686_10116269 | Ga0207686_101162691 | 272 |
| 174 | 3300031090 | Ga0265760_10031980 | Ga0265760_100319802 | 272 |
| 175 | 3300039062 | Ga0400483_013851 | Ga0400483_013851_6324_7229 | 272 |
| 176 | 3300005434 | Ga0070709_10168140 | Ga0070709_101681401 | 273 |
| 177 | 3300049570 | Ga0501033_0333237 | Ga0501033_0333237_155_1051 | 273 |
| 178 | 3300049581 | Ga0501047_0040031 | Ga0501047_0040031_1132_2034 | 273 |
| 179 | 3300060353 | Ga0501082_0043167 | Ga0501082_0043167_2152_3048 | 273 |
| 180 | 3300025297 | Ga0209758_1006809 | Ga0209758_10068095 | 274 |
| 181 | 3300025931 | Ga0207644_10020806 | Ga0207644_100208062 | 274 |
| 182 | 3300032002 | Ga0307416_100049692 | Ga0307416_1000496922 | 274 |
| 183 | 3300048911 | Ga0496108_0189318 | Ga0496108_0189318_478_1374 | 274 |
| 184 | 3300005331 | Ga0070670_100000922 | Ga0070670_10000092210 | 275 |
| 185 | 3300005354 | Ga0070675_100002677 | Ga0070675_1000026773 | 275 |
| 186 | 3300005364 | Ga0070673_100056985 | Ga0070673_1000569852 | 275 |
| 187 | 3300005367 | Ga0070667_100151586 | Ga0070667_1001515862 | 275 |
| 188 | 3300005543 | Ga0070672_100001036 | Ga0070672_10000103610 | 275 |
| 189 | 3300005618 | Ga0068864_100006881 | Ga0068864_1000068812 | 275 |
| 190 | 3300005841 | Ga0068863_100043780 | Ga0068863_1000437802 | 275 |
| 191 | 3300006237 | Ga0097621_100022442 | Ga0097621_1000224424 | 275 |
| 192 | 3300006358 | Ga0068871_100026378 | Ga0068871_1000263784 | 275 |
| 193 | 3300025915 | Ga0207693_10126449 | Ga0207693_101264492 | 275 |
| 194 | 3300025925 | Ga0207650_10003930 | Ga0207650_100039308 | 275 |
| 195 | 3300025926 | Ga0207659_10006781 | Ga0207659_100067814 | 275 |
| 196 | 3300025928 | Ga0207700_10033262 | Ga0207700_100332622 | 275 |
| 197 | 3300025940 | Ga0207691_10006056 | Ga0207691_100060566 | 275 |
| 198 | 3300025960 | Ga0207651_10029173 | Ga0207651_100291731 | 275 |
| 199 | 3300025986 | Ga0207658_10123385 | Ga0207658_101233852 | 275 |
| 200 | 3300026095 | Ga0207676_10004299 | Ga0207676_100042998 | 275 |
| 201 | 3300026121 | Ga0207683_10021217 | Ga0207683_100212174 | 275 |
| 202 | 3300046507 | Ga0495606_0003921 | Ga0495606_0003921_14357_15253 | 275 |
| 203 | 3300014969 | Ga0157376_10010081 | Ga0157376_100100815 | 277 |
| 204 | 3300005543 | Ga0070672_100176970 | Ga0070672_1001769702 | 278 |
| 205 | 3300017792 | Ga0163161_10240465 | Ga0163161_102404652 | 278 |
| 206 | 3300041404 | Ga0439436_0000165 | Ga0439436_0000165_12889_13791 | 278 |
| 207 | 3300041405 | Ga0439438_025746 | Ga0439438_025746_529_1431 | 278 |
| 208 | 3300041407 | Ga0439447_026681 | Ga0439447_026681_349_1251 | 278 |
| 209 | 3300042015 | Ga0439462_0016318 | Ga0439462_0016318_703_1605 | 278 |
| 210 | 3300049570 | Ga0501033_0129881 | Ga0501033_0129881_327_1229 | 278 |
| 211 | 3300049573 | Ga0501037_0089904 | Ga0501037_0089904_558_1460 | 278 |
| 212 | 3300049575 | Ga0501039_0155189 | Ga0501039_0155189_666_1568 | 278 |
| 213 | 3300049577 | Ga0501041_0050928 | Ga0501041_0050928_1053_1955 | 278 |
| 214 | 3300054114 | Ga0501084_0127458 | Ga0501084_0127458_914_1816 | 278 |
| 215 | 3300006195 | Ga0075366_10010651 | Ga0075366_100106515 | 280 |
| 216 | 3300006038 | Ga0075365_10075634 | Ga0075365_100756342 | 281 |
| 217 | 3300006048 | Ga0075363_100000768 | Ga0075363_10000076810 | 281 |
| 218 | 3300006178 | Ga0075367_10019341 | Ga0075367_100193413 | 281 |
| 219 | 3300006195 | Ga0075366_10020528 | Ga0075366_100205281 | 281 |
| 220 | 3300013105 | Ga0157369_10072885 | Ga0157369_100728853 | 281 |
| 221 | 3300050489 | nmdc:mga03683_109980_c1 | nmdc:mga03683_109980_c1_93_989 | 281 |
| 222 | 3300050490 | nmdc:mga03n38_22436_c1 | nmdc:mga03n38_22436_c1_890_1786 | 281 |
| 223 | 3300050492 | nmdc:mga0yw44_59912_c1 | nmdc:mga0yw44_59912_c1_93_989 | 281 |
| 224 | 3300050493 | nmdc:mga0k408_13027_c1 | nmdc:mga0k408_13027_c1_2117_3013 | 281 |
| 225 | 3300005329 | Ga0070683_100160001 | Ga0070683_1001600012 | 282 |
| 226 | 3300005337 | Ga0070682_100146291 | Ga0070682_1001462911 | 282 |
| 227 | 3300005366 | Ga0070659_100099403 | Ga0070659_1000994032 | 282 |
| 228 | 3300005577 | Ga0068857_100294722 | Ga0068857_1002947222 | 282 |
| 229 | 3300013100 | Ga0157373_10111980 | Ga0157373_101119802 | 282 |
| 230 | 3300015262 | Ga0182007_10045162 | Ga0182007_100451622 | 282 |
| 231 | 3300025909 | Ga0207705_10218937 | Ga0207705_102189371 | 282 |
| 232 | 3300025932 | Ga0207690_10174690 | Ga0207690_101746902 | 282 |
| 233 | 3300025944 | Ga0207661_10198290 | Ga0207661_101982902 | 282 |
| 234 | 3300026078 | Ga0207702_10090253 | Ga0207702_100902533 | 282 |
| 235 | 3300037466 | Ga0395898_0097244 | Ga0395898_0097244_623_1519 | 282 |
| 236 | 3300038443 | Ga0395901_0068861 | Ga0395901_0068861_2417_3313 | 282 |
| 237 | 3300042876 | Ga0451577_0018003 | Ga0451577_0018003_3200_4096 | 282 |
| 238 | 3300048909 | Ga0496106_0010427 | Ga0496106_0010427_32_928 | 282 |
| 239 | 3300053077 | Ga0495601_0037659 | Ga0495601_0037659_348_1244 | 282 |
| 240 | 3300005334 | Ga0068869_100117287 | Ga0068869_1001172871 | 283 |
| 241 | 3300005335 | Ga0070666_10002324 | Ga0070666_1000232410 | 283 |
| 242 | 3300005338 | Ga0068868_100000189 | Ga0068868_10000018941 | 283 |
| 243 | 3300005354 | Ga0070675_100000563 | Ga0070675_10000056311 | 283 |
| 244 | 3300005364 | Ga0070673_100001225 | Ga0070673_1000012258 | 283 |
| 245 | 3300005365 | Ga0070688_100017560 | Ga0070688_1000175603 | 283 |
| 246 | 3300005367 | Ga0070667_100015983 | Ga0070667_1000159832 | 283 |
| 247 | 3300005456 | Ga0070678_100025200 | Ga0070678_1000252003 | 283 |
| 248 | 3300005466 | Ga0070685_10025496 | Ga0070685_100254962 | 283 |
| 249 | 3300005548 | Ga0070665_100182079 | Ga0070665_1001820792 | 283 |
| 250 | 3300005617 | Ga0068859_100081825 | Ga0068859_1000818252 | 283 |
| 251 | 3300005618 | Ga0068864_100002453 | Ga0068864_1000024534 | 283 |
| 252 | 3300005834 | Ga0068851_10116012 | Ga0068851_101160122 | 283 |
| 253 | 3300005841 | Ga0068863_100006441 | Ga0068863_1000064413 | 283 |
| 254 | 3300005842 | Ga0068858_100000882 | Ga0068858_10000088224 | 283 |
| 255 | 3300006358 | Ga0068871_100061174 | Ga0068871_1000611743 | 283 |
| 256 | 3300006931 | Ga0097620_100081827 | Ga0097620_1000818272 | 283 |
| 257 | 3300009177 | Ga0105248_10096833 | Ga0105248_100968333 | 283 |
| 258 | 3300013306 | Ga0163162_10054125 | Ga0163162_100541253 | 283 |
| 259 | 3300014325 | Ga0163163_10001152 | Ga0163163_1000115212 | 283 |
| 260 | 3300014968 | Ga0157379_10021311 | Ga0157379_100213115 | 283 |
| 261 | 3300025321 | Ga0207656_10031875 | Ga0207656_100318752 | 283 |
| 262 | 3300025893 | Ga0207682_10059797 | Ga0207682_100597972 | 283 |
| 263 | 3300025926 | Ga0207659_10000474 | Ga0207659_100004748 | 283 |
| 264 | 3300025931 | Ga0207644_10001390 | Ga0207644_1000139011 | 283 |
| 265 | 3300025941 | Ga0207711_10144958 | Ga0207711_101449582 | 283 |
| 266 | 3300025944 | Ga0207661_10374549 | Ga0207661_103745492 | 283 |
| 267 | 3300025960 | Ga0207651_10000495 | Ga0207651_100004953 | 283 |
| 268 | 3300026023 | Ga0207677_10022680 | Ga0207677_100226802 | 283 |
| 269 | 3300026035 | Ga0207703_10000795 | Ga0207703_1000079511 | 283 |
| 270 | 3300026075 | Ga0207708_10159810 | Ga0207708_101598102 | 283 |
| 271 | 3300026088 | Ga0207641_10001123 | Ga0207641_100011238 | 283 |
| 272 | 3300026089 | Ga0207648_10098716 | Ga0207648_100987162 | 283 |
| 273 | 3300026095 | Ga0207676_10000841 | Ga0207676_1000084123 | 283 |
| 274 | 3300028381 | Ga0268264_10054319 | Ga0268264_100543192 | 283 |
| 275 | 3300036401 | Ga0373937_0270668 | Ga0373937_0270668_661_1557 | 283 |
| 276 | 3300042134 | Ga0450898_010215 | Ga0450898_010215_10_912 | 283 |
| 277 | 3300048909 | Ga0496106_0042668 | Ga0496106_0042668_425_1321 | 283 |
| 278 | 3300048911 | Ga0496108_0009386 | Ga0496108_0009386_1611_2507 | 283 |
| 279 | 3300061734 | Ga0530510_0035949 | Ga0530510_0035949_1602_2498 | 283 |
| 280 | 3300005844 | Ga0068862_100097221 | Ga0068862_1000972213 | 284 |
| 281 | 3300009098 | Ga0105245_10441284 | Ga0105245_104412841 | 284 |
| 282 | 3300009148 | Ga0105243_10043295 | Ga0105243_100432954 | 284 |
| 283 | 3300025935 | Ga0207709_10021278 | Ga0207709_100212783 | 284 |
| 284 | 3300031616 | Ga0307508_10000058 | Ga0307508_1000005833 | 284 |
| 285 | 3300005367 | Ga0070667_100001024 | Ga0070667_1000010245 | 285 |
| 286 | 3300005548 | Ga0070665_100491677 | Ga0070665_1004916772 | 285 |
| 287 | 3300005614 | Ga0068856_100070922 | Ga0068856_1000709223 | 285 |
| 288 | 3300013306 | Ga0163162_10419638 | Ga0163162_104196382 | 285 |
| 289 | 3300025927 | Ga0207687_10133337 | Ga0207687_101333372 | 285 |
| 290 | 3300025938 | Ga0207704_10295127 | Ga0207704_102951271 | 285 |
| 291 | 3300025986 | Ga0207658_10000692 | Ga0207658_100006925 | 285 |
| 292 | 3300026078 | Ga0207702_10027427 | Ga0207702_100274273 | 285 |
| 293 | 3300028381 | Ga0268264_10248929 | Ga0268264_102489292 | 285 |
| 294 | 3300005844 | Ga0068862_100044997 | Ga0068862_1000449974 | 286 |
| 295 | 3300028380 | Ga0268265_10101437 | Ga0268265_101014372 | 286 |
| 296 | 3300031238 | Ga0265332_10007361 | Ga0265332_100073611 | 286 |
| 297 | 3300031249 | Ga0265339_10006651 | Ga0265339_100066514 | 286 |
| 298 | 3300031250 | Ga0265331_10005102 | Ga0265331_100051025 | 286 |
| 299 | 3300031712 | Ga0265342_10000035 | Ga0265342_1000003570 | 286 |
| 300 | 3300042439 | Ga0439464_0006709 | Ga0439464_0006709_2084_2980 | 286 |
| 301 | 3300005329 | Ga0070683_100530265 | Ga0070683_1005302651 | 287 |
| 302 | 3300005333 | Ga0070677_10024124 | Ga0070677_100241242 | 287 |
| 303 | 3300005334 | Ga0068869_100290236 | Ga0068869_1002902362 | 287 |
| 304 | 3300005338 | Ga0068868_100010035 | Ga0068868_1000100351 | 287 |
| 305 | 3300005343 | Ga0070687_100248206 | Ga0070687_1002482061 | 287 |
| 306 | 3300005366 | Ga0070659_100064853 | Ga0070659_1000648533 | 287 |
| 307 | 3300005535 | Ga0070684_100386411 | Ga0070684_1003864112 | 287 |
| 308 | 3300005578 | Ga0068854_100119452 | Ga0068854_1001194522 | 287 |
| 309 | 3300005614 | Ga0068856_100015300 | Ga0068856_1000153005 | 287 |
| 310 | 3300005834 | Ga0068851_10212202 | Ga0068851_102122022 | 287 |
| 311 | 3300005844 | Ga0068862_100161893 | Ga0068862_1001618932 | 287 |
| 312 | 3300005981 | Ga0081538_10003075 | Ga0081538_1000307514 | 287 |
| 313 | 3300009174 | Ga0105241_10336513 | Ga0105241_103365131 | 287 |
| 314 | 3300010375 | Ga0105239_10253889 | Ga0105239_102538892 | 287 |
| 315 | 3300013296 | Ga0157374_10678076 | Ga0157374_106780762 | 287 |
| 316 | 3300013297 | Ga0157378_10099948 | Ga0157378_100999481 | 287 |
| 317 | 3300013307 | Ga0157372_10200865 | Ga0157372_102008652 | 287 |
| 318 | 3300025932 | Ga0207690_10077325 | Ga0207690_100773252 | 287 |
| 319 | 3300025981 | Ga0207640_10089056 | Ga0207640_100890562 | 287 |
| 320 | 3300026078 | Ga0207702_10017319 | Ga0207702_100173195 | 287 |
| 321 | 3300026116 | Ga0207674_10350271 | Ga0207674_103502712 | 287 |
| 322 | 3300031548 | Ga0307408_100485697 | Ga0307408_1004856971 | 287 |
| 323 | 3300031824 | Ga0307413_10076937 | Ga0307413_100769372 | 287 |
| 324 | 3300048905 | Ga0496102_0300715 | Ga0496102_0300715_95_991 | 287 |
| 325 | 3300048909 | Ga0496106_0419053 | Ga0496106_0419053_27_923 | 287 |
| 326 | 3300048912 | Ga0496109_0111811 | Ga0496109_0111811_126_1022 | 287 |
| 327 | 3300048915 | Ga0496112_0005654 | Ga0496112_0005654_9840_10736 | 287 |
| 328 | 3300049574 | Ga0501038_0166855 | Ga0501038_0166855_420_1316 | 287 |
| 329 | 3300049579 | Ga0501043_0361134 | Ga0501043_0361134_76_972 | 287 |
| 330 | 3300049581 | Ga0501047_0351735 | Ga0501047_0351735_324_1220 | 287 |
| 331 | 3300049742 | Ga0501080_0129307 | Ga0501080_0129307_1412_2308 | 287 |
| 332 | 3300049823 | Ga0501044_0013050 | Ga0501044_0013050_7487_8383 | 287 |
| 333 | 3300005614 | Ga0068856_100287268 | Ga0068856_1002872682 | 288 |
| 334 | 3300005981 | Ga0081538_10056445 | Ga0081538_100564453 | 288 |
| 335 | 3300005981 | Ga0081538_10058242 | Ga0081538_100582422 | 288 |
| 336 | 3300031456 | Ga0307513_10058673 | Ga0307513_100586733 | 288 |
| 337 | 3300031911 | Ga0307412_10275493 | Ga0307412_102754932 | 288 |
| 338 | 3300005436 | Ga0070713_100103117 | Ga0070713_1001031172 | 289 |
| 339 | 3300005437 | Ga0070710_10031115 | Ga0070710_100311152 | 289 |
| 340 | 3300005439 | Ga0070711_100011490 | Ga0070711_1000114904 | 289 |
| 341 | 3300006175 | Ga0070712_100088811 | Ga0070712_1000888113 | 289 |
| 342 | 3300025898 | Ga0207692_10013406 | Ga0207692_100134062 | 289 |
| 343 | 3300025915 | Ga0207693_10003058 | Ga0207693_1000305815 | 289 |
| 344 | 3300035691 | Ga0373931_0075378 | Ga0373931_0075378_881_1774 | 289 |
| 345 | 3300037068 | Ga0373925_0143060 | Ga0373925_0143060_22_915 | 289 |
| 346 | 3300003911 | JGI25405J52794_10001742 | JGI25405J52794_100017425 | 290 |
| 347 | 3300005937 | Ga0081455_10001790 | Ga0081455_1000179018 | 290 |
| 348 | 3300005981 | Ga0081538_10022297 | Ga0081538_100222974 | 290 |
| 349 | 3300005985 | Ga0081539_10038599 | Ga0081539_100385993 | 290 |
| 350 | 3300006844 | Ga0075428_100164692 | Ga0075428_1001646922 | 290 |
| 351 | 3300006847 | Ga0075431_100053369 | Ga0075431_1000533695 | 290 |
| 352 | 3300006852 | Ga0075433_10158585 | Ga0075433_101585852 | 290 |
| 353 | 3300009094 | Ga0111539_10226850 | Ga0111539_102268502 | 290 |
| 354 | 3300009147 | Ga0114129_10203550 | Ga0114129_102035502 | 290 |
| 355 | 3300035410 | Ga0373924_0115457 | Ga0373924_0115457_17_913 | 290 |
| 356 | 3300035724 | Ga0373933_0056217 | Ga0373933_0056217_1035_1931 | 290 |
| 357 | 3300036401 | Ga0373937_0090756 | Ga0373937_0090756_1203_2099 | 290 |
| 358 | 3300049574 | Ga0501038_0115806 | Ga0501038_0115806_418_1311 | 290 |
| 359 | 3300050507 | nmdc:mga05p37_22464_c1 | nmdc:mga05p37_22464_c1_4671_5567 | 290 |
| 360 | 3300050508 | nmdc:mga09592_30694_c1 | nmdc:mga09592_30694_c1_335_1231 | 290 |
| 361 | 3300050509 | nmdc:mga0qj67_198000_c1 | nmdc:mga0qj67_198000_c1_454_1350 | 290 |
| 362 | 3300050510 | nmdc:mga06r32_344124_c1 | nmdc:mga06r32_344124_c1_27_923 | 290 |
| 363 | 3300050511 | nmdc:mga08y16_48970_c1 | nmdc:mga08y16_48970_c1_966_1862 | 290 |
| 364 | 3300053093 | Ga0500651_0117053 | Ga0500651_0117053_668_1564 | 290 |
| 365 | 3300061734 | Ga0530510_0083032 | Ga0530510_0083032_1239_2132 | 290 |
| 366 | 3300005353 | Ga0070669_100100811 | Ga0070669_1001008112 | 291 |
| 367 | 3300005459 | Ga0068867_100006149 | Ga0068867_1000061497 | 291 |
| 368 | 3300005544 | Ga0070686_100184150 | Ga0070686_1001841502 | 291 |
| 369 | 3300005617 | Ga0068859_100434222 | Ga0068859_1004342221 | 291 |
| 370 | 3300005719 | Ga0068861_100005129 | Ga0068861_10000512912 | 291 |
| 371 | 3300005843 | Ga0068860_100007353 | Ga0068860_10000735311 | 291 |
| 372 | 3300006881 | Ga0068865_100009177 | Ga0068865_1000091777 | 291 |
| 373 | 3300006931 | Ga0097620_100434208 | Ga0097620_1004342082 | 291 |
| 374 | 3300009176 | Ga0105242_10413550 | Ga0105242_104135501 | 291 |
| 375 | 3300009553 | Ga0105249_10101318 | Ga0105249_101013183 | 291 |
| 376 | 3300013306 | Ga0163162_10001712 | Ga0163162_1000171216 | 291 |
| 377 | 3300025893 | Ga0207682_10046526 | Ga0207682_100465261 | 291 |
| 378 | 3300025938 | Ga0207704_10021737 | Ga0207704_100217372 | 291 |
| 379 | 3300026075 | Ga0207708_10017645 | Ga0207708_100176457 | 291 |
| 380 | 3300028380 | Ga0268265_10044130 | Ga0268265_100441302 | 291 |
| 381 | 3300028381 | Ga0268264_10016355 | Ga0268264_100163552 | 291 |
| 382 | 3300049574 | Ga0501038_0263661 | Ga0501038_0263661_378_1274 | 291 |
| 383 | 3300049592 | Ga0501076_0032788 | Ga0501076_0032788_105_1001 | 291 |
| 384 | 3300060353 | Ga0501082_0168319 | Ga0501082_0168319_762_1658 | 291 |
| 385 | 3300013104 | Ga0157370_10418514 | Ga0157370_104185142 | 292 |
| 386 | 3300031250 | Ga0265331_10024550 | Ga0265331_100245503 | 292 |
| 387 | 3300033179 | Ga0307507_10033714 | Ga0307507_100337147 | 292 |
| 388 | 3300035692 | Ga0373935_0070502 | Ga0373935_0070502_557_1453 | 292 |
| 389 | 3300037068 | Ga0373925_0049942 | Ga0373925_0049942_754_1650 | 292 |
| 390 | 3300053094 | Ga0500566_0099399 | Ga0500566_0099399_432_1328 | 292 |
| 391 | 3300053178 | Ga0500637_0068220 | Ga0500637_0068220_868_1764 | 292 |
| 392 | 3300005337 | Ga0070682_100049722 | Ga0070682_1000497223 | 293 |
| 393 | 3300005458 | Ga0070681_10144278 | Ga0070681_101442782 | 293 |
| 394 | 3300006358 | Ga0068871_100046138 | Ga0068871_1000461384 | 293 |
| 395 | 3300009174 | Ga0105241_10039823 | Ga0105241_100398232 | 293 |
| 396 | 3300013308 | Ga0157375_10014793 | Ga0157375_100147936 | 293 |
| 397 | 3300025911 | Ga0207654_10124524 | Ga0207654_101245242 | 293 |
| 398 | iso_pu_bacteria | 2643221603 | 2644029199 | 294 |
| 399 | iso_pu_bacteria | 2791355199 | 2793081329 | 294 |
| 400 | iso_pu_bacteria | 2842733646 | 2842737135 | 294 |
| 401 | iso_pu_bacteria | 2842747753 | 2842750383 | 294 |
| 402 | iso_pu_bacteria | 2876808645 | 2876817061 | 294 |
| 403 | iso_pu_bacteria | 2879110137 | 2879117554 | 294 |
| 404 | iso_pu_bacteria | 2885192300 | 2885193348 | 294 |
| 405 | iso_pu_bacteria | 2889033259 | 2889042269 | 294 |
| 406 | iso_pu_bacteria | 8006964411 | 8006968185 | 294 |
| 407 | iso_pu_bacteria | 8006984368 | 8006985451 | 294 |
| 408 | 3300005327 | Ga0070658_10084120 | Ga0070658_100841202 | 295 |
| 409 | 3300005336 | Ga0070680_100271745 | Ga0070680_1002717452 | 295 |
| 410 | 3300005339 | Ga0070660_100003956 | Ga0070660_1000039565 | 295 |
| 411 | 3300005530 | Ga0070679_100005441 | Ga0070679_10000544111 | 295 |
| 412 | 3300005563 | Ga0068855_100012729 | Ga0068855_1000127295 | 295 |
| 413 | 3300005614 | Ga0068856_100444505 | Ga0068856_1004445052 | 295 |
| 414 | 3300009093 | Ga0105240_10036890 | Ga0105240_100368907 | 295 |
| 415 | 3300009551 | Ga0105238_10050623 | Ga0105238_100506235 | 295 |
| 416 | 3300025909 | Ga0207705_10176951 | Ga0207705_101769512 | 295 |
| 417 | 3300025913 | Ga0207695_10047693 | Ga0207695_100476932 | 295 |
| 418 | 3300025919 | Ga0207657_10029442 | Ga0207657_100294423 | 295 |
| 419 | 3300025921 | Ga0207652_10073660 | Ga0207652_100736602 | 295 |
| 420 | 3300025949 | Ga0207667_10214918 | Ga0207667_102149182 | 295 |
| 421 | 3300026078 | Ga0207702_10372221 | Ga0207702_103722212 | 295 |
| 422 | 3300035089 | Ga0373944_0027834 | Ga0373944_0027834_723_1610 | 295 |
| 423 | 3300035695 | Ga0373927_0062712 | Ga0373927_0062712_756_1643 | 295 |
| 424 | 3300037068 | Ga0373925_0002569 | Ga0373925_0002569_7343_8230 | 295 |
| 425 | 3300049765 | Ga0501268_027319 | Ga0501268_027319_88_975 | 295 |
| 426 | 3300006846 | Ga0075430_100009372 | Ga0075430_1000093724 | 296 |
| 427 | 3300006846 | Ga0075430_100037653 | Ga0075430_1000376532 | 296 |
| 428 | 3300006880 | Ga0075429_100002916 | Ga0075429_1000029162 | 296 |
| 429 | 3300006880 | Ga0075429_100056334 | Ga0075429_1000563342 | 296 |
| 430 | 3300050509 | nmdc:mga0qj67_3746_c1 | nmdc:mga0qj67_3746_c1_2558_3463 | 296 |
| 431 | iso_pu_bacteria | 2885366525 | 2885373920 | 297 |
| 432 | 3300002070 | JGI24750J21931_1004067 | JGI24750J21931_10040672 | 298 |
| 433 | 3300003323 | rootH1_10104906 | rootH1_101049063 | 298 |
| 434 | 3300003659 | JGI25404J52841_10004946 | JGI25404J52841_100049462 | 298 |
| 435 | 3300003659 | JGI25404J52841_10006150 | JGI25404J52841_100061503 | 298 |
| 436 | 3300003659 | JGI25404J52841_10008111 | JGI25404J52841_100081112 | 298 |
| 437 | 3300005328 | Ga0070676_10022298 | Ga0070676_100222982 | 298 |
| 438 | 3300005328 | Ga0070676_10045892 | Ga0070676_100458922 | 298 |
| 439 | 3300005329 | Ga0070683_100007447 | Ga0070683_1000074475 | 298 |
| 440 | 3300005329 | Ga0070683_100021476 | Ga0070683_1000214765 | 298 |
| 441 | 3300005329 | Ga0070683_100168615 | Ga0070683_1001686152 | 298 |
| 442 | 3300005330 | Ga0070690_100000399 | Ga0070690_1000003993 | 298 |
| 443 | 3300005330 | Ga0070690_100117188 | Ga0070690_1001171881 | 298 |
| 444 | 3300005331 | Ga0070670_100030097 | Ga0070670_1000300972 | 298 |
| 445 | 3300005331 | Ga0070670_100055450 | Ga0070670_1000554504 | 298 |
| 446 | 3300005333 | Ga0070677_10049495 | Ga0070677_100494952 | 298 |
| 447 | 3300005334 | Ga0068869_100003219 | Ga0068869_1000032197 | 298 |
| 448 | 3300005334 | Ga0068869_100006651 | Ga0068869_1000066519 | 298 |
| 449 | 3300005334 | Ga0068869_100026483 | Ga0068869_1000264833 | 298 |
| 450 | 3300005335 | Ga0070666_10204326 | Ga0070666_102043262 | 298 |
| 451 | 3300005336 | Ga0070680_100021711 | Ga0070680_1000217112 | 298 |
| 452 | 3300005336 | Ga0070680_100044919 | Ga0070680_1000449193 | 298 |
| 453 | 3300005337 | Ga0070682_100158271 | Ga0070682_1001582712 | 298 |
| 454 | 3300005338 | Ga0068868_100199466 | Ga0068868_1001994662 | 298 |
| 455 | 3300005338 | Ga0068868_100223016 | Ga0068868_1002230161 | 298 |
| 456 | 3300005338 | Ga0068868_100238981 | Ga0068868_1002389812 | 298 |
| 457 | 3300005339 | Ga0070660_100321134 | Ga0070660_1003211342 | 298 |
| 458 | 3300005340 | Ga0070689_100004701 | Ga0070689_1000047016 | 298 |
| 459 | 3300005340 | Ga0070689_100021719 | Ga0070689_1000217192 | 298 |
| 460 | 3300005341 | Ga0070691_10006502 | Ga0070691_100065023 | 298 |
| 461 | 3300005343 | Ga0070687_100127302 | Ga0070687_1001273022 | 298 |
| 462 | 3300005343 | Ga0070687_100128137 | Ga0070687_1001281372 | 298 |
| 463 | 3300005344 | Ga0070661_100082837 | Ga0070661_1000828373 | 298 |
| 464 | 3300005345 | Ga0070692_10008809 | Ga0070692_100088096 | 298 |
| 465 | 3300005345 | Ga0070692_10013225 | Ga0070692_100132253 | 298 |
| 466 | 3300005345 | Ga0070692_10081406 | Ga0070692_100814062 | 298 |
| 467 | 3300005347 | Ga0070668_100023686 | Ga0070668_1000236865 | 298 |
| 468 | 3300005347 | Ga0070668_100025239 | Ga0070668_1000252395 | 298 |
| 469 | 3300005347 | Ga0070668_100031806 | Ga0070668_1000318064 | 298 |
| 470 | 3300005347 | Ga0070668_100216582 | Ga0070668_1002165822 | 298 |
| 471 | 3300005353 | Ga0070669_100007163 | Ga0070669_1000071638 | 298 |
| 472 | 3300005353 | Ga0070669_100097613 | Ga0070669_1000976132 | 298 |
| 473 | 3300005353 | Ga0070669_100101253 | Ga0070669_1001012532 | 298 |
| 474 | 3300005353 | Ga0070669_100266355 | Ga0070669_1002663552 | 298 |
| 475 | 3300005353 | Ga0070669_100289500 | Ga0070669_1002895002 | 298 |
| 476 | 3300005354 | Ga0070675_100041355 | Ga0070675_1000413552 | 298 |
| 477 | 3300005354 | Ga0070675_100042797 | Ga0070675_1000427973 | 298 |
| 478 | 3300005354 | Ga0070675_100267858 | Ga0070675_1002678582 | 298 |
| 479 | 3300005355 | Ga0070671_100012832 | Ga0070671_1000128327 | 298 |
| 480 | 3300005355 | Ga0070671_100021121 | Ga0070671_1000211212 | 298 |
| 481 | 3300005355 | Ga0070671_100096376 | Ga0070671_1000963762 | 298 |
| 482 | 3300005356 | Ga0070674_100095783 | Ga0070674_1000957832 | 298 |
| 483 | 3300005364 | Ga0070673_100285571 | Ga0070673_1002855712 | 298 |
| 484 | 3300005364 | Ga0070673_100406033 | Ga0070673_1004060331 | 298 |
| 485 | 3300005364 | Ga0070673_100434033 | Ga0070673_1004340332 | 298 |
| 486 | 3300005365 | Ga0070688_100149275 | Ga0070688_1001492752 | 298 |
| 487 | 3300005365 | Ga0070688_100151470 | Ga0070688_1001514702 | 298 |
| 488 | 3300005366 | Ga0070659_100009066 | Ga0070659_1000090663 | 298 |
| 489 | 3300005366 | Ga0070659_100063230 | Ga0070659_1000632303 | 298 |
| 490 | 3300005434 | Ga0070709_10167893 | Ga0070709_101678931 | 298 |
| 491 | 3300005435 | Ga0070714_100082979 | Ga0070714_1000829792 | 298 |
| 492 | 3300005436 | Ga0070713_100018535 | Ga0070713_1000185354 | 298 |
| 493 | 3300005437 | Ga0070710_10025349 | Ga0070710_100253493 | 298 |
| 494 | 3300005438 | Ga0070701_10000752 | Ga0070701_100007527 | 298 |
| 495 | 3300005438 | Ga0070701_10111869 | Ga0070701_101118692 | 298 |
| 496 | 3300005440 | Ga0070705_100007429 | Ga0070705_1000074295 | 298 |
| 497 | 3300005440 | Ga0070705_100058565 | Ga0070705_1000585651 | 298 |
| 498 | 3300005440 | Ga0070705_100278045 | Ga0070705_1002780451 | 298 |
| 499 | 3300005441 | Ga0070700_100000925 | Ga0070700_10000092510 | 298 |
| 500 | 3300005441 | Ga0070700_100131998 | Ga0070700_1001319982 | 298 |
| 501 | 3300005444 | Ga0070694_100025958 | Ga0070694_1000259582 | 298 |
| 502 | 3300005445 | Ga0070708_100199227 | Ga0070708_1001992271 | 298 |
| 503 | 3300005455 | Ga0070663_100046461 | Ga0070663_1000464612 | 298 |
| 504 | 3300005455 | Ga0070663_100049930 | Ga0070663_1000499303 | 298 |
| 505 | 3300005455 | Ga0070663_100100390 | Ga0070663_1001003901 | 298 |
| 506 | 3300005455 | Ga0070663_100124743 | Ga0070663_1001247432 | 298 |
| 507 | 3300005455 | Ga0070663_100307727 | Ga0070663_1003077271 | 298 |
| 508 | 3300005456 | Ga0070678_100007403 | Ga0070678_1000074035 | 298 |
| 509 | 3300005456 | Ga0070678_100037245 | Ga0070678_1000372452 | 298 |
| 510 | 3300005456 | Ga0070678_100057699 | Ga0070678_1000576992 | 298 |
| 511 | 3300005456 | Ga0070678_100092852 | Ga0070678_1000928522 | 298 |
| 512 | 3300005458 | Ga0070681_10018365 | Ga0070681_100183654 | 298 |
| 513 | 3300005458 | Ga0070681_10070398 | Ga0070681_100703984 | 298 |
| 514 | 3300005458 | Ga0070681_10211631 | Ga0070681_102116312 | 298 |
| 515 | 3300005459 | Ga0068867_100089100 | Ga0068867_1000891002 | 298 |
| 516 | 3300005459 | Ga0068867_100099061 | Ga0068867_1000990612 | 298 |
| 517 | 3300005459 | Ga0068867_100273901 | Ga0068867_1002739012 | 298 |
| 518 | 3300005466 | Ga0070685_10015529 | Ga0070685_100155292 | 298 |
| 519 | 3300005466 | Ga0070685_10137422 | Ga0070685_101374221 | 298 |
| 520 | 3300005467 | Ga0070706_100516414 | Ga0070706_1005164141 | 298 |
| 521 | 3300005468 | Ga0070707_100341436 | Ga0070707_1003414362 | 298 |
| 522 | 3300005468 | Ga0070707_100422316 | Ga0070707_1004223161 | 298 |
| 523 | 3300005518 | Ga0070699_100000906 | Ga0070699_10000090616 | 298 |
| 524 | 3300005518 | Ga0070699_100023230 | Ga0070699_1000232304 | 298 |
| 525 | 3300005518 | Ga0070699_100305293 | Ga0070699_1003052932 | 298 |
| 526 | 3300005530 | Ga0070679_100015823 | Ga0070679_1000158234 | 298 |
| 527 | 3300005530 | Ga0070679_100024448 | Ga0070679_1000244482 | 298 |
| 528 | 3300005530 | Ga0070679_100184090 | Ga0070679_1001840902 | 298 |
| 529 | 3300005530 | Ga0070679_100238268 | Ga0070679_1002382682 | 298 |
| 530 | 3300005535 | Ga0070684_100007885 | Ga0070684_1000078855 | 298 |
| 531 | 3300005536 | Ga0070697_100005574 | Ga0070697_1000055743 | 298 |
| 532 | 3300005536 | Ga0070697_100070715 | Ga0070697_1000707152 | 298 |
| 533 | 3300005539 | Ga0068853_100026014 | Ga0068853_1000260142 | 298 |
| 534 | 3300005539 | Ga0068853_100139481 | Ga0068853_1001394812 | 298 |
| 535 | 3300005543 | Ga0070672_100055373 | Ga0070672_1000553732 | 298 |
| 536 | 3300005543 | Ga0070672_100061105 | Ga0070672_1000611052 | 298 |
| 537 | 3300005543 | Ga0070672_100251519 | Ga0070672_1002515192 | 298 |
| 538 | 3300005544 | Ga0070686_100000177 | Ga0070686_10000017720 | 298 |
| 539 | 3300005545 | Ga0070695_100047657 | Ga0070695_1000476572 | 298 |
| 540 | 3300005546 | Ga0070696_100054698 | Ga0070696_1000546982 | 298 |
| 541 | 3300005547 | Ga0070693_100043604 | Ga0070693_1000436042 | 298 |
| 542 | 3300005547 | Ga0070693_100094607 | Ga0070693_1000946072 | 298 |
| 543 | 3300005548 | Ga0070665_100007828 | Ga0070665_1000078283 | 298 |
| 544 | 3300005548 | Ga0070665_100148762 | Ga0070665_1001487622 | 298 |
| 545 | 3300005548 | Ga0070665_100164423 | Ga0070665_1001644232 | 298 |
| 546 | 3300005548 | Ga0070665_100471820 | Ga0070665_1004718202 | 298 |
| 547 | 3300005549 | Ga0070704_100037598 | Ga0070704_1000375982 | 298 |
| 548 | 3300005563 | Ga0068855_100064508 | Ga0068855_1000645082 | 298 |
| 549 | 3300005563 | Ga0068855_100100124 | Ga0068855_1001001244 | 298 |
| 550 | 3300005563 | Ga0068855_100348945 | Ga0068855_1003489452 | 298 |
| 551 | 3300005564 | Ga0070664_100118640 | Ga0070664_1001186402 | 298 |
| 552 | 3300005564 | Ga0070664_100163670 | Ga0070664_1001636702 | 298 |
| 553 | 3300005577 | Ga0068857_100006104 | Ga0068857_1000061045 | 298 |
| 554 | 3300005577 | Ga0068857_100029484 | Ga0068857_1000294842 | 298 |
| 555 | 3300005614 | Ga0068856_100037984 | Ga0068856_1000379844 | 298 |
| 556 | 3300005614 | Ga0068856_100063577 | Ga0068856_1000635775 | 298 |
| 557 | 3300005615 | Ga0070702_100000094 | Ga0070702_1000000946 | 298 |
| 558 | 3300005615 | Ga0070702_100211269 | Ga0070702_1002112691 | 298 |
| 559 | 3300005616 | Ga0068852_100120955 | Ga0068852_1001209552 | 298 |
| 560 | 3300005617 | Ga0068859_100003487 | Ga0068859_10000348715 | 298 |
| 561 | 3300005617 | Ga0068859_100052149 | Ga0068859_1000521495 | 298 |
| 562 | 3300005617 | Ga0068859_100132092 | Ga0068859_1001320922 | 298 |
| 563 | 3300005617 | Ga0068859_100422291 | Ga0068859_1004222912 | 298 |
| 564 | 3300005618 | Ga0068864_100043158 | Ga0068864_1000431582 | 298 |
| 565 | 3300005618 | Ga0068864_100163901 | Ga0068864_1001639012 | 298 |
| 566 | 3300005618 | Ga0068864_100585237 | Ga0068864_1005852371 | 298 |
| 567 | 3300005718 | Ga0068866_10002364 | Ga0068866_100023648 | 298 |
| 568 | 3300005718 | Ga0068866_10017758 | Ga0068866_100177581 | 298 |
| 569 | 3300005719 | Ga0068861_100000255 | Ga0068861_10000025516 | 298 |
| 570 | 3300005719 | Ga0068861_100067328 | Ga0068861_1000673282 | 298 |
| 571 | 3300005834 | Ga0068851_10004859 | Ga0068851_100048597 | 298 |
| 572 | 3300005840 | Ga0068870_10004257 | Ga0068870_100042572 | 298 |
| 573 | 3300005840 | Ga0068870_10135986 | Ga0068870_101359862 | 298 |
| 574 | 3300005840 | Ga0068870_10146502 | Ga0068870_101465022 | 298 |
| 575 | 3300005841 | Ga0068863_100139191 | Ga0068863_1001391912 | 298 |
| 576 | 3300005841 | Ga0068863_100251345 | Ga0068863_1002513451 | 298 |
| 577 | 3300005842 | Ga0068858_100001789 | Ga0068858_10000178917 | 298 |
| 578 | 3300005842 | Ga0068858_100080687 | Ga0068858_1000806871 | 298 |
| 579 | 3300005842 | Ga0068858_100406802 | Ga0068858_1004068021 | 298 |
| 580 | 3300005843 | Ga0068860_100000302 | Ga0068860_10000030210 | 298 |
| 581 | 3300005843 | Ga0068860_100003206 | Ga0068860_1000032062 | 298 |
| 582 | 3300005843 | Ga0068860_100006654 | Ga0068860_10000665413 | 298 |
| 583 | 3300005843 | Ga0068860_100008918 | Ga0068860_1000089187 | 298 |
| 584 | 3300005844 | Ga0068862_100007694 | Ga0068862_1000076945 | 298 |
| 585 | 3300005844 | Ga0068862_100014806 | Ga0068862_1000148066 | 298 |
| 586 | 3300005844 | Ga0068862_100021668 | Ga0068862_1000216685 | 298 |
| 587 | 3300005844 | Ga0068862_100193274 | Ga0068862_1001932741 | 298 |
| 588 | 3300005937 | Ga0081455_10000968 | Ga0081455_100009684 | 298 |
| 589 | 3300005937 | Ga0081455_10001667 | Ga0081455_1000166716 | 298 |
| 590 | 3300005937 | Ga0081455_10008173 | Ga0081455_100081738 | 298 |
| 591 | 3300005937 | Ga0081455_10155344 | Ga0081455_101553442 | 298 |
| 592 | 3300005937 | Ga0081455_10318319 | Ga0081455_103183192 | 298 |
| 593 | 3300005981 | Ga0081538_10032479 | Ga0081538_100324794 | 298 |
| 594 | 3300005983 | Ga0081540_1000918 | Ga0081540_10009188 | 298 |
| 595 | 3300005983 | Ga0081540_1002732 | Ga0081540_10027328 | 298 |
| 596 | 3300005983 | Ga0081540_1002906 | Ga0081540_100290612 | 298 |
| 597 | 3300005983 | Ga0081540_1006154 | Ga0081540_10061542 | 298 |
| 598 | 3300005983 | Ga0081540_1006733 | Ga0081540_10067332 | 298 |
| 599 | 3300005983 | Ga0081540_1010879 | Ga0081540_10108794 | 298 |
| 600 | 3300005983 | Ga0081540_1028665 | Ga0081540_10286652 | 298 |
| 601 | 3300005985 | Ga0081539_10000003 | Ga0081539_10000003154 | 298 |
| 602 | 3300005985 | Ga0081539_10000584 | Ga0081539_100005843 | 298 |
| 603 | 3300005985 | Ga0081539_10027501 | Ga0081539_100275013 | 298 |
| 604 | 3300006028 | Ga0070717_10012536 | Ga0070717_100125362 | 298 |
| 605 | 3300006038 | Ga0075365_10032976 | Ga0075365_100329762 | 298 |
| 606 | 3300006038 | Ga0075365_10064463 | Ga0075365_100644632 | 298 |
| 607 | 3300006038 | Ga0075365_10246597 | Ga0075365_102465972 | 298 |
| 608 | 3300006042 | Ga0075368_10007386 | Ga0075368_100073864 | 298 |
| 609 | 3300006048 | Ga0075363_100015561 | Ga0075363_1000155612 | 298 |
| 610 | 3300006048 | Ga0075363_100018197 | Ga0075363_1000181973 | 298 |
| 611 | 3300006175 | Ga0070712_100001605 | Ga0070712_1000016059 | 298 |
| 612 | 3300006175 | Ga0070712_100009301 | Ga0070712_1000093014 | 298 |
| 613 | 3300006177 | Ga0075362_10136798 | Ga0075362_101367982 | 298 |
| 614 | 3300006178 | Ga0075367_10048909 | Ga0075367_100489092 | 298 |
| 615 | 3300006186 | Ga0075369_10005272 | Ga0075369_100052724 | 298 |
| 616 | 3300006195 | Ga0075366_10009755 | Ga0075366_100097553 | 298 |
| 617 | 3300006195 | Ga0075366_10123714 | Ga0075366_101237142 | 298 |
| 618 | 3300006237 | Ga0097621_100028036 | Ga0097621_1000280362 | 298 |
| 619 | 3300006237 | Ga0097621_100097681 | Ga0097621_1000976812 | 298 |
| 620 | 3300006237 | Ga0097621_100274093 | Ga0097621_1002740932 | 298 |
| 621 | 3300006353 | Ga0075370_10004796 | Ga0075370_100047966 | 298 |
| 622 | 3300006353 | Ga0075370_10062814 | Ga0075370_100628142 | 298 |
| 623 | 3300006353 | Ga0075370_10125906 | Ga0075370_101259062 | 298 |
| 624 | 3300006358 | Ga0068871_100007550 | Ga0068871_1000075503 | 298 |
| 625 | 3300006358 | Ga0068871_100304888 | Ga0068871_1003048881 | 298 |
| 626 | 3300006844 | Ga0075428_100066041 | Ga0075428_1000660412 | 298 |
| 627 | 3300006844 | Ga0075428_100482384 | Ga0075428_1004823842 | 298 |
| 628 | 3300006846 | Ga0075430_100206074 | Ga0075430_1002060742 | 298 |
| 629 | 3300006847 | Ga0075431_100219242 | Ga0075431_1002192422 | 298 |
| 630 | 3300006871 | Ga0075434_100011947 | Ga0075434_1000119473 | 298 |
| 631 | 3300006871 | Ga0075434_100373067 | Ga0075434_1003730672 | 298 |
| 632 | 3300006881 | Ga0068865_100000317 | Ga0068865_10000031720 | 298 |
| 633 | 3300006881 | Ga0068865_100008577 | Ga0068865_1000085772 | 298 |
| 634 | 3300006881 | Ga0068865_100058984 | Ga0068865_1000589842 | 298 |
| 635 | 3300006881 | Ga0068865_100112089 | Ga0068865_1001120892 | 298 |
| 636 | 3300006881 | Ga0068865_100277349 | Ga0068865_1002773492 | 298 |
| 637 | 3300006931 | Ga0097620_100003487 | Ga0097620_10000348715 | 298 |
| 638 | 3300006931 | Ga0097620_100052151 | Ga0097620_1000521515 | 298 |
| 639 | 3300006931 | Ga0097620_100132099 | Ga0097620_1001320992 | 298 |
| 640 | 3300006931 | Ga0097620_100422278 | Ga0097620_1004222782 | 298 |
| 641 | 3300007076 | Ga0075435_100037025 | Ga0075435_1000370252 | 298 |
| 642 | 3300007076 | Ga0075435_100470637 | Ga0075435_1004706371 | 298 |
| 643 | 3300007265 | Ga0099794_10057663 | Ga0099794_100576632 | 298 |
| 644 | 3300009093 | Ga0105240_10019274 | Ga0105240_100192741 | 298 |
| 645 | 3300009093 | Ga0105240_10121831 | Ga0105240_101218312 | 298 |
| 646 | 3300009093 | Ga0105240_10155110 | Ga0105240_101551102 | 298 |
| 647 | 3300009094 | Ga0111539_10125112 | Ga0111539_101251122 | 298 |
| 648 | 3300009094 | Ga0111539_10303506 | Ga0111539_103035062 | 298 |
| 649 | 3300009094 | Ga0111539_10541322 | Ga0111539_105413222 | 298 |
| 650 | 3300009098 | Ga0105245_10000323 | Ga0105245_1000032325 | 298 |
| 651 | 3300009098 | Ga0105245_10158197 | Ga0105245_101581972 | 298 |
| 652 | 3300009098 | Ga0105245_10363627 | Ga0105245_103636272 | 298 |
| 653 | 3300009101 | Ga0105247_10116428 | Ga0105247_101164281 | 298 |
| 654 | 3300009101 | Ga0105247_10255586 | Ga0105247_102555861 | 298 |
| 655 | 3300009147 | Ga0114129_10245029 | Ga0114129_102450292 | 298 |
| 656 | 3300009148 | Ga0105243_10004705 | Ga0105243_1000470510 | 298 |
| 657 | 3300009148 | Ga0105243_10045697 | Ga0105243_100456974 | 298 |
| 658 | 3300009148 | Ga0105243_10238117 | Ga0105243_102381172 | 298 |
| 659 | 3300009148 | Ga0105243_10307624 | Ga0105243_103076242 | 298 |
| 660 | 3300009174 | Ga0105241_10009325 | Ga0105241_100093255 | 298 |
| 661 | 3300009174 | Ga0105241_10125477 | Ga0105241_101254772 | 298 |
| 662 | 3300009176 | Ga0105242_10000119 | Ga0105242_1000011925 | 298 |
| 663 | 3300009176 | Ga0105242_10196837 | Ga0105242_101968371 | 298 |
| 664 | 3300009176 | Ga0105242_10262622 | Ga0105242_102626222 | 298 |
| 665 | 3300009177 | Ga0105248_10006375 | Ga0105248_1000637511 | 298 |
| 666 | 3300009177 | Ga0105248_10007036 | Ga0105248_100070367 | 298 |
| 667 | 3300009177 | Ga0105248_10179018 | Ga0105248_101790182 | 298 |
| 668 | 3300009177 | Ga0105248_10198013 | Ga0105248_101980132 | 298 |
| 669 | 3300009545 | Ga0105237_10002097 | Ga0105237_100020973 | 298 |
| 670 | 3300009545 | Ga0105237_10007055 | Ga0105237_100070553 | 298 |
| 671 | 3300009545 | Ga0105237_10092735 | Ga0105237_100927351 | 298 |
| 672 | 3300009545 | Ga0105237_10190859 | Ga0105237_101908591 | 298 |
| 673 | 3300009545 | Ga0105237_10380563 | Ga0105237_103805632 | 298 |
| 674 | 3300009551 | Ga0105238_10040046 | Ga0105238_100400464 | 298 |
| 675 | 3300009551 | Ga0105238_10116126 | Ga0105238_101161263 | 298 |
| 676 | 3300009551 | Ga0105238_10122535 | Ga0105238_101225352 | 298 |
| 677 | 3300009553 | Ga0105249_10046861 | Ga0105249_100468612 | 298 |
| 678 | 3300010375 | Ga0105239_10026973 | Ga0105239_100269737 | 298 |
| 679 | 3300010375 | Ga0105239_10036659 | Ga0105239_100366591 | 298 |
| 680 | 3300010375 | Ga0105239_10042969 | Ga0105239_100429694 | 298 |
| 681 | 3300010375 | Ga0105239_10060691 | Ga0105239_100606914 | 298 |
| 682 | 3300010375 | Ga0105239_10372036 | Ga0105239_103720362 | 298 |
| 683 | 3300011119 | Ga0105246_10003792 | Ga0105246_100037924 | 298 |
| 684 | 3300011119 | Ga0105246_10093953 | Ga0105246_100939532 | 298 |
| 685 | 3300011119 | Ga0105246_10104278 | Ga0105246_101042782 | 298 |
| 686 | 3300013104 | Ga0157370_10202684 | Ga0157370_102026842 | 298 |
| 687 | 3300013104 | Ga0157370_10234242 | Ga0157370_102342422 | 298 |
| 688 | 3300013105 | Ga0157369_10010807 | Ga0157369_1001080710 | 298 |
| 689 | 3300013296 | Ga0157374_10073380 | Ga0157374_100733802 | 298 |
| 690 | 3300013296 | Ga0157374_10216405 | Ga0157374_102164052 | 298 |
| 691 | 3300013296 | Ga0157374_10293938 | Ga0157374_102939382 | 298 |
| 692 | 3300013297 | Ga0157378_10004288 | Ga0157378_100042882 | 298 |
| 693 | 3300013306 | Ga0163162_10011141 | Ga0163162_100111412 | 298 |
| 694 | 3300013306 | Ga0163162_10102512 | Ga0163162_101025122 | 298 |
| 695 | 3300013306 | Ga0163162_10333118 | Ga0163162_103331182 | 298 |
| 696 | 3300013306 | Ga0163162_10377368 | Ga0163162_103773681 | 298 |
| 697 | 3300013308 | Ga0157375_10102445 | Ga0157375_101024452 | 298 |
| 698 | 3300013308 | Ga0157375_10113225 | Ga0157375_101132251 | 298 |
| 699 | 3300013308 | Ga0157375_10242881 | Ga0157375_102428812 | 298 |
| 700 | 3300014325 | Ga0163163_10009357 | Ga0163163_100093578 | 298 |
| 701 | 3300014326 | Ga0157380_10001047 | Ga0157380_100010472 | 298 |
| 702 | 3300014326 | Ga0157380_10020930 | Ga0157380_100209305 | 298 |
| 703 | 3300014326 | Ga0157380_10103136 | Ga0157380_101031362 | 298 |
| 704 | 3300014326 | Ga0157380_10117387 | Ga0157380_101173872 | 298 |
| 705 | 3300014326 | Ga0157380_10208896 | Ga0157380_102088962 | 298 |
| 706 | 3300014745 | Ga0157377_10091774 | Ga0157377_100917742 | 298 |
| 707 | 3300014745 | Ga0157377_10178989 | Ga0157377_101789892 | 298 |
| 708 | 3300014968 | Ga0157379_10029784 | Ga0157379_100297843 | 298 |
| 709 | 3300014968 | Ga0157379_10049919 | Ga0157379_100499192 | 298 |
| 710 | 3300014969 | Ga0157376_10106888 | Ga0157376_101068882 | 298 |
| 711 | 3300017792 | Ga0163161_10017226 | Ga0163161_100172265 | 298 |
| 712 | 3300017792 | Ga0163161_10091129 | Ga0163161_100911292 | 298 |
| 713 | 3300017792 | Ga0163161_10112784 | Ga0163161_101127842 | 298 |
| 714 | 3300017792 | Ga0163161_10124455 | Ga0163161_101244552 | 298 |
| 715 | 3300020070 | Ga0206356_11210809 | Ga0206356_112108091 | 298 |
| 716 | 3300025297 | Ga0209758_1033890 | Ga0209758_10338902 | 298 |
| 717 | 3300025893 | Ga0207682_10019898 | Ga0207682_100198982 | 298 |
| 718 | 3300025893 | Ga0207682_10035323 | Ga0207682_100353232 | 298 |
| 719 | 3300025898 | Ga0207692_10018759 | Ga0207692_100187593 | 298 |
| 720 | 3300025899 | Ga0207642_10003256 | Ga0207642_100032562 | 298 |
| 721 | 3300025899 | Ga0207642_10051002 | Ga0207642_100510022 | 298 |
| 722 | 3300025901 | Ga0207688_10011915 | Ga0207688_100119153 | 298 |
| 723 | 3300025901 | Ga0207688_10017227 | Ga0207688_100172272 | 298 |
| 724 | 3300025901 | Ga0207688_10162648 | Ga0207688_101626482 | 298 |
| 725 | 3300025901 | Ga0207688_10191417 | Ga0207688_101914172 | 298 |
| 726 | 3300025903 | Ga0207680_10075576 | Ga0207680_100755762 | 298 |
| 727 | 3300025903 | Ga0207680_10289196 | Ga0207680_102891961 | 298 |
| 728 | 3300025904 | Ga0207647_10110360 | Ga0207647_101103602 | 298 |
| 729 | 3300025906 | Ga0207699_10071132 | Ga0207699_100711322 | 298 |
| 730 | 3300025907 | Ga0207645_10005151 | Ga0207645_100051517 | 298 |
| 731 | 3300025907 | Ga0207645_10051548 | Ga0207645_100515482 | 298 |
| 732 | 3300025908 | Ga0207643_10002576 | Ga0207643_1000257610 | 298 |
| 733 | 3300025908 | Ga0207643_10066324 | Ga0207643_100663242 | 298 |
| 734 | 3300025909 | Ga0207705_10263041 | Ga0207705_102630412 | 298 |
| 735 | 3300025910 | Ga0207684_10367900 | Ga0207684_103679001 | 298 |
| 736 | 3300025911 | Ga0207654_10060678 | Ga0207654_100606782 | 298 |
| 737 | 3300025912 | Ga0207707_10005157 | Ga0207707_100051576 | 298 |
| 738 | 3300025912 | Ga0207707_10143731 | Ga0207707_101437312 | 298 |
| 739 | 3300025913 | Ga0207695_10210322 | Ga0207695_102103222 | 298 |
| 740 | 3300025914 | Ga0207671_10010943 | Ga0207671_100109432 | 298 |
| 741 | 3300025914 | Ga0207671_10143186 | Ga0207671_101431862 | 298 |
| 742 | 3300025914 | Ga0207671_10185346 | Ga0207671_101853461 | 298 |
| 743 | 3300025915 | Ga0207693_10002797 | Ga0207693_100027978 | 298 |
| 744 | 3300025915 | Ga0207693_10008767 | Ga0207693_100087674 | 298 |
| 745 | 3300025917 | Ga0207660_10008675 | Ga0207660_100086756 | 298 |
| 746 | 3300025917 | Ga0207660_10023568 | Ga0207660_100235683 | 298 |
| 747 | 3300025918 | Ga0207662_10078419 | Ga0207662_100784192 | 298 |
| 748 | 3300025918 | Ga0207662_10200822 | Ga0207662_102008222 | 298 |
| 749 | 3300025919 | Ga0207657_10002580 | Ga0207657_1000258013 | 298 |
| 750 | 3300025919 | Ga0207657_10197162 | Ga0207657_101971622 | 298 |
| 751 | 3300025920 | Ga0207649_10022375 | Ga0207649_100223752 | 298 |
| 752 | 3300025921 | Ga0207652_10018208 | Ga0207652_100182086 | 298 |
| 753 | 3300025921 | Ga0207652_10056860 | Ga0207652_100568604 | 298 |
| 754 | 3300025922 | Ga0207646_10378165 | Ga0207646_103781651 | 298 |
| 755 | 3300025922 | Ga0207646_10411054 | Ga0207646_104110542 | 298 |
| 756 | 3300025923 | Ga0207681_10019750 | Ga0207681_100197505 | 298 |
| 757 | 3300025923 | Ga0207681_10223188 | Ga0207681_102231881 | 298 |
| 758 | 3300025923 | Ga0207681_10260967 | Ga0207681_102609672 | 298 |
| 759 | 3300025925 | Ga0207650_10091540 | Ga0207650_100915402 | 298 |
| 760 | 3300025926 | Ga0207659_10054332 | Ga0207659_100543322 | 298 |
| 761 | 3300025927 | Ga0207687_10003182 | Ga0207687_1000318211 | 298 |
| 762 | 3300025927 | Ga0207687_10052004 | Ga0207687_100520042 | 298 |
| 763 | 3300025928 | Ga0207700_10002090 | Ga0207700_100020905 | 298 |
| 764 | 3300025928 | Ga0207700_10049876 | Ga0207700_100498762 | 298 |
| 765 | 3300025929 | Ga0207664_10367695 | Ga0207664_103676951 | 298 |
| 766 | 3300025931 | Ga0207644_10004154 | Ga0207644_100041542 | 298 |
| 767 | 3300025931 | Ga0207644_10063836 | Ga0207644_100638362 | 298 |
| 768 | 3300025931 | Ga0207644_10085265 | Ga0207644_100852652 | 298 |
| 769 | 3300025934 | Ga0207686_10002522 | Ga0207686_100025221 | 298 |
| 770 | 3300025934 | Ga0207686_10089612 | Ga0207686_100896122 | 298 |
| 771 | 3300025935 | Ga0207709_10000932 | Ga0207709_100009326 | 298 |
| 772 | 3300025935 | Ga0207709_10191740 | Ga0207709_101917402 | 298 |
| 773 | 3300025936 | Ga0207670_10003858 | Ga0207670_100038583 | 298 |
| 774 | 3300025936 | Ga0207670_10046734 | Ga0207670_100467342 | 298 |
| 775 | 3300025937 | Ga0207669_10167365 | Ga0207669_101673652 | 298 |
| 776 | 3300025937 | Ga0207669_10365793 | Ga0207669_103657931 | 298 |
| 777 | 3300025938 | Ga0207704_10000268 | Ga0207704_1000026821 | 298 |
| 778 | 3300025938 | Ga0207704_10011098 | Ga0207704_100110983 | 298 |
| 779 | 3300025938 | Ga0207704_10050588 | Ga0207704_100505882 | 298 |
| 780 | 3300025938 | Ga0207704_10124838 | Ga0207704_101248382 | 298 |
| 781 | 3300025938 | Ga0207704_10158554 | Ga0207704_101585542 | 298 |
| 782 | 3300025939 | Ga0207665_10079155 | Ga0207665_100791552 | 298 |
| 783 | 3300025939 | Ga0207665_10150104 | Ga0207665_101501041 | 298 |
| 784 | 3300025940 | Ga0207691_10011760 | Ga0207691_100117602 | 298 |
| 785 | 3300025940 | Ga0207691_10114317 | Ga0207691_101143172 | 298 |
| 786 | 3300025940 | Ga0207691_10126097 | Ga0207691_101260971 | 298 |
| 787 | 3300025941 | Ga0207711_10022699 | Ga0207711_100226995 | 298 |
| 788 | 3300025941 | Ga0207711_10036602 | Ga0207711_100366022 | 298 |
| 789 | 3300025941 | Ga0207711_10200618 | Ga0207711_102006182 | 298 |
| 790 | 3300025942 | Ga0207689_10000159 | Ga0207689_1000015925 | 298 |
| 791 | 3300025942 | Ga0207689_10025106 | Ga0207689_100251064 | 298 |
| 792 | 3300025944 | Ga0207661_10007579 | Ga0207661_100075793 | 298 |
| 793 | 3300025944 | Ga0207661_10009807 | Ga0207661_100098072 | 298 |
| 794 | 3300025945 | Ga0207679_10053568 | Ga0207679_100535682 | 298 |
| 795 | 3300025945 | Ga0207679_10184057 | Ga0207679_101840572 | 298 |
| 796 | 3300025945 | Ga0207679_10434008 | Ga0207679_104340082 | 298 |
| 797 | 3300025949 | Ga0207667_10016840 | Ga0207667_100168402 | 298 |
| 798 | 3300025949 | Ga0207667_10064631 | Ga0207667_100646314 | 298 |
| 799 | 3300025949 | Ga0207667_10126841 | Ga0207667_101268412 | 298 |
| 800 | 3300025949 | Ga0207667_10484791 | Ga0207667_104847912 | 298 |
| 801 | 3300025960 | Ga0207651_10193878 | Ga0207651_101938782 | 298 |
| 802 | 3300025961 | Ga0207712_10040158 | Ga0207712_100401582 | 298 |
| 803 | 3300025961 | Ga0207712_10202287 | Ga0207712_102022872 | 298 |
| 804 | 3300025961 | Ga0207712_10420240 | Ga0207712_104202401 | 298 |
| 805 | 3300025981 | Ga0207640_10034460 | Ga0207640_100344603 | 298 |
| 806 | 3300025981 | Ga0207640_10250311 | Ga0207640_102503112 | 298 |
| 807 | 3300025986 | Ga0207658_10008973 | Ga0207658_100089736 | 298 |
| 808 | 3300025986 | Ga0207658_10021202 | Ga0207658_100212025 | 298 |
| 809 | 3300025986 | Ga0207658_10271354 | Ga0207658_102713542 | 298 |
| 810 | 3300026023 | Ga0207677_10041039 | Ga0207677_100410392 | 298 |
| 811 | 3300026035 | Ga0207703_10002699 | Ga0207703_1000269916 | 298 |
| 812 | 3300026035 | Ga0207703_10017959 | Ga0207703_100179595 | 298 |
| 813 | 3300026035 | Ga0207703_10144995 | Ga0207703_101449952 | 298 |
| 814 | 3300026035 | Ga0207703_10560275 | Ga0207703_105602751 | 298 |
| 815 | 3300026041 | Ga0207639_10042625 | Ga0207639_100426252 | 298 |
| 816 | 3300026041 | Ga0207639_10251802 | Ga0207639_102518022 | 298 |
| 817 | 3300026067 | Ga0207678_10011891 | Ga0207678_100118918 | 298 |
| 818 | 3300026067 | Ga0207678_10047090 | Ga0207678_100470902 | 298 |
| 819 | 3300026067 | Ga0207678_10053433 | Ga0207678_100534333 | 298 |
| 820 | 3300026067 | Ga0207678_10077637 | Ga0207678_100776372 | 298 |
| 821 | 3300026075 | Ga0207708_10000248 | Ga0207708_1000024830 | 298 |
| 822 | 3300026075 | Ga0207708_10011614 | Ga0207708_100116144 | 298 |
| 823 | 3300026078 | Ga0207702_10290230 | Ga0207702_102902301 | 298 |
| 824 | 3300026078 | Ga0207702_10377022 | Ga0207702_103770222 | 298 |
| 825 | 3300026088 | Ga0207641_10013187 | Ga0207641_100131875 | 298 |
| 826 | 3300026088 | Ga0207641_10199731 | Ga0207641_101997311 | 298 |
| 827 | 3300026088 | Ga0207641_10393676 | Ga0207641_103936762 | 298 |
| 828 | 3300026089 | Ga0207648_10000248 | Ga0207648_1000024830 | 298 |
| 829 | 3300026089 | Ga0207648_10026036 | Ga0207648_100260364 | 298 |
| 830 | 3300026089 | Ga0207648_10174087 | Ga0207648_101740873 | 298 |
| 831 | 3300026095 | Ga0207676_10043140 | Ga0207676_100431402 | 298 |
| 832 | 3300026095 | Ga0207676_10300812 | Ga0207676_103008122 | 298 |
| 833 | 3300026095 | Ga0207676_10375909 | Ga0207676_103759092 | 298 |
| 834 | 3300026116 | Ga0207674_10004582 | Ga0207674_100045825 | 298 |
| 835 | 3300026116 | Ga0207674_10047317 | Ga0207674_100473171 | 298 |
| 836 | 3300026116 | Ga0207674_10387587 | Ga0207674_103875871 | 298 |
| 837 | 3300026118 | Ga0207675_100000426 | Ga0207675_10000042615 | 298 |
| 838 | 3300026118 | Ga0207675_100017007 | Ga0207675_1000170073 | 298 |
| 839 | 3300026118 | Ga0207675_100028771 | Ga0207675_1000287714 | 298 |
| 840 | 3300026118 | Ga0207675_100132515 | Ga0207675_1001325152 | 298 |
| 841 | 3300026118 | Ga0207675_100138505 | Ga0207675_1001385052 | 298 |
| 842 | 3300026121 | Ga0207683_10002091 | Ga0207683_100020911 | 298 |
| 843 | 3300026121 | Ga0207683_10014218 | Ga0207683_100142182 | 298 |
| 844 | 3300026121 | Ga0207683_10073232 | Ga0207683_100732322 | 298 |
| 845 | 3300026121 | Ga0207683_10074413 | Ga0207683_100744132 | 298 |
| 846 | 3300026121 | Ga0207683_10083292 | Ga0207683_100832922 | 298 |
| 847 | 3300026121 | Ga0207683_10090709 | Ga0207683_100907092 | 298 |
| 848 | 3300026121 | Ga0207683_10191120 | Ga0207683_101911202 | 298 |
| 849 | 3300026121 | Ga0207683_10312034 | Ga0207683_103120342 | 298 |
| 850 | 3300026121 | Ga0207683_10420829 | Ga0207683_104208292 | 298 |
| 851 | 3300026142 | Ga0207698_10030421 | Ga0207698_100304214 | 298 |
| 852 | 3300027671 | Ga0209588_1015742 | Ga0209588_10157422 | 298 |
| 853 | 3300028379 | Ga0268266_10006822 | Ga0268266_100068224 | 298 |
| 854 | 3300028379 | Ga0268266_10052351 | Ga0268266_100523513 | 298 |
| 855 | 3300028379 | Ga0268266_10461477 | Ga0268266_104614772 | 298 |
| 856 | 3300028379 | Ga0268266_10473951 | Ga0268266_104739512 | 298 |
| 857 | 3300028379 | Ga0268266_10582327 | Ga0268266_105823271 | 298 |
| 858 | 3300028380 | Ga0268265_10009053 | Ga0268265_100090532 | 298 |
| 859 | 3300028380 | Ga0268265_10022104 | Ga0268265_100221042 | 298 |
| 860 | 3300028380 | Ga0268265_10263756 | Ga0268265_102637561 | 298 |
| 861 | 3300028380 | Ga0268265_10301253 | Ga0268265_103012532 | 298 |
| 862 | 3300028381 | Ga0268264_10000020 | Ga0268264_10000020112 | 298 |
| 863 | 3300028381 | Ga0268264_10018483 | Ga0268264_100184835 | 298 |
| 864 | 3300028381 | Ga0268264_10084506 | Ga0268264_100845063 | 298 |
| 865 | 3300028381 | Ga0268264_10234493 | Ga0268264_102344932 | 298 |
| 866 | 3300030521 | Ga0307511_10000499 | Ga0307511_1000049927 | 298 |
| 867 | 3300030521 | Ga0307511_10062819 | Ga0307511_100628193 | 298 |
| 868 | 3300031456 | Ga0307513_10178889 | Ga0307513_101788892 | 298 |
| 869 | 3300031507 | Ga0307509_10122293 | Ga0307509_101222932 | 298 |
| 870 | 3300031548 | Ga0307408_100017923 | Ga0307408_1000179232 | 298 |
| 871 | 3300031548 | Ga0307408_100062663 | Ga0307408_1000626632 | 298 |
| 872 | 3300031616 | Ga0307508_10088793 | Ga0307508_100887931 | 298 |
| 873 | 3300031649 | Ga0307514_10152433 | Ga0307514_101524331 | 298 |
| 874 | 3300031731 | Ga0307405_10007368 | Ga0307405_100073685 | 298 |
| 875 | 3300031731 | Ga0307405_10012696 | Ga0307405_100126963 | 298 |
| 876 | 3300031824 | Ga0307413_10061387 | Ga0307413_100613871 | 298 |
| 877 | 3300031852 | Ga0307410_10001424 | Ga0307410_100014242 | 298 |
| 878 | 3300031901 | Ga0307406_10003267 | Ga0307406_100032676 | 298 |
| 879 | 3300031901 | Ga0307406_10024568 | Ga0307406_100245683 | 298 |
| 880 | 3300031901 | Ga0307406_10087089 | Ga0307406_100870892 | 298 |
| 881 | 3300031911 | Ga0307412_10016495 | Ga0307412_100164953 | 298 |
| 882 | 3300031911 | Ga0307412_10233548 | Ga0307412_102335482 | 298 |
| 883 | 3300031995 | Ga0307409_100003569 | Ga0307409_1000035696 | 298 |
| 884 | 3300031995 | Ga0307409_100014701 | Ga0307409_1000147014 | 298 |
| 885 | 3300031995 | Ga0307409_100490894 | Ga0307409_1004908942 | 298 |
| 886 | 3300032002 | Ga0307416_100064996 | Ga0307416_1000649962 | 298 |
| 887 | 3300032002 | Ga0307416_100250153 | Ga0307416_1002501532 | 298 |
| 888 | 3300032002 | Ga0307416_100636203 | Ga0307416_1006362032 | 298 |
| 889 | 3300032002 | Ga0307416_100640447 | Ga0307416_1006404472 | 298 |
| 890 | 3300032005 | Ga0307411_10000547 | Ga0307411_100005475 | 298 |
| 891 | 3300032126 | Ga0307415_100001658 | Ga0307415_1000016585 | 298 |
| 892 | 3300033180 | Ga0307510_10019237 | Ga0307510_100192373 | 298 |
| 893 | 3300033180 | Ga0307510_10038138 | Ga0307510_100381383 | 298 |
| 894 | 3300035112 | Ga0373932_0008089 | Ga0373932_0008089_1000_1896 | 298 |
| 895 | 3300035113 | Ga0373936_0005672 | Ga0373936_0005672_2783_3679 | 298 |
| 896 | 3300035113 | Ga0373936_0082790 | Ga0373936_0082790_291_1187 | 298 |
| 897 | 3300035116 | Ga0373945_0004379 | Ga0373945_0004379_428_1324 | 298 |
| 898 | 3300035116 | Ga0373945_0074518 | Ga0373945_0074518_200_1096 | 298 |
| 899 | 3300035118 | Ga0373954_0007360 | Ga0373954_0007360_691_1587 | 298 |
| 900 | 3300035118 | Ga0373954_0099745 | Ga0373954_0099745_37_933 | 298 |
| 901 | 3300035118 | Ga0373954_0102936 | Ga0373954_0102936_400_1296 | 298 |
| 902 | 3300035119 | Ga0373956_0128676 | Ga0373956_0128676_257_1153 | 298 |
| 903 | 3300035120 | Ga0373957_0009030 | Ga0373957_0009030_1770_2666 | 298 |
| 904 | 3300035120 | Ga0373957_0030947 | Ga0373957_0030947_1058_1954 | 298 |
| 905 | 3300035120 | Ga0373957_0076518 | Ga0373957_0076518_315_1211 | 298 |
| 906 | 3300035170 | Ga0373943_0016917 | Ga0373943_0016917_620_1516 | 298 |
| 907 | 3300035171 | Ga0373946_0068210 | Ga0373946_0068210_406_1302 | 298 |
| 908 | 3300035398 | Ga0316574_0233619 | Ga0316574_0233619_138_1034 | 298 |
| 909 | 3300035691 | Ga0373931_0016732 | Ga0373931_0016732_2204_3100 | 298 |
| 910 | 3300035692 | Ga0373935_0006803 | Ga0373935_0006803_1885_2781 | 298 |
| 911 | 3300035692 | Ga0373935_0013290 | Ga0373935_0013290_3587_4483 | 298 |
| 912 | 3300035695 | Ga0373927_0013193 | Ga0373927_0013193_2776_3672 | 298 |
| 913 | 3300035695 | Ga0373927_0016649 | Ga0373927_0016649_2601_3497 | 298 |
| 914 | 3300035695 | Ga0373927_0037203 | Ga0373927_0037203_267_1163 | 298 |
| 915 | 3300035695 | Ga0373927_0059921 | Ga0373927_0059921_1370_2266 | 298 |
| 916 | 3300035695 | Ga0373927_0152253 | Ga0373927_0152253_431_1327 | 298 |
| 917 | 3300035724 | Ga0373933_0000052 | Ga0373933_0000052_36534_37430 | 298 |
| 918 | 3300035725 | Ga0373947_0006320 | Ga0373947_0006320_2448_3344 | 298 |
| 919 | 3300035725 | Ga0373947_0022644 | Ga0373947_0022644_99_995 | 298 |
| 920 | 3300035725 | Ga0373947_0034033 | Ga0373947_0034033_1205_2101 | 298 |
| 921 | 3300036401 | Ga0373937_0047530 | Ga0373937_0047530_2634_3530 | 298 |
| 922 | 3300036401 | Ga0373937_0161815 | Ga0373937_0161815_1151_2047 | 298 |
| 923 | 3300036401 | Ga0373937_0163926 | Ga0373937_0163926_273_1169 | 298 |
| 924 | 3300036712 | Ga0316584_0010473 | Ga0316584_0010473_4704_5600 | 298 |
| 925 | 3300037068 | Ga0373925_0017689 | Ga0373925_0017689_3866_4762 | 298 |
| 926 | 3300037068 | Ga0373925_0127754 | Ga0373925_0127754_406_1302 | 298 |
| 927 | 3300037068 | Ga0373925_0215827 | Ga0373925_0215827_470_1366 | 298 |
| 928 | 3300037471 | Ga0395905_0114673 | Ga0395905_0114673_816_1712 | 298 |
| 929 | 3300041404 | Ga0439436_0001548 | Ga0439436_0001548_3945_4841 | 298 |
| 930 | 3300041407 | Ga0439447_014312 | Ga0439447_014312_112_1008 | 298 |
| 931 | 3300041413 | Ga0439465_0000774 | Ga0439465_0000774_6009_6905 | 298 |
| 932 | 3300041997 | Ga0439431_0000394 | Ga0439431_0000394_2355_3251 | 298 |
| 933 | 3300042004 | Ga0439445_0001136 | Ga0439445_0001136_1705_2601 | 298 |
| 934 | 3300042004 | Ga0439445_0026192 | Ga0439445_0026192_333_1229 | 298 |
| 935 | 3300042006 | Ga0439432_001228 | Ga0439432_001228_5621_6517 | 298 |
| 936 | 3300042007 | Ga0439449_0026601 | Ga0439449_0026601_968_1864 | 298 |
| 937 | 3300042010 | Ga0439452_003157 | Ga0439452_003157_2140_3036 | 298 |
| 938 | 3300042115 | Ga0450911_000712 | Ga0450911_000712_2983_3879 | 298 |
| 939 | 3300042185 | Ga0450909_001959 | Ga0450909_001959_402_1298 | 298 |
| 940 | 3300042435 | Ga0439434_0000875 | Ga0439434_0000875_1799_2695 | 298 |
| 941 | 3300044673 | Ga0453683_0002262 | Ga0453683_0002262_8370_9266 | 298 |
| 942 | 3300044673 | Ga0453683_0080698 | Ga0453683_0080698_157_1053 | 298 |
| 943 | 3300045051 | Ga0451576_0014155 | Ga0451576_0014155_2479_3375 | 298 |
| 944 | 3300045051 | Ga0451576_0048819 | Ga0451576_0048819_2721_3617 | 298 |
| 945 | 3300045976 | Ga0466967_0061237 | Ga0466967_0061237_1473_2369 | 298 |
| 946 | 3300046454 | Ga0495592_0032113 | Ga0495592_0032113_2818_3714 | 298 |
| 947 | 3300046454 | Ga0495592_0079820 | Ga0495592_0079820_1069_1965 | 298 |
| 948 | 3300046454 | Ga0495592_0170871 | Ga0495592_0170871_379_1275 | 298 |
| 949 | 3300046455 | Ga0495603_0011507 | Ga0495603_0011507_2034_2930 | 298 |
| 950 | 3300046455 | Ga0495603_0013515 | Ga0495603_0013515_3728_4624 | 298 |
| 951 | 3300046455 | Ga0495603_0069911 | Ga0495603_0069911_274_1170 | 298 |
| 952 | 3300046459 | Ga0495629_0065657 | Ga0495629_0065657_1557_2453 | 298 |
| 953 | 3300046459 | Ga0495629_0074705 | Ga0495629_0074705_1279_2175 | 298 |
| 954 | 3300046461 | Ga0495641_0016211 | Ga0495641_0016211_525_1421 | 298 |
| 955 | 3300046472 | Ga0495580_0004026 | Ga0495580_0004026_2954_3850 | 298 |
| 956 | 3300046472 | Ga0495580_0021531 | Ga0495580_0021531_2540_3436 | 298 |
| 957 | 3300046473 | Ga0495582_0006646 | Ga0495582_0006646_2656_3552 | 298 |
| 958 | 3300046473 | Ga0495582_0008224 | Ga0495582_0008224_842_1738 | 298 |
| 959 | 3300046474 | Ga0495605_0022588 | Ga0495605_0022588_2281_3177 | 298 |
| 960 | 3300046474 | Ga0495605_0024779 | Ga0495605_0024779_1711_2607 | 298 |
| 961 | 3300046474 | Ga0495605_0100546 | Ga0495605_0100546_252_1148 | 298 |
| 962 | 3300046475 | Ga0495639_0000899 | Ga0495639_0000899_6014_6910 | 298 |
| 963 | 3300046475 | Ga0495639_0005803 | Ga0495639_0005803_3914_4810 | 298 |
| 964 | 3300046475 | Ga0495639_0027461 | Ga0495639_0027461_333_1229 | 298 |
| 965 | 3300046476 | Ga0495662_0012692 | Ga0495662_0012692_789_1685 | 298 |
| 966 | 3300046477 | Ga0495664_0007063 | Ga0495664_0007063_1621_2517 | 298 |
| 967 | 3300046477 | Ga0495664_0126198 | Ga0495664_0126198_592_1488 | 298 |
| 968 | 3300046491 | Ga0495584_0062928 | Ga0495584_0062928_523_1419 | 298 |
| 969 | 3300046492 | Ga0495585_0082939 | Ga0495585_0082939_747_1643 | 298 |
| 970 | 3300046499 | Ga0495594_0030099 | Ga0495594_0030099_1725_2621 | 298 |
| 971 | 3300046501 | Ga0495607_0083054 | Ga0495607_0083054_377_1273 | 298 |
| 972 | 3300046514 | Ga0495618_0081113 | Ga0495618_0081113_1096_1992 | 298 |
| 973 | 3300046515 | Ga0495620_0067547 | Ga0495620_0067547_51_947 | 298 |
| 974 | 3300046516 | Ga0495628_0118016 | Ga0495628_0118016_1017_1913 | 298 |
| 975 | 3300046517 | Ga0495630_0038724 | Ga0495630_0038724_1882_2778 | 298 |
| 976 | 3300046517 | Ga0495630_0053234 | Ga0495630_0053234_1683_2579 | 298 |
| 977 | 3300046518 | Ga0495631_0092989 | Ga0495631_0092989_197_1093 | 298 |
| 978 | 3300046519 | Ga0495632_0072267 | Ga0495632_0072267_453_1349 | 298 |
| 979 | 3300046526 | Ga0495666_0016941 | Ga0495666_0016941_1942_2838 | 298 |
| 980 | 3300046529 | Ga0495652_0036311 | Ga0495652_0036311_2756_3652 | 298 |
| 981 | 3300046529 | Ga0495652_0086761 | Ga0495652_0086761_883_1779 | 298 |
| 982 | 3300046530 | Ga0495654_0027390 | Ga0495654_0027390_1980_2876 | 298 |
| 983 | 3300046531 | Ga0495665_0004419 | Ga0495665_0004419_171_1067 | 298 |
| 984 | 3300046531 | Ga0495665_0042616 | Ga0495665_0042616_908_1804 | 298 |
| 985 | 3300046533 | Ga0495640_0018841 | Ga0495640_0018841_395_1291 | 298 |
| 986 | 3300046537 | Ga0495598_0012440 | Ga0495598_0012440_198_1094 | 298 |
| 987 | 3300046537 | Ga0495598_0032353 | Ga0495598_0032353_36_932 | 298 |
| 988 | 3300046537 | Ga0495598_0045923 | Ga0495598_0045923_212_1108 | 298 |
| 989 | 3300046538 | Ga0495609_0082195 | Ga0495609_0082195_469_1365 | 298 |
| 990 | 3300046539 | Ga0495621_0013313 | Ga0495621_0013313_998_1894 | 298 |
| 991 | 3300046543 | Ga0495645_0014210 | Ga0495645_0014210_586_1482 | 298 |
| 992 | 3300046543 | Ga0495645_0070240 | Ga0495645_0070240_1615_2511 | 298 |
| 993 | 3300046557 | Ga0495622_0013015 | Ga0495622_0013015_1163_2059 | 298 |
| 994 | 3300046557 | Ga0495622_0050722 | Ga0495622_0050722_236_1132 | 298 |
| 995 | 3300046557 | Ga0495622_0164244 | Ga0495622_0164244_40_936 | 298 |
| 996 | 3300046558 | Ga0495633_0051427 | Ga0495633_0051427_952_1848 | 298 |
| 997 | 3300046558 | Ga0495633_0089316 | Ga0495633_0089316_502_1398 | 298 |
| 998 | 3300046559 | Ga0495667_0173375 | Ga0495667_0173375_224_1120 | 298 |
| 999 | 3300046615 | Ga0495656_0010426 | Ga0495656_0010426_1772_2668 | 298 |
| 1000 | 3300046616 | Ga0495668_0220097 | Ga0495668_0220097_27_923 | 298 |
| 1001 | 3300046642 | Ga0495634_0099285 | Ga0495634_0099285_786_1682 | 298 |
| 1002 | 3300046648 | Ga0495611_0031066 | Ga0495611_0031066_569_1465 | 298 |
| 1003 | 3300046663 | Ga0495635_0011519 | Ga0495635_0011519_664_1560 | 298 |
| 1004 | 3300046663 | Ga0495635_0020966 | Ga0495635_0020966_3624_4520 | 298 |
| 1005 | 3300046674 | Ga0495588_0097710 | Ga0495588_0097710_275_1171 | 298 |
| 1006 | 3300046674 | Ga0495588_0154618 | Ga0495588_0154618_176_1072 | 298 |
| 1007 | 3300046678 | Ga0495599_0126985 | Ga0495599_0126985_148_1044 | 298 |
| 1008 | 3300046678 | Ga0495599_0268941 | Ga0495599_0268941_60_956 | 298 |
| 1009 | 3300046680 | Ga0495646_0092676 | Ga0495646_0092676_358_1254 | 298 |
| 1010 | 3300046681 | Ga0495647_0005461 | Ga0495647_0005461_1166_2062 | 298 |
| 1011 | 3300046681 | Ga0495647_0081884 | Ga0495647_0081884_232_1128 | 298 |
| 1012 | 3300046683 | Ga0495658_0010654 | Ga0495658_0010654_637_1533 | 298 |
| 1013 | 3300046683 | Ga0495658_0181050 | Ga0495658_0181050_174_1070 | 298 |
| 1014 | 3300046684 | Ga0495669_0107997 | Ga0495669_0107997_248_1144 | 298 |
| 1015 | 3300046689 | Ga0495613_0009283 | Ga0495613_0009283_3715_4611 | 298 |
| 1016 | 3300046689 | Ga0495613_0085486 | Ga0495613_0085486_209_1105 | 298 |
| 1017 | 3300046689 | Ga0495613_0293721 | Ga0495613_0293721_220_1116 | 298 |
| 1018 | 3300046690 | Ga0495624_0016396 | Ga0495624_0016396_208_1104 | 298 |
| 1019 | 3300046691 | Ga0495670_0018387 | Ga0495670_0018387_1616_2512 | 298 |
| 1020 | 3300046691 | Ga0495670_0058671 | Ga0495670_0058671_141_1037 | 298 |
| 1021 | 3300046692 | Ga0495671_0217070 | Ga0495671_0217070_10_906 | 298 |
| 1022 | 3300047315 | Ga0495581_0013837 | Ga0495581_0013837_1163_2059 | 298 |
| 1023 | 3300047317 | Ga0495604_0118972 | Ga0495604_0118972_41_937 | 298 |
| 1024 | 3300047318 | Ga0495636_0009131 | Ga0495636_0009131_1854_2750 | 298 |
| 1025 | 3300047319 | Ga0495674_0039213 | Ga0495674_0039213_517_1413 | 298 |
| 1026 | 3300047320 | Ga0495672_0125570 | Ga0495672_0125570_361_1257 | 298 |
| 1027 | 3300047321 | Ga0495676_0031851 | Ga0495676_0031851_2219_3115 | 298 |
| 1028 | 3300047444 | Ga0495675_0180742 | Ga0495675_0180742_217_1113 | 298 |
| 1029 | 3300047470 | Ga0495681_0090403 | Ga0495681_0090403_231_1127 | 298 |
| 1030 | 3300047470 | Ga0495681_0096190 | Ga0495681_0096190_372_1268 | 298 |
| 1031 | 3300047471 | Ga0495684_0011564 | Ga0495684_0011564_415_1311 | 298 |
| 1032 | 3300047471 | Ga0495684_0147381 | Ga0495684_0147381_269_1165 | 298 |
| 1033 | 3300047472 | Ga0495686_0029299 | Ga0495686_0029299_244_1140 | 298 |
| 1034 | 3300047472 | Ga0495686_0084660 | Ga0495686_0084660_35_931 | 298 |
| 1035 | 3300047673 | Ga0495593_0020360 | Ga0495593_0020360_255_1151 | 298 |
| 1036 | 3300047673 | Ga0495593_0027076 | Ga0495593_0027076_509_1405 | 298 |
| 1037 | 3300047673 | Ga0495593_0201857 | Ga0495593_0201857_14_985 | 298 |
| 1038 | 3300048088 | Ga0495602_0208100 | Ga0495602_0208100_218_1114 | 298 |
| 1039 | 3300048089 | Ga0495614_0042248 | Ga0495614_0042248_421_1317 | 298 |
| 1040 | 3300048090 | Ga0495615_0002153 | Ga0495615_0002153_1197_2093 | 298 |
| 1041 | 3300048903 | Ga0496100_0010350 | Ga0496100_0010350_2931_3827 | 298 |
| 1042 | 3300048904 | Ga0496101_0032479 | Ga0496101_0032479_308_1204 | 298 |
| 1043 | 3300048904 | Ga0496101_0045426 | Ga0496101_0045426_781_1677 | 298 |
| 1044 | 3300048905 | Ga0496102_0004752 | Ga0496102_0004752_5186_6082 | 298 |
| 1045 | 3300048905 | Ga0496102_0068893 | Ga0496102_0068893_1693_2589 | 298 |
| 1046 | 3300048905 | Ga0496102_0167254 | Ga0496102_0167254_1024_1920 | 298 |
| 1047 | 3300048906 | Ga0496103_0034432 | Ga0496103_0034432_1157_2053 | 298 |
| 1048 | 3300048907 | Ga0496104_0043776 | Ga0496104_0043776_680_1576 | 298 |
| 1049 | 3300048907 | Ga0496104_0102687 | Ga0496104_0102687_887_1783 | 298 |
| 1050 | 3300048908 | Ga0496105_0033643 | Ga0496105_0033643_2353_3249 | 298 |
| 1051 | 3300048909 | Ga0496106_0166440 | Ga0496106_0166440_159_1055 | 298 |
| 1052 | 3300048909 | Ga0496106_0198156 | Ga0496106_0198156_267_1163 | 298 |
| 1053 | 3300048909 | Ga0496106_0250786 | Ga0496106_0250786_502_1398 | 298 |
| 1054 | 3300048910 | Ga0496107_0007743 | Ga0496107_0007743_2376_3272 | 298 |
| 1055 | 3300048911 | Ga0496108_0491898 | Ga0496108_0491898_126_1022 | 298 |
| 1056 | 3300048912 | Ga0496109_0013303 | Ga0496109_0013303_488_1384 | 298 |
| 1057 | 3300048912 | Ga0496109_0031307 | Ga0496109_0031307_3099_3995 | 298 |
| 1058 | 3300048912 | Ga0496109_0283842 | Ga0496109_0283842_152_1048 | 298 |
| 1059 | 3300048912 | Ga0496109_0486899 | Ga0496109_0486899_163_1059 | 298 |
| 1060 | 3300048912 | Ga0496109_0631024 | Ga0496109_0631024_28_924 | 298 |
| 1061 | 3300048913 | Ga0496110_0026032 | Ga0496110_0026032_260_1156 | 298 |
| 1062 | 3300048913 | Ga0496110_0027726 | Ga0496110_0027726_1438_2334 | 298 |
| 1063 | 3300048914 | Ga0496111_0048970 | Ga0496111_0048970_1829_2725 | 298 |
| 1064 | 3300048914 | Ga0496111_0232733 | Ga0496111_0232733_308_1204 | 298 |
| 1065 | 3300048915 | Ga0496112_0070168 | Ga0496112_0070168_1128_2024 | 298 |
| 1066 | 3300048915 | Ga0496112_0121449 | Ga0496112_0121449_365_1261 | 298 |
| 1067 | 3300048915 | Ga0496112_0193064 | Ga0496112_0193064_901_1797 | 298 |
| 1068 | 3300048916 | Ga0496113_0003249 | Ga0496113_0003249_1111_2007 | 298 |
| 1069 | 3300048916 | Ga0496113_0017767 | Ga0496113_0017767_751_1647 | 298 |
| 1070 | 3300048916 | Ga0496113_0026946 | Ga0496113_0026946_2431_3327 | 298 |
| 1071 | 3300048917 | Ga0496114_0007527 | Ga0496114_0007527_1313_2209 | 298 |
| 1072 | 3300048918 | Ga0496115_0002391 | Ga0496115_0002391_11140_12036 | 298 |
| 1073 | 3300048918 | Ga0496115_0006943 | Ga0496115_0006943_4687_5583 | 298 |
| 1074 | 3300048920 | Ga0496117_0088182 | Ga0496117_0088182_339_1235 | 298 |
| 1075 | 3300048924 | Ga0496121_0006615 | Ga0496121_0006615_13084_13980 | 298 |
| 1076 | 3300048924 | Ga0496121_0035578 | Ga0496121_0035578_966_1862 | 298 |
| 1077 | 3300048924 | Ga0496121_0043929 | Ga0496121_0043929_2334_3230 | 298 |
| 1078 | 3300048925 | Ga0496122_0000039 | Ga0496122_0000039_119696_120592 | 298 |
| 1079 | 3300048926 | Ga0496123_0000026 | Ga0496123_0000026_119792_120688 | 298 |
| 1080 | 3300048927 | Ga0496124_0047240 | Ga0496124_0047240_1196_2092 | 298 |
| 1081 | 3300048928 | Ga0496125_0014317 | Ga0496125_0014317_4173_5069 | 298 |
| 1082 | 3300048928 | Ga0496125_0102183 | Ga0496125_0102183_879_1775 | 298 |
| 1083 | 3300048929 | Ga0496126_0010044 | Ga0496126_0010044_7173_8072 | 298 |
| 1084 | 3300048929 | Ga0496126_0017497 | Ga0496126_0017497_2840_3736 | 298 |
| 1085 | 3300048929 | Ga0496126_0234043 | Ga0496126_0234043_53_949 | 298 |
| 1086 | 3300049460 | Ga0495682_0022688 | Ga0495682_0022688_858_1754 | 298 |
| 1087 | 3300049571 | Ga0501034_0000812 | Ga0501034_0000812_15757_16653 | 298 |
| 1088 | 3300049575 | Ga0501039_0258413 | Ga0501039_0258413_50_946 | 298 |
| 1089 | 3300049576 | Ga0501040_0105476 | Ga0501040_0105476_534_1430 | 298 |
| 1090 | 3300049582 | Ga0501048_0107272 | Ga0501048_0107272_14_910 | 298 |
| 1091 | 3300049588 | Ga0501072_0000134 | Ga0501072_0000134_35963_36859 | 298 |
| 1092 | 3300049591 | Ga0501075_0150048 | Ga0501075_0150048_271_1167 | 298 |
| 1093 | 3300049592 | Ga0501076_0033230 | Ga0501076_0033230_151_1047 | 298 |
| 1094 | 3300049741 | Ga0501079_0195273 | Ga0501079_0195273_320_1216 | 298 |
| 1095 | 3300050490 | nmdc:mga03n38_11045_c1 | nmdc:mga03n38_11045_c1_1507_2403 | 298 |
| 1096 | 3300050492 | nmdc:mga0yw44_25794_c1 | nmdc:mga0yw44_25794_c1_1976_2872 | 298 |
| 1097 | 3300050496 | nmdc:mga07m45_20026_c1 | nmdc:mga07m45_20026_c1_2375_3271 | 298 |
| 1098 | 3300050508 | nmdc:mga09592_1120_c1 | nmdc:mga09592_1120_c1_983_1918 | 298 |
| 1099 | 3300050509 | nmdc:mga0qj67_22457_c1 | nmdc:mga0qj67_22457_c1_1387_2322 | 298 |
| 1100 | 3300050509 | nmdc:mga0qj67_372961_c1 | nmdc:mga0qj67_372961_c1_114_1010 | 298 |
| 1101 | 3300050510 | nmdc:mga06r32_239650_c1 | nmdc:mga06r32_239650_c1_784_1680 | 298 |
| 1102 | 3300050511 | nmdc:mga08y16_279756_c1 | nmdc:mga08y16_279756_c1_457_1353 | 298 |
| 1103 | 3300050511 | nmdc:mga08y16_494119_c1 | nmdc:mga08y16_494119_c1_99_995 | 298 |
| 1104 | 3300050512 | nmdc:mga0n895_188748_c1 | nmdc:mga0n895_188748_c1_356_1252 | 298 |
| 1105 | 3300050512 | nmdc:mga0n895_44749_c1 | nmdc:mga0n895_44749_c1_1313_2209 | 298 |
| 1106 | 3300050512 | nmdc:mga0n895_82990_c1 | nmdc:mga0n895_82990_c1_449_1345 | 298 |
| 1107 | 3300050513 | nmdc:mga0rr50_17123_c1 | nmdc:mga0rr50_17123_c1_387_1283 | 298 |
| 1108 | 3300050513 | nmdc:mga0rr50_234870_c1 | nmdc:mga0rr50_234870_c1_168_1064 | 298 |
| 1109 | 3300050515 | nmdc:mga0a205_590441_c1 | nmdc:mga0a205_590441_c1_21_917 | 298 |
| 1110 | 3300053077 | Ga0495601_0140052 | Ga0495601_0140052_124_1020 | 298 |
| 1111 | 3300053077 | Ga0495601_0166548 | Ga0495601_0166548_201_1097 | 298 |
| 1112 | 3300053078 | Ga0495612_0011987 | Ga0495612_0011987_2153_3049 | 298 |
| 1113 | 3300053084 | Ga0495595_0072209 | Ga0495595_0072209_371_1267 | 298 |
| 1114 | 3300053085 | Ga0495619_0040773 | Ga0495619_0040773_2063_2959 | 298 |
| 1115 | 3300053090 | Ga0500646_0000464 | Ga0500646_0000464_4673_5569 | 298 |
| 1116 | 3300053096 | Ga0500641_0160744 | Ga0500641_0160744_32_928 | 298 |
| 1117 | 3300053119 | Ga0500595_014358 | Ga0500595_014358_63_959 | 298 |
| 1118 | 3300053133 | Ga0500655_005291 | Ga0500655_005291_689_1585 | 298 |
| 1119 | 3300053134 | Ga0500658_0054348 | Ga0500658_0054348_432_1328 | 298 |
| 1120 | 3300053136 | Ga0500559_0005515 | Ga0500559_0005515_1941_2837 | 298 |
| 1121 | 3300053139 | Ga0500568_0083298 | Ga0500568_0083298_54_950 | 298 |
| 1122 | 3300053140 | Ga0500573_0008795 | Ga0500573_0008795_2958_3854 | 298 |
| 1123 | 3300053142 | Ga0500577_0137315 | Ga0500577_0137315_16_912 | 298 |
| 1124 | 3300053148 | Ga0500590_047748 | Ga0500590_047748_838_1734 | 298 |
| 1125 | 3300053148 | Ga0500590_084523 | Ga0500590_084523_18_914 | 298 |
| 1126 | 3300053150 | Ga0500603_000717 | Ga0500603_000717_2312_3208 | 298 |
| 1127 | 3300053151 | Ga0500604_0000243 | Ga0500604_0000243_6026_6922 | 298 |
| 1128 | 3300053160 | Ga0500633_0065580 | Ga0500633_0065580_227_1123 | 298 |
| 1129 | 3300053161 | Ga0500634_0089323 | Ga0500634_0089323_416_1312 | 298 |
| 1130 | 3300053177 | Ga0500636_0168929 | Ga0500636_0168929_75_971 | 298 |
| 1131 | 3300053177 | Ga0500636_0210549 | Ga0500636_0210549_99_995 | 298 |
| 1132 | 3300053178 | Ga0500637_0001020 | Ga0500637_0001020_3043_3939 | 298 |
| 1133 | 3300053733 | Ga0500552_003478 | Ga0500552_003478_540_1436 | 298 |
| 1134 | 3300053735 | Ga0500596_006291 | Ga0500596_006291_901_1797 | 298 |
| 1135 | 3300054114 | Ga0501084_0273119 | Ga0501084_0273119_176_1072 | 298 |
| 1136 | iso_pu_bacteria | 2545555834 | 2545679551 | 298 |
| 1137 | iso_pu_bacteria | 2883577096 | 2883577268 | 298 |
| 1138 | iso_pu_bacteria | 2929199973 | 2929204150 | 298 |
| 1139 | iso_pu_bacteria | 3003665799 | 3003671402 | 298 |
| 1140 | iso_pu_bacteria | 8055909800 | 8055911322 | 298 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dbl-assembly1.cif.gz_B | crystal structure of e159q mutant of btucdf | 0.5547 | 5 | 284 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5498 | 4 | 288 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.5443 | 10 | 284 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5434 | 4 | 288 |
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.5372 | 11 | 276 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9283 | 8 | 282 | 1.10.3470.10 |
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9031 | 8 | 282 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8127 | 8 | 283 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7947 | 8 | 283 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7833 | 9 | 283 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537UZA7-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9758 | 72 | 298 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A537V1Q1-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9691 | 1 | 272 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A520W5B1-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9687 | 1 | 298 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A847DRL4-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9682 | 5 | 247 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A537UZA7-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9675 | 72 | 298 |
GO:0005886
GO:0006865 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar