F490693

General Info

Members Datasets Scaffolds Average Seq Length
1140 355 2280 80

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_101122012|Ga0070706_1011220121
Length 81
Sequence VSGFAFDPCARCEEMMQPYLDRDLSVEQMMEAEAHLDVCSHCRRRYRFEVSLRRYVRTVADEKQMPQELKAKLAVLRTPLH

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
119 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
120 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
211 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
212 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
228 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
229 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
230 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
231 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
232 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
233 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
236 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
237 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
238 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
239 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
240 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
241 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
242 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
243 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
244 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
245 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
246 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
247 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
248 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
249 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
256 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
257 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
258 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
261 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
262 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
280 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
285 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
288 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
322 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
329 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
330 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
350 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
355 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 1.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 6.32
Rhizosphere 92.19
Stem 0
Stem Tuber 0
Unclassified 15.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_101122012 3300005467 Bacteria 724
2 2214741331 2209111006 Archaea 953
3 ARcpr5yngRDRAFT_c002676 3300000043 Unclassified 1831
4 ARSoilOldRDRAFT_c001729 3300000044 Unclassified 2003
5 JGI24747J21853_1050140 3300001978 Bacteria 508
6 JGI24739J22299_10043863 3300001989 Bacteria 1476
7 JGI24743J22301_10004517 3300001991 Bacteria 2274
8 JGI24743J22301_10058672 3300001991 Bacteria 791
9 JGI24743J22301_10095463 3300001991 Unclassified 637
10 JGI24738J21930_10025519 3300002075 Bacteria 1215
11 JGI24738J21930_10062747 3300002075 Bacteria 764
12 JGI24744J21845_10037088 3300002077 Bacteria 919
13 JGI24744J21845_10092072 3300002077 Bacteria 557
14 JGI24034J26672_10066300 3300002239 Bacteria 641
15 JGI24034J26672_10073220 3300002239 Bacteria 616
16 JGI24742J22300_10025285 3300002244 Bacteria 1026
17 JGI24742J22300_10120439 3300002244 Bacteria 518
18 JGI24751J29686_10078962 3300002459 Bacteria 682
19 JGI25406J46586_10025619 3300003203 Bacteria 2287
20 JGI25406J46586_10134316 3300003203 Bacteria 725
21 Ga0058863_10000400 3300004799 Bacteria 1171
22 Ga0058863_11966875 3300004799 Bacteria 905
23 Ga0058861_10036801 3300004800 Bacteria 944
24 Ga0058860_10162899 3300004801 Bacteria 892
25 Ga0058860_12210104 3300004801 Bacteria 841
26 Ga0058862_10098273 3300004803 Bacteria 881
27 Ga0070658_10012481 3300005327 Bacteria 6817
28 Ga0070658_10164960 3300005327 Bacteria 1859
29 Ga0070658_10983869 3300005327 Unclassified 734
30 Ga0070658_11186789 3300005327 Bacteria 664
31 Ga0070676_10120648 3300005328 Bacteria 1645
32 Ga0070676_10149159 3300005328 Bacteria 1495
33 Ga0070683_100018147 3300005329 Bacteria 6227
34 Ga0070683_100065183 3300005329 Bacteria 3392
35 Ga0070683_100120855 3300005329 Bacteria 2474
36 Ga0070683_100354697 3300005329 Unclassified 1397
37 Ga0070683_100520645 3300005329 Bacteria 1136
38 Ga0070683_100747945 3300005329 Bacteria 937
39 Ga0070690_100472279 3300005330 Bacteria 934
40 Ga0070670_100961684 3300005331 Bacteria 776
41 Ga0070670_101320500 3300005331 Unclassified 660
42 Ga0070670_101601209 3300005331 Bacteria 599
43 Ga0068869_100023368 3300005334 Bacteria 4268
44 Ga0068869_100269957 3300005334 Bacteria 1364
45 Ga0068869_100308655 3300005334 Unclassified 1280
46 Ga0068869_101838707 3300005334 Unclassified 542
47 Ga0068869_101874253 3300005334 Bacteria 537
48 Ga0070666_10204304 3300005335 Unclassified 1390
49 Ga0070680_100007895 3300005336 Bacteria 8115
50 Ga0070680_100147736 3300005336 Unclassified 1973
51 Ga0070680_100376973 3300005336 Bacteria 1208
52 Ga0070680_101030691 3300005336 Bacteria 711
53 Ga0070680_101272267 3300005336 Bacteria 637
54 Ga0070682_100005220 3300005337 Bacteria 7226
55 Ga0070682_100108336 3300005337 Unclassified 1847
56 Ga0070682_100471803 3300005337 Unclassified 966
57 Ga0070682_100523886 3300005337 Bacteria 922
58 Ga0070682_100630593 3300005337 Bacteria 851
59 Ga0070682_101825362 3300005337 Bacteria 531
60 Ga0068868_100110844 3300005338 Bacteria 2230
61 Ga0068868_100415272 3300005338 Bacteria 1164
62 Ga0068868_100529186 3300005338 Unclassified 1036
63 Ga0068868_100796543 3300005338 Bacteria 852
64 Ga0070660_100004686 3300005339 Bacteria 9468
65 Ga0070660_100063955 3300005339 Bacteria 2861
66 Ga0070660_100400628 3300005339 Unclassified 1135
67 Ga0070660_100405434 3300005339 Unclassified 1128
68 Ga0070660_101558565 3300005339 Bacteria 562
69 Ga0070689_100149218 3300005340 Bacteria 1885
70 Ga0070689_101462785 3300005340 Bacteria 618
71 Ga0070691_10001238 3300005341 Bacteria 10761
72 Ga0070691_10264948 3300005341 Bacteria 926
73 Ga0070691_10372810 3300005341 Bacteria 798
74 Ga0070691_10820831 3300005341 Unclassified 568
75 Ga0070691_10822967 3300005341 Unclassified 567
76 Ga0070687_100259899 3300005343 Bacteria 1083
77 Ga0070687_101357259 3300005343 Unclassified 530
78 Ga0070661_100014709 3300005344 Bacteria 5518
79 Ga0070661_100076821 3300005344 Bacteria 2461
80 Ga0070661_100313064 3300005344 Bacteria 1225
81 Ga0070661_100419923 3300005344 Bacteria 1060
82 Ga0070661_101766879 3300005344 Bacteria 524
83 Ga0070692_10012229 3300005345 Bacteria 3965
84 Ga0070692_10123571 3300005345 Bacteria 1446
85 Ga0070692_10240012 3300005345 Unclassified 1080
86 Ga0070692_10277631 3300005345 Bacteria 1014
87 Ga0070692_10862229 3300005345 Unclassified 623
88 Ga0070668_100097921 3300005347 Bacteria 2320
89 Ga0070668_101224370 3300005347 Bacteria 681
90 Ga0070668_101791386 3300005347 Bacteria 564
91 Ga0070669_100061755 3300005353 Bacteria 2754
92 Ga0070669_100110873 3300005353 Unclassified 2082
93 Ga0070669_100216640 3300005353 Bacteria 1513
94 Ga0070669_100316774 3300005353 Bacteria 1259
95 Ga0070675_100013979 3300005354 Bacteria 6319
96 Ga0070675_100066526 3300005354 Bacteria 2981
97 Ga0070675_100077897 3300005354 Bacteria 2760
98 Ga0070675_100331224 3300005354 Unclassified 1347
99 Ga0070671_100192672 3300005355 Bacteria 1728
100 Ga0070671_100568969 3300005355 Bacteria 978
101 Ga0070674_100024067 3300005356 Bacteria 3950
102 Ga0070674_100032596 3300005356 Bacteria 3460
103 Ga0070674_100066818 3300005356 Bacteria 2527
104 Ga0070674_100694487 3300005356 Bacteria 869
105 Ga0070674_101029289 3300005356 Bacteria 724
106 Ga0070674_101042143 3300005356 Bacteria 720
107 Ga0070674_101767873 3300005356 Unclassified 560
108 Ga0070673_100009358 3300005364 Bacteria 6574
109 Ga0070673_100052387 3300005364 Bacteria 3202
110 Ga0070673_100440169 3300005364 Unclassified 1171
111 Ga0070688_100020579 3300005365 Bacteria 3838
112 Ga0070688_100443056 3300005365 Bacteria 969
113 Ga0070688_100629724 3300005365 Bacteria 824
114 Ga0070659_100046848 3300005366 Bacteria 3390
115 Ga0070659_100055876 3300005366 Bacteria 3112
116 Ga0070659_100069351 3300005366 Unclassified 2798
117 Ga0070659_100134231 3300005366 Unclassified 2012
118 Ga0070659_101238669 3300005366 Unclassified 660
119 Ga0070667_101273894 3300005367 Bacteria 689
120 Ga0070667_101487235 3300005367 Unclassified 636
121 Ga0070703_10252828 3300005406 Bacteria 716
122 Ga0070701_10003360 3300005438 Bacteria 6318
123 Ga0070701_10165889 3300005438 Unclassified 1283
124 Ga0070701_10184858 3300005438 Bacteria 1223
125 Ga0070705_100057463 3300005440 Bacteria 2295
126 Ga0070700_100077418 3300005441 Bacteria 2138
127 Ga0070700_100135553 3300005441 Bacteria 1667
128 Ga0070700_100270932 3300005441 Unclassified 1226
129 Ga0070700_101191568 3300005441 Bacteria 635
130 Ga0070694_100413225 3300005444 Bacteria 1059
131 Ga0070694_100450391 3300005444 Unclassified 1016
132 Ga0070694_100594985 3300005444 Archaea 890
133 Ga0070694_101352627 3300005444 Bacteria 600
134 Ga0070708_100425083 3300005445 Unclassified 1253
135 Ga0070708_101340347 3300005445 Bacteria 668
136 Ga0070663_100303087 3300005455 Bacteria 1279
137 Ga0070663_101279227 3300005455 Unclassified 647
138 Ga0070663_101436932 3300005455 Bacteria 612
139 Ga0070678_100017141 3300005456 Bacteria 4654
140 Ga0070678_100048516 3300005456 Bacteria 3058
141 Ga0070678_100362420 3300005456 Bacteria 1249
142 Ga0070678_100911464 3300005456 Unclassified 804
143 Ga0070678_101533240 3300005456 Bacteria 624
144 Ga0070678_101980994 3300005456 Unclassified 551
145 Ga0070678_102185928 3300005456 Bacteria 525
146 Ga0070662_100016854 3300005457 Bacteria 4911
147 Ga0070662_100019166 3300005457 Bacteria 4642
148 Ga0070662_100048366 3300005457 Bacteria 3064
149 Ga0070662_100053146 3300005457 Bacteria 2931
150 Ga0070662_100865491 3300005457 Bacteria 770
151 Ga0070662_101905200 3300005457 Unclassified 514
152 Ga0070681_10072596 3300005458 Bacteria 3404
153 Ga0070681_10180469 3300005458 Unclassified 2032
154 Ga0070681_10274946 3300005458 Bacteria 1596
155 Ga0070681_10385000 3300005458 Bacteria 1313
156 Ga0068867_100073418 3300005459 Bacteria 2562
157 Ga0068867_100215413 3300005459 Bacteria 1545
158 Ga0068867_100505065 3300005459 Bacteria 1040
159 Ga0068867_100552932 3300005459 Bacteria 997
160 Ga0068867_100707492 3300005459 Unclassified 890
161 Ga0068867_101077312 3300005459 Bacteria 733
162 Ga0068867_101133090 3300005459 Unclassified 716
163 Ga0070685_10025373 3300005466 Bacteria 3263
164 Ga0070685_10051017 3300005466 Bacteria 2392
165 Ga0070685_10517617 3300005466 Unclassified 847
166 Ga0070706_100116655 3300005467 Bacteria 2487
167 Ga0070706_101633067 3300005467 Bacteria 588
168 Ga0070707_100212372 3300005468 Bacteria 1886
169 Ga0070707_100300165 3300005468 Bacteria 1561
170 Ga0070707_100538427 3300005468 Bacteria 1130
171 Ga0070707_100599964 3300005468 Bacteria 1064
172 Ga0070707_101071429 3300005468 Bacteria 772
173 Ga0070698_100422962 3300005471 Bacteria 1267
174 Ga0070698_100875197 3300005471 Bacteria 844
175 Ga0070699_100751143 3300005518 Bacteria 892
176 Ga0070679_100011289 3300005530 Bacteria 8517
177 Ga0070679_100037511 3300005530 Bacteria 4815
178 Ga0070679_100273839 3300005530 Bacteria 1641
179 Ga0070684_100030643 3300005535 Bacteria 4572
180 Ga0070684_100085253 3300005535 Bacteria 2801
181 Ga0070684_100108143 3300005535 Bacteria 2491
182 Ga0070684_100289579 3300005535 Bacteria 1501
183 Ga0070684_100346796 3300005535 Bacteria 1365
184 Ga0070684_100415153 3300005535 Bacteria 1242
185 Ga0070684_100670648 3300005535 Unclassified 966
186 Ga0070684_101292044 3300005535 Unclassified 687
187 Ga0068853_100014429 3300005539 Bacteria 6469
188 Ga0068853_100062964 3300005539 Bacteria 3212
189 Ga0068853_100167491 3300005539 Bacteria 1986
190 Ga0068853_101074489 3300005539 Unclassified 776
191 Ga0070672_100012820 3300005543 Bacteria 5903
192 Ga0070672_100123283 3300005543 Bacteria 2124
193 Ga0070672_100128796 3300005543 Bacteria 2078
194 Ga0070672_100872964 3300005543 Bacteria 794
195 Ga0070686_100029728 3300005544 Bacteria 3327
196 Ga0070686_100109964 3300005544 Unclassified 1876
197 Ga0070686_100628513 3300005544 Bacteria 849
198 Ga0070686_101093220 3300005544 Archaea 658
199 Ga0070695_101023736 3300005545 Bacteria 673
200 Ga0070696_100309973 3300005546 Bacteria 1211
201 Ga0070696_100507729 3300005546 Bacteria 960
202 Ga0070693_100045096 3300005547 Bacteria 2497
203 Ga0070693_100072121 3300005547 Bacteria 2036
204 Ga0070693_100441027 3300005547 Bacteria 912
205 Ga0070693_100603786 3300005547 Bacteria 792
206 Ga0070665_100194410 3300005548 Bacteria 2029
207 Ga0070665_100390657 3300005548 Unclassified 1399
208 Ga0070665_100447059 3300005548 Bacteria 1302
209 Ga0070665_100982496 3300005548 Bacteria 856
210 Ga0070704_100016961 3300005549 Bacteria 4618
211 Ga0070704_100073456 3300005549 Bacteria 2492
212 Ga0070704_100706319 3300005549 Bacteria 895
213 Ga0070704_100893734 3300005549 Bacteria 798
214 Ga0068855_100156199 3300005563 Bacteria 2591
215 Ga0068855_100345925 3300005563 Bacteria 1639
216 Ga0070664_100003869 3300005564 Bacteria 12088
217 Ga0070664_100010761 3300005564 Bacteria 7417
218 Ga0070664_100161931 3300005564 Unclassified 1980
219 Ga0070664_100169043 3300005564 Bacteria 1939
220 Ga0070664_100479900 3300005564 Unclassified 1144
221 Ga0070664_101377796 3300005564 Unclassified 666
222 Ga0070664_101507668 3300005564 Bacteria 636
223 Ga0068857_100071647 3300005577 Bacteria 3088
224 Ga0068857_102027130 3300005577 Unclassified 564
225 Ga0068854_100003667 3300005578 Bacteria 9604
226 Ga0068854_100888177 3300005578 Bacteria 783
227 Ga0068854_100915063 3300005578 Bacteria 772
228 Ga0068856_100179207 3300005614 Bacteria 2132
229 Ga0068856_100203070 3300005614 Bacteria 1997
230 Ga0068856_100407407 3300005614 Bacteria 1379
231 Ga0070702_100016434 3300005615 Bacteria 3797
232 Ga0070702_100025615 3300005615 Bacteria 3162
233 Ga0070702_101322173 3300005615 Unclassified 586
234 Ga0068852_100007373 3300005616 Bacteria 8022
235 Ga0068852_100043051 3300005616 Bacteria 3827
236 Ga0068852_100062908 3300005616 Bacteria 3229
237 Ga0068852_100247937 3300005616 Bacteria 1705
238 Ga0068852_100520762 3300005616 Unclassified 1186
239 Ga0068852_100653281 3300005616 Unclassified 1059
240 Ga0068859_100140109 3300005617 Bacteria 2492
241 Ga0068859_101434378 3300005617 Bacteria 762
242 Ga0068859_101462464 3300005617 Unclassified 754
243 Ga0068864_100015387 3300005618 Bacteria 6361
244 Ga0068864_100423296 3300005618 Unclassified 1269
245 Ga0068864_100659244 3300005618 Bacteria 1019
246 Ga0068864_101632593 3300005618 Bacteria 649
247 Ga0068866_10037817 3300005718 Bacteria 2372
248 Ga0068866_10130980 3300005718 Bacteria 1426
249 Ga0068866_10186024 3300005718 Unclassified 1230
250 Ga0068866_10496758 3300005718 Bacteria 806
251 Ga0068866_11162069 3300005718 Bacteria 556
252 Ga0068861_100682255 3300005719 Bacteria 953
253 Ga0068861_100791987 3300005719 Unclassified 889
254 Ga0068861_102317783 3300005719 Bacteria 539
255 Ga0068851_10135097 3300005834 Bacteria 1337
256 Ga0068851_10146037 3300005834 Bacteria 1290
257 Ga0068851_10330989 3300005834 Unclassified 882
258 Ga0068851_10785829 3300005834 Bacteria 591
259 Ga0068870_10047359 3300005840 Bacteria 2260
260 Ga0068870_10069276 3300005840 Unclassified 1919
261 Ga0068870_10176969 3300005840 Bacteria 1277
262 Ga0068870_10498032 3300005840 Unclassified 812
263 Ga0068870_10792203 3300005840 Bacteria 662
264 Ga0068863_100102857 3300005841 Bacteria 2716
265 Ga0068863_100319447 3300005841 Unclassified 1508
266 Ga0068858_100034435 3300005842 Bacteria 4698
267 Ga0068858_100387978 3300005842 Bacteria 1341
268 Ga0068860_100069094 3300005843 Bacteria 3357
269 Ga0068862_100503741 3300005844 Bacteria 1150
270 Ga0068862_100825068 3300005844 Unclassified 907
271 Ga0081455_10012612 3300005937 Bacteria 8421
272 Ga0081455_10026862 3300005937 Bacteria 5286
273 Ga0081455_10030348 3300005937 Bacteria 4911
274 Ga0081455_10197501 3300005937 Bacteria 1509
275 Ga0081455_10450052 3300005937 Unclassified 880
276 Ga0081539_10000890 3300005985 Bacteria 57132
277 Ga0081539_10000913 3300005985 Bacteria 55913
278 Ga0081539_10274747 3300005985 Bacteria 736
279 Ga0075365_10185597 3300006038 Bacteria 1455
280 Ga0075365_10215918 3300006038 Unclassified 1345
281 Ga0075368_10386016 3300006042 Bacteria 614
282 Ga0075363_100032780 3300006048 Bacteria 2701
283 Ga0075364_10555882 3300006051 Bacteria 784
284 Ga0075432_10002834 3300006058 Bacteria 5823
285 Ga0075432_10315263 3300006058 Unclassified 653
286 Ga0075367_10395143 3300006178 Bacteria 874
287 Ga0097621_100335071 3300006237 Bacteria 1342
288 Ga0097621_100518500 3300006237 Bacteria 1082
289 Ga0097621_100700064 3300006237 Bacteria 933
290 Ga0097621_101021418 3300006237 Bacteria 774
291 Ga0068871_100530762 3300006358 Bacteria 1064
292 Ga0068871_100594839 3300006358 Bacteria 1006
293 Ga0068871_100914323 3300006358 Bacteria 814
294 Ga0068871_100987398 3300006358 Bacteria 784
295 Ga0068871_101674327 3300006358 Unclassified 603
296 Ga0075428_100007037 3300006844 Bacteria 12475
297 Ga0075428_101504935 3300006844 Unclassified 705
298 Ga0075428_101748580 3300006844 Bacteria 648
299 Ga0075428_101769432 3300006844 Bacteria 644
300 Ga0075430_100069637 3300006846 Bacteria 2951
301 Ga0075430_100250350 3300006846 Bacteria 1468
302 Ga0075431_100222939 3300006847 Unclassified 1923
303 Ga0075431_101128770 3300006847 Bacteria 748
304 Ga0075433_10868588 3300006852 Bacteria 787
305 Ga0075434_100619594 3300006871 Bacteria 1101
306 Ga0075434_100763109 3300006871 Bacteria 984
307 Ga0075429_100015672 3300006880 Bacteria 6568
308 Ga0075429_101784490 3300006880 Bacteria 534
309 Ga0068865_100010600 3300006881 Bacteria 5744
310 Ga0068865_100028908 3300006881 Bacteria 3673
311 Ga0068865_100061189 3300006881 Bacteria 2638
312 Ga0068865_100251534 3300006881 Bacteria 1395
313 Ga0068865_100657094 3300006881 Bacteria 892
314 Ga0097620_100140117 3300006931 Bacteria 2492
315 Ga0097620_101434349 3300006931 Bacteria 762
316 Ga0097620_101462223 3300006931 Unclassified 754
317 Ga0075435_100281477 3300007076 Bacteria 1420
318 Ga0075435_100411961 3300007076 Unclassified 1163
319 Ga0105244_10413686 3300009036 Bacteria 620
320 Ga0111539_10048272 3300009094 Bacteria 5084
321 Ga0111539_10434001 3300009094 Bacteria 1529
322 Ga0111539_10673954 3300009094 Archaea 1204
323 Ga0111539_10920760 3300009094 Bacteria 1017
324 Ga0111539_12345987 3300009094 Bacteria 619
325 Ga0111539_12598296 3300009094 Bacteria 587
326 Ga0105245_10002458 3300009098 Bacteria 16754
327 Ga0105245_10037615 3300009098 Bacteria 4303
328 Ga0105245_10128207 3300009098 Bacteria 2377
329 Ga0105245_10340484 3300009098 Bacteria 1483
330 Ga0105245_10438691 3300009098 Bacteria 1312
331 Ga0105245_10587517 3300009098 Bacteria 1139
332 Ga0105245_10837010 3300009098 Unclassified 960
333 Ga0105245_11184800 3300009098 Bacteria 812
334 Ga0105245_11327525 3300009098 Archaea 768
335 Ga0105247_10016412 3300009101 Bacteria 4437
336 Ga0105247_10403972 3300009101 Unclassified 974
337 Ga0114129_10006579 3300009147 Bacteria 16496
338 Ga0114129_10054711 3300009147 Bacteria 5595
339 Ga0114129_10772526 3300009147 Unclassified 1228
340 Ga0114129_11131925 3300009147 Bacteria 978
341 Ga0114129_11260965 3300009147 Bacteria 918
342 Ga0114129_11773738 3300009147 Unclassified 751
343 Ga0114129_12557994 3300009147 Bacteria 610
344 Ga0105243_10005485 3300009148 Bacteria 9893
345 Ga0105243_10114175 3300009148 Bacteria 2266
346 Ga0105243_10155875 3300009148 Bacteria 1964
347 Ga0105243_10299389 3300009148 Bacteria 1457
348 Ga0105243_10341823 3300009148 Bacteria 1371
349 Ga0105243_10657490 3300009148 Bacteria 1016
350 Ga0105243_10881191 3300009148 Bacteria 889
351 Ga0105243_11125349 3300009148 Unclassified 795
352 Ga0105243_11488103 3300009148 Bacteria 700
353 Ga0105241_12182417 3300009174 Bacteria 549
354 Ga0105242_10004703 3300009176 Bacteria 10568
355 Ga0105242_10131180 3300009176 Bacteria 2163
356 Ga0105242_10147878 3300009176 Unclassified 2045
357 Ga0105242_10302863 3300009176 Bacteria 1460
358 Ga0105242_10360402 3300009176 Bacteria 1346
359 Ga0105242_12214428 3300009176 Bacteria 595
360 Ga0105248_10277459 3300009177 Bacteria 1887
361 Ga0105248_11035383 3300009177 Bacteria 927
362 Ga0105248_12646319 3300009177 Unclassified 572
363 Ga0105248_12667251 3300009177 Bacteria 570
364 Ga0105248_12926449 3300009177 Bacteria 544
365 Ga0105237_10362186 3300009545 Bacteria 1454
366 Ga0105238_10004615 3300009551 Bacteria 13633
367 Ga0105238_10655795 3300009551 Bacteria 1060
368 Ga0105238_11490411 3300009551 Unclassified 705
369 Ga0105249_10074040 3300009553 Bacteria 3151
370 Ga0105249_10129166 3300009553 Bacteria 2410
371 Ga0105249_10167696 3300009553 Bacteria 2127
372 Ga0105249_10791601 3300009553 Bacteria 1012
373 Ga0105239_10060383 3300010375 Bacteria 4161
374 Ga0105239_10173487 3300010375 Bacteria 2412
375 Ga0105239_10314495 3300010375 Bacteria 1765
376 Ga0105239_10493149 3300010375 Bacteria 1392
377 Ga0105239_10685042 3300010375 Bacteria 1172
378 Ga0105239_12667311 3300010375 Unclassified 583
379 Ga0105246_10073527 3300011119 Unclassified 2414
380 Ga0105246_10151414 3300011119 Bacteria 1756
381 Ga0105246_10196226 3300011119 Bacteria 1566
382 Ga0105246_10202032 3300011119 Bacteria 1546
383 Ga0105246_10251886 3300011119 Unclassified 1402
384 Ga0105246_10486262 3300011119 Bacteria 1045
385 Ga0105246_10619270 3300011119 Bacteria 938
386 Ga0105246_10916465 3300011119 Bacteria 787
387 Ga0105246_11066732 3300011119 Bacteria 736
388 Ga0157343_1011118 3300012488 Unclassified 693
389 Ga0157314_1028173 3300012500 Unclassified 616
390 Ga0157314_1036908 3300012500 Bacteria 574
391 Ga0157339_1067631 3300012505 Unclassified 509
392 Ga0157373_10475281 3300013100 Bacteria 901
393 Ga0157373_10577989 3300013100 Unclassified 817
394 Ga0157373_10865248 3300013100 Unclassified 669
395 Ga0157373_11094913 3300013100 Bacteria 597
396 Ga0157371_10195844 3300013102 Bacteria 1448
397 Ga0157371_10234896 3300013102 Bacteria 1318
398 Ga0157371_10325779 3300013102 Bacteria 1115
399 Ga0157370_10769753 3300013104 Bacteria 877
400 Ga0157370_10795452 3300013104 Bacteria 861
401 Ga0157369_10104309 3300013105 Bacteria 3019
402 Ga0157374_10141270 3300013296 Bacteria 2338
403 Ga0157374_10532139 3300013296 Bacteria 1182
404 Ga0157374_12846246 3300013296 Unclassified 511
405 Ga0157378_10223569 3300013297 Bacteria 1791
406 Ga0157378_10763532 3300013297 Unclassified 990
407 Ga0157378_10790326 3300013297 Bacteria 974
408 Ga0157378_11270294 3300013297 Bacteria 777
409 Ga0163162_10484589 3300013306 Unclassified 1368
410 Ga0163162_10821685 3300013306 Bacteria 1046
411 Ga0163162_11875234 3300013306 Bacteria 686
412 Ga0163162_11990492 3300013306 Bacteria 666
413 Ga0157372_10009445 3300013307 Bacteria 10376
414 Ga0157372_10105468 3300013307 Bacteria 3223
415 Ga0157372_10509020 3300013307 Archaea 1404
416 Ga0157375_10029312 3300013308 Bacteria 5173
417 Ga0157375_10041919 3300013308 Bacteria 4425
418 Ga0157375_10651885 3300013308 Bacteria 1209
419 Ga0157375_10960602 3300013308 Bacteria 996
420 Ga0157375_10974996 3300013308 Bacteria 988
421 Ga0157375_12548815 3300013308 Unclassified 611
422 Ga0163163_10199617 3300014325 Bacteria 2048
423 Ga0163163_10542539 3300014325 Unclassified 1225
424 Ga0163163_10587035 3300014325 Bacteria 1177
425 Ga0163163_11526590 3300014325 Bacteria 729
426 Ga0163163_11973199 3300014325 Unclassified 643
427 Ga0163163_12694173 3300014325 Bacteria 554
428 Ga0157380_10040382 3300014326 Bacteria 3634
429 Ga0157380_10049025 3300014326 Bacteria 3329
430 Ga0157380_10159646 3300014326 Bacteria 1958
431 Ga0157380_12047313 3300014326 Bacteria 635
432 Ga0157377_10001311 3300014745 Bacteria 10644
433 Ga0157377_10003506 3300014745 Bacteria 7100
434 Ga0157377_10063765 3300014745 Bacteria 2111
435 Ga0157377_10077178 3300014745 Bacteria 1939
436 Ga0157377_10163634 3300014745 Unclassified 1386
437 Ga0157377_10843662 3300014745 Bacteria 680
438 Ga0157377_11284666 3300014745 Bacteria 571
439 Ga0157377_11484705 3300014745 Unclassified 538
440 Ga0157379_10070862 3300014968 Unclassified 3119
441 Ga0157379_10075391 3300014968 Unclassified 3020
442 Ga0157379_12098590 3300014968 Bacteria 560
443 Ga0157376_10035152 3300014969 Bacteria 4052
444 Ga0157376_10131046 3300014969 Bacteria 2237
445 Ga0157376_10423087 3300014969 Bacteria 1293
446 Ga0163161_10017266 3300017792 Bacteria 5049
447 Ga0163161_10507902 3300017792 Unclassified 982
448 Ga0163161_10784000 3300017792 Bacteria 800
449 Ga0163161_11490969 3300017792 Unclassified 593
450 Ga0206356_10423462 3300020070 Bacteria 3473
451 Ga0206356_10715168 3300020070 Bacteria 1292
452 Ga0206351_10732071 3300020077 Bacteria 514
453 Ga0206352_10539032 3300020078 Bacteria 914
454 Ga0206350_10935077 3300020080 Bacteria 1231
455 Ga0206354_10785179 3300020081 Bacteria 1318
456 Ga0206354_11277640 3300020081 Bacteria 1610
457 Ga0224712_10070446 3300022467 Bacteria 1418
458 Ga0207656_10243534 3300025321 Unclassified 879
459 Ga0207653_10018400 3300025885 Bacteria 2200
460 Ga0207642_10086808 3300025899 Bacteria 1535
461 Ga0207642_10117534 3300025899 Bacteria 1366
462 Ga0207642_10769334 3300025899 Bacteria 611
463 Ga0207688_10013555 3300025901 Bacteria 4431
464 Ga0207688_10060772 3300025901 Bacteria 2129
465 Ga0207688_10111828 3300025901 Unclassified 1586
466 Ga0207688_10143489 3300025901 Unclassified 1406
467 Ga0207688_10550347 3300025901 Bacteria 725
468 Ga0207680_10086005 3300025903 Bacteria 1987
469 Ga0207647_10349319 3300025904 Bacteria 837
470 Ga0207645_10116806 3300025907 Bacteria 1730
471 Ga0207645_10227145 3300025907 Bacteria 1231
472 Ga0207643_10153252 3300025908 Bacteria 1383
473 Ga0207643_10206206 3300025908 Bacteria 1199
474 Ga0207643_10325628 3300025908 Bacteria 961
475 Ga0207643_10361395 3300025908 Bacteria 913
476 Ga0207643_10517390 3300025908 Bacteria 764
477 Ga0207705_10023479 3300025909 Bacteria 4399
478 Ga0207705_10890455 3300025909 Unclassified 690
479 Ga0207705_11230661 3300025909 Bacteria 574
480 Ga0207684_10152321 3300025910 Bacteria 1990
481 Ga0207684_10904603 3300025910 Bacteria 742
482 Ga0207654_10595001 3300025911 Bacteria 789
483 Ga0207654_11434169 3300025911 Unclassified 503
484 Ga0207707_10016045 3300025912 Bacteria 6531
485 Ga0207707_10178775 3300025912 Bacteria 1853
486 Ga0207707_10393042 3300025912 Unclassified 1191
487 Ga0207707_10671939 3300025912 Bacteria 872
488 Ga0207707_10805229 3300025912 Bacteria 782
489 Ga0207671_10718342 3300025914 Bacteria 794
490 Ga0207660_10017237 3300025917 Bacteria 4794
491 Ga0207660_10155820 3300025917 Bacteria 1758
492 Ga0207660_10168419 3300025917 Bacteria 1694
493 Ga0207662_10085898 3300025918 Bacteria 1927
494 Ga0207662_10636895 3300025918 Bacteria 744
495 Ga0207657_10003899 3300025919 Bacteria 15830
496 Ga0207657_10096050 3300025919 Bacteria 2465
497 Ga0207657_10194098 3300025919 Bacteria 1636
498 Ga0207657_10210994 3300025919 Bacteria 1559
499 Ga0207657_10583151 3300025919 Unclassified 873
500 Ga0207657_10999542 3300025919 Bacteria 642
501 Ga0207657_11190135 3300025919 Bacteria 580
502 Ga0207649_10006520 3300025920 Bacteria 6341
503 Ga0207649_10045143 3300025920 Bacteria 2700
504 Ga0207649_10300772 3300025920 Bacteria 1173
505 Ga0207649_11365178 3300025920 Bacteria 561
506 Ga0207652_10049961 3300025921 Bacteria 3582
507 Ga0207652_10131826 3300025921 Bacteria 2229
508 Ga0207652_10427981 3300025921 Unclassified 1194
509 Ga0207652_10675408 3300025921 Bacteria 923
510 Ga0207646_10188524 3300025922 Bacteria 1863
511 Ga0207646_10270563 3300025922 Unclassified 1536
512 Ga0207646_11830118 3300025922 Unclassified 519
513 Ga0207681_10124965 3300025923 Bacteria 1893
514 Ga0207681_10306574 3300025923 Bacteria 1258
515 Ga0207681_10348453 3300025923 Unclassified 1185
516 Ga0207681_10683881 3300025923 Unclassified 852
517 Ga0207681_10717210 3300025923 Unclassified 832
518 Ga0207694_10118485 3300025924 Bacteria 2112
519 Ga0207694_11682504 3300025924 Bacteria 534
520 Ga0207650_11468665 3300025925 Bacteria 580
521 Ga0207650_11523066 3300025925 Unclassified 568
522 Ga0207659_10050673 3300025926 Bacteria 2950
523 Ga0207659_10121009 3300025926 Bacteria 2006
524 Ga0207659_10126612 3300025926 Bacteria 1965
525 Ga0207659_10193288 3300025926 Bacteria 1620
526 Ga0207659_10701790 3300025926 Bacteria 866
527 Ga0207687_10012133 3300025927 Bacteria 5635
528 Ga0207687_10013736 3300025927 Bacteria 5288
529 Ga0207687_10190967 3300025927 Bacteria 1594
530 Ga0207687_10329199 3300025927 Unclassified 1239
531 Ga0207687_10926236 3300025927 Bacteria 746
532 Ga0207644_10645960 3300025931 Bacteria 880
533 Ga0207644_10960397 3300025931 Bacteria 717
534 Ga0207644_11097051 3300025931 Bacteria 669
535 Ga0207690_10037340 3300025932 Bacteria 3153
536 Ga0207690_10051083 3300025932 Bacteria 2763
537 Ga0207690_10263376 3300025932 Bacteria 1336
538 Ga0207706_10003040 3300025933 Bacteria 16170
539 Ga0207706_10018100 3300025933 Bacteria 6339
540 Ga0207706_10025020 3300025933 Bacteria 5353
541 Ga0207706_10209297 3300025933 Bacteria 1710
542 Ga0207706_10747880 3300025933 Bacteria 833
543 Ga0207686_10282224 3300025934 Bacteria 1226
544 Ga0207686_11247868 3300025934 Archaea 609
545 Ga0207709_10043199 3300025935 Unclassified 2716
546 Ga0207709_10074295 3300025935 Bacteria 2169
547 Ga0207709_10691128 3300025935 Bacteria 816
548 Ga0207670_10122359 3300025936 Unclassified 1894
549 Ga0207670_10400516 3300025936 Bacteria 1097
550 Ga0207669_10073407 3300025937 Bacteria 2158
551 Ga0207669_10111386 3300025937 Bacteria 1835
552 Ga0207669_10163492 3300025937 Bacteria 1575
553 Ga0207669_11194503 3300025937 Bacteria 644
554 Ga0207669_11354239 3300025937 Unclassified 605
555 Ga0207669_11560249 3300025937 Archaea 563
556 Ga0207704_10067422 3300025938 Bacteria 2251
557 Ga0207704_10242297 3300025938 Bacteria 1348
558 Ga0207704_10259544 3300025938 Unclassified 1309
559 Ga0207704_11797851 3300025938 Bacteria 527
560 Ga0207691_10006406 3300025940 Bacteria 11371
561 Ga0207691_10012064 3300025940 Bacteria 8290
562 Ga0207691_10136553 3300025940 Bacteria 2162
563 Ga0207691_10540916 3300025940 Bacteria 988
564 Ga0207691_11020508 3300025940 Bacteria 690
565 Ga0207711_10043749 3300025941 Bacteria 3821
566 Ga0207711_10215795 3300025941 Bacteria 1753
567 Ga0207711_11346223 3300025941 Bacteria 656
568 Ga0207689_10121142 3300025942 Bacteria 2152
569 Ga0207689_10868378 3300025942 Bacteria 761
570 Ga0207689_11530401 3300025942 Unclassified 556
571 Ga0207689_11558846 3300025942 Bacteria 550
572 Ga0207689_11633856 3300025942 Bacteria 535
573 Ga0207661_10000612 3300025944 Bacteria 22876
574 Ga0207661_10033009 3300025944 Bacteria 4015
575 Ga0207661_10036867 3300025944 Bacteria 3820
576 Ga0207661_10205708 3300025944 Bacteria 1733
577 Ga0207661_10277007 3300025944 Bacteria 1498
578 Ga0207661_10341501 3300025944 Unclassified 1349
579 Ga0207661_10377166 3300025944 Archaea 1283
580 Ga0207661_11334018 3300025944 Bacteria 659
581 Ga0207661_11720266 3300025944 Bacteria 572
582 Ga0207679_10117357 3300025945 Bacteria 2112
583 Ga0207679_10133330 3300025945 Bacteria 1996
584 Ga0207679_10217596 3300025945 Bacteria 1605
585 Ga0207679_10294743 3300025945 Unclassified 1396
586 Ga0207679_10710625 3300025945 Unclassified 912
587 Ga0207679_10741182 3300025945 Bacteria 893
588 Ga0207679_11340165 3300025945 Bacteria 657
589 Ga0207667_11344700 3300025949 Bacteria 689
590 Ga0207651_10184857 3300025960 Unclassified 1657
591 Ga0207651_11223308 3300025960 Bacteria 674
592 Ga0207712_10898689 3300025961 Bacteria 783
593 Ga0207668_10029857 3300025972 Bacteria 3578
594 Ga0207668_10718474 3300025972 Bacteria 879
595 Ga0207640_10074967 3300025981 Bacteria 2291
596 Ga0207640_10496448 3300025981 Archaea 1015
597 Ga0207640_11348832 3300025981 Unclassified 638
598 Ga0207640_11459965 3300025981 Bacteria 614
599 Ga0207658_10828041 3300025986 Bacteria 841
600 Ga0207677_10027716 3300026023 Bacteria 3573
601 Ga0207677_10315501 3300026023 Bacteria 1297
602 Ga0207677_10895731 3300026023 Bacteria 799
603 Ga0207677_11111706 3300026023 Bacteria 721
604 Ga0207677_11331989 3300026023 Archaea 660
605 Ga0207703_10051335 3300026035 Bacteria 3341
606 Ga0207703_10980027 3300026035 Bacteria 811
607 Ga0207639_10012338 3300026041 Bacteria 5950
608 Ga0207639_10519206 3300026041 Unclassified 1090
609 Ga0207639_11199777 3300026041 Unclassified 712
610 Ga0207639_11716654 3300026041 Bacteria 588
611 Ga0207678_10023034 3300026067 Bacteria 5450
612 Ga0207678_10177813 3300026067 Bacteria 1817
613 Ga0207678_10438064 3300026067 Bacteria 1135
614 Ga0207708_10015196 3300026075 Bacteria 5771
615 Ga0207708_10016992 3300026075 Bacteria 5477
616 Ga0207708_10060405 3300026075 Bacteria 2893
617 Ga0207708_10248364 3300026075 Bacteria 1433
618 Ga0207702_10074671 3300026078 Bacteria 2927
619 Ga0207702_10206917 3300026078 Bacteria 1822
620 Ga0207702_10417877 3300026078 Bacteria 1296
621 Ga0207641_10790612 3300026088 Bacteria 938
622 Ga0207648_10051981 3300026089 Bacteria 3582
623 Ga0207648_10125301 3300026089 Bacteria 2260
624 Ga0207648_10182488 3300026089 Bacteria 1858
625 Ga0207648_10185847 3300026089 Bacteria 1841
626 Ga0207648_10445614 3300026089 Bacteria 1178
627 Ga0207648_11628147 3300026089 Unclassified 607
628 Ga0207676_10276214 3300026095 Bacteria 1523
629 Ga0207676_10579641 3300026095 Bacteria 1075
630 Ga0207676_10960354 3300026095 Bacteria 841
631 Ga0207676_11662958 3300026095 Bacteria 637
632 Ga0207676_11736969 3300026095 Unclassified 622
633 Ga0207674_10031518 3300026116 Bacteria 5569
634 Ga0207674_10060638 3300026116 Bacteria 3824
635 Ga0207674_10431412 3300026116 Unclassified 1274
636 Ga0207674_11081827 3300026116 Bacteria 771
637 Ga0207674_11184008 3300026116 Bacteria 734
638 Ga0207675_100119742 3300026118 Bacteria 2490
639 Ga0207675_100647694 3300026118 Unclassified 1062
640 Ga0207683_10004422 3300026121 Bacteria 12149
641 Ga0207683_10025471 3300026121 Bacteria 5104
642 Ga0207683_10061101 3300026121 Bacteria 3315
643 Ga0207683_10115188 3300026121 Bacteria 2410
644 Ga0207683_10260174 3300026121 Bacteria 1584
645 Ga0207683_10833282 3300026121 Bacteria 856
646 Ga0207683_11157473 3300026121 Archaea 717
647 Ga0207683_11528163 3300026121 Bacteria 616
648 Ga0207698_10003410 3300026142 Bacteria 9566
649 Ga0207698_10052158 3300026142 Bacteria 3132
650 Ga0207698_10069554 3300026142 Bacteria 2784
651 Ga0207698_10096671 3300026142 Bacteria 2435
652 Ga0207698_10485231 3300026142 Bacteria 1200
653 Ga0207698_12233416 3300026142 Unclassified 560
654 Ga0209998_10052091 3300027717 Unclassified 949
655 Ga0209813_10469070 3300027866 Bacteria 518
656 Ga0209974_10158418 3300027876 Bacteria 820
657 Ga0207428_10002314 3300027907 Bacteria 19080
658 Ga0207428_10167268 3300027907 Bacteria 1667
659 Ga0207428_10175303 3300027907 Bacteria 1622
660 Ga0268266_10249643 3300028379 Bacteria 1641
661 Ga0268266_10510220 3300028379 Bacteria 1149
662 Ga0268266_10642900 3300028379 Bacteria 1021
663 Ga0268266_11364561 3300028379 Bacteria 684
664 Ga0268265_11237955 3300028380 Unclassified 745
665 Ga0268265_11550855 3300028380 Bacteria 667
666 Ga0268264_10036367 3300028381 Bacteria 4057
667 Ga0268264_10661439 3300028381 Unclassified 1035
668 Ga0307408_100885856 3300031548 Bacteria 816
669 Ga0307405_10730476 3300031731 Bacteria 823
670 Ga0307405_10804385 3300031731 Bacteria 788
671 Ga0326468_10084057 3300031889 Unclassified 556
672 Ga0307416_100149706 3300032002 Bacteria 2138
673 Ga0307416_100636788 3300032002 Bacteria 1150
674 Ga0307415_100459462 3300032126 Bacteria 1103
675 Ga0373948_0013703 3300034817 Bacteria 1468
676 Ga0373938_0136265 3300034957 Bacteria 644
677 Ga0373928_0035993 3300035084 Bacteria 1118
678 Ga0373949_0089257 3300035090 Bacteria 831
679 Ga0373951_0097676 3300035091 Bacteria 777
680 Ga0373941_0013948 3300035115 Bacteria 2136
681 Ga0373960_0093458 3300035121 Unclassified 965
682 Ga0373942_0199928 3300035207 Bacteria 662
683 Ga0373961_0081863 3300035241 Bacteria 1017
684 Ga0373962_0027361 3300035242 Bacteria 1542
685 Ga0373931_0072674 3300035691 Bacteria 1881
686 Ga0373931_0260963 3300035691 Unclassified 1057
687 Ga0373937_1789897 3300036401 Bacteria 561
688 Ga0395899_0053875 3300037312 Bacteria 2978
689 Ga0395900_0005363 3300037418 Bacteria 13437
690 Ga0395900_0056240 3300037418 Bacteria 4050
691 Ga0395900_0088732 3300037418 Bacteria 3179
692 Ga0395900_0193927 3300037418 Unclassified 2059
693 Ga0395900_0671501 3300037418 Bacteria 971
694 Ga0395898_0063334 3300037466 Bacteria 3589
695 Ga0395898_0071698 3300037466 Bacteria 3347
696 Ga0395898_0117909 3300037466 Bacteria 2543
697 Ga0395898_1628378 3300037466 Unclassified 569
698 Ga0395898_1693641 3300037466 Unclassified 555
699 Ga0395905_0006331 3300037471 Bacteria 11928
700 Ga0395905_0027035 3300037471 Bacteria 5411
701 Ga0395905_0062102 3300037471 Bacteria 3495
702 Ga0395905_0105649 3300037471 Bacteria 2644
703 Ga0395901_0013286 3300038443 Bacteria 8363
704 Ga0395901_0021597 3300038443 Bacteria 6595
705 Ga0395901_0030277 3300038443 Bacteria 5576
706 Ga0395901_0067669 3300038443 Bacteria 3720
707 Ga0395901_0083956 3300038443 Bacteria 3329
708 Ga0395901_0757946 3300038443 Bacteria 963
709 Ga0395901_0787498 3300038443 Bacteria 941
710 Ga0395901_1426352 3300038443 Bacteria 650
711 Ga0451787_144833 3300041441 Bacteria 581
712 Ga0451789_0067247 3300041443 Bacteria 630
713 Ga0451789_0622442 3300041443 Bacteria 1140
714 Ga0451793_0217906 3300041452 Unclassified 1348
715 Ga0451802_0539959 3300041460 Bacteria 1034
716 Ga0451802_2123391 3300041460 Bacteria 972
717 Ga0451807_1505927 3300041486 Bacteria 630
718 Ga0451835_0445768 3300041492 Bacteria 802
719 Ga0451837_1813209 3300041494 Bacteria 564
720 Ga0451853_3086998 3300041512 Unclassified 1193
721 Ga0450911_028724 3300042115 Bacteria 721
722 Ga0450920_002200 3300042122 Bacteria 3301
723 Ga0450923_039659 3300042125 Unclassified 986
724 Ga0450890_060459 3300042127 Bacteria 593
725 Ga0450898_090077 3300042134 Unclassified 632
726 Ga0450902_009145 3300042137 Unclassified 1558
727 Ga0450906_016580 3300042145 Bacteria 1332
728 Ga0450907_059315 3300042146 Bacteria 660
729 Ga0439458_0044625 3300042157 Unclassified 1083
730 Ga0450908_025444 3300042184 Bacteria 1034
731 Ga0450909_070273 3300042185 Bacteria 560
732 Ga0439464_0295073 3300042439 Bacteria 529
733 Ga0450916_034239 3300042530 Unclassified 751
734 Ga0450918_013958 3300042531 Bacteria 1397
735 Ga0439440_0232638 3300042993 Bacteria 556
736 Ga0466967_0350002 3300045976 Bacteria 1430
737 Ga0495603_0035069 3300046455 Bacteria 3015
738 Ga0495603_0264450 3300046455 Bacteria 990
739 Ga0495641_0270051 3300046461 Bacteria 765
740 Ga0495651_0500581 3300046462 Bacteria 778
741 Ga0495582_0443499 3300046473 Bacteria 749
742 Ga0495605_0138172 3300046474 Bacteria 1095
743 Ga0495584_0613625 3300046491 Bacteria 555
744 Ga0495585_0244741 3300046492 Bacteria 897
745 Ga0495596_0105550 3300046500 Bacteria 1094
746 Ga0495596_0405762 3300046500 Bacteria 531
747 Ga0495608_0138327 3300046511 Bacteria 1555
748 Ga0495616_0280749 3300046513 Bacteria 708
749 Ga0495618_0646578 3300046514 Bacteria 626
750 Ga0495620_0210159 3300046515 Bacteria 747
751 Ga0495628_0219470 3300046516 Bacteria 1428
752 Ga0495628_0777536 3300046516 Bacteria 671
753 Ga0495630_0143599 3300046517 Bacteria 1815
754 Ga0495644_0043043 3300046523 Unclassified 1700
755 Ga0495587_0709012 3300046536 Bacteria 551
756 Ga0495598_0259894 3300046537 Bacteria 646
757 Ga0495645_0347890 3300046543 Bacteria 956
758 Ga0495667_0957206 3300046559 Unclassified 523
759 Ga0495656_0172387 3300046615 Unclassified 1059
760 Ga0495656_0337502 3300046615 Bacteria 779
761 Ga0495656_0712993 3300046615 Bacteria 540
762 Ga0495634_0820110 3300046642 Bacteria 530
763 Ga0495611_0223513 3300046648 Bacteria 876
764 Ga0495635_0199282 3300046663 Bacteria 1358
765 Ga0495659_0102784 3300046664 Bacteria 1109
766 Ga0495588_0327785 3300046674 Bacteria 805
767 Ga0495658_0482207 3300046683 Bacteria 793
768 Ga0495658_0736409 3300046683 Bacteria 632
769 Ga0495658_0850368 3300046683 Unclassified 584
770 Ga0495624_0350387 3300046690 Bacteria 888
771 Ga0495624_0564779 3300046690 Bacteria 679
772 Ga0495670_0410725 3300046691 Bacteria 732
773 Ga0495671_0058339 3300046692 Bacteria 1910
774 Ga0495589_0045256 3300046794 Bacteria 2187
775 Ga0495600_0698996 3300046809 Bacteria 610
776 Ga0495660_0489572 3300046810 Bacteria 527
777 Ga0495581_0539635 3300047315 Bacteria 677
778 Ga0495604_0245016 3300047317 Bacteria 1224
779 Ga0495604_0589546 3300047317 Bacteria 714
780 Ga0495636_0087635 3300047318 Bacteria 1348
781 Ga0495674_0120853 3300047319 Bacteria 2213
782 Ga0495676_0336055 3300047321 Bacteria 1012
783 Ga0495676_1031363 3300047321 Unclassified 524
784 Ga0495675_0243476 3300047444 Bacteria 1082
785 Ga0495684_0605319 3300047471 Bacteria 739
786 Ga0496100_0432659 3300048903 Bacteria 1006
787 Ga0496100_0554901 3300048903 Bacteria 889
788 Ga0496100_0849718 3300048903 Bacteria 716
789 Ga0496100_1306091 3300048903 Bacteria 572
790 Ga0496101_0130884 3300048904 Bacteria 1905
791 Ga0496101_0138299 3300048904 Unclassified 1855
792 Ga0496101_0217352 3300048904 Bacteria 1482
793 Ga0496101_1157668 3300048904 Bacteria 607
794 Ga0496102_0234483 3300048905 Unclassified 1730
795 Ga0496102_0527928 3300048905 Bacteria 1103
796 Ga0496102_0615214 3300048905 Bacteria 1009
797 Ga0496102_0668846 3300048905 Bacteria 961
798 Ga0496102_1524458 3300048905 Archaea 587
799 Ga0496102_1729973 3300048905 Bacteria 543
800 Ga0496103_0160526 3300048906 Unclassified 1442
801 Ga0496104_0027875 3300048907 Bacteria 5230
802 Ga0496104_0230746 3300048907 Bacteria 1763
803 Ga0496104_0303765 3300048907 Unclassified 1508
804 Ga0496104_0382872 3300048907 Bacteria 1319
805 Ga0496104_1101567 3300048907 Bacteria 698
806 Ga0496104_1355928 3300048907 Bacteria 614
807 Ga0496104_1378047 3300048907 Bacteria 608
808 Ga0496105_0120951 3300048908 Bacteria 2159
809 Ga0496105_0215961 3300048908 Bacteria 1562
810 Ga0496105_0364671 3300048908 Bacteria 1152
811 Ga0496105_0584496 3300048908 Bacteria 868
812 Ga0496106_0025632 3300048909 Bacteria 4390
813 Ga0496107_0191368 3300048910 Bacteria 1520
814 Ga0496107_0429079 3300048910 Bacteria 983
815 Ga0496107_1337180 3300048910 Bacteria 512
816 Ga0496108_0019446 3300048911 Bacteria 5578
817 Ga0496108_0270465 3300048911 Bacteria 1479
818 Ga0496108_0652845 3300048911 Bacteria 914
819 Ga0496108_1463315 3300048911 Bacteria 569
820 Ga0496108_1568393 3300048911 Bacteria 546
821 Ga0496109_0002689 3300048912 Bacteria 14909
822 Ga0496109_0011202 3300048912 Bacteria 7696
823 Ga0496109_0084789 3300048912 Bacteria 2923
824 Ga0496109_0121469 3300048912 Unclassified 2434
825 Ga0496109_0522717 3300048912 Bacteria 1120
826 Ga0496109_1167443 3300048912 Bacteria 707
827 Ga0496109_1768708 3300048912 Archaea 551
828 Ga0496109_1882614 3300048912 Bacteria 531
829 Ga0496110_0030503 3300048913 Bacteria 4648
830 Ga0496110_0033633 3300048913 Bacteria 4436
831 Ga0496110_0831379 3300048913 Bacteria 828
832 Ga0496110_1686591 3300048913 Unclassified 544
833 Ga0496110_1730585 3300048913 Unclassified 535
834 Ga0496111_0003152 3300048914 Bacteria 10149
835 Ga0496111_0067911 3300048914 Bacteria 2590
836 Ga0496111_0259350 3300048914 Bacteria 1290
837 Ga0496111_0506762 3300048914 Unclassified 888
838 Ga0496112_0148129 3300048915 Bacteria 2315
839 Ga0496112_0218787 3300048915 Bacteria 1861
840 Ga0496113_0239154 3300048916 Bacteria 1449
841 Ga0496114_0127020 3300048917 Bacteria 2199
842 Ga0496114_0146112 3300048917 Bacteria 2050
843 Ga0496114_0217280 3300048917 Unclassified 1678
844 Ga0496114_0325870 3300048917 Bacteria 1358
845 Ga0496114_0336944 3300048917 Bacteria 1333
846 Ga0496114_0381691 3300048917 Bacteria 1247
847 Ga0496114_0445050 3300048917 Bacteria 1147
848 Ga0496114_0489201 3300048917 Bacteria 1088
849 Ga0496114_0513982 3300048917 Bacteria 1059
850 Ga0496114_1112719 3300048917 Bacteria 675
851 Ga0501031_0001754 3300049568 Bacteria 13605
852 Ga0501031_0152337 3300049568 Bacteria 1511
853 Ga0501031_0214057 3300049568 Bacteria 1255
854 Ga0501031_0609937 3300049568 Bacteria 702
855 Ga0501031_0748699 3300049568 Bacteria 627
856 Ga0501032_0014533 3300049569 Bacteria 5574
857 Ga0501032_0015883 3300049569 Bacteria 5304
858 Ga0501032_0143422 3300049569 Bacteria 1572
859 Ga0501032_0175329 3300049569 Bacteria 1405
860 Ga0501032_0352308 3300049569 Bacteria 948
861 Ga0501032_0594350 3300049569 Bacteria 704
862 Ga0501033_0021291 3300049570 Bacteria 4891
863 Ga0501033_0123752 3300049570 Bacteria 1875
864 Ga0501033_0224595 3300049570 Bacteria 1336
865 Ga0501034_0121208 3300049571 Bacteria 2602
866 Ga0501034_0207367 3300049571 Bacteria 1916
867 Ga0501036_0022147 3300049572 Bacteria 5345
868 Ga0501036_0036855 3300049572 Bacteria 4137
869 Ga0501036_0046920 3300049572 Bacteria 3658
870 Ga0501036_0054874 3300049572 Bacteria 3376
871 Ga0501036_0103525 3300049572 Bacteria 2407
872 Ga0501036_0331860 3300049572 Bacteria 1270
873 Ga0501036_0338754 3300049572 Bacteria 1256
874 Ga0501036_1579255 3300049572 Unclassified 530
875 Ga0501037_0001734 3300049573 Bacteria 15838
876 Ga0501037_0012017 3300049573 Bacteria 6379
877 Ga0501037_0076460 3300049573 Bacteria 2430
878 Ga0501037_0225254 3300049573 Bacteria 1318
879 Ga0501037_0258555 3300049573 Bacteria 1217
880 Ga0501038_0010491 3300049574 Bacteria 8472
881 Ga0501038_0020457 3300049574 Bacteria 5948
882 Ga0501038_0021628 3300049574 Bacteria 5771
883 Ga0501038_0046809 3300049574 Bacteria 3749
884 Ga0501038_0371394 3300049574 Bacteria 1111
885 Ga0501038_0925532 3300049574 Bacteria 643
886 Ga0501038_0971800 3300049574 Bacteria 624
887 Ga0501038_1013005 3300049574 Unclassified 609
888 Ga0501038_1200320 3300049574 Unclassified 551
889 Ga0501039_0013914 3300049575 Bacteria 6155
890 Ga0501039_0055895 3300049575 Bacteria 3058
891 Ga0501039_0067408 3300049575 Bacteria 2779
892 Ga0501039_0068069 3300049575 Bacteria 2765
893 Ga0501039_0110088 3300049575 Bacteria 2153
894 Ga0501039_0135629 3300049575 Bacteria 1932
895 Ga0501039_0198444 3300049575 Bacteria 1578
896 Ga0501039_0290168 3300049575 Bacteria 1286
897 Ga0501039_0328024 3300049575 Bacteria 1203
898 Ga0501040_0019285 3300049576 Bacteria 4536
899 Ga0501040_0022250 3300049576 Bacteria 4241
900 Ga0501040_0041611 3300049576 Bacteria 3129
901 Ga0501040_0052374 3300049576 Bacteria 2793
902 Ga0501040_0062134 3300049576 Bacteria 2570
903 Ga0501040_0112106 3300049576 Unclassified 1908
904 Ga0501040_0112614 3300049576 Unclassified 1904
905 Ga0501040_0117512 3300049576 Bacteria 1864
906 Ga0501040_0252341 3300049576 Bacteria 1258
907 Ga0501040_0435522 3300049576 Bacteria 943
908 Ga0501041_0006203 3300049577 Bacteria 6988
909 Ga0501041_0007256 3300049577 Bacteria 6505
910 Ga0501041_0028618 3300049577 Bacteria 3361
911 Ga0501041_0079270 3300049577 Bacteria 2021
912 Ga0501041_0392273 3300049577 Unclassified 879
913 Ga0501041_0501330 3300049577 Bacteria 772
914 Ga0501041_0597561 3300049577 Bacteria 704
915 Ga0501042_0006488 3300049578 Bacteria 7597
916 Ga0501042_0016796 3300049578 Bacteria 5033
917 Ga0501042_0058535 3300049578 Bacteria 2751
918 Ga0501042_0113882 3300049578 Bacteria 1947
919 Ga0501042_0242329 3300049578 Bacteria 1301
920 Ga0501042_0475668 3300049578 Bacteria 906
921 Ga0501042_1377111 3300049578 Unclassified 514
922 Ga0501043_0057097 3300049579 Bacteria 3065
923 Ga0501043_0081566 3300049579 Unclassified 2542
924 Ga0501043_0098803 3300049579 Bacteria 2294
925 Ga0501043_0329677 3300049579 Bacteria 1162
926 Ga0501043_0363906 3300049579 Bacteria 1097
927 Ga0501046_0003198 3300049580 Bacteria 15071
928 Ga0501046_0048035 3300049580 Bacteria 3381
929 Ga0501046_0063500 3300049580 Bacteria 2883
930 Ga0501046_0103819 3300049580 Bacteria 2178
931 Ga0501046_0138552 3300049580 Bacteria 1842
932 Ga0501046_0287854 3300049580 Unclassified 1202
933 Ga0501046_0769721 3300049580 Unclassified 676
934 Ga0501047_0513915 3300049581 Bacteria 1024
935 Ga0501048_0005712 3300049582 Bacteria 9456
936 Ga0501048_0016260 3300049582 Bacteria 5484
937 Ga0501048_0049671 3300049582 Bacteria 2989
938 Ga0501048_0057482 3300049582 Bacteria 2759
939 Ga0501048_0083215 3300049582 Bacteria 2257
940 Ga0501048_0092389 3300049582 Bacteria 2134
941 Ga0501048_0190743 3300049582 Bacteria 1452
942 Ga0501048_0455541 3300049582 Bacteria 916
943 Ga0501067_0029785 3300049583 Bacteria 3026
944 Ga0501067_0416262 3300049583 Unclassified 750
945 Ga0501067_0533503 3300049583 Bacteria 657
946 Ga0501068_0011157 3300049584 Bacteria 5063
947 Ga0501068_0011596 3300049584 Bacteria 4978
948 Ga0501068_0147984 3300049584 Bacteria 1475
949 Ga0501068_0186174 3300049584 Bacteria 1314
950 Ga0501068_0194918 3300049584 Bacteria 1284
951 Ga0501068_0245792 3300049584 Bacteria 1139
952 Ga0501068_0330909 3300049584 Bacteria 977
953 Ga0501069_0000404 3300049585 Bacteria 19543
954 Ga0501069_0005994 3300049585 Bacteria 6340
955 Ga0501069_0023246 3300049585 Bacteria 3378
956 Ga0501069_0071781 3300049585 Bacteria 1941
957 Ga0501069_0084634 3300049585 Bacteria 1789
958 Ga0501069_0104261 3300049585 Unclassified 1611
959 Ga0501069_0121787 3300049585 Bacteria 1490
960 Ga0501069_0451383 3300049585 Bacteria 764
961 Ga0501069_0956969 3300049585 Bacteria 522
962 Ga0501070_0038832 3300049586 Bacteria 3972
963 Ga0501070_0120293 3300049586 Bacteria 2170
964 Ga0501070_0142276 3300049586 Bacteria 1980
965 Ga0501070_0330457 3300049586 Bacteria 1239
966 Ga0501070_0980483 3300049586 Bacteria 656
967 Ga0501070_1474431 3300049586 Bacteria 515
968 Ga0501071_0007629 3300049587 Bacteria 7128
969 Ga0501071_0017219 3300049587 Bacteria 4981
970 Ga0501071_0023334 3300049587 Bacteria 4320
971 Ga0501071_0035205 3300049587 Bacteria 3566
972 Ga0501071_0054966 3300049587 Bacteria 2873
973 Ga0501071_0070959 3300049587 Bacteria 2539
974 Ga0501071_0128945 3300049587 Bacteria 1878
975 Ga0501071_0511580 3300049587 Bacteria 921
976 Ga0501071_1391546 3300049587 Bacteria 542
977 Ga0501072_0024283 3300049588 Bacteria 4714
978 Ga0501072_0031317 3300049588 Bacteria 4162
979 Ga0501072_0047202 3300049588 Bacteria 3391
980 Ga0501072_0141758 3300049588 Bacteria 1916
981 Ga0501072_0273398 3300049588 Bacteria 1344
982 Ga0501072_0589395 3300049588 Bacteria 877
983 Ga0501072_1221232 3300049588 Bacteria 584
984 Ga0501073_0027444 3300049589 Bacteria 4071
985 Ga0501073_0036973 3300049589 Bacteria 3468
986 Ga0501073_0045539 3300049589 Bacteria 3089
987 Ga0501074_0010424 3300049590 Bacteria 6744
988 Ga0501074_0035462 3300049590 Bacteria 3614
989 Ga0501074_0046674 3300049590 Bacteria 3132
990 Ga0501074_0075607 3300049590 Bacteria 2417
991 Ga0501074_0083713 3300049590 Bacteria 2287
992 Ga0501074_0191407 3300049590 Unclassified 1458
993 Ga0501074_0903316 3300049590 Bacteria 622
994 Ga0501074_0912687 3300049590 Unclassified 618
995 Ga0501075_0079617 3300049591 Bacteria 2479
996 Ga0501075_0086681 3300049591 Bacteria 2372
997 Ga0501075_0111997 3300049591 Bacteria 2075
998 Ga0501075_0213807 3300049591 Bacteria 1470
999 Ga0501075_0224889 3300049591 Bacteria 1431
1000 Ga0501075_0246283 3300049591 Bacteria 1362
1001 Ga0501075_0267587 3300049591 Bacteria 1302
1002 Ga0501075_0997239 3300049591 Bacteria 636
1003 Ga0501076_0001971 3300049592 Bacteria 14012
1004 Ga0501076_0030067 3300049592 Bacteria 4229
1005 Ga0501076_0040451 3300049592 Bacteria 3664
1006 Ga0501076_0062557 3300049592 Bacteria 2964
1007 Ga0501076_0071760 3300049592 Bacteria 2770
1008 Ga0501076_0077841 3300049592 Bacteria 2660
1009 Ga0501076_0129944 3300049592 Bacteria 2043
1010 Ga0501076_0134821 3300049592 Bacteria 2004
1011 Ga0501076_0154388 3300049592 Bacteria 1868
1012 Ga0501076_0160284 3300049592 Bacteria 1832
1013 Ga0501076_0357025 3300049592 Bacteria 1200
1014 Ga0501076_0720248 3300049592 Archaea 823
1015 Ga0501077_0011287 3300049593 Bacteria 5577
1016 Ga0501077_0023420 3300049593 Bacteria 3915
1017 Ga0501077_0061071 3300049593 Bacteria 2391
1018 Ga0501077_0100358 3300049593 Bacteria 1834
1019 Ga0501077_0109828 3300049593 Bacteria 1747
1020 Ga0501077_0221591 3300049593 Bacteria 1202
1021 Ga0501077_0361937 3300049593 Bacteria 926
1022 Ga0501077_0571907 3300049593 Bacteria 725
1023 Ga0501077_0939064 3300049593 Bacteria 556
1024 Ga0501079_0012614 3300049741 Bacteria 6453
1025 Ga0501079_0027218 3300049741 Bacteria 4383
1026 Ga0501079_0037136 3300049741 Bacteria 3753
1027 Ga0501079_0092603 3300049741 Unclassified 2341
1028 Ga0501079_0149866 3300049741 Bacteria 1818
1029 Ga0501079_0329425 3300049741 Bacteria 1196
1030 Ga0501079_0537722 3300049741 Bacteria 919
1031 Ga0501079_0579047 3300049741 Bacteria 883
1032 Ga0501079_1326048 3300049741 Bacteria 566
1033 Ga0501080_0009195 3300049742 Bacteria 9002
1034 Ga0501080_0010484 3300049742 Bacteria 8487
1035 Ga0501080_0054290 3300049742 Bacteria 3730
1036 Ga0501080_0079553 3300049742 Bacteria 3047
1037 Ga0501080_0097690 3300049742 Bacteria 2727
1038 Ga0501080_0195377 3300049742 Bacteria 1859
1039 Ga0501080_0279880 3300049742 Bacteria 1517
1040 Ga0501080_0287468 3300049742 Bacteria 1494
1041 Ga0501080_0357664 3300049742 Bacteria 1317
1042 Ga0501080_0505965 3300049742 Bacteria 1079
1043 Ga0501080_1230120 3300049742 Bacteria 643
1044 Ga0501081_0007559 3300049743 Bacteria 7047
1045 Ga0501081_0026901 3300049743 Bacteria 3881
1046 Ga0501081_0122242 3300049743 Bacteria 1855
1047 Ga0501081_0133582 3300049743 Bacteria 1774
1048 Ga0501081_0143009 3300049743 Bacteria 1715
1049 Ga0501081_0252163 3300049743 Bacteria 1288
1050 Ga0501081_0458080 3300049743 Bacteria 948
1051 Ga0501083_0006299 3300049744 Bacteria 8416
1052 Ga0501083_0009341 3300049744 Bacteria 6921
1053 Ga0501083_0029146 3300049744 Bacteria 3799
1054 Ga0501083_0311954 3300049744 Unclassified 1023
1055 Ga0501083_0394585 3300049744 Bacteria 900
1056 Ga0501083_0815682 3300049744 Bacteria 607
1057 Ga0501035_0026164 3300049822 Bacteria 5342
1058 Ga0501035_0034600 3300049822 Bacteria 4589
1059 Ga0501035_0110735 3300049822 Bacteria 2406
1060 Ga0501035_0111907 3300049822 Bacteria 2392
1061 Ga0501035_0508606 3300049822 Bacteria 991
1062 Ga0501035_0603218 3300049822 Bacteria 894
1063 Ga0501035_1191426 3300049822 Unclassified 591
1064 Ga0501044_0146738 3300049823 Bacteria 2344
1065 Ga0501044_0607539 3300049823 Bacteria 986
1066 Ga0501044_0773261 3300049823 Bacteria 841
1067 Ga0501045_0016648 3300049824 Bacteria 5223
1068 Ga0501045_0026675 3300049824 Bacteria 4157
1069 Ga0501045_0028937 3300049824 Bacteria 3999
1070 Ga0501045_0045530 3300049824 Bacteria 3194
1071 Ga0501045_0065278 3300049824 Bacteria 2672
1072 Ga0501045_0084664 3300049824 Bacteria 2339
1073 Ga0501045_0359545 3300049824 Archaea 1083
1074 Ga0501045_0529024 3300049824 Bacteria 875
1075 Ga0501045_1084983 3300049824 Bacteria 586
1076 nmdc:mga03n38_33083_c1 3300050490 Bacteria 2196
1077 nmdc:mga00v17_149210_c1 3300050491 Bacteria 1502
1078 nmdc:mga0yw44_686432_c1 3300050492 Unclassified 696
1079 nmdc:mga0yw44_95997_c1 3300050492 Bacteria 1881
1080 nmdc:mga04h51_141322_c1 3300050495 Bacteria 913
1081 nmdc:mga05p37_2048777_c1 3300050507 Unclassified 539
1082 nmdc:mga05p37_22081_c1 3300050507 Bacteria 7713
1083 nmdc:mga05p37_23743_c1 3300050507 Bacteria 7446
1084 nmdc:mga05p37_247142_c1 3300050507 Bacteria 2141
1085 nmdc:mga09592_1365894_c1 3300050508 Bacteria 580
1086 nmdc:mga09592_28987_c1 3300050508 Bacteria 4603
1087 nmdc:mga0qj67_99131_c1 3300050509 Bacteria 2347
1088 nmdc:mga06r32_1344820_c1 3300050510 Unclassified 657
1089 nmdc:mga06r32_840086_c1 3300050510 Bacteria 877
1090 nmdc:mga08y16_1169611_c1 3300050511 Bacteria 741
1091 nmdc:mga08y16_128631_c1 3300050511 Bacteria 2634
1092 nmdc:mga08y16_33557_c1 3300050511 Bacteria 5390
1093 nmdc:mga08y16_74927_c1 3300050511 Bacteria 3528
1094 nmdc:mga0n895_1074783_c1 3300050512 Unclassified 783
1095 nmdc:mga0n895_528034_c1 3300050512 Bacteria 1187
1096 nmdc:mga0n895_828617_c1 3300050512 Bacteria 914
1097 nmdc:mga0a205_368361_c1 3300050515 Bacteria 1303
1098 nmdc:mga0a205_788872_c1 3300050515 Bacteria 798
1099 nmdc:mga0a205_90715_c1 3300050515 Bacteria 2953
1100 Ga0495655_0230433 3300053083 Unclassified 616
1101 Ga0495595_0008836 3300053084 Bacteria 4149
1102 Ga0495595_0091108 3300053084 Bacteria 1463
1103 Ga0495595_0667404 3300053084 Bacteria 532
1104 Ga0495619_0264311 3300053085 Bacteria 1192
1105 Ga0501084_0025140 3300054114 Bacteria 4968
1106 Ga0501084_0026068 3300054114 Bacteria 4877
1107 Ga0501084_0045376 3300054114 Bacteria 3679
1108 Ga0501084_0045652 3300054114 Bacteria 3668
1109 Ga0501084_0106836 3300054114 Bacteria 2352
1110 Ga0501084_0291123 3300054114 Bacteria 1379
1111 Ga0501084_0402064 3300054114 Bacteria 1157
1112 Ga0501084_0442549 3300054114 Bacteria 1099
1113 Ga0501084_0653507 3300054114 Bacteria 888
1114 Ga0501084_0967622 3300054114 Bacteria 715
1115 Ga0501084_1209451 3300054114 Bacteria 634
1116 Ga0587069_088426 3300059642 Bacteria 615
1117 Ga0501082_0053681 3300060353 Bacteria 3473
1118 Ga0501082_0062549 3300060353 Bacteria 3204
1119 Ga0501082_0096947 3300060353 Bacteria 2549
1120 Ga0501082_0102354 3300060353 Bacteria 2478
1121 Ga0501082_0107066 3300060353 Bacteria 2418
1122 Ga0501082_0252782 3300060353 Bacteria 1533
1123 Ga0501082_0329875 3300060353 Bacteria 1329
1124 Ga0501082_0394861 3300060353 Bacteria 1207
1125 Ga0501082_0490962 3300060353 Bacteria 1073
1126 Ga0501082_0495401 3300060353 Bacteria 1068
1127 Ga0501082_1113355 3300060353 Bacteria 690
1128 Ga0530510_0020887 3300061734 Bacteria 4656
1129 Ga0530510_0063666 3300061734 Bacteria 2670
1130 Ga0530510_0080521 3300061734 Bacteria 2370
1131 Ga0530510_0084447 3300061734 Bacteria 2312
1132 Ga0530510_0095107 3300061734 Bacteria 2176
1133 Ga0530510_0096247 3300061734 Bacteria 2164
1134 Ga0530510_0097928 3300061734 Bacteria 2145
1135 Ga0530510_0303982 3300061734 Bacteria 1194
1136 Ga0530510_0341880 3300061734 Bacteria 1123
1137 Ga0530510_0362127 3300061734 Unclassified 1090
1138 Ga0530510_0426363 3300061734 Bacteria 1001
1139 Ga0530510_0530570 3300061734 Bacteria 893
1140 Ga0530510_1216469 3300061734 Bacteria 577
1141 Ga0070706_101122012
1142 2214741331
1143 ARcpr5yngRDRAFT_c002676
1144 ARSoilOldRDRAFT_c001729
1145 JGI24747J21853_1050140
1146 JGI24739J22299_10043863
1147 JGI24743J22301_10004517
1148 JGI24743J22301_10058672
1149 JGI24743J22301_10095463
1150 JGI24738J21930_10025519
1151 JGI24738J21930_10062747
1152 JGI24744J21845_10037088
1153 JGI24744J21845_10092072
1154 JGI24034J26672_10066300
1155 JGI24034J26672_10073220
1156 JGI24742J22300_10025285
1157 JGI24742J22300_10120439
1158 JGI24751J29686_10078962
1159 JGI25406J46586_10025619
1160 JGI25406J46586_10134316
1161 Ga0058863_10000400
1162 Ga0058863_11966875
1163 Ga0058861_10036801
1164 Ga0058860_10162899
1165 Ga0058860_12210104
1166 Ga0058862_10098273
1167 Ga0070658_10012481
1168 Ga0070658_10164960
1169 Ga0070658_10983869
1170 Ga0070658_11186789
1171 Ga0070676_10120648
1172 Ga0070676_10149159
1173 Ga0070683_100018147
1174 Ga0070683_100065183
1175 Ga0070683_100120855
1176 Ga0070683_100354697
1177 Ga0070683_100520645
1178 Ga0070683_100747945
1179 Ga0070690_100472279
1180 Ga0070670_100961684
1181 Ga0070670_101320500
1182 Ga0070670_101601209
1183 Ga0068869_100023368
1184 Ga0068869_100269957
1185 Ga0068869_100308655
1186 Ga0068869_101838707
1187 Ga0068869_101874253
1188 Ga0070666_10204304
1189 Ga0070680_100007895
1190 Ga0070680_100147736
1191 Ga0070680_100376973
1192 Ga0070680_101030691
1193 Ga0070680_101272267
1194 Ga0070682_100005220
1195 Ga0070682_100108336
1196 Ga0070682_100471803
1197 Ga0070682_100523886
1198 Ga0070682_100630593
1199 Ga0070682_101825362
1200 Ga0068868_100110844
1201 Ga0068868_100415272
1202 Ga0068868_100529186
1203 Ga0068868_100796543
1204 Ga0070660_100004686
1205 Ga0070660_100063955
1206 Ga0070660_100400628
1207 Ga0070660_100405434
1208 Ga0070660_101558565
1209 Ga0070689_100149218
1210 Ga0070689_101462785
1211 Ga0070691_10001238
1212 Ga0070691_10264948
1213 Ga0070691_10372810
1214 Ga0070691_10820831
1215 Ga0070691_10822967
1216 Ga0070687_100259899
1217 Ga0070687_101357259
1218 Ga0070661_100014709
1219 Ga0070661_100076821
1220 Ga0070661_100313064
1221 Ga0070661_100419923
1222 Ga0070661_101766879
1223 Ga0070692_10012229
1224 Ga0070692_10123571
1225 Ga0070692_10240012
1226 Ga0070692_10277631
1227 Ga0070692_10862229
1228 Ga0070668_100097921
1229 Ga0070668_101224370
1230 Ga0070668_101791386
1231 Ga0070669_100061755
1232 Ga0070669_100110873
1233 Ga0070669_100216640
1234 Ga0070669_100316774
1235 Ga0070675_100013979
1236 Ga0070675_100066526
1237 Ga0070675_100077897
1238 Ga0070675_100331224
1239 Ga0070671_100192672
1240 Ga0070671_100568969
1241 Ga0070674_100024067
1242 Ga0070674_100032596
1243 Ga0070674_100066818
1244 Ga0070674_100694487
1245 Ga0070674_101029289
1246 Ga0070674_101042143
1247 Ga0070674_101767873
1248 Ga0070673_100009358
1249 Ga0070673_100052387
1250 Ga0070673_100440169
1251 Ga0070688_100020579
1252 Ga0070688_100443056
1253 Ga0070688_100629724
1254 Ga0070659_100046848
1255 Ga0070659_100055876
1256 Ga0070659_100069351
1257 Ga0070659_100134231
1258 Ga0070659_101238669
1259 Ga0070667_101273894
1260 Ga0070667_101487235
1261 Ga0070703_10252828
1262 Ga0070701_10003360
1263 Ga0070701_10165889
1264 Ga0070701_10184858
1265 Ga0070705_100057463
1266 Ga0070700_100077418
1267 Ga0070700_100135553
1268 Ga0070700_100270932
1269 Ga0070700_101191568
1270 Ga0070694_100413225
1271 Ga0070694_100450391
1272 Ga0070694_100594985
1273 Ga0070694_101352627
1274 Ga0070708_100425083
1275 Ga0070708_101340347
1276 Ga0070663_100303087
1277 Ga0070663_101279227
1278 Ga0070663_101436932
1279 Ga0070678_100017141
1280 Ga0070678_100048516
1281 Ga0070678_100362420
1282 Ga0070678_100911464
1283 Ga0070678_101533240
1284 Ga0070678_101980994
1285 Ga0070678_102185928
1286 Ga0070662_100016854
1287 Ga0070662_100019166
1288 Ga0070662_100048366
1289 Ga0070662_100053146
1290 Ga0070662_100865491
1291 Ga0070662_101905200
1292 Ga0070681_10072596
1293 Ga0070681_10180469
1294 Ga0070681_10274946
1295 Ga0070681_10385000
1296 Ga0068867_100073418
1297 Ga0068867_100215413
1298 Ga0068867_100505065
1299 Ga0068867_100552932
1300 Ga0068867_100707492
1301 Ga0068867_101077312
1302 Ga0068867_101133090
1303 Ga0070685_10025373
1304 Ga0070685_10051017
1305 Ga0070685_10517617
1306 Ga0070706_100116655
1307 Ga0070706_101633067
1308 Ga0070707_100212372
1309 Ga0070707_100300165
1310 Ga0070707_100538427
1311 Ga0070707_100599964
1312 Ga0070707_101071429
1313 Ga0070698_100422962
1314 Ga0070698_100875197
1315 Ga0070699_100751143
1316 Ga0070679_100011289
1317 Ga0070679_100037511
1318 Ga0070679_100273839
1319 Ga0070684_100030643
1320 Ga0070684_100085253
1321 Ga0070684_100108143
1322 Ga0070684_100289579
1323 Ga0070684_100346796
1324 Ga0070684_100415153
1325 Ga0070684_100670648
1326 Ga0070684_101292044
1327 Ga0068853_100014429
1328 Ga0068853_100062964
1329 Ga0068853_100167491
1330 Ga0068853_101074489
1331 Ga0070672_100012820
1332 Ga0070672_100123283
1333 Ga0070672_100128796
1334 Ga0070672_100872964
1335 Ga0070686_100029728
1336 Ga0070686_100109964
1337 Ga0070686_100628513
1338 Ga0070686_101093220
1339 Ga0070695_101023736
1340 Ga0070696_100309973
1341 Ga0070696_100507729
1342 Ga0070693_100045096
1343 Ga0070693_100072121
1344 Ga0070693_100441027
1345 Ga0070693_100603786
1346 Ga0070665_100194410
1347 Ga0070665_100390657
1348 Ga0070665_100447059
1349 Ga0070665_100982496
1350 Ga0070704_100016961
1351 Ga0070704_100073456
1352 Ga0070704_100706319
1353 Ga0070704_100893734
1354 Ga0068855_100156199
1355 Ga0068855_100345925
1356 Ga0070664_100003869
1357 Ga0070664_100010761
1358 Ga0070664_100161931
1359 Ga0070664_100169043
1360 Ga0070664_100479900
1361 Ga0070664_101377796
1362 Ga0070664_101507668
1363 Ga0068857_100071647
1364 Ga0068857_102027130
1365 Ga0068854_100003667
1366 Ga0068854_100888177
1367 Ga0068854_100915063
1368 Ga0068856_100179207
1369 Ga0068856_100203070
1370 Ga0068856_100407407
1371 Ga0070702_100016434
1372 Ga0070702_100025615
1373 Ga0070702_101322173
1374 Ga0068852_100007373
1375 Ga0068852_100043051
1376 Ga0068852_100062908
1377 Ga0068852_100247937
1378 Ga0068852_100520762
1379 Ga0068852_100653281
1380 Ga0068859_100140109
1381 Ga0068859_101434378
1382 Ga0068859_101462464
1383 Ga0068864_100015387
1384 Ga0068864_100423296
1385 Ga0068864_100659244
1386 Ga0068864_101632593
1387 Ga0068866_10037817
1388 Ga0068866_10130980
1389 Ga0068866_10186024
1390 Ga0068866_10496758
1391 Ga0068866_11162069
1392 Ga0068861_100682255
1393 Ga0068861_100791987
1394 Ga0068861_102317783
1395 Ga0068851_10135097
1396 Ga0068851_10146037
1397 Ga0068851_10330989
1398 Ga0068851_10785829
1399 Ga0068870_10047359
1400 Ga0068870_10069276
1401 Ga0068870_10176969
1402 Ga0068870_10498032
1403 Ga0068870_10792203
1404 Ga0068863_100102857
1405 Ga0068863_100319447
1406 Ga0068858_100034435
1407 Ga0068858_100387978
1408 Ga0068860_100069094
1409 Ga0068862_100503741
1410 Ga0068862_100825068
1411 Ga0081455_10012612
1412 Ga0081455_10026862
1413 Ga0081455_10030348
1414 Ga0081455_10197501
1415 Ga0081455_10450052
1416 Ga0081539_10000890
1417 Ga0081539_10000913
1418 Ga0081539_10274747
1419 Ga0075365_10185597
1420 Ga0075365_10215918
1421 Ga0075368_10386016
1422 Ga0075363_100032780
1423 Ga0075364_10555882
1424 Ga0075432_10002834
1425 Ga0075432_10315263
1426 Ga0075367_10395143
1427 Ga0097621_100335071
1428 Ga0097621_100518500
1429 Ga0097621_100700064
1430 Ga0097621_101021418
1431 Ga0068871_100530762
1432 Ga0068871_100594839
1433 Ga0068871_100914323
1434 Ga0068871_100987398
1435 Ga0068871_101674327
1436 Ga0075428_100007037
1437 Ga0075428_101504935
1438 Ga0075428_101748580
1439 Ga0075428_101769432
1440 Ga0075430_100069637
1441 Ga0075430_100250350
1442 Ga0075431_100222939
1443 Ga0075431_101128770
1444 Ga0075433_10868588
1445 Ga0075434_100619594
1446 Ga0075434_100763109
1447 Ga0075429_100015672
1448 Ga0075429_101784490
1449 Ga0068865_100010600
1450 Ga0068865_100028908
1451 Ga0068865_100061189
1452 Ga0068865_100251534
1453 Ga0068865_100657094
1454 Ga0097620_100140117
1455 Ga0097620_101434349
1456 Ga0097620_101462223
1457 Ga0075435_100281477
1458 Ga0075435_100411961
1459 Ga0105244_10413686
1460 Ga0111539_10048272
1461 Ga0111539_10434001
1462 Ga0111539_10673954
1463 Ga0111539_10920760
1464 Ga0111539_12345987
1465 Ga0111539_12598296
1466 Ga0105245_10002458
1467 Ga0105245_10037615
1468 Ga0105245_10128207
1469 Ga0105245_10340484
1470 Ga0105245_10438691
1471 Ga0105245_10587517
1472 Ga0105245_10837010
1473 Ga0105245_11184800
1474 Ga0105245_11327525
1475 Ga0105247_10016412
1476 Ga0105247_10403972
1477 Ga0114129_10006579
1478 Ga0114129_10054711
1479 Ga0114129_10772526
1480 Ga0114129_11131925
1481 Ga0114129_11260965
1482 Ga0114129_11773738
1483 Ga0114129_12557994
1484 Ga0105243_10005485
1485 Ga0105243_10114175
1486 Ga0105243_10155875
1487 Ga0105243_10299389
1488 Ga0105243_10341823
1489 Ga0105243_10657490
1490 Ga0105243_10881191
1491 Ga0105243_11125349
1492 Ga0105243_11488103
1493 Ga0105241_12182417
1494 Ga0105242_10004703
1495 Ga0105242_10131180
1496 Ga0105242_10147878
1497 Ga0105242_10302863
1498 Ga0105242_10360402
1499 Ga0105242_12214428
1500 Ga0105248_10277459
1501 Ga0105248_11035383
1502 Ga0105248_12646319
1503 Ga0105248_12667251
1504 Ga0105248_12926449
1505 Ga0105237_10362186
1506 Ga0105238_10004615
1507 Ga0105238_10655795
1508 Ga0105238_11490411
1509 Ga0105249_10074040
1510 Ga0105249_10129166
1511 Ga0105249_10167696
1512 Ga0105249_10791601
1513 Ga0105239_10060383
1514 Ga0105239_10173487
1515 Ga0105239_10314495
1516 Ga0105239_10493149
1517 Ga0105239_10685042
1518 Ga0105239_12667311
1519 Ga0105246_10073527
1520 Ga0105246_10151414
1521 Ga0105246_10196226
1522 Ga0105246_10202032
1523 Ga0105246_10251886
1524 Ga0105246_10486262
1525 Ga0105246_10619270
1526 Ga0105246_10916465
1527 Ga0105246_11066732
1528 Ga0157343_1011118
1529 Ga0157314_1028173
1530 Ga0157314_1036908
1531 Ga0157339_1067631
1532 Ga0157373_10475281
1533 Ga0157373_10577989
1534 Ga0157373_10865248
1535 Ga0157373_11094913
1536 Ga0157371_10195844
1537 Ga0157371_10234896
1538 Ga0157371_10325779
1539 Ga0157370_10769753
1540 Ga0157370_10795452
1541 Ga0157369_10104309
1542 Ga0157374_10141270
1543 Ga0157374_10532139
1544 Ga0157374_12846246
1545 Ga0157378_10223569
1546 Ga0157378_10763532
1547 Ga0157378_10790326
1548 Ga0157378_11270294
1549 Ga0163162_10484589
1550 Ga0163162_10821685
1551 Ga0163162_11875234
1552 Ga0163162_11990492
1553 Ga0157372_10009445
1554 Ga0157372_10105468
1555 Ga0157372_10509020
1556 Ga0157375_10029312
1557 Ga0157375_10041919
1558 Ga0157375_10651885
1559 Ga0157375_10960602
1560 Ga0157375_10974996
1561 Ga0157375_12548815
1562 Ga0163163_10199617
1563 Ga0163163_10542539
1564 Ga0163163_10587035
1565 Ga0163163_11526590
1566 Ga0163163_11973199
1567 Ga0163163_12694173
1568 Ga0157380_10040382
1569 Ga0157380_10049025
1570 Ga0157380_10159646
1571 Ga0157380_12047313
1572 Ga0157377_10001311
1573 Ga0157377_10003506
1574 Ga0157377_10063765
1575 Ga0157377_10077178
1576 Ga0157377_10163634
1577 Ga0157377_10843662
1578 Ga0157377_11284666
1579 Ga0157377_11484705
1580 Ga0157379_10070862
1581 Ga0157379_10075391
1582 Ga0157379_12098590
1583 Ga0157376_10035152
1584 Ga0157376_10131046
1585 Ga0157376_10423087
1586 Ga0163161_10017266
1587 Ga0163161_10507902
1588 Ga0163161_10784000
1589 Ga0163161_11490969
1590 Ga0206356_10423462
1591 Ga0206356_10715168
1592 Ga0206351_10732071
1593 Ga0206352_10539032
1594 Ga0206350_10935077
1595 Ga0206354_10785179
1596 Ga0206354_11277640
1597 Ga0224712_10070446
1598 Ga0207656_10243534
1599 Ga0207653_10018400
1600 Ga0207642_10086808
1601 Ga0207642_10117534
1602 Ga0207642_10769334
1603 Ga0207688_10013555
1604 Ga0207688_10060772
1605 Ga0207688_10111828
1606 Ga0207688_10143489
1607 Ga0207688_10550347
1608 Ga0207680_10086005
1609 Ga0207647_10349319
1610 Ga0207645_10116806
1611 Ga0207645_10227145
1612 Ga0207643_10153252
1613 Ga0207643_10206206
1614 Ga0207643_10325628
1615 Ga0207643_10361395
1616 Ga0207643_10517390
1617 Ga0207705_10023479
1618 Ga0207705_10890455
1619 Ga0207705_11230661
1620 Ga0207684_10152321
1621 Ga0207684_10904603
1622 Ga0207654_10595001
1623 Ga0207654_11434169
1624 Ga0207707_10016045
1625 Ga0207707_10178775
1626 Ga0207707_10393042
1627 Ga0207707_10671939
1628 Ga0207707_10805229
1629 Ga0207671_10718342
1630 Ga0207660_10017237
1631 Ga0207660_10155820
1632 Ga0207660_10168419
1633 Ga0207662_10085898
1634 Ga0207662_10636895
1635 Ga0207657_10003899
1636 Ga0207657_10096050
1637 Ga0207657_10194098
1638 Ga0207657_10210994
1639 Ga0207657_10583151
1640 Ga0207657_10999542
1641 Ga0207657_11190135
1642 Ga0207649_10006520
1643 Ga0207649_10045143
1644 Ga0207649_10300772
1645 Ga0207649_11365178
1646 Ga0207652_10049961
1647 Ga0207652_10131826
1648 Ga0207652_10427981
1649 Ga0207652_10675408
1650 Ga0207646_10188524
1651 Ga0207646_10270563
1652 Ga0207646_11830118
1653 Ga0207681_10124965
1654 Ga0207681_10306574
1655 Ga0207681_10348453
1656 Ga0207681_10683881
1657 Ga0207681_10717210
1658 Ga0207694_10118485
1659 Ga0207694_11682504
1660 Ga0207650_11468665
1661 Ga0207650_11523066
1662 Ga0207659_10050673
1663 Ga0207659_10121009
1664 Ga0207659_10126612
1665 Ga0207659_10193288
1666 Ga0207659_10701790
1667 Ga0207687_10012133
1668 Ga0207687_10013736
1669 Ga0207687_10190967
1670 Ga0207687_10329199
1671 Ga0207687_10926236
1672 Ga0207644_10645960
1673 Ga0207644_10960397
1674 Ga0207644_11097051
1675 Ga0207690_10037340
1676 Ga0207690_10051083
1677 Ga0207690_10263376
1678 Ga0207706_10003040
1679 Ga0207706_10018100
1680 Ga0207706_10025020
1681 Ga0207706_10209297
1682 Ga0207706_10747880
1683 Ga0207686_10282224
1684 Ga0207686_11247868
1685 Ga0207709_10043199
1686 Ga0207709_10074295
1687 Ga0207709_10691128
1688 Ga0207670_10122359
1689 Ga0207670_10400516
1690 Ga0207669_10073407
1691 Ga0207669_10111386
1692 Ga0207669_10163492
1693 Ga0207669_11194503
1694 Ga0207669_11354239
1695 Ga0207669_11560249
1696 Ga0207704_10067422
1697 Ga0207704_10242297
1698 Ga0207704_10259544
1699 Ga0207704_11797851
1700 Ga0207691_10006406
1701 Ga0207691_10012064
1702 Ga0207691_10136553
1703 Ga0207691_10540916
1704 Ga0207691_11020508
1705 Ga0207711_10043749
1706 Ga0207711_10215795
1707 Ga0207711_11346223
1708 Ga0207689_10121142
1709 Ga0207689_10868378
1710 Ga0207689_11530401
1711 Ga0207689_11558846
1712 Ga0207689_11633856
1713 Ga0207661_10000612
1714 Ga0207661_10033009
1715 Ga0207661_10036867
1716 Ga0207661_10205708
1717 Ga0207661_10277007
1718 Ga0207661_10341501
1719 Ga0207661_10377166
1720 Ga0207661_11334018
1721 Ga0207661_11720266
1722 Ga0207679_10117357
1723 Ga0207679_10133330
1724 Ga0207679_10217596
1725 Ga0207679_10294743
1726 Ga0207679_10710625
1727 Ga0207679_10741182
1728 Ga0207679_11340165
1729 Ga0207667_11344700
1730 Ga0207651_10184857
1731 Ga0207651_11223308
1732 Ga0207712_10898689
1733 Ga0207668_10029857
1734 Ga0207668_10718474
1735 Ga0207640_10074967
1736 Ga0207640_10496448
1737 Ga0207640_11348832
1738 Ga0207640_11459965
1739 Ga0207658_10828041
1740 Ga0207677_10027716
1741 Ga0207677_10315501
1742 Ga0207677_10895731
1743 Ga0207677_11111706
1744 Ga0207677_11331989
1745 Ga0207703_10051335
1746 Ga0207703_10980027
1747 Ga0207639_10012338
1748 Ga0207639_10519206
1749 Ga0207639_11199777
1750 Ga0207639_11716654
1751 Ga0207678_10023034
1752 Ga0207678_10177813
1753 Ga0207678_10438064
1754 Ga0207708_10015196
1755 Ga0207708_10016992
1756 Ga0207708_10060405
1757 Ga0207708_10248364
1758 Ga0207702_10074671
1759 Ga0207702_10206917
1760 Ga0207702_10417877
1761 Ga0207641_10790612
1762 Ga0207648_10051981
1763 Ga0207648_10125301
1764 Ga0207648_10182488
1765 Ga0207648_10185847
1766 Ga0207648_10445614
1767 Ga0207648_11628147
1768 Ga0207676_10276214
1769 Ga0207676_10579641
1770 Ga0207676_10960354
1771 Ga0207676_11662958
1772 Ga0207676_11736969
1773 Ga0207674_10031518
1774 Ga0207674_10060638
1775 Ga0207674_10431412
1776 Ga0207674_11081827
1777 Ga0207674_11184008
1778 Ga0207675_100119742
1779 Ga0207675_100647694
1780 Ga0207683_10004422
1781 Ga0207683_10025471
1782 Ga0207683_10061101
1783 Ga0207683_10115188
1784 Ga0207683_10260174
1785 Ga0207683_10833282
1786 Ga0207683_11157473
1787 Ga0207683_11528163
1788 Ga0207698_10003410
1789 Ga0207698_10052158
1790 Ga0207698_10069554
1791 Ga0207698_10096671
1792 Ga0207698_10485231
1793 Ga0207698_12233416
1794 Ga0209998_10052091
1795 Ga0209813_10469070
1796 Ga0209974_10158418
1797 Ga0207428_10002314
1798 Ga0207428_10167268
1799 Ga0207428_10175303
1800 Ga0268266_10249643
1801 Ga0268266_10510220
1802 Ga0268266_10642900
1803 Ga0268266_11364561
1804 Ga0268265_11237955
1805 Ga0268265_11550855
1806 Ga0268264_10036367
1807 Ga0268264_10661439
1808 Ga0307408_100885856
1809 Ga0307405_10730476
1810 Ga0307405_10804385
1811 Ga0326468_10084057
1812 Ga0307416_100149706
1813 Ga0307416_100636788
1814 Ga0307415_100459462
1815 Ga0373948_0013703
1816 Ga0373938_0136265
1817 Ga0373928_0035993
1818 Ga0373949_0089257
1819 Ga0373951_0097676
1820 Ga0373941_0013948
1821 Ga0373960_0093458
1822 Ga0373942_0199928
1823 Ga0373961_0081863
1824 Ga0373962_0027361
1825 Ga0373931_0072674
1826 Ga0373931_0260963
1827 Ga0373937_1789897
1828 Ga0395899_0053875
1829 Ga0395900_0005363
1830 Ga0395900_0056240
1831 Ga0395900_0088732
1832 Ga0395900_0193927
1833 Ga0395900_0671501
1834 Ga0395898_0063334
1835 Ga0395898_0071698
1836 Ga0395898_0117909
1837 Ga0395898_1628378
1838 Ga0395898_1693641
1839 Ga0395905_0006331
1840 Ga0395905_0027035
1841 Ga0395905_0062102
1842 Ga0395905_0105649
1843 Ga0395901_0013286
1844 Ga0395901_0021597
1845 Ga0395901_0030277
1846 Ga0395901_0067669
1847 Ga0395901_0083956
1848 Ga0395901_0757946
1849 Ga0395901_0787498
1850 Ga0395901_1426352
1851 Ga0451787_144833
1852 Ga0451789_0067247
1853 Ga0451789_0622442
1854 Ga0451793_0217906
1855 Ga0451802_0539959
1856 Ga0451802_2123391
1857 Ga0451807_1505927
1858 Ga0451835_0445768
1859 Ga0451837_1813209
1860 Ga0451853_3086998
1861 Ga0450911_028724
1862 Ga0450920_002200
1863 Ga0450923_039659
1864 Ga0450890_060459
1865 Ga0450898_090077
1866 Ga0450902_009145
1867 Ga0450906_016580
1868 Ga0450907_059315
1869 Ga0439458_0044625
1870 Ga0450908_025444
1871 Ga0450909_070273
1872 Ga0439464_0295073
1873 Ga0450916_034239
1874 Ga0450918_013958
1875 Ga0439440_0232638
1876 Ga0466967_0350002
1877 Ga0495603_0035069
1878 Ga0495603_0264450
1879 Ga0495641_0270051
1880 Ga0495651_0500581
1881 Ga0495582_0443499
1882 Ga0495605_0138172
1883 Ga0495584_0613625
1884 Ga0495585_0244741
1885 Ga0495596_0105550
1886 Ga0495596_0405762
1887 Ga0495608_0138327
1888 Ga0495616_0280749
1889 Ga0495618_0646578
1890 Ga0495620_0210159
1891 Ga0495628_0219470
1892 Ga0495628_0777536
1893 Ga0495630_0143599
1894 Ga0495644_0043043
1895 Ga0495587_0709012
1896 Ga0495598_0259894
1897 Ga0495645_0347890
1898 Ga0495667_0957206
1899 Ga0495656_0172387
1900 Ga0495656_0337502
1901 Ga0495656_0712993
1902 Ga0495634_0820110
1903 Ga0495611_0223513
1904 Ga0495635_0199282
1905 Ga0495659_0102784
1906 Ga0495588_0327785
1907 Ga0495658_0482207
1908 Ga0495658_0736409
1909 Ga0495658_0850368
1910 Ga0495624_0350387
1911 Ga0495624_0564779
1912 Ga0495670_0410725
1913 Ga0495671_0058339
1914 Ga0495589_0045256
1915 Ga0495600_0698996
1916 Ga0495660_0489572
1917 Ga0495581_0539635
1918 Ga0495604_0245016
1919 Ga0495604_0589546
1920 Ga0495636_0087635
1921 Ga0495674_0120853
1922 Ga0495676_0336055
1923 Ga0495676_1031363
1924 Ga0495675_0243476
1925 Ga0495684_0605319
1926 Ga0496100_0432659
1927 Ga0496100_0554901
1928 Ga0496100_0849718
1929 Ga0496100_1306091
1930 Ga0496101_0130884
1931 Ga0496101_0138299
1932 Ga0496101_0217352
1933 Ga0496101_1157668
1934 Ga0496102_0234483
1935 Ga0496102_0527928
1936 Ga0496102_0615214
1937 Ga0496102_0668846
1938 Ga0496102_1524458
1939 Ga0496102_1729973
1940 Ga0496103_0160526
1941 Ga0496104_0027875
1942 Ga0496104_0230746
1943 Ga0496104_0303765
1944 Ga0496104_0382872
1945 Ga0496104_1101567
1946 Ga0496104_1355928
1947 Ga0496104_1378047
1948 Ga0496105_0120951
1949 Ga0496105_0215961
1950 Ga0496105_0364671
1951 Ga0496105_0584496
1952 Ga0496106_0025632
1953 Ga0496107_0191368
1954 Ga0496107_0429079
1955 Ga0496107_1337180
1956 Ga0496108_0019446
1957 Ga0496108_0270465
1958 Ga0496108_0652845
1959 Ga0496108_1463315
1960 Ga0496108_1568393
1961 Ga0496109_0002689
1962 Ga0496109_0011202
1963 Ga0496109_0084789
1964 Ga0496109_0121469
1965 Ga0496109_0522717
1966 Ga0496109_1167443
1967 Ga0496109_1768708
1968 Ga0496109_1882614
1969 Ga0496110_0030503
1970 Ga0496110_0033633
1971 Ga0496110_0831379
1972 Ga0496110_1686591
1973 Ga0496110_1730585
1974 Ga0496111_0003152
1975 Ga0496111_0067911
1976 Ga0496111_0259350
1977 Ga0496111_0506762
1978 Ga0496112_0148129
1979 Ga0496112_0218787
1980 Ga0496113_0239154
1981 Ga0496114_0127020
1982 Ga0496114_0146112
1983 Ga0496114_0217280
1984 Ga0496114_0325870
1985 Ga0496114_0336944
1986 Ga0496114_0381691
1987 Ga0496114_0445050
1988 Ga0496114_0489201
1989 Ga0496114_0513982
1990 Ga0496114_1112719
1991 Ga0501031_0001754
1992 Ga0501031_0152337
1993 Ga0501031_0214057
1994 Ga0501031_0609937
1995 Ga0501031_0748699
1996 Ga0501032_0014533
1997 Ga0501032_0015883
1998 Ga0501032_0143422
1999 Ga0501032_0175329
2000 Ga0501032_0352308
2001 Ga0501032_0594350
2002 Ga0501033_0021291
2003 Ga0501033_0123752
2004 Ga0501033_0224595
2005 Ga0501034_0121208
2006 Ga0501034_0207367
2007 Ga0501036_0022147
2008 Ga0501036_0036855
2009 Ga0501036_0046920
2010 Ga0501036_0054874
2011 Ga0501036_0103525
2012 Ga0501036_0331860
2013 Ga0501036_0338754
2014 Ga0501036_1579255
2015 Ga0501037_0001734
2016 Ga0501037_0012017
2017 Ga0501037_0076460
2018 Ga0501037_0225254
2019 Ga0501037_0258555
2020 Ga0501038_0010491
2021 Ga0501038_0020457
2022 Ga0501038_0021628
2023 Ga0501038_0046809
2024 Ga0501038_0371394
2025 Ga0501038_0925532
2026 Ga0501038_0971800
2027 Ga0501038_1013005
2028 Ga0501038_1200320
2029 Ga0501039_0013914
2030 Ga0501039_0055895
2031 Ga0501039_0067408
2032 Ga0501039_0068069
2033 Ga0501039_0110088
2034 Ga0501039_0135629
2035 Ga0501039_0198444
2036 Ga0501039_0290168
2037 Ga0501039_0328024
2038 Ga0501040_0019285
2039 Ga0501040_0022250
2040 Ga0501040_0041611
2041 Ga0501040_0052374
2042 Ga0501040_0062134
2043 Ga0501040_0112106
2044 Ga0501040_0112614
2045 Ga0501040_0117512
2046 Ga0501040_0252341
2047 Ga0501040_0435522
2048 Ga0501041_0006203
2049 Ga0501041_0007256
2050 Ga0501041_0028618
2051 Ga0501041_0079270
2052 Ga0501041_0392273
2053 Ga0501041_0501330
2054 Ga0501041_0597561
2055 Ga0501042_0006488
2056 Ga0501042_0016796
2057 Ga0501042_0058535
2058 Ga0501042_0113882
2059 Ga0501042_0242329
2060 Ga0501042_0475668
2061 Ga0501042_1377111
2062 Ga0501043_0057097
2063 Ga0501043_0081566
2064 Ga0501043_0098803
2065 Ga0501043_0329677
2066 Ga0501043_0363906
2067 Ga0501046_0003198
2068 Ga0501046_0048035
2069 Ga0501046_0063500
2070 Ga0501046_0103819
2071 Ga0501046_0138552
2072 Ga0501046_0287854
2073 Ga0501046_0769721
2074 Ga0501047_0513915
2075 Ga0501048_0005712
2076 Ga0501048_0016260
2077 Ga0501048_0049671
2078 Ga0501048_0057482
2079 Ga0501048_0083215
2080 Ga0501048_0092389
2081 Ga0501048_0190743
2082 Ga0501048_0455541
2083 Ga0501067_0029785
2084 Ga0501067_0416262
2085 Ga0501067_0533503
2086 Ga0501068_0011157
2087 Ga0501068_0011596
2088 Ga0501068_0147984
2089 Ga0501068_0186174
2090 Ga0501068_0194918
2091 Ga0501068_0245792
2092 Ga0501068_0330909
2093 Ga0501069_0000404
2094 Ga0501069_0005994
2095 Ga0501069_0023246
2096 Ga0501069_0071781
2097 Ga0501069_0084634
2098 Ga0501069_0104261
2099 Ga0501069_0121787
2100 Ga0501069_0451383
2101 Ga0501069_0956969
2102 Ga0501070_0038832
2103 Ga0501070_0120293
2104 Ga0501070_0142276
2105 Ga0501070_0330457
2106 Ga0501070_0980483
2107 Ga0501070_1474431
2108 Ga0501071_0007629
2109 Ga0501071_0017219
2110 Ga0501071_0023334
2111 Ga0501071_0035205
2112 Ga0501071_0054966
2113 Ga0501071_0070959
2114 Ga0501071_0128945
2115 Ga0501071_0511580
2116 Ga0501071_1391546
2117 Ga0501072_0024283
2118 Ga0501072_0031317
2119 Ga0501072_0047202
2120 Ga0501072_0141758
2121 Ga0501072_0273398
2122 Ga0501072_0589395
2123 Ga0501072_1221232
2124 Ga0501073_0027444
2125 Ga0501073_0036973
2126 Ga0501073_0045539
2127 Ga0501074_0010424
2128 Ga0501074_0035462
2129 Ga0501074_0046674
2130 Ga0501074_0075607
2131 Ga0501074_0083713
2132 Ga0501074_0191407
2133 Ga0501074_0903316
2134 Ga0501074_0912687
2135 Ga0501075_0079617
2136 Ga0501075_0086681
2137 Ga0501075_0111997
2138 Ga0501075_0213807
2139 Ga0501075_0224889
2140 Ga0501075_0246283
2141 Ga0501075_0267587
2142 Ga0501075_0997239
2143 Ga0501076_0001971
2144 Ga0501076_0030067
2145 Ga0501076_0040451
2146 Ga0501076_0062557
2147 Ga0501076_0071760
2148 Ga0501076_0077841
2149 Ga0501076_0129944
2150 Ga0501076_0134821
2151 Ga0501076_0154388
2152 Ga0501076_0160284
2153 Ga0501076_0357025
2154 Ga0501076_0720248
2155 Ga0501077_0011287
2156 Ga0501077_0023420
2157 Ga0501077_0061071
2158 Ga0501077_0100358
2159 Ga0501077_0109828
2160 Ga0501077_0221591
2161 Ga0501077_0361937
2162 Ga0501077_0571907
2163 Ga0501077_0939064
2164 Ga0501079_0012614
2165 Ga0501079_0027218
2166 Ga0501079_0037136
2167 Ga0501079_0092603
2168 Ga0501079_0149866
2169 Ga0501079_0329425
2170 Ga0501079_0537722
2171 Ga0501079_0579047
2172 Ga0501079_1326048
2173 Ga0501080_0009195
2174 Ga0501080_0010484
2175 Ga0501080_0054290
2176 Ga0501080_0079553
2177 Ga0501080_0097690
2178 Ga0501080_0195377
2179 Ga0501080_0279880
2180 Ga0501080_0287468
2181 Ga0501080_0357664
2182 Ga0501080_0505965
2183 Ga0501080_1230120
2184 Ga0501081_0007559
2185 Ga0501081_0026901
2186 Ga0501081_0122242
2187 Ga0501081_0133582
2188 Ga0501081_0143009
2189 Ga0501081_0252163
2190 Ga0501081_0458080
2191 Ga0501083_0006299
2192 Ga0501083_0009341
2193 Ga0501083_0029146
2194 Ga0501083_0311954
2195 Ga0501083_0394585
2196 Ga0501083_0815682
2197 Ga0501035_0026164
2198 Ga0501035_0034600
2199 Ga0501035_0110735
2200 Ga0501035_0111907
2201 Ga0501035_0508606
2202 Ga0501035_0603218
2203 Ga0501035_1191426
2204 Ga0501044_0146738
2205 Ga0501044_0607539
2206 Ga0501044_0773261
2207 Ga0501045_0016648
2208 Ga0501045_0026675
2209 Ga0501045_0028937
2210 Ga0501045_0045530
2211 Ga0501045_0065278
2212 Ga0501045_0084664
2213 Ga0501045_0359545
2214 Ga0501045_0529024
2215 Ga0501045_1084983
2216 nmdc:mga03n38_33083_c1
2217 nmdc:mga00v17_149210_c1
2218 nmdc:mga0yw44_686432_c1
2219 nmdc:mga0yw44_95997_c1
2220 nmdc:mga04h51_141322_c1
2221 nmdc:mga05p37_2048777_c1
2222 nmdc:mga05p37_22081_c1
2223 nmdc:mga05p37_23743_c1
2224 nmdc:mga05p37_247142_c1
2225 nmdc:mga09592_1365894_c1
2226 nmdc:mga09592_28987_c1
2227 nmdc:mga0qj67_99131_c1
2228 nmdc:mga06r32_1344820_c1
2229 nmdc:mga06r32_840086_c1
2230 nmdc:mga08y16_1169611_c1
2231 nmdc:mga08y16_128631_c1
2232 nmdc:mga08y16_33557_c1
2233 nmdc:mga08y16_74927_c1
2234 nmdc:mga0n895_1074783_c1
2235 nmdc:mga0n895_528034_c1
2236 nmdc:mga0n895_828617_c1
2237 nmdc:mga0a205_368361_c1
2238 nmdc:mga0a205_788872_c1
2239 nmdc:mga0a205_90715_c1
2240 Ga0495655_0230433
2241 Ga0495595_0008836
2242 Ga0495595_0091108
2243 Ga0495595_0667404
2244 Ga0495619_0264311
2245 Ga0501084_0025140
2246 Ga0501084_0026068
2247 Ga0501084_0045376
2248 Ga0501084_0045652
2249 Ga0501084_0106836
2250 Ga0501084_0291123
2251 Ga0501084_0402064
2252 Ga0501084_0442549
2253 Ga0501084_0653507
2254 Ga0501084_0967622
2255 Ga0501084_1209451
2256 Ga0587069_088426
2257 Ga0501082_0053681
2258 Ga0501082_0062549
2259 Ga0501082_0096947
2260 Ga0501082_0102354
2261 Ga0501082_0107066
2262 Ga0501082_0252782
2263 Ga0501082_0329875
2264 Ga0501082_0394861
2265 Ga0501082_0490962
2266 Ga0501082_0495401
2267 Ga0501082_1113355
2268 Ga0530510_0020887
2269 Ga0530510_0063666
2270 Ga0530510_0080521
2271 Ga0530510_0084447
2272 Ga0530510_0095107
2273 Ga0530510_0096247
2274 Ga0530510_0097928
2275 Ga0530510_0303982
2276 Ga0530510_0341880
2277 Ga0530510_0362127
2278 Ga0530510_0426363
2279 Ga0530510_0530570
2280 Ga0530510_1216469

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

9

43

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wr6-assembly4.cif.gz_D crystal structure of gga3 gat domain in complex with ubiquitin 0.6136 4 41
5wur-assembly1.cif.gz_C crystal structure of sigw in complex with its anti-sigma rsiw, an oxdized form 0.5911 7 71
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.5843 8 72
5vr3-assembly1.cif.gz_A crystal structure of the brs domain of braf 0.5703 3 44
5wur-assembly1.cif.gz_C crystal structure of sigw in complex with its anti-sigma rsiw, an oxdized form 0.551 7 71
ID Description Score Start End Superfamily
af_A0A0R4ISY9_209_303_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6204 4 41 1.20.58.160
af_Q91XE8_17_119_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6105 5 50 1.20.120.550
af_Q9VJH8_36_256_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.5853 1 29 3.40.50.2000
af_Q59LF3_2_249_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.5448 5 49 1.20.1270.60
af_A0A1D6GCT6_95_259_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5436 4 45 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A5Q4ET84-F1-model_v4 HEAT repeat domain-containing protein 0.6209 4 78
AF-A0A127SLD7-F1-model_v4 Putative zinc-finger 0.6057 4 73
AF-A0A7V5P3K1-F1-model_v4 Zf-HC2 domain-containing protein 0.587 3 73 GO:0016020
AF-A0A127SLD7-F1-model_v4 Putative zinc-finger 0.5854 4 73
AF-A0A654E1M7-F1-model_v4 Mycothiol system anti-sigma-R factor 0.5842 2 75

Map