F490693
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1140 | 355 | 2280 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_101122012|Ga0070706_1011220121 |
| Length | 81 |
| Sequence | VSGFAFDPCARCEEMMQPYLDRDLSVEQMMEAEAHLDVCSHCRRRYRFEVSLRRYVRTVADEKQMPQELKAKLAVLRTPLH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 17 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 119 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 120 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 211 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 212 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 233 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 236 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 237 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 238 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 239 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 240 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 241 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 242 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 243 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 244 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 245 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 246 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 247 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 248 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 249 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 301 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.68 |
| Metatranscriptomes | 1.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.05 |
| Nodule | 0 |
| Rhizoplane | 6.32 |
| Rhizosphere | 92.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070706_101122012 | 3300005467 | Bacteria | 724 |
| 2 | 2214741331 | 2209111006 | Archaea | 953 |
| 3 | ARcpr5yngRDRAFT_c002676 | 3300000043 | Unclassified | 1831 |
| 4 | ARSoilOldRDRAFT_c001729 | 3300000044 | Unclassified | 2003 |
| 5 | JGI24747J21853_1050140 | 3300001978 | Bacteria | 508 |
| 6 | JGI24739J22299_10043863 | 3300001989 | Bacteria | 1476 |
| 7 | JGI24743J22301_10004517 | 3300001991 | Bacteria | 2274 |
| 8 | JGI24743J22301_10058672 | 3300001991 | Bacteria | 791 |
| 9 | JGI24743J22301_10095463 | 3300001991 | Unclassified | 637 |
| 10 | JGI24738J21930_10025519 | 3300002075 | Bacteria | 1215 |
| 11 | JGI24738J21930_10062747 | 3300002075 | Bacteria | 764 |
| 12 | JGI24744J21845_10037088 | 3300002077 | Bacteria | 919 |
| 13 | JGI24744J21845_10092072 | 3300002077 | Bacteria | 557 |
| 14 | JGI24034J26672_10066300 | 3300002239 | Bacteria | 641 |
| 15 | JGI24034J26672_10073220 | 3300002239 | Bacteria | 616 |
| 16 | JGI24742J22300_10025285 | 3300002244 | Bacteria | 1026 |
| 17 | JGI24742J22300_10120439 | 3300002244 | Bacteria | 518 |
| 18 | JGI24751J29686_10078962 | 3300002459 | Bacteria | 682 |
| 19 | JGI25406J46586_10025619 | 3300003203 | Bacteria | 2287 |
| 20 | JGI25406J46586_10134316 | 3300003203 | Bacteria | 725 |
| 21 | Ga0058863_10000400 | 3300004799 | Bacteria | 1171 |
| 22 | Ga0058863_11966875 | 3300004799 | Bacteria | 905 |
| 23 | Ga0058861_10036801 | 3300004800 | Bacteria | 944 |
| 24 | Ga0058860_10162899 | 3300004801 | Bacteria | 892 |
| 25 | Ga0058860_12210104 | 3300004801 | Bacteria | 841 |
| 26 | Ga0058862_10098273 | 3300004803 | Bacteria | 881 |
| 27 | Ga0070658_10012481 | 3300005327 | Bacteria | 6817 |
| 28 | Ga0070658_10164960 | 3300005327 | Bacteria | 1859 |
| 29 | Ga0070658_10983869 | 3300005327 | Unclassified | 734 |
| 30 | Ga0070658_11186789 | 3300005327 | Bacteria | 664 |
| 31 | Ga0070676_10120648 | 3300005328 | Bacteria | 1645 |
| 32 | Ga0070676_10149159 | 3300005328 | Bacteria | 1495 |
| 33 | Ga0070683_100018147 | 3300005329 | Bacteria | 6227 |
| 34 | Ga0070683_100065183 | 3300005329 | Bacteria | 3392 |
| 35 | Ga0070683_100120855 | 3300005329 | Bacteria | 2474 |
| 36 | Ga0070683_100354697 | 3300005329 | Unclassified | 1397 |
| 37 | Ga0070683_100520645 | 3300005329 | Bacteria | 1136 |
| 38 | Ga0070683_100747945 | 3300005329 | Bacteria | 937 |
| 39 | Ga0070690_100472279 | 3300005330 | Bacteria | 934 |
| 40 | Ga0070670_100961684 | 3300005331 | Bacteria | 776 |
| 41 | Ga0070670_101320500 | 3300005331 | Unclassified | 660 |
| 42 | Ga0070670_101601209 | 3300005331 | Bacteria | 599 |
| 43 | Ga0068869_100023368 | 3300005334 | Bacteria | 4268 |
| 44 | Ga0068869_100269957 | 3300005334 | Bacteria | 1364 |
| 45 | Ga0068869_100308655 | 3300005334 | Unclassified | 1280 |
| 46 | Ga0068869_101838707 | 3300005334 | Unclassified | 542 |
| 47 | Ga0068869_101874253 | 3300005334 | Bacteria | 537 |
| 48 | Ga0070666_10204304 | 3300005335 | Unclassified | 1390 |
| 49 | Ga0070680_100007895 | 3300005336 | Bacteria | 8115 |
| 50 | Ga0070680_100147736 | 3300005336 | Unclassified | 1973 |
| 51 | Ga0070680_100376973 | 3300005336 | Bacteria | 1208 |
| 52 | Ga0070680_101030691 | 3300005336 | Bacteria | 711 |
| 53 | Ga0070680_101272267 | 3300005336 | Bacteria | 637 |
| 54 | Ga0070682_100005220 | 3300005337 | Bacteria | 7226 |
| 55 | Ga0070682_100108336 | 3300005337 | Unclassified | 1847 |
| 56 | Ga0070682_100471803 | 3300005337 | Unclassified | 966 |
| 57 | Ga0070682_100523886 | 3300005337 | Bacteria | 922 |
| 58 | Ga0070682_100630593 | 3300005337 | Bacteria | 851 |
| 59 | Ga0070682_101825362 | 3300005337 | Bacteria | 531 |
| 60 | Ga0068868_100110844 | 3300005338 | Bacteria | 2230 |
| 61 | Ga0068868_100415272 | 3300005338 | Bacteria | 1164 |
| 62 | Ga0068868_100529186 | 3300005338 | Unclassified | 1036 |
| 63 | Ga0068868_100796543 | 3300005338 | Bacteria | 852 |
| 64 | Ga0070660_100004686 | 3300005339 | Bacteria | 9468 |
| 65 | Ga0070660_100063955 | 3300005339 | Bacteria | 2861 |
| 66 | Ga0070660_100400628 | 3300005339 | Unclassified | 1135 |
| 67 | Ga0070660_100405434 | 3300005339 | Unclassified | 1128 |
| 68 | Ga0070660_101558565 | 3300005339 | Bacteria | 562 |
| 69 | Ga0070689_100149218 | 3300005340 | Bacteria | 1885 |
| 70 | Ga0070689_101462785 | 3300005340 | Bacteria | 618 |
| 71 | Ga0070691_10001238 | 3300005341 | Bacteria | 10761 |
| 72 | Ga0070691_10264948 | 3300005341 | Bacteria | 926 |
| 73 | Ga0070691_10372810 | 3300005341 | Bacteria | 798 |
| 74 | Ga0070691_10820831 | 3300005341 | Unclassified | 568 |
| 75 | Ga0070691_10822967 | 3300005341 | Unclassified | 567 |
| 76 | Ga0070687_100259899 | 3300005343 | Bacteria | 1083 |
| 77 | Ga0070687_101357259 | 3300005343 | Unclassified | 530 |
| 78 | Ga0070661_100014709 | 3300005344 | Bacteria | 5518 |
| 79 | Ga0070661_100076821 | 3300005344 | Bacteria | 2461 |
| 80 | Ga0070661_100313064 | 3300005344 | Bacteria | 1225 |
| 81 | Ga0070661_100419923 | 3300005344 | Bacteria | 1060 |
| 82 | Ga0070661_101766879 | 3300005344 | Bacteria | 524 |
| 83 | Ga0070692_10012229 | 3300005345 | Bacteria | 3965 |
| 84 | Ga0070692_10123571 | 3300005345 | Bacteria | 1446 |
| 85 | Ga0070692_10240012 | 3300005345 | Unclassified | 1080 |
| 86 | Ga0070692_10277631 | 3300005345 | Bacteria | 1014 |
| 87 | Ga0070692_10862229 | 3300005345 | Unclassified | 623 |
| 88 | Ga0070668_100097921 | 3300005347 | Bacteria | 2320 |
| 89 | Ga0070668_101224370 | 3300005347 | Bacteria | 681 |
| 90 | Ga0070668_101791386 | 3300005347 | Bacteria | 564 |
| 91 | Ga0070669_100061755 | 3300005353 | Bacteria | 2754 |
| 92 | Ga0070669_100110873 | 3300005353 | Unclassified | 2082 |
| 93 | Ga0070669_100216640 | 3300005353 | Bacteria | 1513 |
| 94 | Ga0070669_100316774 | 3300005353 | Bacteria | 1259 |
| 95 | Ga0070675_100013979 | 3300005354 | Bacteria | 6319 |
| 96 | Ga0070675_100066526 | 3300005354 | Bacteria | 2981 |
| 97 | Ga0070675_100077897 | 3300005354 | Bacteria | 2760 |
| 98 | Ga0070675_100331224 | 3300005354 | Unclassified | 1347 |
| 99 | Ga0070671_100192672 | 3300005355 | Bacteria | 1728 |
| 100 | Ga0070671_100568969 | 3300005355 | Bacteria | 978 |
| 101 | Ga0070674_100024067 | 3300005356 | Bacteria | 3950 |
| 102 | Ga0070674_100032596 | 3300005356 | Bacteria | 3460 |
| 103 | Ga0070674_100066818 | 3300005356 | Bacteria | 2527 |
| 104 | Ga0070674_100694487 | 3300005356 | Bacteria | 869 |
| 105 | Ga0070674_101029289 | 3300005356 | Bacteria | 724 |
| 106 | Ga0070674_101042143 | 3300005356 | Bacteria | 720 |
| 107 | Ga0070674_101767873 | 3300005356 | Unclassified | 560 |
| 108 | Ga0070673_100009358 | 3300005364 | Bacteria | 6574 |
| 109 | Ga0070673_100052387 | 3300005364 | Bacteria | 3202 |
| 110 | Ga0070673_100440169 | 3300005364 | Unclassified | 1171 |
| 111 | Ga0070688_100020579 | 3300005365 | Bacteria | 3838 |
| 112 | Ga0070688_100443056 | 3300005365 | Bacteria | 969 |
| 113 | Ga0070688_100629724 | 3300005365 | Bacteria | 824 |
| 114 | Ga0070659_100046848 | 3300005366 | Bacteria | 3390 |
| 115 | Ga0070659_100055876 | 3300005366 | Bacteria | 3112 |
| 116 | Ga0070659_100069351 | 3300005366 | Unclassified | 2798 |
| 117 | Ga0070659_100134231 | 3300005366 | Unclassified | 2012 |
| 118 | Ga0070659_101238669 | 3300005366 | Unclassified | 660 |
| 119 | Ga0070667_101273894 | 3300005367 | Bacteria | 689 |
| 120 | Ga0070667_101487235 | 3300005367 | Unclassified | 636 |
| 121 | Ga0070703_10252828 | 3300005406 | Bacteria | 716 |
| 122 | Ga0070701_10003360 | 3300005438 | Bacteria | 6318 |
| 123 | Ga0070701_10165889 | 3300005438 | Unclassified | 1283 |
| 124 | Ga0070701_10184858 | 3300005438 | Bacteria | 1223 |
| 125 | Ga0070705_100057463 | 3300005440 | Bacteria | 2295 |
| 126 | Ga0070700_100077418 | 3300005441 | Bacteria | 2138 |
| 127 | Ga0070700_100135553 | 3300005441 | Bacteria | 1667 |
| 128 | Ga0070700_100270932 | 3300005441 | Unclassified | 1226 |
| 129 | Ga0070700_101191568 | 3300005441 | Bacteria | 635 |
| 130 | Ga0070694_100413225 | 3300005444 | Bacteria | 1059 |
| 131 | Ga0070694_100450391 | 3300005444 | Unclassified | 1016 |
| 132 | Ga0070694_100594985 | 3300005444 | Archaea | 890 |
| 133 | Ga0070694_101352627 | 3300005444 | Bacteria | 600 |
| 134 | Ga0070708_100425083 | 3300005445 | Unclassified | 1253 |
| 135 | Ga0070708_101340347 | 3300005445 | Bacteria | 668 |
| 136 | Ga0070663_100303087 | 3300005455 | Bacteria | 1279 |
| 137 | Ga0070663_101279227 | 3300005455 | Unclassified | 647 |
| 138 | Ga0070663_101436932 | 3300005455 | Bacteria | 612 |
| 139 | Ga0070678_100017141 | 3300005456 | Bacteria | 4654 |
| 140 | Ga0070678_100048516 | 3300005456 | Bacteria | 3058 |
| 141 | Ga0070678_100362420 | 3300005456 | Bacteria | 1249 |
| 142 | Ga0070678_100911464 | 3300005456 | Unclassified | 804 |
| 143 | Ga0070678_101533240 | 3300005456 | Bacteria | 624 |
| 144 | Ga0070678_101980994 | 3300005456 | Unclassified | 551 |
| 145 | Ga0070678_102185928 | 3300005456 | Bacteria | 525 |
| 146 | Ga0070662_100016854 | 3300005457 | Bacteria | 4911 |
| 147 | Ga0070662_100019166 | 3300005457 | Bacteria | 4642 |
| 148 | Ga0070662_100048366 | 3300005457 | Bacteria | 3064 |
| 149 | Ga0070662_100053146 | 3300005457 | Bacteria | 2931 |
| 150 | Ga0070662_100865491 | 3300005457 | Bacteria | 770 |
| 151 | Ga0070662_101905200 | 3300005457 | Unclassified | 514 |
| 152 | Ga0070681_10072596 | 3300005458 | Bacteria | 3404 |
| 153 | Ga0070681_10180469 | 3300005458 | Unclassified | 2032 |
| 154 | Ga0070681_10274946 | 3300005458 | Bacteria | 1596 |
| 155 | Ga0070681_10385000 | 3300005458 | Bacteria | 1313 |
| 156 | Ga0068867_100073418 | 3300005459 | Bacteria | 2562 |
| 157 | Ga0068867_100215413 | 3300005459 | Bacteria | 1545 |
| 158 | Ga0068867_100505065 | 3300005459 | Bacteria | 1040 |
| 159 | Ga0068867_100552932 | 3300005459 | Bacteria | 997 |
| 160 | Ga0068867_100707492 | 3300005459 | Unclassified | 890 |
| 161 | Ga0068867_101077312 | 3300005459 | Bacteria | 733 |
| 162 | Ga0068867_101133090 | 3300005459 | Unclassified | 716 |
| 163 | Ga0070685_10025373 | 3300005466 | Bacteria | 3263 |
| 164 | Ga0070685_10051017 | 3300005466 | Bacteria | 2392 |
| 165 | Ga0070685_10517617 | 3300005466 | Unclassified | 847 |
| 166 | Ga0070706_100116655 | 3300005467 | Bacteria | 2487 |
| 167 | Ga0070706_101633067 | 3300005467 | Bacteria | 588 |
| 168 | Ga0070707_100212372 | 3300005468 | Bacteria | 1886 |
| 169 | Ga0070707_100300165 | 3300005468 | Bacteria | 1561 |
| 170 | Ga0070707_100538427 | 3300005468 | Bacteria | 1130 |
| 171 | Ga0070707_100599964 | 3300005468 | Bacteria | 1064 |
| 172 | Ga0070707_101071429 | 3300005468 | Bacteria | 772 |
| 173 | Ga0070698_100422962 | 3300005471 | Bacteria | 1267 |
| 174 | Ga0070698_100875197 | 3300005471 | Bacteria | 844 |
| 175 | Ga0070699_100751143 | 3300005518 | Bacteria | 892 |
| 176 | Ga0070679_100011289 | 3300005530 | Bacteria | 8517 |
| 177 | Ga0070679_100037511 | 3300005530 | Bacteria | 4815 |
| 178 | Ga0070679_100273839 | 3300005530 | Bacteria | 1641 |
| 179 | Ga0070684_100030643 | 3300005535 | Bacteria | 4572 |
| 180 | Ga0070684_100085253 | 3300005535 | Bacteria | 2801 |
| 181 | Ga0070684_100108143 | 3300005535 | Bacteria | 2491 |
| 182 | Ga0070684_100289579 | 3300005535 | Bacteria | 1501 |
| 183 | Ga0070684_100346796 | 3300005535 | Bacteria | 1365 |
| 184 | Ga0070684_100415153 | 3300005535 | Bacteria | 1242 |
| 185 | Ga0070684_100670648 | 3300005535 | Unclassified | 966 |
| 186 | Ga0070684_101292044 | 3300005535 | Unclassified | 687 |
| 187 | Ga0068853_100014429 | 3300005539 | Bacteria | 6469 |
| 188 | Ga0068853_100062964 | 3300005539 | Bacteria | 3212 |
| 189 | Ga0068853_100167491 | 3300005539 | Bacteria | 1986 |
| 190 | Ga0068853_101074489 | 3300005539 | Unclassified | 776 |
| 191 | Ga0070672_100012820 | 3300005543 | Bacteria | 5903 |
| 192 | Ga0070672_100123283 | 3300005543 | Bacteria | 2124 |
| 193 | Ga0070672_100128796 | 3300005543 | Bacteria | 2078 |
| 194 | Ga0070672_100872964 | 3300005543 | Bacteria | 794 |
| 195 | Ga0070686_100029728 | 3300005544 | Bacteria | 3327 |
| 196 | Ga0070686_100109964 | 3300005544 | Unclassified | 1876 |
| 197 | Ga0070686_100628513 | 3300005544 | Bacteria | 849 |
| 198 | Ga0070686_101093220 | 3300005544 | Archaea | 658 |
| 199 | Ga0070695_101023736 | 3300005545 | Bacteria | 673 |
| 200 | Ga0070696_100309973 | 3300005546 | Bacteria | 1211 |
| 201 | Ga0070696_100507729 | 3300005546 | Bacteria | 960 |
| 202 | Ga0070693_100045096 | 3300005547 | Bacteria | 2497 |
| 203 | Ga0070693_100072121 | 3300005547 | Bacteria | 2036 |
| 204 | Ga0070693_100441027 | 3300005547 | Bacteria | 912 |
| 205 | Ga0070693_100603786 | 3300005547 | Bacteria | 792 |
| 206 | Ga0070665_100194410 | 3300005548 | Bacteria | 2029 |
| 207 | Ga0070665_100390657 | 3300005548 | Unclassified | 1399 |
| 208 | Ga0070665_100447059 | 3300005548 | Bacteria | 1302 |
| 209 | Ga0070665_100982496 | 3300005548 | Bacteria | 856 |
| 210 | Ga0070704_100016961 | 3300005549 | Bacteria | 4618 |
| 211 | Ga0070704_100073456 | 3300005549 | Bacteria | 2492 |
| 212 | Ga0070704_100706319 | 3300005549 | Bacteria | 895 |
| 213 | Ga0070704_100893734 | 3300005549 | Bacteria | 798 |
| 214 | Ga0068855_100156199 | 3300005563 | Bacteria | 2591 |
| 215 | Ga0068855_100345925 | 3300005563 | Bacteria | 1639 |
| 216 | Ga0070664_100003869 | 3300005564 | Bacteria | 12088 |
| 217 | Ga0070664_100010761 | 3300005564 | Bacteria | 7417 |
| 218 | Ga0070664_100161931 | 3300005564 | Unclassified | 1980 |
| 219 | Ga0070664_100169043 | 3300005564 | Bacteria | 1939 |
| 220 | Ga0070664_100479900 | 3300005564 | Unclassified | 1144 |
| 221 | Ga0070664_101377796 | 3300005564 | Unclassified | 666 |
| 222 | Ga0070664_101507668 | 3300005564 | Bacteria | 636 |
| 223 | Ga0068857_100071647 | 3300005577 | Bacteria | 3088 |
| 224 | Ga0068857_102027130 | 3300005577 | Unclassified | 564 |
| 225 | Ga0068854_100003667 | 3300005578 | Bacteria | 9604 |
| 226 | Ga0068854_100888177 | 3300005578 | Bacteria | 783 |
| 227 | Ga0068854_100915063 | 3300005578 | Bacteria | 772 |
| 228 | Ga0068856_100179207 | 3300005614 | Bacteria | 2132 |
| 229 | Ga0068856_100203070 | 3300005614 | Bacteria | 1997 |
| 230 | Ga0068856_100407407 | 3300005614 | Bacteria | 1379 |
| 231 | Ga0070702_100016434 | 3300005615 | Bacteria | 3797 |
| 232 | Ga0070702_100025615 | 3300005615 | Bacteria | 3162 |
| 233 | Ga0070702_101322173 | 3300005615 | Unclassified | 586 |
| 234 | Ga0068852_100007373 | 3300005616 | Bacteria | 8022 |
| 235 | Ga0068852_100043051 | 3300005616 | Bacteria | 3827 |
| 236 | Ga0068852_100062908 | 3300005616 | Bacteria | 3229 |
| 237 | Ga0068852_100247937 | 3300005616 | Bacteria | 1705 |
| 238 | Ga0068852_100520762 | 3300005616 | Unclassified | 1186 |
| 239 | Ga0068852_100653281 | 3300005616 | Unclassified | 1059 |
| 240 | Ga0068859_100140109 | 3300005617 | Bacteria | 2492 |
| 241 | Ga0068859_101434378 | 3300005617 | Bacteria | 762 |
| 242 | Ga0068859_101462464 | 3300005617 | Unclassified | 754 |
| 243 | Ga0068864_100015387 | 3300005618 | Bacteria | 6361 |
| 244 | Ga0068864_100423296 | 3300005618 | Unclassified | 1269 |
| 245 | Ga0068864_100659244 | 3300005618 | Bacteria | 1019 |
| 246 | Ga0068864_101632593 | 3300005618 | Bacteria | 649 |
| 247 | Ga0068866_10037817 | 3300005718 | Bacteria | 2372 |
| 248 | Ga0068866_10130980 | 3300005718 | Bacteria | 1426 |
| 249 | Ga0068866_10186024 | 3300005718 | Unclassified | 1230 |
| 250 | Ga0068866_10496758 | 3300005718 | Bacteria | 806 |
| 251 | Ga0068866_11162069 | 3300005718 | Bacteria | 556 |
| 252 | Ga0068861_100682255 | 3300005719 | Bacteria | 953 |
| 253 | Ga0068861_100791987 | 3300005719 | Unclassified | 889 |
| 254 | Ga0068861_102317783 | 3300005719 | Bacteria | 539 |
| 255 | Ga0068851_10135097 | 3300005834 | Bacteria | 1337 |
| 256 | Ga0068851_10146037 | 3300005834 | Bacteria | 1290 |
| 257 | Ga0068851_10330989 | 3300005834 | Unclassified | 882 |
| 258 | Ga0068851_10785829 | 3300005834 | Bacteria | 591 |
| 259 | Ga0068870_10047359 | 3300005840 | Bacteria | 2260 |
| 260 | Ga0068870_10069276 | 3300005840 | Unclassified | 1919 |
| 261 | Ga0068870_10176969 | 3300005840 | Bacteria | 1277 |
| 262 | Ga0068870_10498032 | 3300005840 | Unclassified | 812 |
| 263 | Ga0068870_10792203 | 3300005840 | Bacteria | 662 |
| 264 | Ga0068863_100102857 | 3300005841 | Bacteria | 2716 |
| 265 | Ga0068863_100319447 | 3300005841 | Unclassified | 1508 |
| 266 | Ga0068858_100034435 | 3300005842 | Bacteria | 4698 |
| 267 | Ga0068858_100387978 | 3300005842 | Bacteria | 1341 |
| 268 | Ga0068860_100069094 | 3300005843 | Bacteria | 3357 |
| 269 | Ga0068862_100503741 | 3300005844 | Bacteria | 1150 |
| 270 | Ga0068862_100825068 | 3300005844 | Unclassified | 907 |
| 271 | Ga0081455_10012612 | 3300005937 | Bacteria | 8421 |
| 272 | Ga0081455_10026862 | 3300005937 | Bacteria | 5286 |
| 273 | Ga0081455_10030348 | 3300005937 | Bacteria | 4911 |
| 274 | Ga0081455_10197501 | 3300005937 | Bacteria | 1509 |
| 275 | Ga0081455_10450052 | 3300005937 | Unclassified | 880 |
| 276 | Ga0081539_10000890 | 3300005985 | Bacteria | 57132 |
| 277 | Ga0081539_10000913 | 3300005985 | Bacteria | 55913 |
| 278 | Ga0081539_10274747 | 3300005985 | Bacteria | 736 |
| 279 | Ga0075365_10185597 | 3300006038 | Bacteria | 1455 |
| 280 | Ga0075365_10215918 | 3300006038 | Unclassified | 1345 |
| 281 | Ga0075368_10386016 | 3300006042 | Bacteria | 614 |
| 282 | Ga0075363_100032780 | 3300006048 | Bacteria | 2701 |
| 283 | Ga0075364_10555882 | 3300006051 | Bacteria | 784 |
| 284 | Ga0075432_10002834 | 3300006058 | Bacteria | 5823 |
| 285 | Ga0075432_10315263 | 3300006058 | Unclassified | 653 |
| 286 | Ga0075367_10395143 | 3300006178 | Bacteria | 874 |
| 287 | Ga0097621_100335071 | 3300006237 | Bacteria | 1342 |
| 288 | Ga0097621_100518500 | 3300006237 | Bacteria | 1082 |
| 289 | Ga0097621_100700064 | 3300006237 | Bacteria | 933 |
| 290 | Ga0097621_101021418 | 3300006237 | Bacteria | 774 |
| 291 | Ga0068871_100530762 | 3300006358 | Bacteria | 1064 |
| 292 | Ga0068871_100594839 | 3300006358 | Bacteria | 1006 |
| 293 | Ga0068871_100914323 | 3300006358 | Bacteria | 814 |
| 294 | Ga0068871_100987398 | 3300006358 | Bacteria | 784 |
| 295 | Ga0068871_101674327 | 3300006358 | Unclassified | 603 |
| 296 | Ga0075428_100007037 | 3300006844 | Bacteria | 12475 |
| 297 | Ga0075428_101504935 | 3300006844 | Unclassified | 705 |
| 298 | Ga0075428_101748580 | 3300006844 | Bacteria | 648 |
| 299 | Ga0075428_101769432 | 3300006844 | Bacteria | 644 |
| 300 | Ga0075430_100069637 | 3300006846 | Bacteria | 2951 |
| 301 | Ga0075430_100250350 | 3300006846 | Bacteria | 1468 |
| 302 | Ga0075431_100222939 | 3300006847 | Unclassified | 1923 |
| 303 | Ga0075431_101128770 | 3300006847 | Bacteria | 748 |
| 304 | Ga0075433_10868588 | 3300006852 | Bacteria | 787 |
| 305 | Ga0075434_100619594 | 3300006871 | Bacteria | 1101 |
| 306 | Ga0075434_100763109 | 3300006871 | Bacteria | 984 |
| 307 | Ga0075429_100015672 | 3300006880 | Bacteria | 6568 |
| 308 | Ga0075429_101784490 | 3300006880 | Bacteria | 534 |
| 309 | Ga0068865_100010600 | 3300006881 | Bacteria | 5744 |
| 310 | Ga0068865_100028908 | 3300006881 | Bacteria | 3673 |
| 311 | Ga0068865_100061189 | 3300006881 | Bacteria | 2638 |
| 312 | Ga0068865_100251534 | 3300006881 | Bacteria | 1395 |
| 313 | Ga0068865_100657094 | 3300006881 | Bacteria | 892 |
| 314 | Ga0097620_100140117 | 3300006931 | Bacteria | 2492 |
| 315 | Ga0097620_101434349 | 3300006931 | Bacteria | 762 |
| 316 | Ga0097620_101462223 | 3300006931 | Unclassified | 754 |
| 317 | Ga0075435_100281477 | 3300007076 | Bacteria | 1420 |
| 318 | Ga0075435_100411961 | 3300007076 | Unclassified | 1163 |
| 319 | Ga0105244_10413686 | 3300009036 | Bacteria | 620 |
| 320 | Ga0111539_10048272 | 3300009094 | Bacteria | 5084 |
| 321 | Ga0111539_10434001 | 3300009094 | Bacteria | 1529 |
| 322 | Ga0111539_10673954 | 3300009094 | Archaea | 1204 |
| 323 | Ga0111539_10920760 | 3300009094 | Bacteria | 1017 |
| 324 | Ga0111539_12345987 | 3300009094 | Bacteria | 619 |
| 325 | Ga0111539_12598296 | 3300009094 | Bacteria | 587 |
| 326 | Ga0105245_10002458 | 3300009098 | Bacteria | 16754 |
| 327 | Ga0105245_10037615 | 3300009098 | Bacteria | 4303 |
| 328 | Ga0105245_10128207 | 3300009098 | Bacteria | 2377 |
| 329 | Ga0105245_10340484 | 3300009098 | Bacteria | 1483 |
| 330 | Ga0105245_10438691 | 3300009098 | Bacteria | 1312 |
| 331 | Ga0105245_10587517 | 3300009098 | Bacteria | 1139 |
| 332 | Ga0105245_10837010 | 3300009098 | Unclassified | 960 |
| 333 | Ga0105245_11184800 | 3300009098 | Bacteria | 812 |
| 334 | Ga0105245_11327525 | 3300009098 | Archaea | 768 |
| 335 | Ga0105247_10016412 | 3300009101 | Bacteria | 4437 |
| 336 | Ga0105247_10403972 | 3300009101 | Unclassified | 974 |
| 337 | Ga0114129_10006579 | 3300009147 | Bacteria | 16496 |
| 338 | Ga0114129_10054711 | 3300009147 | Bacteria | 5595 |
| 339 | Ga0114129_10772526 | 3300009147 | Unclassified | 1228 |
| 340 | Ga0114129_11131925 | 3300009147 | Bacteria | 978 |
| 341 | Ga0114129_11260965 | 3300009147 | Bacteria | 918 |
| 342 | Ga0114129_11773738 | 3300009147 | Unclassified | 751 |
| 343 | Ga0114129_12557994 | 3300009147 | Bacteria | 610 |
| 344 | Ga0105243_10005485 | 3300009148 | Bacteria | 9893 |
| 345 | Ga0105243_10114175 | 3300009148 | Bacteria | 2266 |
| 346 | Ga0105243_10155875 | 3300009148 | Bacteria | 1964 |
| 347 | Ga0105243_10299389 | 3300009148 | Bacteria | 1457 |
| 348 | Ga0105243_10341823 | 3300009148 | Bacteria | 1371 |
| 349 | Ga0105243_10657490 | 3300009148 | Bacteria | 1016 |
| 350 | Ga0105243_10881191 | 3300009148 | Bacteria | 889 |
| 351 | Ga0105243_11125349 | 3300009148 | Unclassified | 795 |
| 352 | Ga0105243_11488103 | 3300009148 | Bacteria | 700 |
| 353 | Ga0105241_12182417 | 3300009174 | Bacteria | 549 |
| 354 | Ga0105242_10004703 | 3300009176 | Bacteria | 10568 |
| 355 | Ga0105242_10131180 | 3300009176 | Bacteria | 2163 |
| 356 | Ga0105242_10147878 | 3300009176 | Unclassified | 2045 |
| 357 | Ga0105242_10302863 | 3300009176 | Bacteria | 1460 |
| 358 | Ga0105242_10360402 | 3300009176 | Bacteria | 1346 |
| 359 | Ga0105242_12214428 | 3300009176 | Bacteria | 595 |
| 360 | Ga0105248_10277459 | 3300009177 | Bacteria | 1887 |
| 361 | Ga0105248_11035383 | 3300009177 | Bacteria | 927 |
| 362 | Ga0105248_12646319 | 3300009177 | Unclassified | 572 |
| 363 | Ga0105248_12667251 | 3300009177 | Bacteria | 570 |
| 364 | Ga0105248_12926449 | 3300009177 | Bacteria | 544 |
| 365 | Ga0105237_10362186 | 3300009545 | Bacteria | 1454 |
| 366 | Ga0105238_10004615 | 3300009551 | Bacteria | 13633 |
| 367 | Ga0105238_10655795 | 3300009551 | Bacteria | 1060 |
| 368 | Ga0105238_11490411 | 3300009551 | Unclassified | 705 |
| 369 | Ga0105249_10074040 | 3300009553 | Bacteria | 3151 |
| 370 | Ga0105249_10129166 | 3300009553 | Bacteria | 2410 |
| 371 | Ga0105249_10167696 | 3300009553 | Bacteria | 2127 |
| 372 | Ga0105249_10791601 | 3300009553 | Bacteria | 1012 |
| 373 | Ga0105239_10060383 | 3300010375 | Bacteria | 4161 |
| 374 | Ga0105239_10173487 | 3300010375 | Bacteria | 2412 |
| 375 | Ga0105239_10314495 | 3300010375 | Bacteria | 1765 |
| 376 | Ga0105239_10493149 | 3300010375 | Bacteria | 1392 |
| 377 | Ga0105239_10685042 | 3300010375 | Bacteria | 1172 |
| 378 | Ga0105239_12667311 | 3300010375 | Unclassified | 583 |
| 379 | Ga0105246_10073527 | 3300011119 | Unclassified | 2414 |
| 380 | Ga0105246_10151414 | 3300011119 | Bacteria | 1756 |
| 381 | Ga0105246_10196226 | 3300011119 | Bacteria | 1566 |
| 382 | Ga0105246_10202032 | 3300011119 | Bacteria | 1546 |
| 383 | Ga0105246_10251886 | 3300011119 | Unclassified | 1402 |
| 384 | Ga0105246_10486262 | 3300011119 | Bacteria | 1045 |
| 385 | Ga0105246_10619270 | 3300011119 | Bacteria | 938 |
| 386 | Ga0105246_10916465 | 3300011119 | Bacteria | 787 |
| 387 | Ga0105246_11066732 | 3300011119 | Bacteria | 736 |
| 388 | Ga0157343_1011118 | 3300012488 | Unclassified | 693 |
| 389 | Ga0157314_1028173 | 3300012500 | Unclassified | 616 |
| 390 | Ga0157314_1036908 | 3300012500 | Bacteria | 574 |
| 391 | Ga0157339_1067631 | 3300012505 | Unclassified | 509 |
| 392 | Ga0157373_10475281 | 3300013100 | Bacteria | 901 |
| 393 | Ga0157373_10577989 | 3300013100 | Unclassified | 817 |
| 394 | Ga0157373_10865248 | 3300013100 | Unclassified | 669 |
| 395 | Ga0157373_11094913 | 3300013100 | Bacteria | 597 |
| 396 | Ga0157371_10195844 | 3300013102 | Bacteria | 1448 |
| 397 | Ga0157371_10234896 | 3300013102 | Bacteria | 1318 |
| 398 | Ga0157371_10325779 | 3300013102 | Bacteria | 1115 |
| 399 | Ga0157370_10769753 | 3300013104 | Bacteria | 877 |
| 400 | Ga0157370_10795452 | 3300013104 | Bacteria | 861 |
| 401 | Ga0157369_10104309 | 3300013105 | Bacteria | 3019 |
| 402 | Ga0157374_10141270 | 3300013296 | Bacteria | 2338 |
| 403 | Ga0157374_10532139 | 3300013296 | Bacteria | 1182 |
| 404 | Ga0157374_12846246 | 3300013296 | Unclassified | 511 |
| 405 | Ga0157378_10223569 | 3300013297 | Bacteria | 1791 |
| 406 | Ga0157378_10763532 | 3300013297 | Unclassified | 990 |
| 407 | Ga0157378_10790326 | 3300013297 | Bacteria | 974 |
| 408 | Ga0157378_11270294 | 3300013297 | Bacteria | 777 |
| 409 | Ga0163162_10484589 | 3300013306 | Unclassified | 1368 |
| 410 | Ga0163162_10821685 | 3300013306 | Bacteria | 1046 |
| 411 | Ga0163162_11875234 | 3300013306 | Bacteria | 686 |
| 412 | Ga0163162_11990492 | 3300013306 | Bacteria | 666 |
| 413 | Ga0157372_10009445 | 3300013307 | Bacteria | 10376 |
| 414 | Ga0157372_10105468 | 3300013307 | Bacteria | 3223 |
| 415 | Ga0157372_10509020 | 3300013307 | Archaea | 1404 |
| 416 | Ga0157375_10029312 | 3300013308 | Bacteria | 5173 |
| 417 | Ga0157375_10041919 | 3300013308 | Bacteria | 4425 |
| 418 | Ga0157375_10651885 | 3300013308 | Bacteria | 1209 |
| 419 | Ga0157375_10960602 | 3300013308 | Bacteria | 996 |
| 420 | Ga0157375_10974996 | 3300013308 | Bacteria | 988 |
| 421 | Ga0157375_12548815 | 3300013308 | Unclassified | 611 |
| 422 | Ga0163163_10199617 | 3300014325 | Bacteria | 2048 |
| 423 | Ga0163163_10542539 | 3300014325 | Unclassified | 1225 |
| 424 | Ga0163163_10587035 | 3300014325 | Bacteria | 1177 |
| 425 | Ga0163163_11526590 | 3300014325 | Bacteria | 729 |
| 426 | Ga0163163_11973199 | 3300014325 | Unclassified | 643 |
| 427 | Ga0163163_12694173 | 3300014325 | Bacteria | 554 |
| 428 | Ga0157380_10040382 | 3300014326 | Bacteria | 3634 |
| 429 | Ga0157380_10049025 | 3300014326 | Bacteria | 3329 |
| 430 | Ga0157380_10159646 | 3300014326 | Bacteria | 1958 |
| 431 | Ga0157380_12047313 | 3300014326 | Bacteria | 635 |
| 432 | Ga0157377_10001311 | 3300014745 | Bacteria | 10644 |
| 433 | Ga0157377_10003506 | 3300014745 | Bacteria | 7100 |
| 434 | Ga0157377_10063765 | 3300014745 | Bacteria | 2111 |
| 435 | Ga0157377_10077178 | 3300014745 | Bacteria | 1939 |
| 436 | Ga0157377_10163634 | 3300014745 | Unclassified | 1386 |
| 437 | Ga0157377_10843662 | 3300014745 | Bacteria | 680 |
| 438 | Ga0157377_11284666 | 3300014745 | Bacteria | 571 |
| 439 | Ga0157377_11484705 | 3300014745 | Unclassified | 538 |
| 440 | Ga0157379_10070862 | 3300014968 | Unclassified | 3119 |
| 441 | Ga0157379_10075391 | 3300014968 | Unclassified | 3020 |
| 442 | Ga0157379_12098590 | 3300014968 | Bacteria | 560 |
| 443 | Ga0157376_10035152 | 3300014969 | Bacteria | 4052 |
| 444 | Ga0157376_10131046 | 3300014969 | Bacteria | 2237 |
| 445 | Ga0157376_10423087 | 3300014969 | Bacteria | 1293 |
| 446 | Ga0163161_10017266 | 3300017792 | Bacteria | 5049 |
| 447 | Ga0163161_10507902 | 3300017792 | Unclassified | 982 |
| 448 | Ga0163161_10784000 | 3300017792 | Bacteria | 800 |
| 449 | Ga0163161_11490969 | 3300017792 | Unclassified | 593 |
| 450 | Ga0206356_10423462 | 3300020070 | Bacteria | 3473 |
| 451 | Ga0206356_10715168 | 3300020070 | Bacteria | 1292 |
| 452 | Ga0206351_10732071 | 3300020077 | Bacteria | 514 |
| 453 | Ga0206352_10539032 | 3300020078 | Bacteria | 914 |
| 454 | Ga0206350_10935077 | 3300020080 | Bacteria | 1231 |
| 455 | Ga0206354_10785179 | 3300020081 | Bacteria | 1318 |
| 456 | Ga0206354_11277640 | 3300020081 | Bacteria | 1610 |
| 457 | Ga0224712_10070446 | 3300022467 | Bacteria | 1418 |
| 458 | Ga0207656_10243534 | 3300025321 | Unclassified | 879 |
| 459 | Ga0207653_10018400 | 3300025885 | Bacteria | 2200 |
| 460 | Ga0207642_10086808 | 3300025899 | Bacteria | 1535 |
| 461 | Ga0207642_10117534 | 3300025899 | Bacteria | 1366 |
| 462 | Ga0207642_10769334 | 3300025899 | Bacteria | 611 |
| 463 | Ga0207688_10013555 | 3300025901 | Bacteria | 4431 |
| 464 | Ga0207688_10060772 | 3300025901 | Bacteria | 2129 |
| 465 | Ga0207688_10111828 | 3300025901 | Unclassified | 1586 |
| 466 | Ga0207688_10143489 | 3300025901 | Unclassified | 1406 |
| 467 | Ga0207688_10550347 | 3300025901 | Bacteria | 725 |
| 468 | Ga0207680_10086005 | 3300025903 | Bacteria | 1987 |
| 469 | Ga0207647_10349319 | 3300025904 | Bacteria | 837 |
| 470 | Ga0207645_10116806 | 3300025907 | Bacteria | 1730 |
| 471 | Ga0207645_10227145 | 3300025907 | Bacteria | 1231 |
| 472 | Ga0207643_10153252 | 3300025908 | Bacteria | 1383 |
| 473 | Ga0207643_10206206 | 3300025908 | Bacteria | 1199 |
| 474 | Ga0207643_10325628 | 3300025908 | Bacteria | 961 |
| 475 | Ga0207643_10361395 | 3300025908 | Bacteria | 913 |
| 476 | Ga0207643_10517390 | 3300025908 | Bacteria | 764 |
| 477 | Ga0207705_10023479 | 3300025909 | Bacteria | 4399 |
| 478 | Ga0207705_10890455 | 3300025909 | Unclassified | 690 |
| 479 | Ga0207705_11230661 | 3300025909 | Bacteria | 574 |
| 480 | Ga0207684_10152321 | 3300025910 | Bacteria | 1990 |
| 481 | Ga0207684_10904603 | 3300025910 | Bacteria | 742 |
| 482 | Ga0207654_10595001 | 3300025911 | Bacteria | 789 |
| 483 | Ga0207654_11434169 | 3300025911 | Unclassified | 503 |
| 484 | Ga0207707_10016045 | 3300025912 | Bacteria | 6531 |
| 485 | Ga0207707_10178775 | 3300025912 | Bacteria | 1853 |
| 486 | Ga0207707_10393042 | 3300025912 | Unclassified | 1191 |
| 487 | Ga0207707_10671939 | 3300025912 | Bacteria | 872 |
| 488 | Ga0207707_10805229 | 3300025912 | Bacteria | 782 |
| 489 | Ga0207671_10718342 | 3300025914 | Bacteria | 794 |
| 490 | Ga0207660_10017237 | 3300025917 | Bacteria | 4794 |
| 491 | Ga0207660_10155820 | 3300025917 | Bacteria | 1758 |
| 492 | Ga0207660_10168419 | 3300025917 | Bacteria | 1694 |
| 493 | Ga0207662_10085898 | 3300025918 | Bacteria | 1927 |
| 494 | Ga0207662_10636895 | 3300025918 | Bacteria | 744 |
| 495 | Ga0207657_10003899 | 3300025919 | Bacteria | 15830 |
| 496 | Ga0207657_10096050 | 3300025919 | Bacteria | 2465 |
| 497 | Ga0207657_10194098 | 3300025919 | Bacteria | 1636 |
| 498 | Ga0207657_10210994 | 3300025919 | Bacteria | 1559 |
| 499 | Ga0207657_10583151 | 3300025919 | Unclassified | 873 |
| 500 | Ga0207657_10999542 | 3300025919 | Bacteria | 642 |
| 501 | Ga0207657_11190135 | 3300025919 | Bacteria | 580 |
| 502 | Ga0207649_10006520 | 3300025920 | Bacteria | 6341 |
| 503 | Ga0207649_10045143 | 3300025920 | Bacteria | 2700 |
| 504 | Ga0207649_10300772 | 3300025920 | Bacteria | 1173 |
| 505 | Ga0207649_11365178 | 3300025920 | Bacteria | 561 |
| 506 | Ga0207652_10049961 | 3300025921 | Bacteria | 3582 |
| 507 | Ga0207652_10131826 | 3300025921 | Bacteria | 2229 |
| 508 | Ga0207652_10427981 | 3300025921 | Unclassified | 1194 |
| 509 | Ga0207652_10675408 | 3300025921 | Bacteria | 923 |
| 510 | Ga0207646_10188524 | 3300025922 | Bacteria | 1863 |
| 511 | Ga0207646_10270563 | 3300025922 | Unclassified | 1536 |
| 512 | Ga0207646_11830118 | 3300025922 | Unclassified | 519 |
| 513 | Ga0207681_10124965 | 3300025923 | Bacteria | 1893 |
| 514 | Ga0207681_10306574 | 3300025923 | Bacteria | 1258 |
| 515 | Ga0207681_10348453 | 3300025923 | Unclassified | 1185 |
| 516 | Ga0207681_10683881 | 3300025923 | Unclassified | 852 |
| 517 | Ga0207681_10717210 | 3300025923 | Unclassified | 832 |
| 518 | Ga0207694_10118485 | 3300025924 | Bacteria | 2112 |
| 519 | Ga0207694_11682504 | 3300025924 | Bacteria | 534 |
| 520 | Ga0207650_11468665 | 3300025925 | Bacteria | 580 |
| 521 | Ga0207650_11523066 | 3300025925 | Unclassified | 568 |
| 522 | Ga0207659_10050673 | 3300025926 | Bacteria | 2950 |
| 523 | Ga0207659_10121009 | 3300025926 | Bacteria | 2006 |
| 524 | Ga0207659_10126612 | 3300025926 | Bacteria | 1965 |
| 525 | Ga0207659_10193288 | 3300025926 | Bacteria | 1620 |
| 526 | Ga0207659_10701790 | 3300025926 | Bacteria | 866 |
| 527 | Ga0207687_10012133 | 3300025927 | Bacteria | 5635 |
| 528 | Ga0207687_10013736 | 3300025927 | Bacteria | 5288 |
| 529 | Ga0207687_10190967 | 3300025927 | Bacteria | 1594 |
| 530 | Ga0207687_10329199 | 3300025927 | Unclassified | 1239 |
| 531 | Ga0207687_10926236 | 3300025927 | Bacteria | 746 |
| 532 | Ga0207644_10645960 | 3300025931 | Bacteria | 880 |
| 533 | Ga0207644_10960397 | 3300025931 | Bacteria | 717 |
| 534 | Ga0207644_11097051 | 3300025931 | Bacteria | 669 |
| 535 | Ga0207690_10037340 | 3300025932 | Bacteria | 3153 |
| 536 | Ga0207690_10051083 | 3300025932 | Bacteria | 2763 |
| 537 | Ga0207690_10263376 | 3300025932 | Bacteria | 1336 |
| 538 | Ga0207706_10003040 | 3300025933 | Bacteria | 16170 |
| 539 | Ga0207706_10018100 | 3300025933 | Bacteria | 6339 |
| 540 | Ga0207706_10025020 | 3300025933 | Bacteria | 5353 |
| 541 | Ga0207706_10209297 | 3300025933 | Bacteria | 1710 |
| 542 | Ga0207706_10747880 | 3300025933 | Bacteria | 833 |
| 543 | Ga0207686_10282224 | 3300025934 | Bacteria | 1226 |
| 544 | Ga0207686_11247868 | 3300025934 | Archaea | 609 |
| 545 | Ga0207709_10043199 | 3300025935 | Unclassified | 2716 |
| 546 | Ga0207709_10074295 | 3300025935 | Bacteria | 2169 |
| 547 | Ga0207709_10691128 | 3300025935 | Bacteria | 816 |
| 548 | Ga0207670_10122359 | 3300025936 | Unclassified | 1894 |
| 549 | Ga0207670_10400516 | 3300025936 | Bacteria | 1097 |
| 550 | Ga0207669_10073407 | 3300025937 | Bacteria | 2158 |
| 551 | Ga0207669_10111386 | 3300025937 | Bacteria | 1835 |
| 552 | Ga0207669_10163492 | 3300025937 | Bacteria | 1575 |
| 553 | Ga0207669_11194503 | 3300025937 | Bacteria | 644 |
| 554 | Ga0207669_11354239 | 3300025937 | Unclassified | 605 |
| 555 | Ga0207669_11560249 | 3300025937 | Archaea | 563 |
| 556 | Ga0207704_10067422 | 3300025938 | Bacteria | 2251 |
| 557 | Ga0207704_10242297 | 3300025938 | Bacteria | 1348 |
| 558 | Ga0207704_10259544 | 3300025938 | Unclassified | 1309 |
| 559 | Ga0207704_11797851 | 3300025938 | Bacteria | 527 |
| 560 | Ga0207691_10006406 | 3300025940 | Bacteria | 11371 |
| 561 | Ga0207691_10012064 | 3300025940 | Bacteria | 8290 |
| 562 | Ga0207691_10136553 | 3300025940 | Bacteria | 2162 |
| 563 | Ga0207691_10540916 | 3300025940 | Bacteria | 988 |
| 564 | Ga0207691_11020508 | 3300025940 | Bacteria | 690 |
| 565 | Ga0207711_10043749 | 3300025941 | Bacteria | 3821 |
| 566 | Ga0207711_10215795 | 3300025941 | Bacteria | 1753 |
| 567 | Ga0207711_11346223 | 3300025941 | Bacteria | 656 |
| 568 | Ga0207689_10121142 | 3300025942 | Bacteria | 2152 |
| 569 | Ga0207689_10868378 | 3300025942 | Bacteria | 761 |
| 570 | Ga0207689_11530401 | 3300025942 | Unclassified | 556 |
| 571 | Ga0207689_11558846 | 3300025942 | Bacteria | 550 |
| 572 | Ga0207689_11633856 | 3300025942 | Bacteria | 535 |
| 573 | Ga0207661_10000612 | 3300025944 | Bacteria | 22876 |
| 574 | Ga0207661_10033009 | 3300025944 | Bacteria | 4015 |
| 575 | Ga0207661_10036867 | 3300025944 | Bacteria | 3820 |
| 576 | Ga0207661_10205708 | 3300025944 | Bacteria | 1733 |
| 577 | Ga0207661_10277007 | 3300025944 | Bacteria | 1498 |
| 578 | Ga0207661_10341501 | 3300025944 | Unclassified | 1349 |
| 579 | Ga0207661_10377166 | 3300025944 | Archaea | 1283 |
| 580 | Ga0207661_11334018 | 3300025944 | Bacteria | 659 |
| 581 | Ga0207661_11720266 | 3300025944 | Bacteria | 572 |
| 582 | Ga0207679_10117357 | 3300025945 | Bacteria | 2112 |
| 583 | Ga0207679_10133330 | 3300025945 | Bacteria | 1996 |
| 584 | Ga0207679_10217596 | 3300025945 | Bacteria | 1605 |
| 585 | Ga0207679_10294743 | 3300025945 | Unclassified | 1396 |
| 586 | Ga0207679_10710625 | 3300025945 | Unclassified | 912 |
| 587 | Ga0207679_10741182 | 3300025945 | Bacteria | 893 |
| 588 | Ga0207679_11340165 | 3300025945 | Bacteria | 657 |
| 589 | Ga0207667_11344700 | 3300025949 | Bacteria | 689 |
| 590 | Ga0207651_10184857 | 3300025960 | Unclassified | 1657 |
| 591 | Ga0207651_11223308 | 3300025960 | Bacteria | 674 |
| 592 | Ga0207712_10898689 | 3300025961 | Bacteria | 783 |
| 593 | Ga0207668_10029857 | 3300025972 | Bacteria | 3578 |
| 594 | Ga0207668_10718474 | 3300025972 | Bacteria | 879 |
| 595 | Ga0207640_10074967 | 3300025981 | Bacteria | 2291 |
| 596 | Ga0207640_10496448 | 3300025981 | Archaea | 1015 |
| 597 | Ga0207640_11348832 | 3300025981 | Unclassified | 638 |
| 598 | Ga0207640_11459965 | 3300025981 | Bacteria | 614 |
| 599 | Ga0207658_10828041 | 3300025986 | Bacteria | 841 |
| 600 | Ga0207677_10027716 | 3300026023 | Bacteria | 3573 |
| 601 | Ga0207677_10315501 | 3300026023 | Bacteria | 1297 |
| 602 | Ga0207677_10895731 | 3300026023 | Bacteria | 799 |
| 603 | Ga0207677_11111706 | 3300026023 | Bacteria | 721 |
| 604 | Ga0207677_11331989 | 3300026023 | Archaea | 660 |
| 605 | Ga0207703_10051335 | 3300026035 | Bacteria | 3341 |
| 606 | Ga0207703_10980027 | 3300026035 | Bacteria | 811 |
| 607 | Ga0207639_10012338 | 3300026041 | Bacteria | 5950 |
| 608 | Ga0207639_10519206 | 3300026041 | Unclassified | 1090 |
| 609 | Ga0207639_11199777 | 3300026041 | Unclassified | 712 |
| 610 | Ga0207639_11716654 | 3300026041 | Bacteria | 588 |
| 611 | Ga0207678_10023034 | 3300026067 | Bacteria | 5450 |
| 612 | Ga0207678_10177813 | 3300026067 | Bacteria | 1817 |
| 613 | Ga0207678_10438064 | 3300026067 | Bacteria | 1135 |
| 614 | Ga0207708_10015196 | 3300026075 | Bacteria | 5771 |
| 615 | Ga0207708_10016992 | 3300026075 | Bacteria | 5477 |
| 616 | Ga0207708_10060405 | 3300026075 | Bacteria | 2893 |
| 617 | Ga0207708_10248364 | 3300026075 | Bacteria | 1433 |
| 618 | Ga0207702_10074671 | 3300026078 | Bacteria | 2927 |
| 619 | Ga0207702_10206917 | 3300026078 | Bacteria | 1822 |
| 620 | Ga0207702_10417877 | 3300026078 | Bacteria | 1296 |
| 621 | Ga0207641_10790612 | 3300026088 | Bacteria | 938 |
| 622 | Ga0207648_10051981 | 3300026089 | Bacteria | 3582 |
| 623 | Ga0207648_10125301 | 3300026089 | Bacteria | 2260 |
| 624 | Ga0207648_10182488 | 3300026089 | Bacteria | 1858 |
| 625 | Ga0207648_10185847 | 3300026089 | Bacteria | 1841 |
| 626 | Ga0207648_10445614 | 3300026089 | Bacteria | 1178 |
| 627 | Ga0207648_11628147 | 3300026089 | Unclassified | 607 |
| 628 | Ga0207676_10276214 | 3300026095 | Bacteria | 1523 |
| 629 | Ga0207676_10579641 | 3300026095 | Bacteria | 1075 |
| 630 | Ga0207676_10960354 | 3300026095 | Bacteria | 841 |
| 631 | Ga0207676_11662958 | 3300026095 | Bacteria | 637 |
| 632 | Ga0207676_11736969 | 3300026095 | Unclassified | 622 |
| 633 | Ga0207674_10031518 | 3300026116 | Bacteria | 5569 |
| 634 | Ga0207674_10060638 | 3300026116 | Bacteria | 3824 |
| 635 | Ga0207674_10431412 | 3300026116 | Unclassified | 1274 |
| 636 | Ga0207674_11081827 | 3300026116 | Bacteria | 771 |
| 637 | Ga0207674_11184008 | 3300026116 | Bacteria | 734 |
| 638 | Ga0207675_100119742 | 3300026118 | Bacteria | 2490 |
| 639 | Ga0207675_100647694 | 3300026118 | Unclassified | 1062 |
| 640 | Ga0207683_10004422 | 3300026121 | Bacteria | 12149 |
| 641 | Ga0207683_10025471 | 3300026121 | Bacteria | 5104 |
| 642 | Ga0207683_10061101 | 3300026121 | Bacteria | 3315 |
| 643 | Ga0207683_10115188 | 3300026121 | Bacteria | 2410 |
| 644 | Ga0207683_10260174 | 3300026121 | Bacteria | 1584 |
| 645 | Ga0207683_10833282 | 3300026121 | Bacteria | 856 |
| 646 | Ga0207683_11157473 | 3300026121 | Archaea | 717 |
| 647 | Ga0207683_11528163 | 3300026121 | Bacteria | 616 |
| 648 | Ga0207698_10003410 | 3300026142 | Bacteria | 9566 |
| 649 | Ga0207698_10052158 | 3300026142 | Bacteria | 3132 |
| 650 | Ga0207698_10069554 | 3300026142 | Bacteria | 2784 |
| 651 | Ga0207698_10096671 | 3300026142 | Bacteria | 2435 |
| 652 | Ga0207698_10485231 | 3300026142 | Bacteria | 1200 |
| 653 | Ga0207698_12233416 | 3300026142 | Unclassified | 560 |
| 654 | Ga0209998_10052091 | 3300027717 | Unclassified | 949 |
| 655 | Ga0209813_10469070 | 3300027866 | Bacteria | 518 |
| 656 | Ga0209974_10158418 | 3300027876 | Bacteria | 820 |
| 657 | Ga0207428_10002314 | 3300027907 | Bacteria | 19080 |
| 658 | Ga0207428_10167268 | 3300027907 | Bacteria | 1667 |
| 659 | Ga0207428_10175303 | 3300027907 | Bacteria | 1622 |
| 660 | Ga0268266_10249643 | 3300028379 | Bacteria | 1641 |
| 661 | Ga0268266_10510220 | 3300028379 | Bacteria | 1149 |
| 662 | Ga0268266_10642900 | 3300028379 | Bacteria | 1021 |
| 663 | Ga0268266_11364561 | 3300028379 | Bacteria | 684 |
| 664 | Ga0268265_11237955 | 3300028380 | Unclassified | 745 |
| 665 | Ga0268265_11550855 | 3300028380 | Bacteria | 667 |
| 666 | Ga0268264_10036367 | 3300028381 | Bacteria | 4057 |
| 667 | Ga0268264_10661439 | 3300028381 | Unclassified | 1035 |
| 668 | Ga0307408_100885856 | 3300031548 | Bacteria | 816 |
| 669 | Ga0307405_10730476 | 3300031731 | Bacteria | 823 |
| 670 | Ga0307405_10804385 | 3300031731 | Bacteria | 788 |
| 671 | Ga0326468_10084057 | 3300031889 | Unclassified | 556 |
| 672 | Ga0307416_100149706 | 3300032002 | Bacteria | 2138 |
| 673 | Ga0307416_100636788 | 3300032002 | Bacteria | 1150 |
| 674 | Ga0307415_100459462 | 3300032126 | Bacteria | 1103 |
| 675 | Ga0373948_0013703 | 3300034817 | Bacteria | 1468 |
| 676 | Ga0373938_0136265 | 3300034957 | Bacteria | 644 |
| 677 | Ga0373928_0035993 | 3300035084 | Bacteria | 1118 |
| 678 | Ga0373949_0089257 | 3300035090 | Bacteria | 831 |
| 679 | Ga0373951_0097676 | 3300035091 | Bacteria | 777 |
| 680 | Ga0373941_0013948 | 3300035115 | Bacteria | 2136 |
| 681 | Ga0373960_0093458 | 3300035121 | Unclassified | 965 |
| 682 | Ga0373942_0199928 | 3300035207 | Bacteria | 662 |
| 683 | Ga0373961_0081863 | 3300035241 | Bacteria | 1017 |
| 684 | Ga0373962_0027361 | 3300035242 | Bacteria | 1542 |
| 685 | Ga0373931_0072674 | 3300035691 | Bacteria | 1881 |
| 686 | Ga0373931_0260963 | 3300035691 | Unclassified | 1057 |
| 687 | Ga0373937_1789897 | 3300036401 | Bacteria | 561 |
| 688 | Ga0395899_0053875 | 3300037312 | Bacteria | 2978 |
| 689 | Ga0395900_0005363 | 3300037418 | Bacteria | 13437 |
| 690 | Ga0395900_0056240 | 3300037418 | Bacteria | 4050 |
| 691 | Ga0395900_0088732 | 3300037418 | Bacteria | 3179 |
| 692 | Ga0395900_0193927 | 3300037418 | Unclassified | 2059 |
| 693 | Ga0395900_0671501 | 3300037418 | Bacteria | 971 |
| 694 | Ga0395898_0063334 | 3300037466 | Bacteria | 3589 |
| 695 | Ga0395898_0071698 | 3300037466 | Bacteria | 3347 |
| 696 | Ga0395898_0117909 | 3300037466 | Bacteria | 2543 |
| 697 | Ga0395898_1628378 | 3300037466 | Unclassified | 569 |
| 698 | Ga0395898_1693641 | 3300037466 | Unclassified | 555 |
| 699 | Ga0395905_0006331 | 3300037471 | Bacteria | 11928 |
| 700 | Ga0395905_0027035 | 3300037471 | Bacteria | 5411 |
| 701 | Ga0395905_0062102 | 3300037471 | Bacteria | 3495 |
| 702 | Ga0395905_0105649 | 3300037471 | Bacteria | 2644 |
| 703 | Ga0395901_0013286 | 3300038443 | Bacteria | 8363 |
| 704 | Ga0395901_0021597 | 3300038443 | Bacteria | 6595 |
| 705 | Ga0395901_0030277 | 3300038443 | Bacteria | 5576 |
| 706 | Ga0395901_0067669 | 3300038443 | Bacteria | 3720 |
| 707 | Ga0395901_0083956 | 3300038443 | Bacteria | 3329 |
| 708 | Ga0395901_0757946 | 3300038443 | Bacteria | 963 |
| 709 | Ga0395901_0787498 | 3300038443 | Bacteria | 941 |
| 710 | Ga0395901_1426352 | 3300038443 | Bacteria | 650 |
| 711 | Ga0451787_144833 | 3300041441 | Bacteria | 581 |
| 712 | Ga0451789_0067247 | 3300041443 | Bacteria | 630 |
| 713 | Ga0451789_0622442 | 3300041443 | Bacteria | 1140 |
| 714 | Ga0451793_0217906 | 3300041452 | Unclassified | 1348 |
| 715 | Ga0451802_0539959 | 3300041460 | Bacteria | 1034 |
| 716 | Ga0451802_2123391 | 3300041460 | Bacteria | 972 |
| 717 | Ga0451807_1505927 | 3300041486 | Bacteria | 630 |
| 718 | Ga0451835_0445768 | 3300041492 | Bacteria | 802 |
| 719 | Ga0451837_1813209 | 3300041494 | Bacteria | 564 |
| 720 | Ga0451853_3086998 | 3300041512 | Unclassified | 1193 |
| 721 | Ga0450911_028724 | 3300042115 | Bacteria | 721 |
| 722 | Ga0450920_002200 | 3300042122 | Bacteria | 3301 |
| 723 | Ga0450923_039659 | 3300042125 | Unclassified | 986 |
| 724 | Ga0450890_060459 | 3300042127 | Bacteria | 593 |
| 725 | Ga0450898_090077 | 3300042134 | Unclassified | 632 |
| 726 | Ga0450902_009145 | 3300042137 | Unclassified | 1558 |
| 727 | Ga0450906_016580 | 3300042145 | Bacteria | 1332 |
| 728 | Ga0450907_059315 | 3300042146 | Bacteria | 660 |
| 729 | Ga0439458_0044625 | 3300042157 | Unclassified | 1083 |
| 730 | Ga0450908_025444 | 3300042184 | Bacteria | 1034 |
| 731 | Ga0450909_070273 | 3300042185 | Bacteria | 560 |
| 732 | Ga0439464_0295073 | 3300042439 | Bacteria | 529 |
| 733 | Ga0450916_034239 | 3300042530 | Unclassified | 751 |
| 734 | Ga0450918_013958 | 3300042531 | Bacteria | 1397 |
| 735 | Ga0439440_0232638 | 3300042993 | Bacteria | 556 |
| 736 | Ga0466967_0350002 | 3300045976 | Bacteria | 1430 |
| 737 | Ga0495603_0035069 | 3300046455 | Bacteria | 3015 |
| 738 | Ga0495603_0264450 | 3300046455 | Bacteria | 990 |
| 739 | Ga0495641_0270051 | 3300046461 | Bacteria | 765 |
| 740 | Ga0495651_0500581 | 3300046462 | Bacteria | 778 |
| 741 | Ga0495582_0443499 | 3300046473 | Bacteria | 749 |
| 742 | Ga0495605_0138172 | 3300046474 | Bacteria | 1095 |
| 743 | Ga0495584_0613625 | 3300046491 | Bacteria | 555 |
| 744 | Ga0495585_0244741 | 3300046492 | Bacteria | 897 |
| 745 | Ga0495596_0105550 | 3300046500 | Bacteria | 1094 |
| 746 | Ga0495596_0405762 | 3300046500 | Bacteria | 531 |
| 747 | Ga0495608_0138327 | 3300046511 | Bacteria | 1555 |
| 748 | Ga0495616_0280749 | 3300046513 | Bacteria | 708 |
| 749 | Ga0495618_0646578 | 3300046514 | Bacteria | 626 |
| 750 | Ga0495620_0210159 | 3300046515 | Bacteria | 747 |
| 751 | Ga0495628_0219470 | 3300046516 | Bacteria | 1428 |
| 752 | Ga0495628_0777536 | 3300046516 | Bacteria | 671 |
| 753 | Ga0495630_0143599 | 3300046517 | Bacteria | 1815 |
| 754 | Ga0495644_0043043 | 3300046523 | Unclassified | 1700 |
| 755 | Ga0495587_0709012 | 3300046536 | Bacteria | 551 |
| 756 | Ga0495598_0259894 | 3300046537 | Bacteria | 646 |
| 757 | Ga0495645_0347890 | 3300046543 | Bacteria | 956 |
| 758 | Ga0495667_0957206 | 3300046559 | Unclassified | 523 |
| 759 | Ga0495656_0172387 | 3300046615 | Unclassified | 1059 |
| 760 | Ga0495656_0337502 | 3300046615 | Bacteria | 779 |
| 761 | Ga0495656_0712993 | 3300046615 | Bacteria | 540 |
| 762 | Ga0495634_0820110 | 3300046642 | Bacteria | 530 |
| 763 | Ga0495611_0223513 | 3300046648 | Bacteria | 876 |
| 764 | Ga0495635_0199282 | 3300046663 | Bacteria | 1358 |
| 765 | Ga0495659_0102784 | 3300046664 | Bacteria | 1109 |
| 766 | Ga0495588_0327785 | 3300046674 | Bacteria | 805 |
| 767 | Ga0495658_0482207 | 3300046683 | Bacteria | 793 |
| 768 | Ga0495658_0736409 | 3300046683 | Bacteria | 632 |
| 769 | Ga0495658_0850368 | 3300046683 | Unclassified | 584 |
| 770 | Ga0495624_0350387 | 3300046690 | Bacteria | 888 |
| 771 | Ga0495624_0564779 | 3300046690 | Bacteria | 679 |
| 772 | Ga0495670_0410725 | 3300046691 | Bacteria | 732 |
| 773 | Ga0495671_0058339 | 3300046692 | Bacteria | 1910 |
| 774 | Ga0495589_0045256 | 3300046794 | Bacteria | 2187 |
| 775 | Ga0495600_0698996 | 3300046809 | Bacteria | 610 |
| 776 | Ga0495660_0489572 | 3300046810 | Bacteria | 527 |
| 777 | Ga0495581_0539635 | 3300047315 | Bacteria | 677 |
| 778 | Ga0495604_0245016 | 3300047317 | Bacteria | 1224 |
| 779 | Ga0495604_0589546 | 3300047317 | Bacteria | 714 |
| 780 | Ga0495636_0087635 | 3300047318 | Bacteria | 1348 |
| 781 | Ga0495674_0120853 | 3300047319 | Bacteria | 2213 |
| 782 | Ga0495676_0336055 | 3300047321 | Bacteria | 1012 |
| 783 | Ga0495676_1031363 | 3300047321 | Unclassified | 524 |
| 784 | Ga0495675_0243476 | 3300047444 | Bacteria | 1082 |
| 785 | Ga0495684_0605319 | 3300047471 | Bacteria | 739 |
| 786 | Ga0496100_0432659 | 3300048903 | Bacteria | 1006 |
| 787 | Ga0496100_0554901 | 3300048903 | Bacteria | 889 |
| 788 | Ga0496100_0849718 | 3300048903 | Bacteria | 716 |
| 789 | Ga0496100_1306091 | 3300048903 | Bacteria | 572 |
| 790 | Ga0496101_0130884 | 3300048904 | Bacteria | 1905 |
| 791 | Ga0496101_0138299 | 3300048904 | Unclassified | 1855 |
| 792 | Ga0496101_0217352 | 3300048904 | Bacteria | 1482 |
| 793 | Ga0496101_1157668 | 3300048904 | Bacteria | 607 |
| 794 | Ga0496102_0234483 | 3300048905 | Unclassified | 1730 |
| 795 | Ga0496102_0527928 | 3300048905 | Bacteria | 1103 |
| 796 | Ga0496102_0615214 | 3300048905 | Bacteria | 1009 |
| 797 | Ga0496102_0668846 | 3300048905 | Bacteria | 961 |
| 798 | Ga0496102_1524458 | 3300048905 | Archaea | 587 |
| 799 | Ga0496102_1729973 | 3300048905 | Bacteria | 543 |
| 800 | Ga0496103_0160526 | 3300048906 | Unclassified | 1442 |
| 801 | Ga0496104_0027875 | 3300048907 | Bacteria | 5230 |
| 802 | Ga0496104_0230746 | 3300048907 | Bacteria | 1763 |
| 803 | Ga0496104_0303765 | 3300048907 | Unclassified | 1508 |
| 804 | Ga0496104_0382872 | 3300048907 | Bacteria | 1319 |
| 805 | Ga0496104_1101567 | 3300048907 | Bacteria | 698 |
| 806 | Ga0496104_1355928 | 3300048907 | Bacteria | 614 |
| 807 | Ga0496104_1378047 | 3300048907 | Bacteria | 608 |
| 808 | Ga0496105_0120951 | 3300048908 | Bacteria | 2159 |
| 809 | Ga0496105_0215961 | 3300048908 | Bacteria | 1562 |
| 810 | Ga0496105_0364671 | 3300048908 | Bacteria | 1152 |
| 811 | Ga0496105_0584496 | 3300048908 | Bacteria | 868 |
| 812 | Ga0496106_0025632 | 3300048909 | Bacteria | 4390 |
| 813 | Ga0496107_0191368 | 3300048910 | Bacteria | 1520 |
| 814 | Ga0496107_0429079 | 3300048910 | Bacteria | 983 |
| 815 | Ga0496107_1337180 | 3300048910 | Bacteria | 512 |
| 816 | Ga0496108_0019446 | 3300048911 | Bacteria | 5578 |
| 817 | Ga0496108_0270465 | 3300048911 | Bacteria | 1479 |
| 818 | Ga0496108_0652845 | 3300048911 | Bacteria | 914 |
| 819 | Ga0496108_1463315 | 3300048911 | Bacteria | 569 |
| 820 | Ga0496108_1568393 | 3300048911 | Bacteria | 546 |
| 821 | Ga0496109_0002689 | 3300048912 | Bacteria | 14909 |
| 822 | Ga0496109_0011202 | 3300048912 | Bacteria | 7696 |
| 823 | Ga0496109_0084789 | 3300048912 | Bacteria | 2923 |
| 824 | Ga0496109_0121469 | 3300048912 | Unclassified | 2434 |
| 825 | Ga0496109_0522717 | 3300048912 | Bacteria | 1120 |
| 826 | Ga0496109_1167443 | 3300048912 | Bacteria | 707 |
| 827 | Ga0496109_1768708 | 3300048912 | Archaea | 551 |
| 828 | Ga0496109_1882614 | 3300048912 | Bacteria | 531 |
| 829 | Ga0496110_0030503 | 3300048913 | Bacteria | 4648 |
| 830 | Ga0496110_0033633 | 3300048913 | Bacteria | 4436 |
| 831 | Ga0496110_0831379 | 3300048913 | Bacteria | 828 |
| 832 | Ga0496110_1686591 | 3300048913 | Unclassified | 544 |
| 833 | Ga0496110_1730585 | 3300048913 | Unclassified | 535 |
| 834 | Ga0496111_0003152 | 3300048914 | Bacteria | 10149 |
| 835 | Ga0496111_0067911 | 3300048914 | Bacteria | 2590 |
| 836 | Ga0496111_0259350 | 3300048914 | Bacteria | 1290 |
| 837 | Ga0496111_0506762 | 3300048914 | Unclassified | 888 |
| 838 | Ga0496112_0148129 | 3300048915 | Bacteria | 2315 |
| 839 | Ga0496112_0218787 | 3300048915 | Bacteria | 1861 |
| 840 | Ga0496113_0239154 | 3300048916 | Bacteria | 1449 |
| 841 | Ga0496114_0127020 | 3300048917 | Bacteria | 2199 |
| 842 | Ga0496114_0146112 | 3300048917 | Bacteria | 2050 |
| 843 | Ga0496114_0217280 | 3300048917 | Unclassified | 1678 |
| 844 | Ga0496114_0325870 | 3300048917 | Bacteria | 1358 |
| 845 | Ga0496114_0336944 | 3300048917 | Bacteria | 1333 |
| 846 | Ga0496114_0381691 | 3300048917 | Bacteria | 1247 |
| 847 | Ga0496114_0445050 | 3300048917 | Bacteria | 1147 |
| 848 | Ga0496114_0489201 | 3300048917 | Bacteria | 1088 |
| 849 | Ga0496114_0513982 | 3300048917 | Bacteria | 1059 |
| 850 | Ga0496114_1112719 | 3300048917 | Bacteria | 675 |
| 851 | Ga0501031_0001754 | 3300049568 | Bacteria | 13605 |
| 852 | Ga0501031_0152337 | 3300049568 | Bacteria | 1511 |
| 853 | Ga0501031_0214057 | 3300049568 | Bacteria | 1255 |
| 854 | Ga0501031_0609937 | 3300049568 | Bacteria | 702 |
| 855 | Ga0501031_0748699 | 3300049568 | Bacteria | 627 |
| 856 | Ga0501032_0014533 | 3300049569 | Bacteria | 5574 |
| 857 | Ga0501032_0015883 | 3300049569 | Bacteria | 5304 |
| 858 | Ga0501032_0143422 | 3300049569 | Bacteria | 1572 |
| 859 | Ga0501032_0175329 | 3300049569 | Bacteria | 1405 |
| 860 | Ga0501032_0352308 | 3300049569 | Bacteria | 948 |
| 861 | Ga0501032_0594350 | 3300049569 | Bacteria | 704 |
| 862 | Ga0501033_0021291 | 3300049570 | Bacteria | 4891 |
| 863 | Ga0501033_0123752 | 3300049570 | Bacteria | 1875 |
| 864 | Ga0501033_0224595 | 3300049570 | Bacteria | 1336 |
| 865 | Ga0501034_0121208 | 3300049571 | Bacteria | 2602 |
| 866 | Ga0501034_0207367 | 3300049571 | Bacteria | 1916 |
| 867 | Ga0501036_0022147 | 3300049572 | Bacteria | 5345 |
| 868 | Ga0501036_0036855 | 3300049572 | Bacteria | 4137 |
| 869 | Ga0501036_0046920 | 3300049572 | Bacteria | 3658 |
| 870 | Ga0501036_0054874 | 3300049572 | Bacteria | 3376 |
| 871 | Ga0501036_0103525 | 3300049572 | Bacteria | 2407 |
| 872 | Ga0501036_0331860 | 3300049572 | Bacteria | 1270 |
| 873 | Ga0501036_0338754 | 3300049572 | Bacteria | 1256 |
| 874 | Ga0501036_1579255 | 3300049572 | Unclassified | 530 |
| 875 | Ga0501037_0001734 | 3300049573 | Bacteria | 15838 |
| 876 | Ga0501037_0012017 | 3300049573 | Bacteria | 6379 |
| 877 | Ga0501037_0076460 | 3300049573 | Bacteria | 2430 |
| 878 | Ga0501037_0225254 | 3300049573 | Bacteria | 1318 |
| 879 | Ga0501037_0258555 | 3300049573 | Bacteria | 1217 |
| 880 | Ga0501038_0010491 | 3300049574 | Bacteria | 8472 |
| 881 | Ga0501038_0020457 | 3300049574 | Bacteria | 5948 |
| 882 | Ga0501038_0021628 | 3300049574 | Bacteria | 5771 |
| 883 | Ga0501038_0046809 | 3300049574 | Bacteria | 3749 |
| 884 | Ga0501038_0371394 | 3300049574 | Bacteria | 1111 |
| 885 | Ga0501038_0925532 | 3300049574 | Bacteria | 643 |
| 886 | Ga0501038_0971800 | 3300049574 | Bacteria | 624 |
| 887 | Ga0501038_1013005 | 3300049574 | Unclassified | 609 |
| 888 | Ga0501038_1200320 | 3300049574 | Unclassified | 551 |
| 889 | Ga0501039_0013914 | 3300049575 | Bacteria | 6155 |
| 890 | Ga0501039_0055895 | 3300049575 | Bacteria | 3058 |
| 891 | Ga0501039_0067408 | 3300049575 | Bacteria | 2779 |
| 892 | Ga0501039_0068069 | 3300049575 | Bacteria | 2765 |
| 893 | Ga0501039_0110088 | 3300049575 | Bacteria | 2153 |
| 894 | Ga0501039_0135629 | 3300049575 | Bacteria | 1932 |
| 895 | Ga0501039_0198444 | 3300049575 | Bacteria | 1578 |
| 896 | Ga0501039_0290168 | 3300049575 | Bacteria | 1286 |
| 897 | Ga0501039_0328024 | 3300049575 | Bacteria | 1203 |
| 898 | Ga0501040_0019285 | 3300049576 | Bacteria | 4536 |
| 899 | Ga0501040_0022250 | 3300049576 | Bacteria | 4241 |
| 900 | Ga0501040_0041611 | 3300049576 | Bacteria | 3129 |
| 901 | Ga0501040_0052374 | 3300049576 | Bacteria | 2793 |
| 902 | Ga0501040_0062134 | 3300049576 | Bacteria | 2570 |
| 903 | Ga0501040_0112106 | 3300049576 | Unclassified | 1908 |
| 904 | Ga0501040_0112614 | 3300049576 | Unclassified | 1904 |
| 905 | Ga0501040_0117512 | 3300049576 | Bacteria | 1864 |
| 906 | Ga0501040_0252341 | 3300049576 | Bacteria | 1258 |
| 907 | Ga0501040_0435522 | 3300049576 | Bacteria | 943 |
| 908 | Ga0501041_0006203 | 3300049577 | Bacteria | 6988 |
| 909 | Ga0501041_0007256 | 3300049577 | Bacteria | 6505 |
| 910 | Ga0501041_0028618 | 3300049577 | Bacteria | 3361 |
| 911 | Ga0501041_0079270 | 3300049577 | Bacteria | 2021 |
| 912 | Ga0501041_0392273 | 3300049577 | Unclassified | 879 |
| 913 | Ga0501041_0501330 | 3300049577 | Bacteria | 772 |
| 914 | Ga0501041_0597561 | 3300049577 | Bacteria | 704 |
| 915 | Ga0501042_0006488 | 3300049578 | Bacteria | 7597 |
| 916 | Ga0501042_0016796 | 3300049578 | Bacteria | 5033 |
| 917 | Ga0501042_0058535 | 3300049578 | Bacteria | 2751 |
| 918 | Ga0501042_0113882 | 3300049578 | Bacteria | 1947 |
| 919 | Ga0501042_0242329 | 3300049578 | Bacteria | 1301 |
| 920 | Ga0501042_0475668 | 3300049578 | Bacteria | 906 |
| 921 | Ga0501042_1377111 | 3300049578 | Unclassified | 514 |
| 922 | Ga0501043_0057097 | 3300049579 | Bacteria | 3065 |
| 923 | Ga0501043_0081566 | 3300049579 | Unclassified | 2542 |
| 924 | Ga0501043_0098803 | 3300049579 | Bacteria | 2294 |
| 925 | Ga0501043_0329677 | 3300049579 | Bacteria | 1162 |
| 926 | Ga0501043_0363906 | 3300049579 | Bacteria | 1097 |
| 927 | Ga0501046_0003198 | 3300049580 | Bacteria | 15071 |
| 928 | Ga0501046_0048035 | 3300049580 | Bacteria | 3381 |
| 929 | Ga0501046_0063500 | 3300049580 | Bacteria | 2883 |
| 930 | Ga0501046_0103819 | 3300049580 | Bacteria | 2178 |
| 931 | Ga0501046_0138552 | 3300049580 | Bacteria | 1842 |
| 932 | Ga0501046_0287854 | 3300049580 | Unclassified | 1202 |
| 933 | Ga0501046_0769721 | 3300049580 | Unclassified | 676 |
| 934 | Ga0501047_0513915 | 3300049581 | Bacteria | 1024 |
| 935 | Ga0501048_0005712 | 3300049582 | Bacteria | 9456 |
| 936 | Ga0501048_0016260 | 3300049582 | Bacteria | 5484 |
| 937 | Ga0501048_0049671 | 3300049582 | Bacteria | 2989 |
| 938 | Ga0501048_0057482 | 3300049582 | Bacteria | 2759 |
| 939 | Ga0501048_0083215 | 3300049582 | Bacteria | 2257 |
| 940 | Ga0501048_0092389 | 3300049582 | Bacteria | 2134 |
| 941 | Ga0501048_0190743 | 3300049582 | Bacteria | 1452 |
| 942 | Ga0501048_0455541 | 3300049582 | Bacteria | 916 |
| 943 | Ga0501067_0029785 | 3300049583 | Bacteria | 3026 |
| 944 | Ga0501067_0416262 | 3300049583 | Unclassified | 750 |
| 945 | Ga0501067_0533503 | 3300049583 | Bacteria | 657 |
| 946 | Ga0501068_0011157 | 3300049584 | Bacteria | 5063 |
| 947 | Ga0501068_0011596 | 3300049584 | Bacteria | 4978 |
| 948 | Ga0501068_0147984 | 3300049584 | Bacteria | 1475 |
| 949 | Ga0501068_0186174 | 3300049584 | Bacteria | 1314 |
| 950 | Ga0501068_0194918 | 3300049584 | Bacteria | 1284 |
| 951 | Ga0501068_0245792 | 3300049584 | Bacteria | 1139 |
| 952 | Ga0501068_0330909 | 3300049584 | Bacteria | 977 |
| 953 | Ga0501069_0000404 | 3300049585 | Bacteria | 19543 |
| 954 | Ga0501069_0005994 | 3300049585 | Bacteria | 6340 |
| 955 | Ga0501069_0023246 | 3300049585 | Bacteria | 3378 |
| 956 | Ga0501069_0071781 | 3300049585 | Bacteria | 1941 |
| 957 | Ga0501069_0084634 | 3300049585 | Bacteria | 1789 |
| 958 | Ga0501069_0104261 | 3300049585 | Unclassified | 1611 |
| 959 | Ga0501069_0121787 | 3300049585 | Bacteria | 1490 |
| 960 | Ga0501069_0451383 | 3300049585 | Bacteria | 764 |
| 961 | Ga0501069_0956969 | 3300049585 | Bacteria | 522 |
| 962 | Ga0501070_0038832 | 3300049586 | Bacteria | 3972 |
| 963 | Ga0501070_0120293 | 3300049586 | Bacteria | 2170 |
| 964 | Ga0501070_0142276 | 3300049586 | Bacteria | 1980 |
| 965 | Ga0501070_0330457 | 3300049586 | Bacteria | 1239 |
| 966 | Ga0501070_0980483 | 3300049586 | Bacteria | 656 |
| 967 | Ga0501070_1474431 | 3300049586 | Bacteria | 515 |
| 968 | Ga0501071_0007629 | 3300049587 | Bacteria | 7128 |
| 969 | Ga0501071_0017219 | 3300049587 | Bacteria | 4981 |
| 970 | Ga0501071_0023334 | 3300049587 | Bacteria | 4320 |
| 971 | Ga0501071_0035205 | 3300049587 | Bacteria | 3566 |
| 972 | Ga0501071_0054966 | 3300049587 | Bacteria | 2873 |
| 973 | Ga0501071_0070959 | 3300049587 | Bacteria | 2539 |
| 974 | Ga0501071_0128945 | 3300049587 | Bacteria | 1878 |
| 975 | Ga0501071_0511580 | 3300049587 | Bacteria | 921 |
| 976 | Ga0501071_1391546 | 3300049587 | Bacteria | 542 |
| 977 | Ga0501072_0024283 | 3300049588 | Bacteria | 4714 |
| 978 | Ga0501072_0031317 | 3300049588 | Bacteria | 4162 |
| 979 | Ga0501072_0047202 | 3300049588 | Bacteria | 3391 |
| 980 | Ga0501072_0141758 | 3300049588 | Bacteria | 1916 |
| 981 | Ga0501072_0273398 | 3300049588 | Bacteria | 1344 |
| 982 | Ga0501072_0589395 | 3300049588 | Bacteria | 877 |
| 983 | Ga0501072_1221232 | 3300049588 | Bacteria | 584 |
| 984 | Ga0501073_0027444 | 3300049589 | Bacteria | 4071 |
| 985 | Ga0501073_0036973 | 3300049589 | Bacteria | 3468 |
| 986 | Ga0501073_0045539 | 3300049589 | Bacteria | 3089 |
| 987 | Ga0501074_0010424 | 3300049590 | Bacteria | 6744 |
| 988 | Ga0501074_0035462 | 3300049590 | Bacteria | 3614 |
| 989 | Ga0501074_0046674 | 3300049590 | Bacteria | 3132 |
| 990 | Ga0501074_0075607 | 3300049590 | Bacteria | 2417 |
| 991 | Ga0501074_0083713 | 3300049590 | Bacteria | 2287 |
| 992 | Ga0501074_0191407 | 3300049590 | Unclassified | 1458 |
| 993 | Ga0501074_0903316 | 3300049590 | Bacteria | 622 |
| 994 | Ga0501074_0912687 | 3300049590 | Unclassified | 618 |
| 995 | Ga0501075_0079617 | 3300049591 | Bacteria | 2479 |
| 996 | Ga0501075_0086681 | 3300049591 | Bacteria | 2372 |
| 997 | Ga0501075_0111997 | 3300049591 | Bacteria | 2075 |
| 998 | Ga0501075_0213807 | 3300049591 | Bacteria | 1470 |
| 999 | Ga0501075_0224889 | 3300049591 | Bacteria | 1431 |
| 1000 | Ga0501075_0246283 | 3300049591 | Bacteria | 1362 |
| 1001 | Ga0501075_0267587 | 3300049591 | Bacteria | 1302 |
| 1002 | Ga0501075_0997239 | 3300049591 | Bacteria | 636 |
| 1003 | Ga0501076_0001971 | 3300049592 | Bacteria | 14012 |
| 1004 | Ga0501076_0030067 | 3300049592 | Bacteria | 4229 |
| 1005 | Ga0501076_0040451 | 3300049592 | Bacteria | 3664 |
| 1006 | Ga0501076_0062557 | 3300049592 | Bacteria | 2964 |
| 1007 | Ga0501076_0071760 | 3300049592 | Bacteria | 2770 |
| 1008 | Ga0501076_0077841 | 3300049592 | Bacteria | 2660 |
| 1009 | Ga0501076_0129944 | 3300049592 | Bacteria | 2043 |
| 1010 | Ga0501076_0134821 | 3300049592 | Bacteria | 2004 |
| 1011 | Ga0501076_0154388 | 3300049592 | Bacteria | 1868 |
| 1012 | Ga0501076_0160284 | 3300049592 | Bacteria | 1832 |
| 1013 | Ga0501076_0357025 | 3300049592 | Bacteria | 1200 |
| 1014 | Ga0501076_0720248 | 3300049592 | Archaea | 823 |
| 1015 | Ga0501077_0011287 | 3300049593 | Bacteria | 5577 |
| 1016 | Ga0501077_0023420 | 3300049593 | Bacteria | 3915 |
| 1017 | Ga0501077_0061071 | 3300049593 | Bacteria | 2391 |
| 1018 | Ga0501077_0100358 | 3300049593 | Bacteria | 1834 |
| 1019 | Ga0501077_0109828 | 3300049593 | Bacteria | 1747 |
| 1020 | Ga0501077_0221591 | 3300049593 | Bacteria | 1202 |
| 1021 | Ga0501077_0361937 | 3300049593 | Bacteria | 926 |
| 1022 | Ga0501077_0571907 | 3300049593 | Bacteria | 725 |
| 1023 | Ga0501077_0939064 | 3300049593 | Bacteria | 556 |
| 1024 | Ga0501079_0012614 | 3300049741 | Bacteria | 6453 |
| 1025 | Ga0501079_0027218 | 3300049741 | Bacteria | 4383 |
| 1026 | Ga0501079_0037136 | 3300049741 | Bacteria | 3753 |
| 1027 | Ga0501079_0092603 | 3300049741 | Unclassified | 2341 |
| 1028 | Ga0501079_0149866 | 3300049741 | Bacteria | 1818 |
| 1029 | Ga0501079_0329425 | 3300049741 | Bacteria | 1196 |
| 1030 | Ga0501079_0537722 | 3300049741 | Bacteria | 919 |
| 1031 | Ga0501079_0579047 | 3300049741 | Bacteria | 883 |
| 1032 | Ga0501079_1326048 | 3300049741 | Bacteria | 566 |
| 1033 | Ga0501080_0009195 | 3300049742 | Bacteria | 9002 |
| 1034 | Ga0501080_0010484 | 3300049742 | Bacteria | 8487 |
| 1035 | Ga0501080_0054290 | 3300049742 | Bacteria | 3730 |
| 1036 | Ga0501080_0079553 | 3300049742 | Bacteria | 3047 |
| 1037 | Ga0501080_0097690 | 3300049742 | Bacteria | 2727 |
| 1038 | Ga0501080_0195377 | 3300049742 | Bacteria | 1859 |
| 1039 | Ga0501080_0279880 | 3300049742 | Bacteria | 1517 |
| 1040 | Ga0501080_0287468 | 3300049742 | Bacteria | 1494 |
| 1041 | Ga0501080_0357664 | 3300049742 | Bacteria | 1317 |
| 1042 | Ga0501080_0505965 | 3300049742 | Bacteria | 1079 |
| 1043 | Ga0501080_1230120 | 3300049742 | Bacteria | 643 |
| 1044 | Ga0501081_0007559 | 3300049743 | Bacteria | 7047 |
| 1045 | Ga0501081_0026901 | 3300049743 | Bacteria | 3881 |
| 1046 | Ga0501081_0122242 | 3300049743 | Bacteria | 1855 |
| 1047 | Ga0501081_0133582 | 3300049743 | Bacteria | 1774 |
| 1048 | Ga0501081_0143009 | 3300049743 | Bacteria | 1715 |
| 1049 | Ga0501081_0252163 | 3300049743 | Bacteria | 1288 |
| 1050 | Ga0501081_0458080 | 3300049743 | Bacteria | 948 |
| 1051 | Ga0501083_0006299 | 3300049744 | Bacteria | 8416 |
| 1052 | Ga0501083_0009341 | 3300049744 | Bacteria | 6921 |
| 1053 | Ga0501083_0029146 | 3300049744 | Bacteria | 3799 |
| 1054 | Ga0501083_0311954 | 3300049744 | Unclassified | 1023 |
| 1055 | Ga0501083_0394585 | 3300049744 | Bacteria | 900 |
| 1056 | Ga0501083_0815682 | 3300049744 | Bacteria | 607 |
| 1057 | Ga0501035_0026164 | 3300049822 | Bacteria | 5342 |
| 1058 | Ga0501035_0034600 | 3300049822 | Bacteria | 4589 |
| 1059 | Ga0501035_0110735 | 3300049822 | Bacteria | 2406 |
| 1060 | Ga0501035_0111907 | 3300049822 | Bacteria | 2392 |
| 1061 | Ga0501035_0508606 | 3300049822 | Bacteria | 991 |
| 1062 | Ga0501035_0603218 | 3300049822 | Bacteria | 894 |
| 1063 | Ga0501035_1191426 | 3300049822 | Unclassified | 591 |
| 1064 | Ga0501044_0146738 | 3300049823 | Bacteria | 2344 |
| 1065 | Ga0501044_0607539 | 3300049823 | Bacteria | 986 |
| 1066 | Ga0501044_0773261 | 3300049823 | Bacteria | 841 |
| 1067 | Ga0501045_0016648 | 3300049824 | Bacteria | 5223 |
| 1068 | Ga0501045_0026675 | 3300049824 | Bacteria | 4157 |
| 1069 | Ga0501045_0028937 | 3300049824 | Bacteria | 3999 |
| 1070 | Ga0501045_0045530 | 3300049824 | Bacteria | 3194 |
| 1071 | Ga0501045_0065278 | 3300049824 | Bacteria | 2672 |
| 1072 | Ga0501045_0084664 | 3300049824 | Bacteria | 2339 |
| 1073 | Ga0501045_0359545 | 3300049824 | Archaea | 1083 |
| 1074 | Ga0501045_0529024 | 3300049824 | Bacteria | 875 |
| 1075 | Ga0501045_1084983 | 3300049824 | Bacteria | 586 |
| 1076 | nmdc:mga03n38_33083_c1 | 3300050490 | Bacteria | 2196 |
| 1077 | nmdc:mga00v17_149210_c1 | 3300050491 | Bacteria | 1502 |
| 1078 | nmdc:mga0yw44_686432_c1 | 3300050492 | Unclassified | 696 |
| 1079 | nmdc:mga0yw44_95997_c1 | 3300050492 | Bacteria | 1881 |
| 1080 | nmdc:mga04h51_141322_c1 | 3300050495 | Bacteria | 913 |
| 1081 | nmdc:mga05p37_2048777_c1 | 3300050507 | Unclassified | 539 |
| 1082 | nmdc:mga05p37_22081_c1 | 3300050507 | Bacteria | 7713 |
| 1083 | nmdc:mga05p37_23743_c1 | 3300050507 | Bacteria | 7446 |
| 1084 | nmdc:mga05p37_247142_c1 | 3300050507 | Bacteria | 2141 |
| 1085 | nmdc:mga09592_1365894_c1 | 3300050508 | Bacteria | 580 |
| 1086 | nmdc:mga09592_28987_c1 | 3300050508 | Bacteria | 4603 |
| 1087 | nmdc:mga0qj67_99131_c1 | 3300050509 | Bacteria | 2347 |
| 1088 | nmdc:mga06r32_1344820_c1 | 3300050510 | Unclassified | 657 |
| 1089 | nmdc:mga06r32_840086_c1 | 3300050510 | Bacteria | 877 |
| 1090 | nmdc:mga08y16_1169611_c1 | 3300050511 | Bacteria | 741 |
| 1091 | nmdc:mga08y16_128631_c1 | 3300050511 | Bacteria | 2634 |
| 1092 | nmdc:mga08y16_33557_c1 | 3300050511 | Bacteria | 5390 |
| 1093 | nmdc:mga08y16_74927_c1 | 3300050511 | Bacteria | 3528 |
| 1094 | nmdc:mga0n895_1074783_c1 | 3300050512 | Unclassified | 783 |
| 1095 | nmdc:mga0n895_528034_c1 | 3300050512 | Bacteria | 1187 |
| 1096 | nmdc:mga0n895_828617_c1 | 3300050512 | Bacteria | 914 |
| 1097 | nmdc:mga0a205_368361_c1 | 3300050515 | Bacteria | 1303 |
| 1098 | nmdc:mga0a205_788872_c1 | 3300050515 | Bacteria | 798 |
| 1099 | nmdc:mga0a205_90715_c1 | 3300050515 | Bacteria | 2953 |
| 1100 | Ga0495655_0230433 | 3300053083 | Unclassified | 616 |
| 1101 | Ga0495595_0008836 | 3300053084 | Bacteria | 4149 |
| 1102 | Ga0495595_0091108 | 3300053084 | Bacteria | 1463 |
| 1103 | Ga0495595_0667404 | 3300053084 | Bacteria | 532 |
| 1104 | Ga0495619_0264311 | 3300053085 | Bacteria | 1192 |
| 1105 | Ga0501084_0025140 | 3300054114 | Bacteria | 4968 |
| 1106 | Ga0501084_0026068 | 3300054114 | Bacteria | 4877 |
| 1107 | Ga0501084_0045376 | 3300054114 | Bacteria | 3679 |
| 1108 | Ga0501084_0045652 | 3300054114 | Bacteria | 3668 |
| 1109 | Ga0501084_0106836 | 3300054114 | Bacteria | 2352 |
| 1110 | Ga0501084_0291123 | 3300054114 | Bacteria | 1379 |
| 1111 | Ga0501084_0402064 | 3300054114 | Bacteria | 1157 |
| 1112 | Ga0501084_0442549 | 3300054114 | Bacteria | 1099 |
| 1113 | Ga0501084_0653507 | 3300054114 | Bacteria | 888 |
| 1114 | Ga0501084_0967622 | 3300054114 | Bacteria | 715 |
| 1115 | Ga0501084_1209451 | 3300054114 | Bacteria | 634 |
| 1116 | Ga0587069_088426 | 3300059642 | Bacteria | 615 |
| 1117 | Ga0501082_0053681 | 3300060353 | Bacteria | 3473 |
| 1118 | Ga0501082_0062549 | 3300060353 | Bacteria | 3204 |
| 1119 | Ga0501082_0096947 | 3300060353 | Bacteria | 2549 |
| 1120 | Ga0501082_0102354 | 3300060353 | Bacteria | 2478 |
| 1121 | Ga0501082_0107066 | 3300060353 | Bacteria | 2418 |
| 1122 | Ga0501082_0252782 | 3300060353 | Bacteria | 1533 |
| 1123 | Ga0501082_0329875 | 3300060353 | Bacteria | 1329 |
| 1124 | Ga0501082_0394861 | 3300060353 | Bacteria | 1207 |
| 1125 | Ga0501082_0490962 | 3300060353 | Bacteria | 1073 |
| 1126 | Ga0501082_0495401 | 3300060353 | Bacteria | 1068 |
| 1127 | Ga0501082_1113355 | 3300060353 | Bacteria | 690 |
| 1128 | Ga0530510_0020887 | 3300061734 | Bacteria | 4656 |
| 1129 | Ga0530510_0063666 | 3300061734 | Bacteria | 2670 |
| 1130 | Ga0530510_0080521 | 3300061734 | Bacteria | 2370 |
| 1131 | Ga0530510_0084447 | 3300061734 | Bacteria | 2312 |
| 1132 | Ga0530510_0095107 | 3300061734 | Bacteria | 2176 |
| 1133 | Ga0530510_0096247 | 3300061734 | Bacteria | 2164 |
| 1134 | Ga0530510_0097928 | 3300061734 | Bacteria | 2145 |
| 1135 | Ga0530510_0303982 | 3300061734 | Bacteria | 1194 |
| 1136 | Ga0530510_0341880 | 3300061734 | Bacteria | 1123 |
| 1137 | Ga0530510_0362127 | 3300061734 | Unclassified | 1090 |
| 1138 | Ga0530510_0426363 | 3300061734 | Bacteria | 1001 |
| 1139 | Ga0530510_0530570 | 3300061734 | Bacteria | 893 |
| 1140 | Ga0530510_1216469 | 3300061734 | Bacteria | 577 |
| 1141 | Ga0070706_101122012 | |||
| 1142 | 2214741331 | |||
| 1143 | ARcpr5yngRDRAFT_c002676 | |||
| 1144 | ARSoilOldRDRAFT_c001729 | |||
| 1145 | JGI24747J21853_1050140 | |||
| 1146 | JGI24739J22299_10043863 | |||
| 1147 | JGI24743J22301_10004517 | |||
| 1148 | JGI24743J22301_10058672 | |||
| 1149 | JGI24743J22301_10095463 | |||
| 1150 | JGI24738J21930_10025519 | |||
| 1151 | JGI24738J21930_10062747 | |||
| 1152 | JGI24744J21845_10037088 | |||
| 1153 | JGI24744J21845_10092072 | |||
| 1154 | JGI24034J26672_10066300 | |||
| 1155 | JGI24034J26672_10073220 | |||
| 1156 | JGI24742J22300_10025285 | |||
| 1157 | JGI24742J22300_10120439 | |||
| 1158 | JGI24751J29686_10078962 | |||
| 1159 | JGI25406J46586_10025619 | |||
| 1160 | JGI25406J46586_10134316 | |||
| 1161 | Ga0058863_10000400 | |||
| 1162 | Ga0058863_11966875 | |||
| 1163 | Ga0058861_10036801 | |||
| 1164 | Ga0058860_10162899 | |||
| 1165 | Ga0058860_12210104 | |||
| 1166 | Ga0058862_10098273 | |||
| 1167 | Ga0070658_10012481 | |||
| 1168 | Ga0070658_10164960 | |||
| 1169 | Ga0070658_10983869 | |||
| 1170 | Ga0070658_11186789 | |||
| 1171 | Ga0070676_10120648 | |||
| 1172 | Ga0070676_10149159 | |||
| 1173 | Ga0070683_100018147 | |||
| 1174 | Ga0070683_100065183 | |||
| 1175 | Ga0070683_100120855 | |||
| 1176 | Ga0070683_100354697 | |||
| 1177 | Ga0070683_100520645 | |||
| 1178 | Ga0070683_100747945 | |||
| 1179 | Ga0070690_100472279 | |||
| 1180 | Ga0070670_100961684 | |||
| 1181 | Ga0070670_101320500 | |||
| 1182 | Ga0070670_101601209 | |||
| 1183 | Ga0068869_100023368 | |||
| 1184 | Ga0068869_100269957 | |||
| 1185 | Ga0068869_100308655 | |||
| 1186 | Ga0068869_101838707 | |||
| 1187 | Ga0068869_101874253 | |||
| 1188 | Ga0070666_10204304 | |||
| 1189 | Ga0070680_100007895 | |||
| 1190 | Ga0070680_100147736 | |||
| 1191 | Ga0070680_100376973 | |||
| 1192 | Ga0070680_101030691 | |||
| 1193 | Ga0070680_101272267 | |||
| 1194 | Ga0070682_100005220 | |||
| 1195 | Ga0070682_100108336 | |||
| 1196 | Ga0070682_100471803 | |||
| 1197 | Ga0070682_100523886 | |||
| 1198 | Ga0070682_100630593 | |||
| 1199 | Ga0070682_101825362 | |||
| 1200 | Ga0068868_100110844 | |||
| 1201 | Ga0068868_100415272 | |||
| 1202 | Ga0068868_100529186 | |||
| 1203 | Ga0068868_100796543 | |||
| 1204 | Ga0070660_100004686 | |||
| 1205 | Ga0070660_100063955 | |||
| 1206 | Ga0070660_100400628 | |||
| 1207 | Ga0070660_100405434 | |||
| 1208 | Ga0070660_101558565 | |||
| 1209 | Ga0070689_100149218 | |||
| 1210 | Ga0070689_101462785 | |||
| 1211 | Ga0070691_10001238 | |||
| 1212 | Ga0070691_10264948 | |||
| 1213 | Ga0070691_10372810 | |||
| 1214 | Ga0070691_10820831 | |||
| 1215 | Ga0070691_10822967 | |||
| 1216 | Ga0070687_100259899 | |||
| 1217 | Ga0070687_101357259 | |||
| 1218 | Ga0070661_100014709 | |||
| 1219 | Ga0070661_100076821 | |||
| 1220 | Ga0070661_100313064 | |||
| 1221 | Ga0070661_100419923 | |||
| 1222 | Ga0070661_101766879 | |||
| 1223 | Ga0070692_10012229 | |||
| 1224 | Ga0070692_10123571 | |||
| 1225 | Ga0070692_10240012 | |||
| 1226 | Ga0070692_10277631 | |||
| 1227 | Ga0070692_10862229 | |||
| 1228 | Ga0070668_100097921 | |||
| 1229 | Ga0070668_101224370 | |||
| 1230 | Ga0070668_101791386 | |||
| 1231 | Ga0070669_100061755 | |||
| 1232 | Ga0070669_100110873 | |||
| 1233 | Ga0070669_100216640 | |||
| 1234 | Ga0070669_100316774 | |||
| 1235 | Ga0070675_100013979 | |||
| 1236 | Ga0070675_100066526 | |||
| 1237 | Ga0070675_100077897 | |||
| 1238 | Ga0070675_100331224 | |||
| 1239 | Ga0070671_100192672 | |||
| 1240 | Ga0070671_100568969 | |||
| 1241 | Ga0070674_100024067 | |||
| 1242 | Ga0070674_100032596 | |||
| 1243 | Ga0070674_100066818 | |||
| 1244 | Ga0070674_100694487 | |||
| 1245 | Ga0070674_101029289 | |||
| 1246 | Ga0070674_101042143 | |||
| 1247 | Ga0070674_101767873 | |||
| 1248 | Ga0070673_100009358 | |||
| 1249 | Ga0070673_100052387 | |||
| 1250 | Ga0070673_100440169 | |||
| 1251 | Ga0070688_100020579 | |||
| 1252 | Ga0070688_100443056 | |||
| 1253 | Ga0070688_100629724 | |||
| 1254 | Ga0070659_100046848 | |||
| 1255 | Ga0070659_100055876 | |||
| 1256 | Ga0070659_100069351 | |||
| 1257 | Ga0070659_100134231 | |||
| 1258 | Ga0070659_101238669 | |||
| 1259 | Ga0070667_101273894 | |||
| 1260 | Ga0070667_101487235 | |||
| 1261 | Ga0070703_10252828 | |||
| 1262 | Ga0070701_10003360 | |||
| 1263 | Ga0070701_10165889 | |||
| 1264 | Ga0070701_10184858 | |||
| 1265 | Ga0070705_100057463 | |||
| 1266 | Ga0070700_100077418 | |||
| 1267 | Ga0070700_100135553 | |||
| 1268 | Ga0070700_100270932 | |||
| 1269 | Ga0070700_101191568 | |||
| 1270 | Ga0070694_100413225 | |||
| 1271 | Ga0070694_100450391 | |||
| 1272 | Ga0070694_100594985 | |||
| 1273 | Ga0070694_101352627 | |||
| 1274 | Ga0070708_100425083 | |||
| 1275 | Ga0070708_101340347 | |||
| 1276 | Ga0070663_100303087 | |||
| 1277 | Ga0070663_101279227 | |||
| 1278 | Ga0070663_101436932 | |||
| 1279 | Ga0070678_100017141 | |||
| 1280 | Ga0070678_100048516 | |||
| 1281 | Ga0070678_100362420 | |||
| 1282 | Ga0070678_100911464 | |||
| 1283 | Ga0070678_101533240 | |||
| 1284 | Ga0070678_101980994 | |||
| 1285 | Ga0070678_102185928 | |||
| 1286 | Ga0070662_100016854 | |||
| 1287 | Ga0070662_100019166 | |||
| 1288 | Ga0070662_100048366 | |||
| 1289 | Ga0070662_100053146 | |||
| 1290 | Ga0070662_100865491 | |||
| 1291 | Ga0070662_101905200 | |||
| 1292 | Ga0070681_10072596 | |||
| 1293 | Ga0070681_10180469 | |||
| 1294 | Ga0070681_10274946 | |||
| 1295 | Ga0070681_10385000 | |||
| 1296 | Ga0068867_100073418 | |||
| 1297 | Ga0068867_100215413 | |||
| 1298 | Ga0068867_100505065 | |||
| 1299 | Ga0068867_100552932 | |||
| 1300 | Ga0068867_100707492 | |||
| 1301 | Ga0068867_101077312 | |||
| 1302 | Ga0068867_101133090 | |||
| 1303 | Ga0070685_10025373 | |||
| 1304 | Ga0070685_10051017 | |||
| 1305 | Ga0070685_10517617 | |||
| 1306 | Ga0070706_100116655 | |||
| 1307 | Ga0070706_101633067 | |||
| 1308 | Ga0070707_100212372 | |||
| 1309 | Ga0070707_100300165 | |||
| 1310 | Ga0070707_100538427 | |||
| 1311 | Ga0070707_100599964 | |||
| 1312 | Ga0070707_101071429 | |||
| 1313 | Ga0070698_100422962 | |||
| 1314 | Ga0070698_100875197 | |||
| 1315 | Ga0070699_100751143 | |||
| 1316 | Ga0070679_100011289 | |||
| 1317 | Ga0070679_100037511 | |||
| 1318 | Ga0070679_100273839 | |||
| 1319 | Ga0070684_100030643 | |||
| 1320 | Ga0070684_100085253 | |||
| 1321 | Ga0070684_100108143 | |||
| 1322 | Ga0070684_100289579 | |||
| 1323 | Ga0070684_100346796 | |||
| 1324 | Ga0070684_100415153 | |||
| 1325 | Ga0070684_100670648 | |||
| 1326 | Ga0070684_101292044 | |||
| 1327 | Ga0068853_100014429 | |||
| 1328 | Ga0068853_100062964 | |||
| 1329 | Ga0068853_100167491 | |||
| 1330 | Ga0068853_101074489 | |||
| 1331 | Ga0070672_100012820 | |||
| 1332 | Ga0070672_100123283 | |||
| 1333 | Ga0070672_100128796 | |||
| 1334 | Ga0070672_100872964 | |||
| 1335 | Ga0070686_100029728 | |||
| 1336 | Ga0070686_100109964 | |||
| 1337 | Ga0070686_100628513 | |||
| 1338 | Ga0070686_101093220 | |||
| 1339 | Ga0070695_101023736 | |||
| 1340 | Ga0070696_100309973 | |||
| 1341 | Ga0070696_100507729 | |||
| 1342 | Ga0070693_100045096 | |||
| 1343 | Ga0070693_100072121 | |||
| 1344 | Ga0070693_100441027 | |||
| 1345 | Ga0070693_100603786 | |||
| 1346 | Ga0070665_100194410 | |||
| 1347 | Ga0070665_100390657 | |||
| 1348 | Ga0070665_100447059 | |||
| 1349 | Ga0070665_100982496 | |||
| 1350 | Ga0070704_100016961 | |||
| 1351 | Ga0070704_100073456 | |||
| 1352 | Ga0070704_100706319 | |||
| 1353 | Ga0070704_100893734 | |||
| 1354 | Ga0068855_100156199 | |||
| 1355 | Ga0068855_100345925 | |||
| 1356 | Ga0070664_100003869 | |||
| 1357 | Ga0070664_100010761 | |||
| 1358 | Ga0070664_100161931 | |||
| 1359 | Ga0070664_100169043 | |||
| 1360 | Ga0070664_100479900 | |||
| 1361 | Ga0070664_101377796 | |||
| 1362 | Ga0070664_101507668 | |||
| 1363 | Ga0068857_100071647 | |||
| 1364 | Ga0068857_102027130 | |||
| 1365 | Ga0068854_100003667 | |||
| 1366 | Ga0068854_100888177 | |||
| 1367 | Ga0068854_100915063 | |||
| 1368 | Ga0068856_100179207 | |||
| 1369 | Ga0068856_100203070 | |||
| 1370 | Ga0068856_100407407 | |||
| 1371 | Ga0070702_100016434 | |||
| 1372 | Ga0070702_100025615 | |||
| 1373 | Ga0070702_101322173 | |||
| 1374 | Ga0068852_100007373 | |||
| 1375 | Ga0068852_100043051 | |||
| 1376 | Ga0068852_100062908 | |||
| 1377 | Ga0068852_100247937 | |||
| 1378 | Ga0068852_100520762 | |||
| 1379 | Ga0068852_100653281 | |||
| 1380 | Ga0068859_100140109 | |||
| 1381 | Ga0068859_101434378 | |||
| 1382 | Ga0068859_101462464 | |||
| 1383 | Ga0068864_100015387 | |||
| 1384 | Ga0068864_100423296 | |||
| 1385 | Ga0068864_100659244 | |||
| 1386 | Ga0068864_101632593 | |||
| 1387 | Ga0068866_10037817 | |||
| 1388 | Ga0068866_10130980 | |||
| 1389 | Ga0068866_10186024 | |||
| 1390 | Ga0068866_10496758 | |||
| 1391 | Ga0068866_11162069 | |||
| 1392 | Ga0068861_100682255 | |||
| 1393 | Ga0068861_100791987 | |||
| 1394 | Ga0068861_102317783 | |||
| 1395 | Ga0068851_10135097 | |||
| 1396 | Ga0068851_10146037 | |||
| 1397 | Ga0068851_10330989 | |||
| 1398 | Ga0068851_10785829 | |||
| 1399 | Ga0068870_10047359 | |||
| 1400 | Ga0068870_10069276 | |||
| 1401 | Ga0068870_10176969 | |||
| 1402 | Ga0068870_10498032 | |||
| 1403 | Ga0068870_10792203 | |||
| 1404 | Ga0068863_100102857 | |||
| 1405 | Ga0068863_100319447 | |||
| 1406 | Ga0068858_100034435 | |||
| 1407 | Ga0068858_100387978 | |||
| 1408 | Ga0068860_100069094 | |||
| 1409 | Ga0068862_100503741 | |||
| 1410 | Ga0068862_100825068 | |||
| 1411 | Ga0081455_10012612 | |||
| 1412 | Ga0081455_10026862 | |||
| 1413 | Ga0081455_10030348 | |||
| 1414 | Ga0081455_10197501 | |||
| 1415 | Ga0081455_10450052 | |||
| 1416 | Ga0081539_10000890 | |||
| 1417 | Ga0081539_10000913 | |||
| 1418 | Ga0081539_10274747 | |||
| 1419 | Ga0075365_10185597 | |||
| 1420 | Ga0075365_10215918 | |||
| 1421 | Ga0075368_10386016 | |||
| 1422 | Ga0075363_100032780 | |||
| 1423 | Ga0075364_10555882 | |||
| 1424 | Ga0075432_10002834 | |||
| 1425 | Ga0075432_10315263 | |||
| 1426 | Ga0075367_10395143 | |||
| 1427 | Ga0097621_100335071 | |||
| 1428 | Ga0097621_100518500 | |||
| 1429 | Ga0097621_100700064 | |||
| 1430 | Ga0097621_101021418 | |||
| 1431 | Ga0068871_100530762 | |||
| 1432 | Ga0068871_100594839 | |||
| 1433 | Ga0068871_100914323 | |||
| 1434 | Ga0068871_100987398 | |||
| 1435 | Ga0068871_101674327 | |||
| 1436 | Ga0075428_100007037 | |||
| 1437 | Ga0075428_101504935 | |||
| 1438 | Ga0075428_101748580 | |||
| 1439 | Ga0075428_101769432 | |||
| 1440 | Ga0075430_100069637 | |||
| 1441 | Ga0075430_100250350 | |||
| 1442 | Ga0075431_100222939 | |||
| 1443 | Ga0075431_101128770 | |||
| 1444 | Ga0075433_10868588 | |||
| 1445 | Ga0075434_100619594 | |||
| 1446 | Ga0075434_100763109 | |||
| 1447 | Ga0075429_100015672 | |||
| 1448 | Ga0075429_101784490 | |||
| 1449 | Ga0068865_100010600 | |||
| 1450 | Ga0068865_100028908 | |||
| 1451 | Ga0068865_100061189 | |||
| 1452 | Ga0068865_100251534 | |||
| 1453 | Ga0068865_100657094 | |||
| 1454 | Ga0097620_100140117 | |||
| 1455 | Ga0097620_101434349 | |||
| 1456 | Ga0097620_101462223 | |||
| 1457 | Ga0075435_100281477 | |||
| 1458 | Ga0075435_100411961 | |||
| 1459 | Ga0105244_10413686 | |||
| 1460 | Ga0111539_10048272 | |||
| 1461 | Ga0111539_10434001 | |||
| 1462 | Ga0111539_10673954 | |||
| 1463 | Ga0111539_10920760 | |||
| 1464 | Ga0111539_12345987 | |||
| 1465 | Ga0111539_12598296 | |||
| 1466 | Ga0105245_10002458 | |||
| 1467 | Ga0105245_10037615 | |||
| 1468 | Ga0105245_10128207 | |||
| 1469 | Ga0105245_10340484 | |||
| 1470 | Ga0105245_10438691 | |||
| 1471 | Ga0105245_10587517 | |||
| 1472 | Ga0105245_10837010 | |||
| 1473 | Ga0105245_11184800 | |||
| 1474 | Ga0105245_11327525 | |||
| 1475 | Ga0105247_10016412 | |||
| 1476 | Ga0105247_10403972 | |||
| 1477 | Ga0114129_10006579 | |||
| 1478 | Ga0114129_10054711 | |||
| 1479 | Ga0114129_10772526 | |||
| 1480 | Ga0114129_11131925 | |||
| 1481 | Ga0114129_11260965 | |||
| 1482 | Ga0114129_11773738 | |||
| 1483 | Ga0114129_12557994 | |||
| 1484 | Ga0105243_10005485 | |||
| 1485 | Ga0105243_10114175 | |||
| 1486 | Ga0105243_10155875 | |||
| 1487 | Ga0105243_10299389 | |||
| 1488 | Ga0105243_10341823 | |||
| 1489 | Ga0105243_10657490 | |||
| 1490 | Ga0105243_10881191 | |||
| 1491 | Ga0105243_11125349 | |||
| 1492 | Ga0105243_11488103 | |||
| 1493 | Ga0105241_12182417 | |||
| 1494 | Ga0105242_10004703 | |||
| 1495 | Ga0105242_10131180 | |||
| 1496 | Ga0105242_10147878 | |||
| 1497 | Ga0105242_10302863 | |||
| 1498 | Ga0105242_10360402 | |||
| 1499 | Ga0105242_12214428 | |||
| 1500 | Ga0105248_10277459 | |||
| 1501 | Ga0105248_11035383 | |||
| 1502 | Ga0105248_12646319 | |||
| 1503 | Ga0105248_12667251 | |||
| 1504 | Ga0105248_12926449 | |||
| 1505 | Ga0105237_10362186 | |||
| 1506 | Ga0105238_10004615 | |||
| 1507 | Ga0105238_10655795 | |||
| 1508 | Ga0105238_11490411 | |||
| 1509 | Ga0105249_10074040 | |||
| 1510 | Ga0105249_10129166 | |||
| 1511 | Ga0105249_10167696 | |||
| 1512 | Ga0105249_10791601 | |||
| 1513 | Ga0105239_10060383 | |||
| 1514 | Ga0105239_10173487 | |||
| 1515 | Ga0105239_10314495 | |||
| 1516 | Ga0105239_10493149 | |||
| 1517 | Ga0105239_10685042 | |||
| 1518 | Ga0105239_12667311 | |||
| 1519 | Ga0105246_10073527 | |||
| 1520 | Ga0105246_10151414 | |||
| 1521 | Ga0105246_10196226 | |||
| 1522 | Ga0105246_10202032 | |||
| 1523 | Ga0105246_10251886 | |||
| 1524 | Ga0105246_10486262 | |||
| 1525 | Ga0105246_10619270 | |||
| 1526 | Ga0105246_10916465 | |||
| 1527 | Ga0105246_11066732 | |||
| 1528 | Ga0157343_1011118 | |||
| 1529 | Ga0157314_1028173 | |||
| 1530 | Ga0157314_1036908 | |||
| 1531 | Ga0157339_1067631 | |||
| 1532 | Ga0157373_10475281 | |||
| 1533 | Ga0157373_10577989 | |||
| 1534 | Ga0157373_10865248 | |||
| 1535 | Ga0157373_11094913 | |||
| 1536 | Ga0157371_10195844 | |||
| 1537 | Ga0157371_10234896 | |||
| 1538 | Ga0157371_10325779 | |||
| 1539 | Ga0157370_10769753 | |||
| 1540 | Ga0157370_10795452 | |||
| 1541 | Ga0157369_10104309 | |||
| 1542 | Ga0157374_10141270 | |||
| 1543 | Ga0157374_10532139 | |||
| 1544 | Ga0157374_12846246 | |||
| 1545 | Ga0157378_10223569 | |||
| 1546 | Ga0157378_10763532 | |||
| 1547 | Ga0157378_10790326 | |||
| 1548 | Ga0157378_11270294 | |||
| 1549 | Ga0163162_10484589 | |||
| 1550 | Ga0163162_10821685 | |||
| 1551 | Ga0163162_11875234 | |||
| 1552 | Ga0163162_11990492 | |||
| 1553 | Ga0157372_10009445 | |||
| 1554 | Ga0157372_10105468 | |||
| 1555 | Ga0157372_10509020 | |||
| 1556 | Ga0157375_10029312 | |||
| 1557 | Ga0157375_10041919 | |||
| 1558 | Ga0157375_10651885 | |||
| 1559 | Ga0157375_10960602 | |||
| 1560 | Ga0157375_10974996 | |||
| 1561 | Ga0157375_12548815 | |||
| 1562 | Ga0163163_10199617 | |||
| 1563 | Ga0163163_10542539 | |||
| 1564 | Ga0163163_10587035 | |||
| 1565 | Ga0163163_11526590 | |||
| 1566 | Ga0163163_11973199 | |||
| 1567 | Ga0163163_12694173 | |||
| 1568 | Ga0157380_10040382 | |||
| 1569 | Ga0157380_10049025 | |||
| 1570 | Ga0157380_10159646 | |||
| 1571 | Ga0157380_12047313 | |||
| 1572 | Ga0157377_10001311 | |||
| 1573 | Ga0157377_10003506 | |||
| 1574 | Ga0157377_10063765 | |||
| 1575 | Ga0157377_10077178 | |||
| 1576 | Ga0157377_10163634 | |||
| 1577 | Ga0157377_10843662 | |||
| 1578 | Ga0157377_11284666 | |||
| 1579 | Ga0157377_11484705 | |||
| 1580 | Ga0157379_10070862 | |||
| 1581 | Ga0157379_10075391 | |||
| 1582 | Ga0157379_12098590 | |||
| 1583 | Ga0157376_10035152 | |||
| 1584 | Ga0157376_10131046 | |||
| 1585 | Ga0157376_10423087 | |||
| 1586 | Ga0163161_10017266 | |||
| 1587 | Ga0163161_10507902 | |||
| 1588 | Ga0163161_10784000 | |||
| 1589 | Ga0163161_11490969 | |||
| 1590 | Ga0206356_10423462 | |||
| 1591 | Ga0206356_10715168 | |||
| 1592 | Ga0206351_10732071 | |||
| 1593 | Ga0206352_10539032 | |||
| 1594 | Ga0206350_10935077 | |||
| 1595 | Ga0206354_10785179 | |||
| 1596 | Ga0206354_11277640 | |||
| 1597 | Ga0224712_10070446 | |||
| 1598 | Ga0207656_10243534 | |||
| 1599 | Ga0207653_10018400 | |||
| 1600 | Ga0207642_10086808 | |||
| 1601 | Ga0207642_10117534 | |||
| 1602 | Ga0207642_10769334 | |||
| 1603 | Ga0207688_10013555 | |||
| 1604 | Ga0207688_10060772 | |||
| 1605 | Ga0207688_10111828 | |||
| 1606 | Ga0207688_10143489 | |||
| 1607 | Ga0207688_10550347 | |||
| 1608 | Ga0207680_10086005 | |||
| 1609 | Ga0207647_10349319 | |||
| 1610 | Ga0207645_10116806 | |||
| 1611 | Ga0207645_10227145 | |||
| 1612 | Ga0207643_10153252 | |||
| 1613 | Ga0207643_10206206 | |||
| 1614 | Ga0207643_10325628 | |||
| 1615 | Ga0207643_10361395 | |||
| 1616 | Ga0207643_10517390 | |||
| 1617 | Ga0207705_10023479 | |||
| 1618 | Ga0207705_10890455 | |||
| 1619 | Ga0207705_11230661 | |||
| 1620 | Ga0207684_10152321 | |||
| 1621 | Ga0207684_10904603 | |||
| 1622 | Ga0207654_10595001 | |||
| 1623 | Ga0207654_11434169 | |||
| 1624 | Ga0207707_10016045 | |||
| 1625 | Ga0207707_10178775 | |||
| 1626 | Ga0207707_10393042 | |||
| 1627 | Ga0207707_10671939 | |||
| 1628 | Ga0207707_10805229 | |||
| 1629 | Ga0207671_10718342 | |||
| 1630 | Ga0207660_10017237 | |||
| 1631 | Ga0207660_10155820 | |||
| 1632 | Ga0207660_10168419 | |||
| 1633 | Ga0207662_10085898 | |||
| 1634 | Ga0207662_10636895 | |||
| 1635 | Ga0207657_10003899 | |||
| 1636 | Ga0207657_10096050 | |||
| 1637 | Ga0207657_10194098 | |||
| 1638 | Ga0207657_10210994 | |||
| 1639 | Ga0207657_10583151 | |||
| 1640 | Ga0207657_10999542 | |||
| 1641 | Ga0207657_11190135 | |||
| 1642 | Ga0207649_10006520 | |||
| 1643 | Ga0207649_10045143 | |||
| 1644 | Ga0207649_10300772 | |||
| 1645 | Ga0207649_11365178 | |||
| 1646 | Ga0207652_10049961 | |||
| 1647 | Ga0207652_10131826 | |||
| 1648 | Ga0207652_10427981 | |||
| 1649 | Ga0207652_10675408 | |||
| 1650 | Ga0207646_10188524 | |||
| 1651 | Ga0207646_10270563 | |||
| 1652 | Ga0207646_11830118 | |||
| 1653 | Ga0207681_10124965 | |||
| 1654 | Ga0207681_10306574 | |||
| 1655 | Ga0207681_10348453 | |||
| 1656 | Ga0207681_10683881 | |||
| 1657 | Ga0207681_10717210 | |||
| 1658 | Ga0207694_10118485 | |||
| 1659 | Ga0207694_11682504 | |||
| 1660 | Ga0207650_11468665 | |||
| 1661 | Ga0207650_11523066 | |||
| 1662 | Ga0207659_10050673 | |||
| 1663 | Ga0207659_10121009 | |||
| 1664 | Ga0207659_10126612 | |||
| 1665 | Ga0207659_10193288 | |||
| 1666 | Ga0207659_10701790 | |||
| 1667 | Ga0207687_10012133 | |||
| 1668 | Ga0207687_10013736 | |||
| 1669 | Ga0207687_10190967 | |||
| 1670 | Ga0207687_10329199 | |||
| 1671 | Ga0207687_10926236 | |||
| 1672 | Ga0207644_10645960 | |||
| 1673 | Ga0207644_10960397 | |||
| 1674 | Ga0207644_11097051 | |||
| 1675 | Ga0207690_10037340 | |||
| 1676 | Ga0207690_10051083 | |||
| 1677 | Ga0207690_10263376 | |||
| 1678 | Ga0207706_10003040 | |||
| 1679 | Ga0207706_10018100 | |||
| 1680 | Ga0207706_10025020 | |||
| 1681 | Ga0207706_10209297 | |||
| 1682 | Ga0207706_10747880 | |||
| 1683 | Ga0207686_10282224 | |||
| 1684 | Ga0207686_11247868 | |||
| 1685 | Ga0207709_10043199 | |||
| 1686 | Ga0207709_10074295 | |||
| 1687 | Ga0207709_10691128 | |||
| 1688 | Ga0207670_10122359 | |||
| 1689 | Ga0207670_10400516 | |||
| 1690 | Ga0207669_10073407 | |||
| 1691 | Ga0207669_10111386 | |||
| 1692 | Ga0207669_10163492 | |||
| 1693 | Ga0207669_11194503 | |||
| 1694 | Ga0207669_11354239 | |||
| 1695 | Ga0207669_11560249 | |||
| 1696 | Ga0207704_10067422 | |||
| 1697 | Ga0207704_10242297 | |||
| 1698 | Ga0207704_10259544 | |||
| 1699 | Ga0207704_11797851 | |||
| 1700 | Ga0207691_10006406 | |||
| 1701 | Ga0207691_10012064 | |||
| 1702 | Ga0207691_10136553 | |||
| 1703 | Ga0207691_10540916 | |||
| 1704 | Ga0207691_11020508 | |||
| 1705 | Ga0207711_10043749 | |||
| 1706 | Ga0207711_10215795 | |||
| 1707 | Ga0207711_11346223 | |||
| 1708 | Ga0207689_10121142 | |||
| 1709 | Ga0207689_10868378 | |||
| 1710 | Ga0207689_11530401 | |||
| 1711 | Ga0207689_11558846 | |||
| 1712 | Ga0207689_11633856 | |||
| 1713 | Ga0207661_10000612 | |||
| 1714 | Ga0207661_10033009 | |||
| 1715 | Ga0207661_10036867 | |||
| 1716 | Ga0207661_10205708 | |||
| 1717 | Ga0207661_10277007 | |||
| 1718 | Ga0207661_10341501 | |||
| 1719 | Ga0207661_10377166 | |||
| 1720 | Ga0207661_11334018 | |||
| 1721 | Ga0207661_11720266 | |||
| 1722 | Ga0207679_10117357 | |||
| 1723 | Ga0207679_10133330 | |||
| 1724 | Ga0207679_10217596 | |||
| 1725 | Ga0207679_10294743 | |||
| 1726 | Ga0207679_10710625 | |||
| 1727 | Ga0207679_10741182 | |||
| 1728 | Ga0207679_11340165 | |||
| 1729 | Ga0207667_11344700 | |||
| 1730 | Ga0207651_10184857 | |||
| 1731 | Ga0207651_11223308 | |||
| 1732 | Ga0207712_10898689 | |||
| 1733 | Ga0207668_10029857 | |||
| 1734 | Ga0207668_10718474 | |||
| 1735 | Ga0207640_10074967 | |||
| 1736 | Ga0207640_10496448 | |||
| 1737 | Ga0207640_11348832 | |||
| 1738 | Ga0207640_11459965 | |||
| 1739 | Ga0207658_10828041 | |||
| 1740 | Ga0207677_10027716 | |||
| 1741 | Ga0207677_10315501 | |||
| 1742 | Ga0207677_10895731 | |||
| 1743 | Ga0207677_11111706 | |||
| 1744 | Ga0207677_11331989 | |||
| 1745 | Ga0207703_10051335 | |||
| 1746 | Ga0207703_10980027 | |||
| 1747 | Ga0207639_10012338 | |||
| 1748 | Ga0207639_10519206 | |||
| 1749 | Ga0207639_11199777 | |||
| 1750 | Ga0207639_11716654 | |||
| 1751 | Ga0207678_10023034 | |||
| 1752 | Ga0207678_10177813 | |||
| 1753 | Ga0207678_10438064 | |||
| 1754 | Ga0207708_10015196 | |||
| 1755 | Ga0207708_10016992 | |||
| 1756 | Ga0207708_10060405 | |||
| 1757 | Ga0207708_10248364 | |||
| 1758 | Ga0207702_10074671 | |||
| 1759 | Ga0207702_10206917 | |||
| 1760 | Ga0207702_10417877 | |||
| 1761 | Ga0207641_10790612 | |||
| 1762 | Ga0207648_10051981 | |||
| 1763 | Ga0207648_10125301 | |||
| 1764 | Ga0207648_10182488 | |||
| 1765 | Ga0207648_10185847 | |||
| 1766 | Ga0207648_10445614 | |||
| 1767 | Ga0207648_11628147 | |||
| 1768 | Ga0207676_10276214 | |||
| 1769 | Ga0207676_10579641 | |||
| 1770 | Ga0207676_10960354 | |||
| 1771 | Ga0207676_11662958 | |||
| 1772 | Ga0207676_11736969 | |||
| 1773 | Ga0207674_10031518 | |||
| 1774 | Ga0207674_10060638 | |||
| 1775 | Ga0207674_10431412 | |||
| 1776 | Ga0207674_11081827 | |||
| 1777 | Ga0207674_11184008 | |||
| 1778 | Ga0207675_100119742 | |||
| 1779 | Ga0207675_100647694 | |||
| 1780 | Ga0207683_10004422 | |||
| 1781 | Ga0207683_10025471 | |||
| 1782 | Ga0207683_10061101 | |||
| 1783 | Ga0207683_10115188 | |||
| 1784 | Ga0207683_10260174 | |||
| 1785 | Ga0207683_10833282 | |||
| 1786 | Ga0207683_11157473 | |||
| 1787 | Ga0207683_11528163 | |||
| 1788 | Ga0207698_10003410 | |||
| 1789 | Ga0207698_10052158 | |||
| 1790 | Ga0207698_10069554 | |||
| 1791 | Ga0207698_10096671 | |||
| 1792 | Ga0207698_10485231 | |||
| 1793 | Ga0207698_12233416 | |||
| 1794 | Ga0209998_10052091 | |||
| 1795 | Ga0209813_10469070 | |||
| 1796 | Ga0209974_10158418 | |||
| 1797 | Ga0207428_10002314 | |||
| 1798 | Ga0207428_10167268 | |||
| 1799 | Ga0207428_10175303 | |||
| 1800 | Ga0268266_10249643 | |||
| 1801 | Ga0268266_10510220 | |||
| 1802 | Ga0268266_10642900 | |||
| 1803 | Ga0268266_11364561 | |||
| 1804 | Ga0268265_11237955 | |||
| 1805 | Ga0268265_11550855 | |||
| 1806 | Ga0268264_10036367 | |||
| 1807 | Ga0268264_10661439 | |||
| 1808 | Ga0307408_100885856 | |||
| 1809 | Ga0307405_10730476 | |||
| 1810 | Ga0307405_10804385 | |||
| 1811 | Ga0326468_10084057 | |||
| 1812 | Ga0307416_100149706 | |||
| 1813 | Ga0307416_100636788 | |||
| 1814 | Ga0307415_100459462 | |||
| 1815 | Ga0373948_0013703 | |||
| 1816 | Ga0373938_0136265 | |||
| 1817 | Ga0373928_0035993 | |||
| 1818 | Ga0373949_0089257 | |||
| 1819 | Ga0373951_0097676 | |||
| 1820 | Ga0373941_0013948 | |||
| 1821 | Ga0373960_0093458 | |||
| 1822 | Ga0373942_0199928 | |||
| 1823 | Ga0373961_0081863 | |||
| 1824 | Ga0373962_0027361 | |||
| 1825 | Ga0373931_0072674 | |||
| 1826 | Ga0373931_0260963 | |||
| 1827 | Ga0373937_1789897 | |||
| 1828 | Ga0395899_0053875 | |||
| 1829 | Ga0395900_0005363 | |||
| 1830 | Ga0395900_0056240 | |||
| 1831 | Ga0395900_0088732 | |||
| 1832 | Ga0395900_0193927 | |||
| 1833 | Ga0395900_0671501 | |||
| 1834 | Ga0395898_0063334 | |||
| 1835 | Ga0395898_0071698 | |||
| 1836 | Ga0395898_0117909 | |||
| 1837 | Ga0395898_1628378 | |||
| 1838 | Ga0395898_1693641 | |||
| 1839 | Ga0395905_0006331 | |||
| 1840 | Ga0395905_0027035 | |||
| 1841 | Ga0395905_0062102 | |||
| 1842 | Ga0395905_0105649 | |||
| 1843 | Ga0395901_0013286 | |||
| 1844 | Ga0395901_0021597 | |||
| 1845 | Ga0395901_0030277 | |||
| 1846 | Ga0395901_0067669 | |||
| 1847 | Ga0395901_0083956 | |||
| 1848 | Ga0395901_0757946 | |||
| 1849 | Ga0395901_0787498 | |||
| 1850 | Ga0395901_1426352 | |||
| 1851 | Ga0451787_144833 | |||
| 1852 | Ga0451789_0067247 | |||
| 1853 | Ga0451789_0622442 | |||
| 1854 | Ga0451793_0217906 | |||
| 1855 | Ga0451802_0539959 | |||
| 1856 | Ga0451802_2123391 | |||
| 1857 | Ga0451807_1505927 | |||
| 1858 | Ga0451835_0445768 | |||
| 1859 | Ga0451837_1813209 | |||
| 1860 | Ga0451853_3086998 | |||
| 1861 | Ga0450911_028724 | |||
| 1862 | Ga0450920_002200 | |||
| 1863 | Ga0450923_039659 | |||
| 1864 | Ga0450890_060459 | |||
| 1865 | Ga0450898_090077 | |||
| 1866 | Ga0450902_009145 | |||
| 1867 | Ga0450906_016580 | |||
| 1868 | Ga0450907_059315 | |||
| 1869 | Ga0439458_0044625 | |||
| 1870 | Ga0450908_025444 | |||
| 1871 | Ga0450909_070273 | |||
| 1872 | Ga0439464_0295073 | |||
| 1873 | Ga0450916_034239 | |||
| 1874 | Ga0450918_013958 | |||
| 1875 | Ga0439440_0232638 | |||
| 1876 | Ga0466967_0350002 | |||
| 1877 | Ga0495603_0035069 | |||
| 1878 | Ga0495603_0264450 | |||
| 1879 | Ga0495641_0270051 | |||
| 1880 | Ga0495651_0500581 | |||
| 1881 | Ga0495582_0443499 | |||
| 1882 | Ga0495605_0138172 | |||
| 1883 | Ga0495584_0613625 | |||
| 1884 | Ga0495585_0244741 | |||
| 1885 | Ga0495596_0105550 | |||
| 1886 | Ga0495596_0405762 | |||
| 1887 | Ga0495608_0138327 | |||
| 1888 | Ga0495616_0280749 | |||
| 1889 | Ga0495618_0646578 | |||
| 1890 | Ga0495620_0210159 | |||
| 1891 | Ga0495628_0219470 | |||
| 1892 | Ga0495628_0777536 | |||
| 1893 | Ga0495630_0143599 | |||
| 1894 | Ga0495644_0043043 | |||
| 1895 | Ga0495587_0709012 | |||
| 1896 | Ga0495598_0259894 | |||
| 1897 | Ga0495645_0347890 | |||
| 1898 | Ga0495667_0957206 | |||
| 1899 | Ga0495656_0172387 | |||
| 1900 | Ga0495656_0337502 | |||
| 1901 | Ga0495656_0712993 | |||
| 1902 | Ga0495634_0820110 | |||
| 1903 | Ga0495611_0223513 | |||
| 1904 | Ga0495635_0199282 | |||
| 1905 | Ga0495659_0102784 | |||
| 1906 | Ga0495588_0327785 | |||
| 1907 | Ga0495658_0482207 | |||
| 1908 | Ga0495658_0736409 | |||
| 1909 | Ga0495658_0850368 | |||
| 1910 | Ga0495624_0350387 | |||
| 1911 | Ga0495624_0564779 | |||
| 1912 | Ga0495670_0410725 | |||
| 1913 | Ga0495671_0058339 | |||
| 1914 | Ga0495589_0045256 | |||
| 1915 | Ga0495600_0698996 | |||
| 1916 | Ga0495660_0489572 | |||
| 1917 | Ga0495581_0539635 | |||
| 1918 | Ga0495604_0245016 | |||
| 1919 | Ga0495604_0589546 | |||
| 1920 | Ga0495636_0087635 | |||
| 1921 | Ga0495674_0120853 | |||
| 1922 | Ga0495676_0336055 | |||
| 1923 | Ga0495676_1031363 | |||
| 1924 | Ga0495675_0243476 | |||
| 1925 | Ga0495684_0605319 | |||
| 1926 | Ga0496100_0432659 | |||
| 1927 | Ga0496100_0554901 | |||
| 1928 | Ga0496100_0849718 | |||
| 1929 | Ga0496100_1306091 | |||
| 1930 | Ga0496101_0130884 | |||
| 1931 | Ga0496101_0138299 | |||
| 1932 | Ga0496101_0217352 | |||
| 1933 | Ga0496101_1157668 | |||
| 1934 | Ga0496102_0234483 | |||
| 1935 | Ga0496102_0527928 | |||
| 1936 | Ga0496102_0615214 | |||
| 1937 | Ga0496102_0668846 | |||
| 1938 | Ga0496102_1524458 | |||
| 1939 | Ga0496102_1729973 | |||
| 1940 | Ga0496103_0160526 | |||
| 1941 | Ga0496104_0027875 | |||
| 1942 | Ga0496104_0230746 | |||
| 1943 | Ga0496104_0303765 | |||
| 1944 | Ga0496104_0382872 | |||
| 1945 | Ga0496104_1101567 | |||
| 1946 | Ga0496104_1355928 | |||
| 1947 | Ga0496104_1378047 | |||
| 1948 | Ga0496105_0120951 | |||
| 1949 | Ga0496105_0215961 | |||
| 1950 | Ga0496105_0364671 | |||
| 1951 | Ga0496105_0584496 | |||
| 1952 | Ga0496106_0025632 | |||
| 1953 | Ga0496107_0191368 | |||
| 1954 | Ga0496107_0429079 | |||
| 1955 | Ga0496107_1337180 | |||
| 1956 | Ga0496108_0019446 | |||
| 1957 | Ga0496108_0270465 | |||
| 1958 | Ga0496108_0652845 | |||
| 1959 | Ga0496108_1463315 | |||
| 1960 | Ga0496108_1568393 | |||
| 1961 | Ga0496109_0002689 | |||
| 1962 | Ga0496109_0011202 | |||
| 1963 | Ga0496109_0084789 | |||
| 1964 | Ga0496109_0121469 | |||
| 1965 | Ga0496109_0522717 | |||
| 1966 | Ga0496109_1167443 | |||
| 1967 | Ga0496109_1768708 | |||
| 1968 | Ga0496109_1882614 | |||
| 1969 | Ga0496110_0030503 | |||
| 1970 | Ga0496110_0033633 | |||
| 1971 | Ga0496110_0831379 | |||
| 1972 | Ga0496110_1686591 | |||
| 1973 | Ga0496110_1730585 | |||
| 1974 | Ga0496111_0003152 | |||
| 1975 | Ga0496111_0067911 | |||
| 1976 | Ga0496111_0259350 | |||
| 1977 | Ga0496111_0506762 | |||
| 1978 | Ga0496112_0148129 | |||
| 1979 | Ga0496112_0218787 | |||
| 1980 | Ga0496113_0239154 | |||
| 1981 | Ga0496114_0127020 | |||
| 1982 | Ga0496114_0146112 | |||
| 1983 | Ga0496114_0217280 | |||
| 1984 | Ga0496114_0325870 | |||
| 1985 | Ga0496114_0336944 | |||
| 1986 | Ga0496114_0381691 | |||
| 1987 | Ga0496114_0445050 | |||
| 1988 | Ga0496114_0489201 | |||
| 1989 | Ga0496114_0513982 | |||
| 1990 | Ga0496114_1112719 | |||
| 1991 | Ga0501031_0001754 | |||
| 1992 | Ga0501031_0152337 | |||
| 1993 | Ga0501031_0214057 | |||
| 1994 | Ga0501031_0609937 | |||
| 1995 | Ga0501031_0748699 | |||
| 1996 | Ga0501032_0014533 | |||
| 1997 | Ga0501032_0015883 | |||
| 1998 | Ga0501032_0143422 | |||
| 1999 | Ga0501032_0175329 | |||
| 2000 | Ga0501032_0352308 | |||
| 2001 | Ga0501032_0594350 | |||
| 2002 | Ga0501033_0021291 | |||
| 2003 | Ga0501033_0123752 | |||
| 2004 | Ga0501033_0224595 | |||
| 2005 | Ga0501034_0121208 | |||
| 2006 | Ga0501034_0207367 | |||
| 2007 | Ga0501036_0022147 | |||
| 2008 | Ga0501036_0036855 | |||
| 2009 | Ga0501036_0046920 | |||
| 2010 | Ga0501036_0054874 | |||
| 2011 | Ga0501036_0103525 | |||
| 2012 | Ga0501036_0331860 | |||
| 2013 | Ga0501036_0338754 | |||
| 2014 | Ga0501036_1579255 | |||
| 2015 | Ga0501037_0001734 | |||
| 2016 | Ga0501037_0012017 | |||
| 2017 | Ga0501037_0076460 | |||
| 2018 | Ga0501037_0225254 | |||
| 2019 | Ga0501037_0258555 | |||
| 2020 | Ga0501038_0010491 | |||
| 2021 | Ga0501038_0020457 | |||
| 2022 | Ga0501038_0021628 | |||
| 2023 | Ga0501038_0046809 | |||
| 2024 | Ga0501038_0371394 | |||
| 2025 | Ga0501038_0925532 | |||
| 2026 | Ga0501038_0971800 | |||
| 2027 | Ga0501038_1013005 | |||
| 2028 | Ga0501038_1200320 | |||
| 2029 | Ga0501039_0013914 | |||
| 2030 | Ga0501039_0055895 | |||
| 2031 | Ga0501039_0067408 | |||
| 2032 | Ga0501039_0068069 | |||
| 2033 | Ga0501039_0110088 | |||
| 2034 | Ga0501039_0135629 | |||
| 2035 | Ga0501039_0198444 | |||
| 2036 | Ga0501039_0290168 | |||
| 2037 | Ga0501039_0328024 | |||
| 2038 | Ga0501040_0019285 | |||
| 2039 | Ga0501040_0022250 | |||
| 2040 | Ga0501040_0041611 | |||
| 2041 | Ga0501040_0052374 | |||
| 2042 | Ga0501040_0062134 | |||
| 2043 | Ga0501040_0112106 | |||
| 2044 | Ga0501040_0112614 | |||
| 2045 | Ga0501040_0117512 | |||
| 2046 | Ga0501040_0252341 | |||
| 2047 | Ga0501040_0435522 | |||
| 2048 | Ga0501041_0006203 | |||
| 2049 | Ga0501041_0007256 | |||
| 2050 | Ga0501041_0028618 | |||
| 2051 | Ga0501041_0079270 | |||
| 2052 | Ga0501041_0392273 | |||
| 2053 | Ga0501041_0501330 | |||
| 2054 | Ga0501041_0597561 | |||
| 2055 | Ga0501042_0006488 | |||
| 2056 | Ga0501042_0016796 | |||
| 2057 | Ga0501042_0058535 | |||
| 2058 | Ga0501042_0113882 | |||
| 2059 | Ga0501042_0242329 | |||
| 2060 | Ga0501042_0475668 | |||
| 2061 | Ga0501042_1377111 | |||
| 2062 | Ga0501043_0057097 | |||
| 2063 | Ga0501043_0081566 | |||
| 2064 | Ga0501043_0098803 | |||
| 2065 | Ga0501043_0329677 | |||
| 2066 | Ga0501043_0363906 | |||
| 2067 | Ga0501046_0003198 | |||
| 2068 | Ga0501046_0048035 | |||
| 2069 | Ga0501046_0063500 | |||
| 2070 | Ga0501046_0103819 | |||
| 2071 | Ga0501046_0138552 | |||
| 2072 | Ga0501046_0287854 | |||
| 2073 | Ga0501046_0769721 | |||
| 2074 | Ga0501047_0513915 | |||
| 2075 | Ga0501048_0005712 | |||
| 2076 | Ga0501048_0016260 | |||
| 2077 | Ga0501048_0049671 | |||
| 2078 | Ga0501048_0057482 | |||
| 2079 | Ga0501048_0083215 | |||
| 2080 | Ga0501048_0092389 | |||
| 2081 | Ga0501048_0190743 | |||
| 2082 | Ga0501048_0455541 | |||
| 2083 | Ga0501067_0029785 | |||
| 2084 | Ga0501067_0416262 | |||
| 2085 | Ga0501067_0533503 | |||
| 2086 | Ga0501068_0011157 | |||
| 2087 | Ga0501068_0011596 | |||
| 2088 | Ga0501068_0147984 | |||
| 2089 | Ga0501068_0186174 | |||
| 2090 | Ga0501068_0194918 | |||
| 2091 | Ga0501068_0245792 | |||
| 2092 | Ga0501068_0330909 | |||
| 2093 | Ga0501069_0000404 | |||
| 2094 | Ga0501069_0005994 | |||
| 2095 | Ga0501069_0023246 | |||
| 2096 | Ga0501069_0071781 | |||
| 2097 | Ga0501069_0084634 | |||
| 2098 | Ga0501069_0104261 | |||
| 2099 | Ga0501069_0121787 | |||
| 2100 | Ga0501069_0451383 | |||
| 2101 | Ga0501069_0956969 | |||
| 2102 | Ga0501070_0038832 | |||
| 2103 | Ga0501070_0120293 | |||
| 2104 | Ga0501070_0142276 | |||
| 2105 | Ga0501070_0330457 | |||
| 2106 | Ga0501070_0980483 | |||
| 2107 | Ga0501070_1474431 | |||
| 2108 | Ga0501071_0007629 | |||
| 2109 | Ga0501071_0017219 | |||
| 2110 | Ga0501071_0023334 | |||
| 2111 | Ga0501071_0035205 | |||
| 2112 | Ga0501071_0054966 | |||
| 2113 | Ga0501071_0070959 | |||
| 2114 | Ga0501071_0128945 | |||
| 2115 | Ga0501071_0511580 | |||
| 2116 | Ga0501071_1391546 | |||
| 2117 | Ga0501072_0024283 | |||
| 2118 | Ga0501072_0031317 | |||
| 2119 | Ga0501072_0047202 | |||
| 2120 | Ga0501072_0141758 | |||
| 2121 | Ga0501072_0273398 | |||
| 2122 | Ga0501072_0589395 | |||
| 2123 | Ga0501072_1221232 | |||
| 2124 | Ga0501073_0027444 | |||
| 2125 | Ga0501073_0036973 | |||
| 2126 | Ga0501073_0045539 | |||
| 2127 | Ga0501074_0010424 | |||
| 2128 | Ga0501074_0035462 | |||
| 2129 | Ga0501074_0046674 | |||
| 2130 | Ga0501074_0075607 | |||
| 2131 | Ga0501074_0083713 | |||
| 2132 | Ga0501074_0191407 | |||
| 2133 | Ga0501074_0903316 | |||
| 2134 | Ga0501074_0912687 | |||
| 2135 | Ga0501075_0079617 | |||
| 2136 | Ga0501075_0086681 | |||
| 2137 | Ga0501075_0111997 | |||
| 2138 | Ga0501075_0213807 | |||
| 2139 | Ga0501075_0224889 | |||
| 2140 | Ga0501075_0246283 | |||
| 2141 | Ga0501075_0267587 | |||
| 2142 | Ga0501075_0997239 | |||
| 2143 | Ga0501076_0001971 | |||
| 2144 | Ga0501076_0030067 | |||
| 2145 | Ga0501076_0040451 | |||
| 2146 | Ga0501076_0062557 | |||
| 2147 | Ga0501076_0071760 | |||
| 2148 | Ga0501076_0077841 | |||
| 2149 | Ga0501076_0129944 | |||
| 2150 | Ga0501076_0134821 | |||
| 2151 | Ga0501076_0154388 | |||
| 2152 | Ga0501076_0160284 | |||
| 2153 | Ga0501076_0357025 | |||
| 2154 | Ga0501076_0720248 | |||
| 2155 | Ga0501077_0011287 | |||
| 2156 | Ga0501077_0023420 | |||
| 2157 | Ga0501077_0061071 | |||
| 2158 | Ga0501077_0100358 | |||
| 2159 | Ga0501077_0109828 | |||
| 2160 | Ga0501077_0221591 | |||
| 2161 | Ga0501077_0361937 | |||
| 2162 | Ga0501077_0571907 | |||
| 2163 | Ga0501077_0939064 | |||
| 2164 | Ga0501079_0012614 | |||
| 2165 | Ga0501079_0027218 | |||
| 2166 | Ga0501079_0037136 | |||
| 2167 | Ga0501079_0092603 | |||
| 2168 | Ga0501079_0149866 | |||
| 2169 | Ga0501079_0329425 | |||
| 2170 | Ga0501079_0537722 | |||
| 2171 | Ga0501079_0579047 | |||
| 2172 | Ga0501079_1326048 | |||
| 2173 | Ga0501080_0009195 | |||
| 2174 | Ga0501080_0010484 | |||
| 2175 | Ga0501080_0054290 | |||
| 2176 | Ga0501080_0079553 | |||
| 2177 | Ga0501080_0097690 | |||
| 2178 | Ga0501080_0195377 | |||
| 2179 | Ga0501080_0279880 | |||
| 2180 | Ga0501080_0287468 | |||
| 2181 | Ga0501080_0357664 | |||
| 2182 | Ga0501080_0505965 | |||
| 2183 | Ga0501080_1230120 | |||
| 2184 | Ga0501081_0007559 | |||
| 2185 | Ga0501081_0026901 | |||
| 2186 | Ga0501081_0122242 | |||
| 2187 | Ga0501081_0133582 | |||
| 2188 | Ga0501081_0143009 | |||
| 2189 | Ga0501081_0252163 | |||
| 2190 | Ga0501081_0458080 | |||
| 2191 | Ga0501083_0006299 | |||
| 2192 | Ga0501083_0009341 | |||
| 2193 | Ga0501083_0029146 | |||
| 2194 | Ga0501083_0311954 | |||
| 2195 | Ga0501083_0394585 | |||
| 2196 | Ga0501083_0815682 | |||
| 2197 | Ga0501035_0026164 | |||
| 2198 | Ga0501035_0034600 | |||
| 2199 | Ga0501035_0110735 | |||
| 2200 | Ga0501035_0111907 | |||
| 2201 | Ga0501035_0508606 | |||
| 2202 | Ga0501035_0603218 | |||
| 2203 | Ga0501035_1191426 | |||
| 2204 | Ga0501044_0146738 | |||
| 2205 | Ga0501044_0607539 | |||
| 2206 | Ga0501044_0773261 | |||
| 2207 | Ga0501045_0016648 | |||
| 2208 | Ga0501045_0026675 | |||
| 2209 | Ga0501045_0028937 | |||
| 2210 | Ga0501045_0045530 | |||
| 2211 | Ga0501045_0065278 | |||
| 2212 | Ga0501045_0084664 | |||
| 2213 | Ga0501045_0359545 | |||
| 2214 | Ga0501045_0529024 | |||
| 2215 | Ga0501045_1084983 | |||
| 2216 | nmdc:mga03n38_33083_c1 | |||
| 2217 | nmdc:mga00v17_149210_c1 | |||
| 2218 | nmdc:mga0yw44_686432_c1 | |||
| 2219 | nmdc:mga0yw44_95997_c1 | |||
| 2220 | nmdc:mga04h51_141322_c1 | |||
| 2221 | nmdc:mga05p37_2048777_c1 | |||
| 2222 | nmdc:mga05p37_22081_c1 | |||
| 2223 | nmdc:mga05p37_23743_c1 | |||
| 2224 | nmdc:mga05p37_247142_c1 | |||
| 2225 | nmdc:mga09592_1365894_c1 | |||
| 2226 | nmdc:mga09592_28987_c1 | |||
| 2227 | nmdc:mga0qj67_99131_c1 | |||
| 2228 | nmdc:mga06r32_1344820_c1 | |||
| 2229 | nmdc:mga06r32_840086_c1 | |||
| 2230 | nmdc:mga08y16_1169611_c1 | |||
| 2231 | nmdc:mga08y16_128631_c1 | |||
| 2232 | nmdc:mga08y16_33557_c1 | |||
| 2233 | nmdc:mga08y16_74927_c1 | |||
| 2234 | nmdc:mga0n895_1074783_c1 | |||
| 2235 | nmdc:mga0n895_528034_c1 | |||
| 2236 | nmdc:mga0n895_828617_c1 | |||
| 2237 | nmdc:mga0a205_368361_c1 | |||
| 2238 | nmdc:mga0a205_788872_c1 | |||
| 2239 | nmdc:mga0a205_90715_c1 | |||
| 2240 | Ga0495655_0230433 | |||
| 2241 | Ga0495595_0008836 | |||
| 2242 | Ga0495595_0091108 | |||
| 2243 | Ga0495595_0667404 | |||
| 2244 | Ga0495619_0264311 | |||
| 2245 | Ga0501084_0025140 | |||
| 2246 | Ga0501084_0026068 | |||
| 2247 | Ga0501084_0045376 | |||
| 2248 | Ga0501084_0045652 | |||
| 2249 | Ga0501084_0106836 | |||
| 2250 | Ga0501084_0291123 | |||
| 2251 | Ga0501084_0402064 | |||
| 2252 | Ga0501084_0442549 | |||
| 2253 | Ga0501084_0653507 | |||
| 2254 | Ga0501084_0967622 | |||
| 2255 | Ga0501084_1209451 | |||
| 2256 | Ga0587069_088426 | |||
| 2257 | Ga0501082_0053681 | |||
| 2258 | Ga0501082_0062549 | |||
| 2259 | Ga0501082_0096947 | |||
| 2260 | Ga0501082_0102354 | |||
| 2261 | Ga0501082_0107066 | |||
| 2262 | Ga0501082_0252782 | |||
| 2263 | Ga0501082_0329875 | |||
| 2264 | Ga0501082_0394861 | |||
| 2265 | Ga0501082_0490962 | |||
| 2266 | Ga0501082_0495401 | |||
| 2267 | Ga0501082_1113355 | |||
| 2268 | Ga0530510_0020887 | |||
| 2269 | Ga0530510_0063666 | |||
| 2270 | Ga0530510_0080521 | |||
| 2271 | Ga0530510_0084447 | |||
| 2272 | Ga0530510_0095107 | |||
| 2273 | Ga0530510_0096247 | |||
| 2274 | Ga0530510_0097928 | |||
| 2275 | Ga0530510_0303982 | |||
| 2276 | Ga0530510_0341880 | |||
| 2277 | Ga0530510_0362127 | |||
| 2278 | Ga0530510_0426363 | |||
| 2279 | Ga0530510_0530570 | |||
| 2280 | Ga0530510_1216469 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wr6-assembly4.cif.gz_D | crystal structure of gga3 gat domain in complex with ubiquitin | 0.6136 | 4 | 41 |
| 5wur-assembly1.cif.gz_C | crystal structure of sigw in complex with its anti-sigma rsiw, an oxdized form | 0.5911 | 7 | 71 |
| 5wuq-assembly2.cif.gz_D | crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form | 0.5843 | 8 | 72 |
| 5vr3-assembly1.cif.gz_A | crystal structure of the brs domain of braf | 0.5703 | 3 | 44 |
| 5wur-assembly1.cif.gz_C | crystal structure of sigw in complex with its anti-sigma rsiw, an oxdized form | 0.551 | 7 | 71 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4ISY9_209_303_1.20.58.160 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.6204 | 4 | 41 | 1.20.58.160 |
| af_Q91XE8_17_119_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.6105 | 5 | 50 | 1.20.120.550 |
| af_Q9VJH8_36_256_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.5853 | 1 | 29 | 3.40.50.2000 |
| af_Q59LF3_2_249_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.5448 | 5 | 49 | 1.20.1270.60 |
| af_A0A1D6GCT6_95_259_1.20.58.70 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.5436 | 4 | 45 | 1.20.58.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5Q4ET84-F1-model_v4 | HEAT repeat domain-containing protein | 0.6209 | 4 | 78 |
|
| AF-A0A127SLD7-F1-model_v4 | Putative zinc-finger | 0.6057 | 4 | 73 |
|
| AF-A0A7V5P3K1-F1-model_v4 | Zf-HC2 domain-containing protein | 0.587 | 3 | 73 |
GO:0016020
|
| AF-A0A127SLD7-F1-model_v4 | Putative zinc-finger | 0.5854 | 4 | 73 |
|
| AF-A0A654E1M7-F1-model_v4 | Mycothiol system anti-sigma-R factor | 0.5842 | 2 | 75 |
|