F490666
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1138 | 407 | 1134 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0000750|Ga0395905_0000750_18342_19109 |
| Length | 255 |
| Sequence | MPPISGLTRKSHSGCSTLSSNHFFLLCKPAIAAGFFISVAATRYGKMRAMKNIVILISGRGSNMQAIVRAAQAEQWPCRIAAVISNRADAEGLMFAAEHGIATEVVVSKEFPSRDAFDAALRLAIDRFAPDLVVLAGFMRILTPGFVEHYAGRMLNIHPSLLPSFPGLATHRQALAAGVKVHGATVHFVTAELDHGPIVAQAAVPVLPGDTEHSLAERVLVQEHVIYPRAVRWFVEGRLSIDNGLVHVNEAAPSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 3 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 4 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 5 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 11 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 12 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 13 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 14 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 15 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 16 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 17 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 24 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 25 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 88 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 89 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 90 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 202 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 203 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 204 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 207 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 208 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 209 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 210 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 211 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 212 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 213 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 218 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 234 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 235 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 236 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 237 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 238 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 239 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 240 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 241 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 242 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 243 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 244 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 247 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 248 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 249 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 250 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 251 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 252 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 253 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 254 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 255 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 256 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 257 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 258 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 259 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 260 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 261 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 262 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 263 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 264 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 359 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 360 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 361 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 362 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 363 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 365 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 366 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 369 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 370 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 371 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 372 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 373 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 374 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 375 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 376 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 377 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 378 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 385 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 386 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 387 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 388 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 389 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 390 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 391 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 392 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 393 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 396 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 398 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 399 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 400 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 401 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 402 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 403 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 404 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.03 |
| Metatranscriptomes | 0.53 |
| Isolates | 0.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.78 |
| Nodule | 0.7 |
| Rhizoplane | 2.9 |
| Rhizosphere | 77.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000527 | 3300001979 | Bacteria | 16316 |
| 2 | JGI24739J22299_10030478 | 3300001989 | Bacteria | 1870 |
| 3 | JGI24737J22298_10012956 | 3300001990 | Bacteria | 2717 |
| 4 | JGI24735J21928_10009274 | 3300002067 | Bacteria | 3165 |
| 5 | JGI25155J39150_1000288 | 3300002704 | Bacteria | 17886 |
| 6 | JGI25156J39149_1000695 | 3300002705 | Bacteria | 18063 |
| 7 | JGI25156J39149_1002511 | 3300002705 | Bacteria | 6539 |
| 8 | JGI25156J39149_1007991 | 3300002705 | Bacteria | 2711 |
| 9 | JGI25154J39366_1000350 | 3300002738 | Bacteria | 26241 |
| 10 | JGI25154J39366_1000571 | 3300002738 | Bacteria | 18063 |
| 11 | JGI25154J39366_1001471 | 3300002738 | Bacteria | 8319 |
| 12 | JGI25154J39366_1003202 | 3300002738 | Bacteria | 3600 |
| 13 | JGI25154J39366_1003796 | 3300002738 | Bacteria | 2980 |
| 14 | JGI25158J39367_1001641 | 3300002739 | Bacteria | 3856 |
| 15 | JGI25157J39369_1000018 | 3300002741 | Bacteria | 177410 |
| 16 | JGI25157J39369_1000773 | 3300002741 | Bacteria | 16575 |
| 17 | JGI25150J39212_1012636 | 3300002774 | Bacteria | 1489 |
| 18 | JGI25159J45721_1005067 | 3300002987 | Bacteria | 4197 |
| 19 | JGI25151J46595_10035406 | 3300003187 | Bacteria | 1896 |
| 20 | JGI25151J46595_10055552 | 3300003187 | Bacteria | 1304 |
| 21 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 22 | JGI25153J46596_10017617 | 3300003215 | Bacteria | 2807 |
| 23 | rootH2_10128398 | 3300003320 | Bacteria | 1100 |
| 24 | rootL2_10017918 | 3300003322 | Bacteria | 1501 |
| 25 | rootH1_10042583 | 3300003316 | Bacteria | 4075 |
| 26 | rootH1_10042583 | 3300003323 | Bacteria | 1921 |
| 27 | rootH1_10042585 | 3300003323 | Bacteria | 1207 |
| 28 | rootH1_10186258 | 3300003323 | Bacteria | 1704 |
| 29 | JGI25160J50197_1002021 | 3300003354 | Bacteria | 9671 |
| 30 | JGI25161J50226_1001870 | 3300003374 | Bacteria | 5878 |
| 31 | Ga0007409J51694_1041494 | 3300003575 | Bacteria | 3994 |
| 32 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 33 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 34 | Ga0055539_1000146 | 3300003752 | Bacteria | 70677 |
| 35 | Ga0055539_1000240 | 3300003752 | Bacteria | 36494 |
| 36 | Ga0055539_1001263 | 3300003752 | Bacteria | 5036 |
| 37 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 38 | Ga0055533_1000103 | 3300003756 | Bacteria | 107860 |
| 39 | Ga0055533_1000150 | 3300003756 | Bacteria | 70677 |
| 40 | Ga0055533_1001052 | 3300003756 | Bacteria | 7936 |
| 41 | Ga0055532_1000005 | 3300003758 | Bacteria | 458107 |
| 42 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 43 | Ga0055525_1000198 | 3300003759 | Bacteria | 70677 |
| 44 | Ga0055525_1001499 | 3300003759 | Bacteria | 4023 |
| 45 | Ga0055535_1002863 | 3300003761 | Bacteria | 5417 |
| 46 | Ga0055542_1002038 | 3300003762 | Bacteria | 7643 |
| 47 | Ga0055526_1000161 | 3300003771 | Bacteria | 59705 |
| 48 | Ga0055526_1000827 | 3300003771 | Bacteria | 23107 |
| 49 | Ga0055526_1003727 | 3300003771 | Bacteria | 9515 |
| 50 | Ga0055537_1000111 | 3300003773 | Bacteria | 61884 |
| 51 | Ga0055524_1000015 | 3300003775 | Bacteria | 246493 |
| 52 | Ga0055524_1002005 | 3300003775 | Bacteria | 10873 |
| 53 | Ga0055524_1002542 | 3300003775 | Bacteria | 9325 |
| 54 | Ga0055524_1005899 | 3300003775 | Bacteria | 5397 |
| 55 | Ga0055524_1017165 | 3300003775 | Bacteria | 2563 |
| 56 | Ga0055536_1000252 | 3300003781 | Bacteria | 42499 |
| 57 | Ga0055534_1000268 | 3300003784 | Bacteria | 35791 |
| 58 | Ga0055534_1002782 | 3300003784 | Bacteria | 5845 |
| 59 | Ga0055534_1004596 | 3300003784 | Bacteria | 3938 |
| 60 | Ga0055528_1000178 | 3300003790 | Bacteria | 53709 |
| 61 | Ga0055530_10001043 | 3300003791 | Bacteria | 22076 |
| 62 | Ga0055530_10028903 | 3300003791 | Bacteria | 1489 |
| 63 | Ga0055540_1000001 | 3300003792 | Bacteria | 466834 |
| 64 | Ga0055531_10002737 | 3300003794 | Bacteria | 11585 |
| 65 | Ga0055531_10007375 | 3300003794 | Bacteria | 6022 |
| 66 | Ga0055531_10021621 | 3300003794 | Bacteria | 2487 |
| 67 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 68 | Ga0055541_1000098 | 3300003841 | Bacteria | 70677 |
| 69 | Ga0055541_1000789 | 3300003841 | Bacteria | 7895 |
| 70 | Ga0065165_1000286 | 3300005262 | Bacteria | 85993 |
| 71 | Ga0065165_1058816 | 3300005262 | Bacteria | 1060 |
| 72 | Ga0070658_10081833 | 3300005327 | Bacteria | 2653 |
| 73 | Ga0070658_10086907 | 3300005327 | Bacteria | 2573 |
| 74 | Ga0070658_10440175 | 3300005327 | Bacteria | 1122 |
| 75 | Ga0070658_10646273 | 3300005327 | Bacteria | 918 |
| 76 | Ga0070690_100031128 | 3300005330 | Bacteria | 3321 |
| 77 | Ga0070670_100273775 | 3300005331 | Bacteria | 1473 |
| 78 | Ga0070670_100295403 | 3300005331 | Bacteria | 1416 |
| 79 | Ga0070677_10023109 | 3300005333 | Bacteria | 2299 |
| 80 | Ga0068869_100037044 | 3300005334 | Bacteria | 3466 |
| 81 | Ga0070666_10019648 | 3300005335 | Bacteria | 4365 |
| 82 | Ga0068868_100195124 | 3300005338 | Bacteria | 1685 |
| 83 | Ga0070660_100227965 | 3300005339 | Bacteria | 1515 |
| 84 | Ga0070689_100346171 | 3300005340 | Bacteria | 1246 |
| 85 | Ga0070661_100023457 | 3300005344 | Bacteria | 4422 |
| 86 | Ga0070668_100059448 | 3300005347 | Bacteria | 2958 |
| 87 | Ga0070669_100004469 | 3300005353 | Bacteria | 10075 |
| 88 | Ga0070675_100066570 | 3300005354 | Bacteria | 2980 |
| 89 | Ga0070675_100501698 | 3300005354 | Bacteria | 1093 |
| 90 | Ga0070671_100031566 | 3300005355 | Bacteria | 4377 |
| 91 | Ga0070671_100187716 | 3300005355 | Bacteria | 1751 |
| 92 | Ga0070674_100028072 | 3300005356 | Bacteria | 3693 |
| 93 | Ga0070673_100028417 | 3300005364 | Bacteria | 4159 |
| 94 | Ga0070659_100003171 | 3300005366 | Bacteria | 11710 |
| 95 | Ga0070659_100004714 | 3300005366 | Bacteria | 9733 |
| 96 | Ga0070659_100174856 | 3300005366 | Bacteria | 1760 |
| 97 | Ga0070667_100002718 | 3300005367 | Bacteria | 15313 |
| 98 | Ga0070667_100246137 | 3300005367 | Bacteria | 1597 |
| 99 | Ga0070701_10066089 | 3300005438 | Bacteria | 1921 |
| 100 | Ga0070663_100023240 | 3300005455 | Bacteria | 4153 |
| 101 | Ga0070663_100384565 | 3300005455 | Bacteria | 1144 |
| 102 | Ga0070678_100130407 | 3300005456 | Bacteria | 1996 |
| 103 | Ga0070662_100016597 | 3300005457 | Bacteria | 4947 |
| 104 | Ga0068867_100027789 | 3300005459 | Bacteria | 4069 |
| 105 | Ga0068867_100122049 | 3300005459 | Bacteria | 2015 |
| 106 | Ga0068867_100800152 | 3300005459 | Bacteria | 841 |
| 107 | Ga0070684_100508873 | 3300005535 | Bacteria | 1116 |
| 108 | Ga0068853_100072486 | 3300005539 | Bacteria | 3001 |
| 109 | Ga0068853_100551899 | 3300005539 | Bacteria | 1091 |
| 110 | Ga0070672_100036953 | 3300005543 | Bacteria | 3724 |
| 111 | Ga0070686_100065917 | 3300005544 | Bacteria | 2354 |
| 112 | Ga0068855_100127299 | 3300005563 | Bacteria | 2911 |
| 113 | Ga0068855_100430825 | 3300005563 | Bacteria | 1442 |
| 114 | Ga0068857_100007953 | 3300005577 | Bacteria | 9152 |
| 115 | Ga0068854_100004599 | 3300005578 | Bacteria | 8706 |
| 116 | Ga0068856_100008259 | 3300005614 | Bacteria | 10149 |
| 117 | Ga0068856_100056975 | 3300005614 | Bacteria | 3858 |
| 118 | Ga0068856_100257418 | 3300005614 | Bacteria | 1760 |
| 119 | Ga0068852_100102675 | 3300005616 | Bacteria | 2584 |
| 120 | Ga0068852_100147709 | 3300005616 | Bacteria | 2182 |
| 121 | Ga0068852_100186438 | 3300005616 | Bacteria | 1954 |
| 122 | Ga0068852_100955562 | 3300005616 | Bacteria | 875 |
| 123 | Ga0068864_100301443 | 3300005618 | Bacteria | 1500 |
| 124 | Ga0068864_100560238 | 3300005618 | Bacteria | 1106 |
| 125 | Ga0068866_10010619 | 3300005718 | Bacteria | 3954 |
| 126 | Ga0068866_10309096 | 3300005718 | Bacteria | 990 |
| 127 | Ga0068861_100016063 | 3300005719 | Bacteria | 5287 |
| 128 | Ga0068861_100158841 | 3300005719 | Bacteria | 1863 |
| 129 | Ga0068863_100019781 | 3300005841 | Bacteria | 6439 |
| 130 | Ga0068863_100473095 | 3300005841 | Bacteria | 1231 |
| 131 | Ga0068858_100017353 | 3300005842 | Bacteria | 6752 |
| 132 | Ga0068860_100565456 | 3300005843 | Bacteria | 1140 |
| 133 | Ga0075363_100043109 | 3300006048 | Bacteria | 2386 |
| 134 | Ga0075366_10099523 | 3300006195 | Bacteria | 1744 |
| 135 | Ga0075366_10197495 | 3300006195 | Bacteria | 1223 |
| 136 | Ga0075370_10002946 | 3300006353 | Bacteria | 7999 |
| 137 | Ga0075370_10271119 | 3300006353 | Bacteria | 1007 |
| 138 | Ga0068871_100073893 | 3300006358 | Bacteria | 2812 |
| 139 | Ga0068865_100114600 | 3300006881 | Bacteria | 1994 |
| 140 | Ga0068865_100269843 | 3300006881 | Bacteria | 1350 |
| 141 | Ga0099824_1036213 | 3300006942 | Bacteria | 1447 |
| 142 | Ga0099823_1017932 | 3300006944 | Bacteria | 6859 |
| 143 | Ga0079104_1000309 | 3300006946 | Bacteria | 61858 |
| 144 | Ga0099826_10000018 | 3300006948 | Bacteria | 198330 |
| 145 | Ga0105251_10002082 | 3300009011 | Bacteria | 16156 |
| 146 | Ga0105251_10005601 | 3300009011 | Bacteria | 8174 |
| 147 | Ga0105251_10013210 | 3300009011 | Bacteria | 4629 |
| 148 | Ga0105251_10024566 | 3300009011 | Bacteria | 3093 |
| 149 | Ga0105251_10049399 | 3300009011 | Bacteria | 2013 |
| 150 | Ga0105244_10001133 | 3300009036 | Bacteria | 22165 |
| 151 | Ga0105244_10002953 | 3300009036 | Bacteria | 12532 |
| 152 | Ga0105244_10007523 | 3300009036 | Bacteria | 6913 |
| 153 | Ga0105244_10061761 | 3300009036 | Bacteria | 1885 |
| 154 | Ga0105240_10012100 | 3300009093 | Bacteria | 11952 |
| 155 | Ga0105240_10017206 | 3300009093 | Bacteria | 9753 |
| 156 | Ga0105240_10024629 | 3300009093 | Bacteria | 7928 |
| 157 | Ga0105245_10262933 | 3300009098 | Bacteria | 1680 |
| 158 | Ga0105243_10052625 | 3300009148 | Bacteria | 3226 |
| 159 | Ga0105243_10054161 | 3300009148 | Bacteria | 3184 |
| 160 | Ga0105241_10019955 | 3300009174 | Bacteria | 4947 |
| 161 | Ga0105241_10186928 | 3300009174 | Bacteria | 1722 |
| 162 | Ga0105242_10007036 | 3300009176 | Bacteria | 8688 |
| 163 | Ga0105248_10078637 | 3300009177 | Bacteria | 3708 |
| 164 | Ga0105237_10499422 | 3300009545 | Bacteria | 1223 |
| 165 | Ga0105237_10755773 | 3300009545 | Bacteria | 979 |
| 166 | Ga0105238_10030398 | 3300009551 | Bacteria | 5498 |
| 167 | Ga0105238_10055566 | 3300009551 | Bacteria | 3974 |
| 168 | Ga0105238_10061774 | 3300009551 | Bacteria | 3749 |
| 169 | Ga0105249_10007528 | 3300009553 | Bacteria | 9500 |
| 170 | Ga0105246_10099856 | 3300011119 | Bacteria | 2111 |
| 171 | Ga0157373_10045986 | 3300013100 | Bacteria | 3115 |
| 172 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 173 | Ga0157371_10207645 | 3300013102 | Bacteria | 1405 |
| 174 | Ga0157370_10366078 | 3300013104 | Bacteria | 1328 |
| 175 | Ga0157370_10764917 | 3300013104 | Bacteria | 880 |
| 176 | Ga0157369_10169148 | 3300013105 | Bacteria | 2304 |
| 177 | Ga0157369_10236802 | 3300013105 | Bacteria | 1907 |
| 178 | Ga0157369_10383864 | 3300013105 | Bacteria | 1458 |
| 179 | Ga0157374_10036965 | 3300013296 | Bacteria | 4477 |
| 180 | Ga0157374_10132950 | 3300013296 | Bacteria | 2409 |
| 181 | Ga0157378_10248522 | 3300013297 | Bacteria | 1702 |
| 182 | Ga0163162_10040965 | 3300013306 | Bacteria | 4633 |
| 183 | Ga0163162_10728762 | 3300013306 | Bacteria | 1112 |
| 184 | Ga0157372_10361837 | 3300013307 | Bacteria | 1690 |
| 185 | Ga0157372_10731731 | 3300013307 | Bacteria | 1150 |
| 186 | Ga0157375_10008692 | 3300013308 | Bacteria | 8901 |
| 187 | Ga0157375_10173565 | 3300013308 | Bacteria | 2304 |
| 188 | Ga0157380_10051165 | 3300014326 | Bacteria | 3266 |
| 189 | Ga0157380_10241647 | 3300014326 | Bacteria | 1628 |
| 190 | Ga0182008_10003842 | 3300014497 | Bacteria | 8925 |
| 191 | Ga0182008_10027616 | 3300014497 | Bacteria | 2873 |
| 192 | Ga0157377_10228313 | 3300014745 | Bacteria | 1195 |
| 193 | Ga0157376_10226589 | 3300014969 | Bacteria | 1734 |
| 194 | Ga0157376_10345560 | 3300014969 | Bacteria | 1422 |
| 195 | Ga0182006_1009422 | 3300015261 | Bacteria | 4374 |
| 196 | Ga0182007_10004447 | 3300015262 | Bacteria | 6350 |
| 197 | Ga0182007_10010110 | 3300015262 | Bacteria | 3748 |
| 198 | Ga0182007_10081906 | 3300015262 | Bacteria | 1059 |
| 199 | Ga0182007_10095791 | 3300015262 | Bacteria | 980 |
| 200 | Ga0182005_1000158 | 3300015265 | Bacteria | 47201 |
| 201 | Ga0213872_10000002 | 3300021361 | Bacteria | 554092 |
| 202 | Ga0213872_10002809 | 3300021361 | Bacteria | 9960 |
| 203 | Ga0213872_10019803 | 3300021361 | Bacteria | 3098 |
| 204 | Ga0213872_10038157 | 3300021361 | Bacteria | 2193 |
| 205 | Ga0213872_10046973 | 3300021361 | Bacteria | 1964 |
| 206 | Ga0213872_10052963 | 3300021361 | Bacteria | 1841 |
| 207 | Ga0213872_10141970 | 3300021361 | Bacteria | 1053 |
| 208 | Ga0209435_100160 | 3300025206 | Bacteria | 21645 |
| 209 | Ga0209435_100473 | 3300025206 | Bacteria | 7971 |
| 210 | Ga0209435_109601 | 3300025206 | Bacteria | 1055 |
| 211 | Ga0209436_100751 | 3300025208 | Bacteria | 13429 |
| 212 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 213 | Ga0209784_100365 | 3300025224 | Bacteria | 21497 |
| 214 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 215 | Ga0209566_100955 | 3300025225 | Bacteria | 13033 |
| 216 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 217 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 218 | Ga0209674_100184 | 3300025226 | Bacteria | 68529 |
| 219 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 220 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 221 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 222 | Ga0207427_101086 | 3300025231 | Bacteria | 11117 |
| 223 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 224 | Ga0209437_100259 | 3300025233 | Bacteria | 82489 |
| 225 | Ga0209258_100525 | 3300025242 | Bacteria | 36665 |
| 226 | Ga0209258_100580 | 3300025242 | Bacteria | 30726 |
| 227 | Ga0209646_1000035 | 3300025246 | Bacteria | 363209 |
| 228 | Ga0209646_1000067 | 3300025246 | Bacteria | 241595 |
| 229 | Ga0209646_1000403 | 3300025246 | Bacteria | 25548 |
| 230 | Ga0209646_1000503 | 3300025246 | Bacteria | 18211 |
| 231 | Ga0209026_1000033 | 3300025250 | Bacteria | 318512 |
| 232 | Ga0209026_1000760 | 3300025250 | Bacteria | 18093 |
| 233 | Ga0209026_1000967 | 3300025250 | Bacteria | 14329 |
| 234 | Ga0209026_1002757 | 3300025250 | Bacteria | 6282 |
| 235 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 236 | Ga0209677_100068 | 3300025253 | Bacteria | 146135 |
| 237 | Ga0209677_100760 | 3300025253 | Bacteria | 16357 |
| 238 | Ga0209677_102322 | 3300025253 | Bacteria | 7314 |
| 239 | Ga0209677_102920 | 3300025253 | Bacteria | 5982 |
| 240 | Ga0209148_1000293 | 3300025254 | Bacteria | 74776 |
| 241 | Ga0209148_1005971 | 3300025254 | Bacteria | 2703 |
| 242 | Ga0209759_1000024 | 3300025256 | Bacteria | 318512 |
| 243 | Ga0209759_1000253 | 3300025256 | Bacteria | 79223 |
| 244 | Ga0209759_1001054 | 3300025256 | Bacteria | 18214 |
| 245 | Ga0209129_1000093 | 3300025258 | Bacteria | 173163 |
| 246 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 247 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 248 | Ga0209565_1000946 | 3300025263 | Bacteria | 15214 |
| 249 | Ga0209565_1001578 | 3300025263 | Bacteria | 9718 |
| 250 | Ga0209565_1002746 | 3300025263 | Bacteria | 6109 |
| 251 | Ga0209565_1012113 | 3300025263 | Bacteria | 2071 |
| 252 | Ga0209673_1000036 | 3300025273 | Bacteria | 323162 |
| 253 | Ga0209673_1006646 | 3300025273 | Bacteria | 5523 |
| 254 | Ga0209130_1001278 | 3300025284 | Bacteria | 17422 |
| 255 | Ga0209130_1001458 | 3300025284 | Bacteria | 15552 |
| 256 | Ga0209675_1000013 | 3300025291 | Bacteria | 448220 |
| 257 | Ga0209675_1000100 | 3300025291 | Bacteria | 128565 |
| 258 | Ga0209675_1000945 | 3300025291 | Bacteria | 18462 |
| 259 | Ga0209675_1007213 | 3300025291 | Bacteria | 4304 |
| 260 | Ga0209675_1009393 | 3300025291 | Bacteria | 3461 |
| 261 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 262 | Ga0209025_1001877 | 3300025294 | Bacteria | 24578 |
| 263 | Ga0209025_1004210 | 3300025294 | Bacteria | 12682 |
| 264 | Ga0209564_1000122 | 3300025295 | Bacteria | 203709 |
| 265 | Ga0209564_1003837 | 3300025295 | Bacteria | 9718 |
| 266 | Ga0209564_1003839 | 3300025295 | Bacteria | 9717 |
| 267 | Ga0209564_1004073 | 3300025295 | Bacteria | 9216 |
| 268 | Ga0209050_1000145 | 3300025298 | Bacteria | 168151 |
| 269 | Ga0209050_1007847 | 3300025298 | Bacteria | 5863 |
| 270 | Ga0209050_1012221 | 3300025298 | Bacteria | 3962 |
| 271 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 272 | Ga0209256_1000061 | 3300025299 | Bacteria | 260890 |
| 273 | Ga0209256_1000106 | 3300025299 | Bacteria | 187258 |
| 274 | Ga0209256_1000269 | 3300025299 | Bacteria | 91493 |
| 275 | Ga0209256_1000676 | 3300025299 | Bacteria | 46097 |
| 276 | Ga0209256_1002862 | 3300025299 | Bacteria | 13132 |
| 277 | Ga0209256_1007013 | 3300025299 | Bacteria | 5721 |
| 278 | Ga0207426_1002626 | 3300025302 | Bacteria | 11130 |
| 279 | Ga0209051_1000018 | 3300025303 | Bacteria | 527061 |
| 280 | Ga0209051_1004528 | 3300025303 | Bacteria | 8521 |
| 281 | Ga0209051_1005475 | 3300025303 | Bacteria | 7404 |
| 282 | Ga0209051_1016272 | 3300025303 | Bacteria | 3376 |
| 283 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 284 | Ga0209257_1000084 | 3300025304 | Bacteria | 291502 |
| 285 | Ga0209257_1004271 | 3300025304 | Bacteria | 11259 |
| 286 | Ga0207697_10031970 | 3300025315 | Bacteria | 2153 |
| 287 | Ga0207656_10276333 | 3300025321 | Bacteria | 827 |
| 288 | Ga0207655_1001288 | 3300025728 | Bacteria | 23781 |
| 289 | Ga0207713_1000135 | 3300025735 | Bacteria | 112173 |
| 290 | Ga0207713_1008988 | 3300025735 | Bacteria | 5683 |
| 291 | Ga0207713_1055329 | 3300025735 | Bacteria | 1549 |
| 292 | Ga0207682_10006644 | 3300025893 | Bacteria | 4648 |
| 293 | Ga0207682_10039046 | 3300025893 | Bacteria | 1928 |
| 294 | Ga0207642_10016456 | 3300025899 | Bacteria | 2786 |
| 295 | Ga0207680_10018874 | 3300025903 | Bacteria | 3677 |
| 296 | Ga0207647_10035754 | 3300025904 | Bacteria | 3163 |
| 297 | Ga0207645_10029160 | 3300025907 | Bacteria | 3558 |
| 298 | Ga0207645_10414350 | 3300025907 | Bacteria | 907 |
| 299 | Ga0207643_10097419 | 3300025908 | Bacteria | 1721 |
| 300 | Ga0207705_10106102 | 3300025909 | Bacteria | 2071 |
| 301 | Ga0207705_10191215 | 3300025909 | Bacteria | 1548 |
| 302 | Ga0207654_10289787 | 3300025911 | Bacteria | 1110 |
| 303 | Ga0207695_10009547 | 3300025913 | Bacteria | 11996 |
| 304 | Ga0207695_10010175 | 3300025913 | Bacteria | 11536 |
| 305 | Ga0207695_10032918 | 3300025913 | Bacteria | 5665 |
| 306 | Ga0207695_10079069 | 3300025913 | Bacteria | 3334 |
| 307 | Ga0207671_10033303 | 3300025914 | Bacteria | 3833 |
| 308 | Ga0207662_10002597 | 3300025918 | Bacteria | 9105 |
| 309 | Ga0207657_10149395 | 3300025919 | Bacteria | 1904 |
| 310 | Ga0207649_10252355 | 3300025920 | Bacteria | 1271 |
| 311 | Ga0207681_10008770 | 3300025923 | Bacteria | 6176 |
| 312 | Ga0207681_10184195 | 3300025923 | Bacteria | 1593 |
| 313 | Ga0207694_10059333 | 3300025924 | Bacteria | 2975 |
| 314 | Ga0207650_10350312 | 3300025925 | Bacteria | 1215 |
| 315 | Ga0207659_10032977 | 3300025926 | Bacteria | 3559 |
| 316 | Ga0207659_10038293 | 3300025926 | Bacteria | 3334 |
| 317 | Ga0207687_10034805 | 3300025927 | Bacteria | 3423 |
| 318 | Ga0207644_10048134 | 3300025931 | Bacteria | 3046 |
| 319 | Ga0207690_10004058 | 3300025932 | Bacteria | 8649 |
| 320 | Ga0207690_10507350 | 3300025932 | Bacteria | 976 |
| 321 | Ga0207706_10015322 | 3300025933 | Bacteria | 6930 |
| 322 | Ga0207706_10144106 | 3300025933 | Bacteria | 2096 |
| 323 | Ga0207709_10002721 | 3300025935 | Bacteria | 10914 |
| 324 | Ga0207670_10369958 | 3300025936 | Bacteria | 1139 |
| 325 | Ga0207669_10006656 | 3300025937 | Bacteria | 5296 |
| 326 | Ga0207691_10048281 | 3300025940 | Bacteria | 3904 |
| 327 | Ga0207691_10093888 | 3300025940 | Bacteria | 2685 |
| 328 | Ga0207691_10096426 | 3300025940 | Bacteria | 2644 |
| 329 | Ga0207689_10011506 | 3300025942 | Bacteria | 7583 |
| 330 | Ga0207689_10039908 | 3300025942 | Bacteria | 3886 |
| 331 | Ga0207661_10052657 | 3300025944 | Bacteria | 3253 |
| 332 | Ga0207667_10021476 | 3300025949 | Bacteria | 7152 |
| 333 | Ga0207712_10009755 | 3300025961 | Bacteria | 6084 |
| 334 | Ga0207668_10046072 | 3300025972 | Bacteria | 2977 |
| 335 | Ga0207640_10079351 | 3300025981 | Bacteria | 2237 |
| 336 | Ga0207640_10096861 | 3300025981 | Bacteria | 2058 |
| 337 | Ga0207658_10013291 | 3300025986 | Bacteria | 5622 |
| 338 | Ga0207677_10040223 | 3300026023 | Bacteria | 3080 |
| 339 | Ga0207703_10005816 | 3300026035 | Bacteria | 9879 |
| 340 | Ga0207678_10076301 | 3300026067 | Bacteria | 2871 |
| 341 | Ga0207678_10422419 | 3300026067 | Bacteria | 1156 |
| 342 | Ga0207678_10488071 | 3300026067 | Bacteria | 1073 |
| 343 | Ga0207702_10001261 | 3300026078 | Bacteria | 25509 |
| 344 | Ga0207702_10058186 | 3300026078 | Bacteria | 3288 |
| 345 | Ga0207641_10005241 | 3300026088 | Bacteria | 11086 |
| 346 | Ga0207648_10047299 | 3300026089 | Bacteria | 3772 |
| 347 | Ga0207648_10225905 | 3300026089 | Bacteria | 1665 |
| 348 | Ga0207648_10356977 | 3300026089 | Bacteria | 1318 |
| 349 | Ga0207674_10057723 | 3300026116 | Bacteria | 3935 |
| 350 | Ga0207675_100002925 | 3300026118 | Bacteria | 16801 |
| 351 | Ga0207675_100111936 | 3300026118 | Bacteria | 2576 |
| 352 | Ga0207683_10041387 | 3300026121 | Bacteria | 4024 |
| 353 | Ga0207683_10377001 | 3300026121 | Bacteria | 1304 |
| 354 | Ga0207698_10008917 | 3300026142 | Bacteria | 6359 |
| 355 | Ga0207698_10121456 | 3300026142 | Bacteria | 2212 |
| 356 | Ga0209281_1000103 | 3300027111 | Bacteria | 221425 |
| 357 | Ga0209968_1001095 | 3300027526 | Bacteria | 4135 |
| 358 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 359 | Ga0209282_1000052 | 3300027666 | Bacteria | 104317 |
| 360 | Ga0209966_1000003 | 3300027695 | Bacteria | 111077 |
| 361 | Ga0268266_10176480 | 3300028379 | Bacteria | 1943 |
| 362 | Ga0268264_10001986 | 3300028381 | Bacteria | 18405 |
| 363 | Ga0307515_10000708 | 3300028794 | Bacteria | 76903 |
| 364 | Ga0307515_10013083 | 3300028794 | Bacteria | 15535 |
| 365 | Ga0307515_10470144 | 3300028794 | Bacteria | 870 |
| 366 | Ga0307511_10076838 | 3300030521 | Bacteria | 2383 |
| 367 | Ga0307512_10056000 | 3300030522 | Bacteria | 3102 |
| 368 | Ga0265328_10005685 | 3300031239 | Bacteria | 5326 |
| 369 | Ga0265327_10000479 | 3300031251 | Bacteria | 70467 |
| 370 | Ga0265327_10031415 | 3300031251 | Bacteria | 2984 |
| 371 | Ga0307509_10073712 | 3300031507 | Bacteria | 3554 |
| 372 | Ga0307508_10000169 | 3300031616 | Bacteria | 78769 |
| 373 | Ga0307514_10085435 | 3300031649 | Bacteria | 2319 |
| 374 | Ga0316576_10077095 | 3300031727 | Bacteria | 2468 |
| 375 | Ga0307516_10008972 | 3300031730 | Bacteria | 11204 |
| 376 | Ga0307516_10009988 | 3300031730 | Bacteria | 10508 |
| 377 | Ga0307413_10273545 | 3300031824 | Bacteria | 1266 |
| 378 | Ga0307518_10127414 | 3300031838 | Bacteria | 1794 |
| 379 | Ga0307410_10247607 | 3300031852 | Bacteria | 1384 |
| 380 | Ga0307409_100226671 | 3300031995 | Bacteria | 1691 |
| 381 | Ga0307409_100280086 | 3300031995 | Bacteria | 1541 |
| 382 | Ga0307416_100005407 | 3300032002 | Bacteria | 7838 |
| 383 | Ga0307416_101791783 | 3300032002 | Bacteria | 718 |
| 384 | Ga0307414_10094204 | 3300032004 | Bacteria | 2234 |
| 385 | Ga0307507_10021968 | 3300033179 | Bacteria | 7077 |
| 386 | Ga0316574_0086518 | 3300035398 | Bacteria | 1995 |
| 387 | Ga0373924_0027378 | 3300035410 | Bacteria | 2266 |
| 388 | Ga0373933_0320756 | 3300035724 | Bacteria | 1005 |
| 389 | Ga0373937_0089551 | 3300036401 | Bacteria | 2849 |
| 390 | Ga0373937_0468785 | 3300036401 | Bacteria | 1196 |
| 391 | Ga0395899_0001064 | 3300037312 | Bacteria | 24780 |
| 392 | Ga0395899_0002813 | 3300037312 | Bacteria | 14019 |
| 393 | Ga0395899_0003608 | 3300037312 | Bacteria | 12242 |
| 394 | Ga0395900_0000131 | 3300037418 | Bacteria | 125554 |
| 395 | Ga0395900_0005698 | 3300037418 | Bacteria | 13021 |
| 396 | Ga0395900_0283273 | 3300037418 | Bacteria | 1648 |
| 397 | Ga0395898_0001532 | 3300037466 | Bacteria | 31823 |
| 398 | Ga0395898_0097883 | 3300037466 | Bacteria | 2817 |
| 399 | Ga0395905_0000750 | 3300037471 | Bacteria | 42802 |
| 400 | Ga0395905_0017710 | 3300037471 | Bacteria | 6763 |
| 401 | Ga0395905_0025730 | 3300037471 | Bacteria | 5549 |
| 402 | Ga0395905_0028213 | 3300037471 | Bacteria | 5291 |
| 403 | Ga0395905_0063403 | 3300037471 | Bacteria | 3458 |
| 404 | Ga0395905_0208288 | 3300037471 | Bacteria | 1832 |
| 405 | Ga0395901_0000002 | 3300038443 | Bacteria | 761045 |
| 406 | Ga0395901_0001718 | 3300038443 | Bacteria | 22613 |
| 407 | Ga0395901_0136559 | 3300038443 | Bacteria | 2577 |
| 408 | Ga0395901_1173314 | 3300038443 | Bacteria | 735 |
| 409 | Ga0436361_0144599 | 3300039447 | Bacteria | 904 |
| 410 | Ga0436361_0338967 | 3300039447 | Bacteria | 4771 |
| 411 | Ga0436361_0600769 | 3300039447 | Bacteria | 3349 |
| 412 | Ga0436361_0846070 | 3300039447 | Bacteria | 4410 |
| 413 | Ga0439461_0030468 | 3300041410 | Bacteria | 1122 |
| 414 | Ga0439465_0120827 | 3300041413 | Bacteria | 918 |
| 415 | Ga0451789_0491830 | 3300041443 | Bacteria | 1054 |
| 416 | Ga0451795_0419335 | 3300041456 | Bacteria | 1283 |
| 417 | Ga0451802_0970336 | 3300041460 | Bacteria | 1525 |
| 418 | Ga0451835_0864634 | 3300041492 | Bacteria | 979 |
| 419 | Ga0451839_0718016 | 3300041496 | Bacteria | 862 |
| 420 | Ga0451849_0077297 | 3300041505 | Bacteria | 878 |
| 421 | Ga0451851_0770517 | 3300041507 | Bacteria | 1466 |
| 422 | Ga0451843_0223084 | 3300041509 | Bacteria | 989 |
| 423 | Ga0439431_0031742 | 3300041997 | Bacteria | 1314 |
| 424 | Ga0439450_007594 | 3300042008 | Bacteria | 1993 |
| 425 | Ga0450906_010415 | 3300042145 | Bacteria | 1759 |
| 426 | Ga0439446_0014983 | 3300042156 | Bacteria | 2146 |
| 427 | Ga0439434_0039325 | 3300042435 | Bacteria | 1451 |
| 428 | Ga0439460_0095082 | 3300042461 | Bacteria | 951 |
| 429 | Ga0450918_001746 | 3300042531 | Bacteria | 4228 |
| 430 | Ga0451577_0091368 | 3300042876 | Bacteria | 2717 |
| 431 | Ga0451577_0751880 | 3300042876 | Bacteria | 882 |
| 432 | Ga0466969_0058160 | 3300044656 | Bacteria | 1882 |
| 433 | Ga0466972_0000088 | 3300044658 | Bacteria | 84167 |
| 434 | Ga0466972_0022575 | 3300044658 | Bacteria | 3132 |
| 435 | Ga0466978_0109275 | 3300044671 | Bacteria | 1714 |
| 436 | Ga0466965_0000666 | 3300044683 | Bacteria | 12609 |
| 437 | Ga0466965_0002051 | 3300044683 | Bacteria | 8434 |
| 438 | Ga0466966_0000687 | 3300044684 | Bacteria | 21520 |
| 439 | Ga0466966_0006128 | 3300044684 | Bacteria | 7946 |
| 440 | Ga0466966_0089471 | 3300044684 | Bacteria | 1912 |
| 441 | Ga0466961_0001458 | 3300044693 | Bacteria | 14699 |
| 442 | Ga0466961_0007342 | 3300044693 | Bacteria | 7013 |
| 443 | Ga0466961_0018736 | 3300044693 | Bacteria | 4453 |
| 444 | Ga0466963_0027945 | 3300044694 | Bacteria | 3616 |
| 445 | Ga0466963_0047308 | 3300044694 | Bacteria | 2839 |
| 446 | Ga0466964_0002548 | 3300044706 | Bacteria | 6493 |
| 447 | Ga0466964_0002848 | 3300044706 | Bacteria | 6238 |
| 448 | Ga0466964_0025767 | 3300044706 | Bacteria | 2298 |
| 449 | Ga0466964_0040051 | 3300044706 | Bacteria | 1890 |
| 450 | Ga0466964_0056879 | 3300044706 | Bacteria | 1618 |
| 451 | Ga0466964_0113758 | 3300044706 | Bacteria | 1210 |
| 452 | Ga0453684_0023234 | 3300044712 | Bacteria | 9147 |
| 453 | Ga0466971_0005142 | 3300044719 | Bacteria | 5665 |
| 454 | Ga0466971_0007302 | 3300044719 | Bacteria | 4811 |
| 455 | Ga0466971_0017715 | 3300044719 | Bacteria | 3154 |
| 456 | Ga0466971_0052756 | 3300044719 | Bacteria | 1832 |
| 457 | Ga0466968_0063481 | 3300044735 | Bacteria | 1596 |
| 458 | Ga0466970_0007806 | 3300044765 | Bacteria | 5370 |
| 459 | Ga0466970_0028412 | 3300044765 | Bacteria | 2938 |
| 460 | Ga0466970_0031025 | 3300044765 | Bacteria | 2821 |
| 461 | Ga0466957_0047867 | 3300044842 | Bacteria | 2598 |
| 462 | Ga0466957_0164008 | 3300044842 | Bacteria | 1444 |
| 463 | Ga0466957_0192226 | 3300044842 | Bacteria | 1337 |
| 464 | Ga0466960_0026488 | 3300044901 | Bacteria | 2634 |
| 465 | Ga0466959_0000287 | 3300045049 | Bacteria | 30550 |
| 466 | Ga0466959_0009422 | 3300045049 | Bacteria | 6947 |
| 467 | Ga0466959_0052023 | 3300045049 | Bacteria | 3001 |
| 468 | Ga0466959_0081458 | 3300045049 | Bacteria | 2332 |
| 469 | Ga0451576_0074320 | 3300045051 | Bacteria | 3537 |
| 470 | Ga0451576_0194483 | 3300045051 | Bacteria | 2118 |
| 471 | Ga0466958_0011505 | 3300045836 | Bacteria | 4983 |
| 472 | Ga0466958_0587412 | 3300045836 | Bacteria | 724 |
| 473 | Ga0466967_0024766 | 3300045976 | Bacteria | 4939 |
| 474 | Ga0466967_0090776 | 3300045976 | Bacteria | 2775 |
| 475 | Ga0466967_0141742 | 3300045976 | Bacteria | 2239 |
| 476 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 477 | Ga0495617_041726 | 3300046452 | Bacteria | 1533 |
| 478 | Ga0495617_085942 | 3300046452 | Bacteria | 1028 |
| 479 | Ga0495627_000207 | 3300046453 | Bacteria | 63763 |
| 480 | Ga0495627_042518 | 3300046453 | Bacteria | 1392 |
| 481 | Ga0495627_046735 | 3300046453 | Bacteria | 1314 |
| 482 | Ga0495592_0030409 | 3300046454 | Bacteria | 4085 |
| 483 | Ga0495592_0100052 | 3300046454 | Bacteria | 2067 |
| 484 | Ga0495603_0106430 | 3300046455 | Bacteria | 1636 |
| 485 | Ga0495603_0364263 | 3300046455 | Bacteria | 829 |
| 486 | Ga0495590_0000025 | 3300046457 | Bacteria | 165221 |
| 487 | Ga0495590_0018282 | 3300046457 | Bacteria | 2510 |
| 488 | Ga0495590_0021071 | 3300046457 | Bacteria | 2312 |
| 489 | Ga0495590_0054003 | 3300046457 | Bacteria | 1403 |
| 490 | Ga0495591_002755 | 3300046458 | Bacteria | 9489 |
| 491 | Ga0495629_0000878 | 3300046459 | Bacteria | 24225 |
| 492 | Ga0495629_0005319 | 3300046459 | Bacteria | 9625 |
| 493 | Ga0495638_0013390 | 3300046460 | Bacteria | 5585 |
| 494 | Ga0495638_0016484 | 3300046460 | Bacteria | 4948 |
| 495 | Ga0495638_0035516 | 3300046460 | Bacteria | 3177 |
| 496 | Ga0495638_0073932 | 3300046460 | Bacteria | 2079 |
| 497 | Ga0495638_0244567 | 3300046460 | Bacteria | 992 |
| 498 | Ga0495651_0100121 | 3300046462 | Bacteria | 2159 |
| 499 | Ga0495651_0134207 | 3300046462 | Bacteria | 1803 |
| 500 | Ga0495651_0351245 | 3300046462 | Bacteria | 974 |
| 501 | Ga0495653_0005181 | 3300046463 | Bacteria | 10598 |
| 502 | Ga0495653_0007366 | 3300046463 | Bacteria | 9015 |
| 503 | Ga0495653_0061355 | 3300046463 | Bacteria | 2845 |
| 504 | Ga0495653_0105341 | 3300046463 | Bacteria | 2036 |
| 505 | Ga0495653_0132732 | 3300046463 | Bacteria | 1760 |
| 506 | Ga0495650_0000015 | 3300046471 | Bacteria | 557595 |
| 507 | Ga0495650_0005573 | 3300046471 | Bacteria | 8121 |
| 508 | Ga0495650_0006345 | 3300046471 | Bacteria | 7391 |
| 509 | Ga0495650_0007195 | 3300046471 | Bacteria | 6744 |
| 510 | Ga0495650_0008662 | 3300046471 | Bacteria | 5893 |
| 511 | Ga0495650_0009150 | 3300046471 | Bacteria | 5673 |
| 512 | Ga0495580_0016442 | 3300046472 | Bacteria | 5551 |
| 513 | Ga0495580_0020600 | 3300046472 | Bacteria | 4878 |
| 514 | Ga0495580_0023359 | 3300046472 | Bacteria | 4542 |
| 515 | Ga0495580_0050910 | 3300046472 | Bacteria | 2928 |
| 516 | Ga0495580_0115644 | 3300046472 | Bacteria | 1863 |
| 517 | Ga0495580_0699376 | 3300046472 | Bacteria | 663 |
| 518 | Ga0495582_0002333 | 3300046473 | Bacteria | 10632 |
| 519 | Ga0495582_0027681 | 3300046473 | Bacteria | 3109 |
| 520 | Ga0495582_0044024 | 3300046473 | Bacteria | 2458 |
| 521 | Ga0495605_0001284 | 3300046474 | Bacteria | 16646 |
| 522 | Ga0495605_0003031 | 3300046474 | Bacteria | 10141 |
| 523 | Ga0495605_0012486 | 3300046474 | Bacteria | 4711 |
| 524 | Ga0495605_0025196 | 3300046474 | Bacteria | 3101 |
| 525 | Ga0495605_0026070 | 3300046474 | Bacteria | 3040 |
| 526 | Ga0495605_0240640 | 3300046474 | Bacteria | 777 |
| 527 | Ga0495662_0386912 | 3300046476 | Bacteria | 687 |
| 528 | Ga0495664_0019005 | 3300046477 | Bacteria | 3946 |
| 529 | Ga0495664_0495309 | 3300046477 | Bacteria | 730 |
| 530 | Ga0495584_0000070 | 3300046491 | Bacteria | 73237 |
| 531 | Ga0495584_0000560 | 3300046491 | Bacteria | 25087 |
| 532 | Ga0495584_0004898 | 3300046491 | Bacteria | 7146 |
| 533 | Ga0495584_0005783 | 3300046491 | Bacteria | 6521 |
| 534 | Ga0495584_0007322 | 3300046491 | Bacteria | 5754 |
| 535 | Ga0495584_0009129 | 3300046491 | Bacteria | 5119 |
| 536 | Ga0495584_0288096 | 3300046491 | Bacteria | 834 |
| 537 | Ga0495585_0000006 | 3300046492 | Bacteria | 320556 |
| 538 | Ga0495585_0006233 | 3300046492 | Bacteria | 7430 |
| 539 | Ga0495585_0006865 | 3300046492 | Bacteria | 7017 |
| 540 | Ga0495585_0010286 | 3300046492 | Bacteria | 5578 |
| 541 | Ga0495585_0010483 | 3300046492 | Bacteria | 5512 |
| 542 | Ga0495585_0013461 | 3300046492 | Bacteria | 4786 |
| 543 | Ga0495585_0026665 | 3300046492 | Bacteria | 3300 |
| 544 | Ga0495585_0030854 | 3300046492 | Bacteria | 3047 |
| 545 | Ga0495585_0032874 | 3300046492 | Bacteria | 2937 |
| 546 | Ga0495585_0034744 | 3300046492 | Bacteria | 2850 |
| 547 | Ga0495585_0059514 | 3300046492 | Bacteria | 2104 |
| 548 | Ga0495585_0068952 | 3300046492 | Bacteria | 1930 |
| 549 | Ga0495585_0154537 | 3300046492 | Bacteria | 1194 |
| 550 | Ga0495585_0193122 | 3300046492 | Bacteria | 1040 |
| 551 | Ga0495594_0003640 | 3300046499 | Bacteria | 7930 |
| 552 | Ga0495594_0005742 | 3300046499 | Bacteria | 6374 |
| 553 | Ga0495594_0013918 | 3300046499 | Bacteria | 4209 |
| 554 | Ga0495594_0030537 | 3300046499 | Bacteria | 2917 |
| 555 | Ga0495594_0069416 | 3300046499 | Bacteria | 1957 |
| 556 | Ga0495596_0000240 | 3300046500 | Bacteria | 37159 |
| 557 | Ga0495596_0001004 | 3300046500 | Bacteria | 16768 |
| 558 | Ga0495596_0001839 | 3300046500 | Bacteria | 11778 |
| 559 | Ga0495596_0008211 | 3300046500 | Bacteria | 4655 |
| 560 | Ga0495596_0008902 | 3300046500 | Bacteria | 4440 |
| 561 | Ga0495596_0009505 | 3300046500 | Bacteria | 4274 |
| 562 | Ga0495596_0011786 | 3300046500 | Bacteria | 3754 |
| 563 | Ga0495596_0012683 | 3300046500 | Bacteria | 3598 |
| 564 | Ga0495596_0031054 | 3300046500 | Bacteria | 2136 |
| 565 | Ga0495596_0033692 | 3300046500 | Bacteria | 2038 |
| 566 | Ga0495596_0041071 | 3300046500 | Bacteria | 1824 |
| 567 | Ga0495596_0070668 | 3300046500 | Bacteria | 1356 |
| 568 | Ga0495596_0196268 | 3300046500 | Bacteria | 784 |
| 569 | Ga0495607_0002594 | 3300046501 | Bacteria | 14550 |
| 570 | Ga0495607_0004085 | 3300046501 | Bacteria | 10913 |
| 571 | Ga0495607_0005057 | 3300046501 | Bacteria | 9558 |
| 572 | Ga0495607_0009947 | 3300046501 | Bacteria | 6404 |
| 573 | Ga0495607_0014386 | 3300046501 | Bacteria | 5152 |
| 574 | Ga0495607_0017453 | 3300046501 | Bacteria | 4607 |
| 575 | Ga0495607_0031280 | 3300046501 | Bacteria | 3259 |
| 576 | Ga0495607_0046605 | 3300046501 | Bacteria | 2544 |
| 577 | Ga0495607_0068424 | 3300046501 | Bacteria | 1991 |
| 578 | Ga0495607_0106432 | 3300046501 | Bacteria | 1493 |
| 579 | Ga0495607_0117837 | 3300046501 | Bacteria | 1398 |
| 580 | Ga0495607_0307808 | 3300046501 | Bacteria | 743 |
| 581 | Ga0495583_0000056 | 3300046506 | Bacteria | 200858 |
| 582 | Ga0495583_0000159 | 3300046506 | Bacteria | 113627 |
| 583 | Ga0495583_0000372 | 3300046506 | Bacteria | 69750 |
| 584 | Ga0495583_0000382 | 3300046506 | Bacteria | 68388 |
| 585 | Ga0495583_0000864 | 3300046506 | Bacteria | 36820 |
| 586 | Ga0495583_0002345 | 3300046506 | Bacteria | 16395 |
| 587 | Ga0495583_0004885 | 3300046506 | Bacteria | 9353 |
| 588 | Ga0495583_0023202 | 3300046506 | Bacteria | 3144 |
| 589 | Ga0495583_0056880 | 3300046506 | Bacteria | 1761 |
| 590 | Ga0495583_0101613 | 3300046506 | Bacteria | 1226 |
| 591 | Ga0495583_0167063 | 3300046506 | Bacteria | 905 |
| 592 | Ga0495583_0209989 | 3300046506 | Bacteria | 789 |
| 593 | Ga0495606_0002998 | 3300046507 | Bacteria | 18539 |
| 594 | Ga0495606_0004210 | 3300046507 | Bacteria | 14562 |
| 595 | Ga0495606_0013849 | 3300046507 | Bacteria | 6332 |
| 596 | Ga0495606_0038316 | 3300046507 | Bacteria | 3244 |
| 597 | Ga0495606_0039674 | 3300046507 | Bacteria | 3169 |
| 598 | Ga0495606_0041103 | 3300046507 | Bacteria | 3102 |
| 599 | Ga0495606_0133232 | 3300046507 | Bacteria | 1475 |
| 600 | Ga0495606_0133665 | 3300046507 | Bacteria | 1472 |
| 601 | Ga0495606_0306052 | 3300046507 | Bacteria | 859 |
| 602 | Ga0495608_0072156 | 3300046511 | Bacteria | 2252 |
| 603 | Ga0495610_0004511 | 3300046512 | Bacteria | 10257 |
| 604 | Ga0495610_0006028 | 3300046512 | Bacteria | 8463 |
| 605 | Ga0495610_0020472 | 3300046512 | Bacteria | 3673 |
| 606 | Ga0495610_0035172 | 3300046512 | Bacteria | 2574 |
| 607 | Ga0495616_0000057 | 3300046513 | Bacteria | 100806 |
| 608 | Ga0495616_0003140 | 3300046513 | Bacteria | 10676 |
| 609 | Ga0495616_0004533 | 3300046513 | Bacteria | 8746 |
| 610 | Ga0495616_0010511 | 3300046513 | Bacteria | 5355 |
| 611 | Ga0495616_0015188 | 3300046513 | Bacteria | 4284 |
| 612 | Ga0495616_0015417 | 3300046513 | Bacteria | 4251 |
| 613 | Ga0495616_0015591 | 3300046513 | Bacteria | 4222 |
| 614 | Ga0495616_0028366 | 3300046513 | Bacteria | 2964 |
| 615 | Ga0495616_0031036 | 3300046513 | Bacteria | 2802 |
| 616 | Ga0495616_0101666 | 3300046513 | Bacteria | 1347 |
| 617 | Ga0495620_0030549 | 3300046515 | Bacteria | 2479 |
| 618 | Ga0495620_0041244 | 3300046515 | Bacteria | 2026 |
| 619 | Ga0495620_0049470 | 3300046515 | Bacteria | 1798 |
| 620 | Ga0495620_0049791 | 3300046515 | Bacteria | 1790 |
| 621 | Ga0495628_0029302 | 3300046516 | Bacteria | 4464 |
| 622 | Ga0495628_0079729 | 3300046516 | Bacteria | 2545 |
| 623 | Ga0495630_0044173 | 3300046517 | Bacteria | 3329 |
| 624 | Ga0495630_0058357 | 3300046517 | Bacteria | 2893 |
| 625 | Ga0495631_0002820 | 3300046518 | Bacteria | 9652 |
| 626 | Ga0495631_0003219 | 3300046518 | Bacteria | 8985 |
| 627 | Ga0495631_0005293 | 3300046518 | Bacteria | 6776 |
| 628 | Ga0495631_0012520 | 3300046518 | Bacteria | 4139 |
| 629 | Ga0495631_0014987 | 3300046518 | Bacteria | 3727 |
| 630 | Ga0495631_0015637 | 3300046518 | Bacteria | 3630 |
| 631 | Ga0495631_0015837 | 3300046518 | Bacteria | 3604 |
| 632 | Ga0495631_0016374 | 3300046518 | Bacteria | 3536 |
| 633 | Ga0495631_0021138 | 3300046518 | Bacteria | 3032 |
| 634 | Ga0495631_0030586 | 3300046518 | Bacteria | 2441 |
| 635 | Ga0495631_0045981 | 3300046518 | Bacteria | 1920 |
| 636 | Ga0495631_0144685 | 3300046518 | Bacteria | 1020 |
| 637 | Ga0495631_0181164 | 3300046518 | Bacteria | 902 |
| 638 | Ga0495632_0000129 | 3300046519 | Bacteria | 77134 |
| 639 | Ga0495632_0000296 | 3300046519 | Bacteria | 48157 |
| 640 | Ga0495632_0000375 | 3300046519 | Bacteria | 42575 |
| 641 | Ga0495632_0008199 | 3300046519 | Bacteria | 6452 |
| 642 | Ga0495632_0022106 | 3300046519 | Bacteria | 3415 |
| 643 | Ga0495632_0022797 | 3300046519 | Bacteria | 3351 |
| 644 | Ga0495632_0025075 | 3300046519 | Bacteria | 3158 |
| 645 | Ga0495632_0026117 | 3300046519 | Bacteria | 3078 |
| 646 | Ga0495637_0000126 | 3300046520 | Bacteria | 57018 |
| 647 | Ga0495637_0023626 | 3300046520 | Bacteria | 2790 |
| 648 | Ga0495637_0070124 | 3300046520 | Bacteria | 1416 |
| 649 | Ga0495643_0000415 | 3300046522 | Bacteria | 55824 |
| 650 | Ga0495643_0011985 | 3300046522 | Bacteria | 5248 |
| 651 | Ga0495643_0026575 | 3300046522 | Bacteria | 3264 |
| 652 | Ga0495643_0031662 | 3300046522 | Bacteria | 2942 |
| 653 | Ga0495643_0048513 | 3300046522 | Bacteria | 2294 |
| 654 | Ga0495643_0095437 | 3300046522 | Bacteria | 1529 |
| 655 | Ga0495643_0125066 | 3300046522 | Bacteria | 1295 |
| 656 | Ga0495643_0313931 | 3300046522 | Bacteria | 710 |
| 657 | Ga0495644_0000389 | 3300046523 | Bacteria | 19747 |
| 658 | Ga0495644_0001948 | 3300046523 | Bacteria | 8291 |
| 659 | Ga0495644_0003401 | 3300046523 | Bacteria | 6293 |
| 660 | Ga0495644_0003438 | 3300046523 | Bacteria | 6265 |
| 661 | Ga0495644_0007023 | 3300046523 | Bacteria | 4355 |
| 662 | Ga0495644_0007542 | 3300046523 | Bacteria | 4194 |
| 663 | Ga0495644_0009481 | 3300046523 | Bacteria | 3752 |
| 664 | Ga0495644_0013643 | 3300046523 | Bacteria | 3117 |
| 665 | Ga0495648_0000708 | 3300046524 | Bacteria | 35539 |
| 666 | Ga0495648_0001488 | 3300046524 | Bacteria | 22912 |
| 667 | Ga0495648_0007168 | 3300046524 | Bacteria | 8955 |
| 668 | Ga0495648_0011619 | 3300046524 | Bacteria | 6616 |
| 669 | Ga0495648_0036925 | 3300046524 | Bacteria | 3144 |
| 670 | Ga0495648_0038209 | 3300046524 | Bacteria | 3074 |
| 671 | Ga0495648_0048317 | 3300046524 | Bacteria | 2620 |
| 672 | Ga0495648_0085064 | 3300046524 | Bacteria | 1788 |
| 673 | Ga0495648_0165099 | 3300046524 | Bacteria | 1140 |
| 674 | Ga0495648_0215620 | 3300046524 | Bacteria | 950 |
| 675 | Ga0495663_0002556 | 3300046525 | Bacteria | 5436 |
| 676 | Ga0495663_0017672 | 3300046525 | Bacteria | 2026 |
| 677 | Ga0495663_0086948 | 3300046525 | Bacteria | 1014 |
| 678 | Ga0495666_0000318 | 3300046526 | Bacteria | 20936 |
| 679 | Ga0495666_0000556 | 3300046526 | Bacteria | 16645 |
| 680 | Ga0495666_0008615 | 3300046526 | Bacteria | 5110 |
| 681 | Ga0495666_0018785 | 3300046526 | Bacteria | 3434 |
| 682 | Ga0495666_0039750 | 3300046526 | Bacteria | 2282 |
| 683 | Ga0495666_0046494 | 3300046526 | Bacteria | 2092 |
| 684 | Ga0495642_0000613 | 3300046528 | Bacteria | 17935 |
| 685 | Ga0495642_0004874 | 3300046528 | Bacteria | 5186 |
| 686 | Ga0495642_0007226 | 3300046528 | Bacteria | 4262 |
| 687 | Ga0495642_0009239 | 3300046528 | Bacteria | 3774 |
| 688 | Ga0495642_0011089 | 3300046528 | Bacteria | 3456 |
| 689 | Ga0495642_0012989 | 3300046528 | Bacteria | 3215 |
| 690 | Ga0495642_0016483 | 3300046528 | Bacteria | 2880 |
| 691 | Ga0495642_0041624 | 3300046528 | Bacteria | 1869 |
| 692 | Ga0495642_0066401 | 3300046528 | Bacteria | 1503 |
| 693 | Ga0495642_0069897 | 3300046528 | Bacteria | 1467 |
| 694 | Ga0495652_0001577 | 3300046529 | Bacteria | 24927 |
| 695 | Ga0495654_0000381 | 3300046530 | Bacteria | 38197 |
| 696 | Ga0495654_0004611 | 3300046530 | Bacteria | 8134 |
| 697 | Ga0495654_0018761 | 3300046530 | Bacteria | 3621 |
| 698 | Ga0495654_0028918 | 3300046530 | Bacteria | 2830 |
| 699 | Ga0495654_0107634 | 3300046530 | Bacteria | 1275 |
| 700 | Ga0495654_0198012 | 3300046530 | Bacteria | 861 |
| 701 | Ga0495665_0020210 | 3300046531 | Bacteria | 3578 |
| 702 | Ga0495665_0049520 | 3300046531 | Bacteria | 2227 |
| 703 | Ga0495665_0060088 | 3300046531 | Bacteria | 2006 |
| 704 | Ga0495640_0017736 | 3300046533 | Bacteria | 5297 |
| 705 | Ga0495586_0009827 | 3300046535 | Bacteria | 5093 |
| 706 | Ga0495586_0012802 | 3300046535 | Bacteria | 4445 |
| 707 | Ga0495586_0024342 | 3300046535 | Bacteria | 3236 |
| 708 | Ga0495586_0152531 | 3300046535 | Bacteria | 1300 |
| 709 | Ga0495587_0243573 | 3300046536 | Bacteria | 1012 |
| 710 | Ga0495609_0001536 | 3300046538 | Bacteria | 15150 |
| 711 | Ga0495609_0003404 | 3300046538 | Bacteria | 9126 |
| 712 | Ga0495609_0003442 | 3300046538 | Bacteria | 9060 |
| 713 | Ga0495609_0004070 | 3300046538 | Bacteria | 8147 |
| 714 | Ga0495609_0004682 | 3300046538 | Bacteria | 7411 |
| 715 | Ga0495609_0015930 | 3300046538 | Bacteria | 3509 |
| 716 | Ga0495609_0016433 | 3300046538 | Bacteria | 3448 |
| 717 | Ga0495609_0021815 | 3300046538 | Bacteria | 2954 |
| 718 | Ga0495609_0029412 | 3300046538 | Bacteria | 2502 |
| 719 | Ga0495609_0033768 | 3300046538 | Bacteria | 2321 |
| 720 | Ga0495609_0048047 | 3300046538 | Bacteria | 1908 |
| 721 | Ga0495609_0065495 | 3300046538 | Bacteria | 1601 |
| 722 | Ga0495609_0099802 | 3300046538 | Bacteria | 1258 |
| 723 | Ga0495621_0003776 | 3300046539 | Bacteria | 4199 |
| 724 | Ga0495597_0001388 | 3300046542 | Bacteria | 17478 |
| 725 | Ga0495597_0002423 | 3300046542 | Bacteria | 11849 |
| 726 | Ga0495597_0003311 | 3300046542 | Bacteria | 9513 |
| 727 | Ga0495597_0005681 | 3300046542 | Bacteria | 6565 |
| 728 | Ga0495597_0009715 | 3300046542 | Bacteria | 4739 |
| 729 | Ga0495597_0010710 | 3300046542 | Bacteria | 4471 |
| 730 | Ga0495597_0035088 | 3300046542 | Bacteria | 2264 |
| 731 | Ga0495597_0038705 | 3300046542 | Bacteria | 2137 |
| 732 | Ga0495597_0171388 | 3300046542 | Bacteria | 881 |
| 733 | Ga0495597_0219965 | 3300046542 | Bacteria | 754 |
| 734 | Ga0495645_0037487 | 3300046543 | Bacteria | 3534 |
| 735 | Ga0495645_0211290 | 3300046543 | Bacteria | 1310 |
| 736 | Ga0495645_0392211 | 3300046543 | Bacteria | 886 |
| 737 | Ga0495622_0000064 | 3300046557 | Bacteria | 93789 |
| 738 | Ga0495622_0000570 | 3300046557 | Bacteria | 22156 |
| 739 | Ga0495622_0006368 | 3300046557 | Bacteria | 5479 |
| 740 | Ga0495622_0032190 | 3300046557 | Bacteria | 2448 |
| 741 | Ga0495622_0054258 | 3300046557 | Bacteria | 1860 |
| 742 | Ga0495622_0102906 | 3300046557 | Bacteria | 1308 |
| 743 | Ga0495633_0003338 | 3300046558 | Bacteria | 10778 |
| 744 | Ga0495633_0004954 | 3300046558 | Bacteria | 8314 |
| 745 | Ga0495633_0008291 | 3300046558 | Bacteria | 5875 |
| 746 | Ga0495633_0032773 | 3300046558 | Bacteria | 2508 |
| 747 | Ga0495633_0034346 | 3300046558 | Bacteria | 2440 |
| 748 | Ga0495633_0060270 | 3300046558 | Bacteria | 1778 |
| 749 | Ga0495633_0065743 | 3300046558 | Bacteria | 1694 |
| 750 | Ga0495633_0079803 | 3300046558 | Bacteria | 1523 |
| 751 | Ga0495633_0115881 | 3300046558 | Bacteria | 1241 |
| 752 | Ga0495633_0260102 | 3300046558 | Bacteria | 791 |
| 753 | Ga0495656_0002704 | 3300046615 | Bacteria | 5923 |
| 754 | Ga0495656_0017670 | 3300046615 | Bacteria | 2724 |
| 755 | Ga0495656_0040418 | 3300046615 | Bacteria | 1943 |
| 756 | Ga0495656_0044093 | 3300046615 | Bacteria | 1876 |
| 757 | Ga0495656_0073514 | 3300046615 | Bacteria | 1525 |
| 758 | Ga0495656_0300791 | 3300046615 | Bacteria | 822 |
| 759 | Ga0495656_0386048 | 3300046615 | Bacteria | 730 |
| 760 | Ga0495668_0000025 | 3300046616 | Bacteria | 304546 |
| 761 | Ga0495668_0000544 | 3300046616 | Bacteria | 46835 |
| 762 | Ga0495668_0000578 | 3300046616 | Bacteria | 44611 |
| 763 | Ga0495668_0003733 | 3300046616 | Bacteria | 11198 |
| 764 | Ga0495668_0021923 | 3300046616 | Bacteria | 3655 |
| 765 | Ga0495668_0029684 | 3300046616 | Bacteria | 3088 |
| 766 | Ga0495668_0034704 | 3300046616 | Bacteria | 2828 |
| 767 | Ga0495668_0045031 | 3300046616 | Bacteria | 2452 |
| 768 | Ga0495668_0055234 | 3300046616 | Bacteria | 2193 |
| 769 | Ga0495668_0066242 | 3300046616 | Bacteria | 1987 |
| 770 | Ga0495634_0053681 | 3300046642 | Bacteria | 2699 |
| 771 | Ga0495634_0369017 | 3300046642 | Bacteria | 857 |
| 772 | Ga0495611_0000946 | 3300046648 | Bacteria | 15555 |
| 773 | Ga0495611_0003308 | 3300046648 | Bacteria | 7123 |
| 774 | Ga0495611_0011108 | 3300046648 | Bacteria | 3814 |
| 775 | Ga0495611_0012399 | 3300046648 | Bacteria | 3624 |
| 776 | Ga0495611_0025380 | 3300046648 | Bacteria | 2582 |
| 777 | Ga0495611_0030378 | 3300046648 | Bacteria | 2375 |
| 778 | Ga0495611_0033374 | 3300046648 | Bacteria | 2270 |
| 779 | Ga0495611_0101818 | 3300046648 | Bacteria | 1334 |
| 780 | Ga0495611_0125987 | 3300046648 | Bacteria | 1194 |
| 781 | Ga0495625_0004296 | 3300046660 | Bacteria | 13552 |
| 782 | Ga0495625_0004306 | 3300046660 | Bacteria | 13526 |
| 783 | Ga0495625_0026121 | 3300046660 | Bacteria | 4416 |
| 784 | Ga0495625_0029610 | 3300046660 | Bacteria | 4091 |
| 785 | Ga0495625_0040181 | 3300046660 | Bacteria | 3414 |
| 786 | Ga0495625_0051408 | 3300046660 | Bacteria | 2954 |
| 787 | Ga0495625_0052327 | 3300046660 | Bacteria | 2925 |
| 788 | Ga0495625_0129530 | 3300046660 | Bacteria | 1710 |
| 789 | Ga0495625_0155060 | 3300046660 | Bacteria | 1537 |
| 790 | Ga0495625_0179307 | 3300046660 | Bacteria | 1410 |
| 791 | Ga0495625_0249643 | 3300046660 | Bacteria | 1152 |
| 792 | Ga0495635_0001292 | 3300046663 | Bacteria | 16730 |
| 793 | Ga0495635_0015435 | 3300046663 | Bacteria | 5341 |
| 794 | Ga0495635_0121076 | 3300046663 | Bacteria | 1785 |
| 795 | Ga0495635_0246513 | 3300046663 | Bacteria | 1205 |
| 796 | Ga0495659_0000526 | 3300046664 | Bacteria | 14120 |
| 797 | Ga0495659_0000919 | 3300046664 | Bacteria | 10459 |
| 798 | Ga0495659_0008635 | 3300046664 | Bacteria | 3243 |
| 799 | Ga0495659_0013224 | 3300046664 | Bacteria | 2686 |
| 800 | Ga0495659_0316897 | 3300046664 | Bacteria | 661 |
| 801 | Ga0495661_0002258 | 3300046665 | Bacteria | 14917 |
| 802 | Ga0495661_0004930 | 3300046665 | Bacteria | 9550 |
| 803 | Ga0495661_0009057 | 3300046665 | Bacteria | 6849 |
| 804 | Ga0495661_0016750 | 3300046665 | Bacteria | 4849 |
| 805 | Ga0495661_0023263 | 3300046665 | Bacteria | 4022 |
| 806 | Ga0495661_0024203 | 3300046665 | Bacteria | 3931 |
| 807 | Ga0495661_0038868 | 3300046665 | Bacteria | 2961 |
| 808 | Ga0495661_0051612 | 3300046665 | Bacteria | 2482 |
| 809 | Ga0495661_0063697 | 3300046665 | Bacteria | 2178 |
| 810 | Ga0495661_0088267 | 3300046665 | Bacteria | 1770 |
| 811 | Ga0495661_0100596 | 3300046665 | Bacteria | 1627 |
| 812 | Ga0495661_0103250 | 3300046665 | Bacteria | 1600 |
| 813 | Ga0495661_0110688 | 3300046665 | Bacteria | 1531 |
| 814 | Ga0495661_0168146 | 3300046665 | Bacteria | 1171 |
| 815 | Ga0495661_0175233 | 3300046665 | Bacteria | 1140 |
| 816 | Ga0495661_0218012 | 3300046665 | Bacteria | 990 |
| 817 | Ga0495661_0316595 | 3300046665 | Bacteria | 776 |
| 818 | Ga0495588_0003376 | 3300046674 | Bacteria | 6937 |
| 819 | Ga0495588_0024317 | 3300046674 | Bacteria | 3008 |
| 820 | Ga0495588_0036417 | 3300046674 | Bacteria | 2496 |
| 821 | Ga0495588_0046183 | 3300046674 | Bacteria | 2233 |
| 822 | Ga0495588_0096087 | 3300046674 | Bacteria | 1554 |
| 823 | Ga0495588_0166293 | 3300046674 | Bacteria | 1166 |
| 824 | Ga0495588_0189117 | 3300046674 | Bacteria | 1087 |
| 825 | Ga0495599_0008525 | 3300046678 | Bacteria | 6237 |
| 826 | Ga0495599_0175798 | 3300046678 | Bacteria | 1320 |
| 827 | Ga0495623_0002848 | 3300046679 | Bacteria | 11409 |
| 828 | Ga0495623_0091236 | 3300046679 | Bacteria | 1869 |
| 829 | Ga0495623_0172788 | 3300046679 | Bacteria | 1261 |
| 830 | Ga0495646_0001272 | 3300046680 | Bacteria | 14827 |
| 831 | Ga0495646_0008984 | 3300046680 | Bacteria | 6344 |
| 832 | Ga0495646_0119223 | 3300046680 | Bacteria | 1494 |
| 833 | Ga0495646_0126911 | 3300046680 | Bacteria | 1439 |
| 834 | Ga0495658_0229075 | 3300046683 | Bacteria | 1165 |
| 835 | Ga0495669_0000092 | 3300046684 | Bacteria | 59765 |
| 836 | Ga0495669_0000583 | 3300046684 | Bacteria | 16207 |
| 837 | Ga0495669_0002000 | 3300046684 | Bacteria | 8364 |
| 838 | Ga0495669_0014388 | 3300046684 | Bacteria | 3382 |
| 839 | Ga0495669_0018903 | 3300046684 | Bacteria | 2968 |
| 840 | Ga0495669_0053696 | 3300046684 | Bacteria | 1812 |
| 841 | Ga0495669_0062837 | 3300046684 | Bacteria | 1683 |
| 842 | Ga0495669_0097430 | 3300046684 | Bacteria | 1363 |
| 843 | Ga0495613_0033961 | 3300046689 | Bacteria | 3789 |
| 844 | Ga0495613_0108969 | 3300046689 | Bacteria | 1997 |
| 845 | Ga0495613_0143776 | 3300046689 | Bacteria | 1703 |
| 846 | Ga0495624_0004719 | 3300046690 | Bacteria | 9913 |
| 847 | Ga0495624_0013356 | 3300046690 | Bacteria | 5600 |
| 848 | Ga0495624_0018817 | 3300046690 | Bacteria | 4616 |
| 849 | Ga0495624_0021868 | 3300046690 | Bacteria | 4236 |
| 850 | Ga0495670_0001955 | 3300046691 | Bacteria | 10140 |
| 851 | Ga0495670_0003903 | 3300046691 | Bacteria | 7323 |
| 852 | Ga0495670_0023024 | 3300046691 | Bacteria | 3075 |
| 853 | Ga0495670_0041036 | 3300046691 | Bacteria | 2308 |
| 854 | Ga0495670_0053575 | 3300046691 | Bacteria | 2020 |
| 855 | Ga0495670_0065194 | 3300046691 | Bacteria | 1835 |
| 856 | Ga0495670_0097054 | 3300046691 | Bacteria | 1514 |
| 857 | Ga0495670_0106660 | 3300046691 | Bacteria | 1447 |
| 858 | Ga0495670_0110917 | 3300046691 | Bacteria | 1419 |
| 859 | Ga0495670_0116948 | 3300046691 | Bacteria | 1383 |
| 860 | Ga0495670_0263036 | 3300046691 | Bacteria | 921 |
| 861 | Ga0495671_0002518 | 3300046692 | Bacteria | 11533 |
| 862 | Ga0495671_0009131 | 3300046692 | Bacteria | 5552 |
| 863 | Ga0495671_0011096 | 3300046692 | Bacteria | 4972 |
| 864 | Ga0495671_0029990 | 3300046692 | Bacteria | 2788 |
| 865 | Ga0495671_0035806 | 3300046692 | Bacteria | 2519 |
| 866 | Ga0495671_0056700 | 3300046692 | Bacteria | 1939 |
| 867 | Ga0495671_0101401 | 3300046692 | Bacteria | 1407 |
| 868 | Ga0495671_0138840 | 3300046692 | Bacteria | 1184 |
| 869 | Ga0495649_0001463 | 3300046694 | Bacteria | 17755 |
| 870 | Ga0495649_0003126 | 3300046694 | Bacteria | 11347 |
| 871 | Ga0495649_0005200 | 3300046694 | Bacteria | 8334 |
| 872 | Ga0495649_0006435 | 3300046694 | Bacteria | 7310 |
| 873 | Ga0495649_0006781 | 3300046694 | Bacteria | 7093 |
| 874 | Ga0495649_0009242 | 3300046694 | Bacteria | 5871 |
| 875 | Ga0495649_0015381 | 3300046694 | Bacteria | 4357 |
| 876 | Ga0495649_0029688 | 3300046694 | Bacteria | 3022 |
| 877 | Ga0495649_0063457 | 3300046694 | Bacteria | 1984 |
| 878 | Ga0495649_0118121 | 3300046694 | Bacteria | 1403 |
| 879 | Ga0495649_0122041 | 3300046694 | Bacteria | 1377 |
| 880 | Ga0495649_0152974 | 3300046694 | Bacteria | 1211 |
| 881 | Ga0495649_0194707 | 3300046694 | Bacteria | 1054 |
| 882 | Ga0495649_0304778 | 3300046694 | Bacteria | 810 |
| 883 | Ga0495649_0319066 | 3300046694 | Bacteria | 789 |
| 884 | Ga0495589_0000032 | 3300046794 | Bacteria | 167736 |
| 885 | Ga0495589_0002314 | 3300046794 | Bacteria | 10704 |
| 886 | Ga0495589_0004788 | 3300046794 | Bacteria | 7194 |
| 887 | Ga0495589_0005625 | 3300046794 | Bacteria | 6611 |
| 888 | Ga0495589_0013093 | 3300046794 | Bacteria | 4283 |
| 889 | Ga0495589_0014852 | 3300046794 | Bacteria | 4006 |
| 890 | Ga0495589_0024976 | 3300046794 | Bacteria | 3034 |
| 891 | Ga0495589_0050404 | 3300046794 | Bacteria | 2059 |
| 892 | Ga0495589_0090532 | 3300046794 | Bacteria | 1485 |
| 893 | Ga0495589_0103208 | 3300046794 | Bacteria | 1378 |
| 894 | Ga0495589_0115136 | 3300046794 | Bacteria | 1296 |
| 895 | Ga0495589_0146367 | 3300046794 | Bacteria | 1129 |
| 896 | Ga0495600_0000474 | 3300046809 | Bacteria | 20802 |
| 897 | Ga0495600_0002069 | 3300046809 | Bacteria | 11320 |
| 898 | Ga0495660_0009441 | 3300046810 | Bacteria | 5688 |
| 899 | Ga0495660_0010483 | 3300046810 | Bacteria | 5390 |
| 900 | Ga0495660_0011814 | 3300046810 | Bacteria | 5062 |
| 901 | Ga0495660_0013996 | 3300046810 | Bacteria | 4651 |
| 902 | Ga0495660_0025613 | 3300046810 | Bacteria | 3349 |
| 903 | Ga0495660_0042266 | 3300046810 | Bacteria | 2519 |
| 904 | Ga0495660_0071539 | 3300046810 | Bacteria | 1839 |
| 905 | Ga0495581_0008394 | 3300047315 | Bacteria | 5987 |
| 906 | Ga0495581_0015215 | 3300047315 | Bacteria | 4465 |
| 907 | Ga0495581_0015668 | 3300047315 | Bacteria | 4399 |
| 908 | Ga0495604_0020165 | 3300047317 | Bacteria | 5327 |
| 909 | Ga0495604_0030329 | 3300047317 | Bacteria | 4295 |
| 910 | Ga0495604_0038987 | 3300047317 | Bacteria | 3735 |
| 911 | Ga0495604_0047559 | 3300047317 | Bacteria | 3340 |
| 912 | Ga0495604_0051135 | 3300047317 | Bacteria | 3205 |
| 913 | Ga0495636_0001913 | 3300047318 | Bacteria | 7964 |
| 914 | Ga0495636_0002620 | 3300047318 | Bacteria | 6925 |
| 915 | Ga0495636_0028437 | 3300047318 | Bacteria | 2280 |
| 916 | Ga0495636_0042381 | 3300047318 | Bacteria | 1891 |
| 917 | Ga0495636_0051765 | 3300047318 | Bacteria | 1722 |
| 918 | Ga0495674_0004291 | 3300047319 | Bacteria | 13716 |
| 919 | Ga0495674_0008961 | 3300047319 | Bacteria | 9507 |
| 920 | Ga0495674_0359082 | 3300047319 | Bacteria | 1181 |
| 921 | Ga0495674_0400908 | 3300047319 | Bacteria | 1107 |
| 922 | Ga0495672_0000041 | 3300047320 | Bacteria | 267545 |
| 923 | Ga0495672_0004140 | 3300047320 | Bacteria | 12054 |
| 924 | Ga0495672_0006589 | 3300047320 | Bacteria | 8943 |
| 925 | Ga0495672_0042796 | 3300047320 | Bacteria | 2728 |
| 926 | Ga0495672_0052973 | 3300047320 | Bacteria | 2380 |
| 927 | Ga0495672_0156877 | 3300047320 | Bacteria | 1174 |
| 928 | Ga0495672_0289083 | 3300047320 | Bacteria | 780 |
| 929 | Ga0495676_0000235 | 3300047321 | Bacteria | 44374 |
| 930 | Ga0495676_0025419 | 3300047321 | Bacteria | 5113 |
| 931 | Ga0495676_0045906 | 3300047321 | Bacteria | 3551 |
| 932 | Ga0495676_0122523 | 3300047321 | Bacteria | 1889 |
| 933 | Ga0495680_0042503 | 3300047322 | Bacteria | 3605 |
| 934 | Ga0495683_0001361 | 3300047323 | Bacteria | 16273 |
| 935 | Ga0495683_0003295 | 3300047323 | Bacteria | 9440 |
| 936 | Ga0495683_0004350 | 3300047323 | Bacteria | 8069 |
| 937 | Ga0495683_0016473 | 3300047323 | Bacteria | 3838 |
| 938 | Ga0495683_0030886 | 3300047323 | Bacteria | 2731 |
| 939 | Ga0495683_0034026 | 3300047323 | Bacteria | 2592 |
| 940 | Ga0495683_0045537 | 3300047323 | Bacteria | 2204 |
| 941 | Ga0495683_0070388 | 3300047323 | Bacteria | 1717 |
| 942 | Ga0495683_0114245 | 3300047323 | Bacteria | 1286 |
| 943 | Ga0495683_0229991 | 3300047323 | Bacteria | 823 |
| 944 | Ga0495687_000127 | 3300047443 | Bacteria | 117520 |
| 945 | Ga0495687_000143 | 3300047443 | Bacteria | 108306 |
| 946 | Ga0495687_001108 | 3300047443 | Bacteria | 26234 |
| 947 | Ga0495687_004036 | 3300047443 | Bacteria | 10188 |
| 948 | Ga0495687_008098 | 3300047443 | Bacteria | 6072 |
| 949 | Ga0495687_034999 | 3300047443 | Bacteria | 2263 |
| 950 | Ga0495687_036591 | 3300047443 | Bacteria | 2195 |
| 951 | Ga0495675_0081573 | 3300047444 | Bacteria | 2036 |
| 952 | Ga0495675_0532871 | 3300047444 | Bacteria | 671 |
| 953 | Ga0495677_0003200 | 3300047445 | Bacteria | 6384 |
| 954 | Ga0495677_0005113 | 3300047445 | Bacteria | 4995 |
| 955 | Ga0495677_0006278 | 3300047445 | Bacteria | 4490 |
| 956 | Ga0495677_0007859 | 3300047445 | Bacteria | 3969 |
| 957 | Ga0495677_0009153 | 3300047445 | Bacteria | 3659 |
| 958 | Ga0495677_0024912 | 3300047445 | Bacteria | 2170 |
| 959 | Ga0495677_0026448 | 3300047445 | Bacteria | 2105 |
| 960 | Ga0495677_0049226 | 3300047445 | Bacteria | 1548 |
| 961 | Ga0495677_0054027 | 3300047445 | Bacteria | 1481 |
| 962 | Ga0495677_0076995 | 3300047445 | Bacteria | 1247 |
| 963 | Ga0495677_0081048 | 3300047445 | Bacteria | 1216 |
| 964 | Ga0495679_000037 | 3300047446 | Bacteria | 158099 |
| 965 | Ga0495679_005470 | 3300047446 | Bacteria | 5628 |
| 966 | Ga0495679_021280 | 3300047446 | Bacteria | 2243 |
| 967 | Ga0495679_033196 | 3300047446 | Bacteria | 1650 |
| 968 | Ga0495685_000113 | 3300047447 | Bacteria | 28884 |
| 969 | Ga0495685_001114 | 3300047447 | Bacteria | 8216 |
| 970 | Ga0495685_008745 | 3300047447 | Bacteria | 3372 |
| 971 | Ga0495685_014165 | 3300047447 | Bacteria | 2708 |
| 972 | Ga0495685_015742 | 3300047447 | Bacteria | 2582 |
| 973 | Ga0495685_024327 | 3300047447 | Bacteria | 2084 |
| 974 | Ga0495673_0006800 | 3300047469 | Bacteria | 6678 |
| 975 | Ga0495673_0040844 | 3300047469 | Bacteria | 2091 |
| 976 | Ga0495673_0047964 | 3300047469 | Bacteria | 1885 |
| 977 | Ga0495681_0000694 | 3300047470 | Bacteria | 25709 |
| 978 | Ga0495681_0001600 | 3300047470 | Bacteria | 16834 |
| 979 | Ga0495681_0002505 | 3300047470 | Bacteria | 13086 |
| 980 | Ga0495681_0004999 | 3300047470 | Bacteria | 8943 |
| 981 | Ga0495681_0019417 | 3300047470 | Bacteria | 3712 |
| 982 | Ga0495681_0019747 | 3300047470 | Bacteria | 3670 |
| 983 | Ga0495681_0023569 | 3300047470 | Bacteria | 3267 |
| 984 | Ga0495681_0028377 | 3300047470 | Bacteria | 2880 |
| 985 | Ga0495681_0066454 | 3300047470 | Bacteria | 1645 |
| 986 | Ga0495681_0075090 | 3300047470 | Bacteria | 1522 |
| 987 | Ga0495686_0000288 | 3300047472 | Bacteria | 88523 |
| 988 | Ga0495686_0000656 | 3300047472 | Bacteria | 47216 |
| 989 | Ga0495686_0002328 | 3300047472 | Bacteria | 18154 |
| 990 | Ga0495686_0007355 | 3300047472 | Bacteria | 8260 |
| 991 | Ga0495686_0053453 | 3300047472 | Bacteria | 2531 |
| 992 | Ga0495686_0060892 | 3300047472 | Bacteria | 2345 |
| 993 | Ga0495593_0012820 | 3300047673 | Bacteria | 4788 |
| 994 | Ga0495593_0012935 | 3300047673 | Bacteria | 4765 |
| 995 | Ga0495593_0032542 | 3300047673 | Bacteria | 2842 |
| 996 | Ga0495593_0048888 | 3300047673 | Bacteria | 2246 |
| 997 | Ga0495602_0006574 | 3300048088 | Bacteria | 12184 |
| 998 | Ga0495602_0022460 | 3300048088 | Bacteria | 6174 |
| 999 | Ga0495602_0062779 | 3300048088 | Bacteria | 3222 |
| 1000 | Ga0495602_0210740 | 3300048088 | Bacteria | 1475 |
| 1001 | Ga0495614_0006362 | 3300048089 | Bacteria | 5305 |
| 1002 | Ga0495614_0006654 | 3300048089 | Bacteria | 5174 |
| 1003 | Ga0495614_0094288 | 3300048089 | Bacteria | 1304 |
| 1004 | Ga0495626_0002049 | 3300048091 | Bacteria | 14744 |
| 1005 | Ga0495626_0010705 | 3300048091 | Bacteria | 4878 |
| 1006 | Ga0495626_0017842 | 3300048091 | Bacteria | 3579 |
| 1007 | Ga0495626_0020742 | 3300048091 | Bacteria | 3270 |
| 1008 | Ga0495626_0021140 | 3300048091 | Bacteria | 3232 |
| 1009 | Ga0495626_0022862 | 3300048091 | Bacteria | 3085 |
| 1010 | Ga0495626_0031484 | 3300048091 | Bacteria | 2552 |
| 1011 | Ga0495626_0033862 | 3300048091 | Bacteria | 2446 |
| 1012 | Ga0495626_0038091 | 3300048091 | Bacteria | 2281 |
| 1013 | Ga0495626_0040299 | 3300048091 | Bacteria | 2207 |
| 1014 | Ga0495626_0059781 | 3300048091 | Bacteria | 1738 |
| 1015 | Ga0495626_0065980 | 3300048091 | Bacteria | 1637 |
| 1016 | Ga0495626_0074515 | 3300048091 | Bacteria | 1518 |
| 1017 | Ga0495626_0109953 | 3300048091 | Bacteria | 1194 |
| 1018 | Ga0495626_0144554 | 3300048091 | Bacteria | 1006 |
| 1019 | Ga0495626_0163969 | 3300048091 | Bacteria | 930 |
| 1020 | Ga0496100_0016601 | 3300048903 | Bacteria | 4327 |
| 1021 | Ga0496100_0171134 | 3300048903 | Bacteria | 1564 |
| 1022 | Ga0496100_0458653 | 3300048903 | Bacteria | 978 |
| 1023 | Ga0496100_0482716 | 3300048903 | Bacteria | 953 |
| 1024 | Ga0496101_0030388 | 3300048904 | Bacteria | 3787 |
| 1025 | Ga0496102_0000931 | 3300048905 | Bacteria | 27579 |
| 1026 | Ga0496102_0401793 | 3300048905 | Bacteria | 1288 |
| 1027 | Ga0496103_0022931 | 3300048906 | Bacteria | 3762 |
| 1028 | Ga0496103_0056910 | 3300048906 | Bacteria | 2427 |
| 1029 | Ga0496103_0529000 | 3300048906 | Bacteria | 753 |
| 1030 | Ga0496104_0338360 | 3300048907 | Bacteria | 1418 |
| 1031 | Ga0496105_0087572 | 3300048908 | Bacteria | 2573 |
| 1032 | Ga0496107_0055316 | 3300048910 | Bacteria | 2866 |
| 1033 | Ga0496109_0009606 | 3300048912 | Bacteria | 8249 |
| 1034 | Ga0496109_0115613 | 3300048912 | Bacteria | 2496 |
| 1035 | Ga0496110_0029094 | 3300048913 | Bacteria | 4750 |
| 1036 | Ga0496110_0045736 | 3300048913 | Bacteria | 3827 |
| 1037 | Ga0496110_0047706 | 3300048913 | Bacteria | 3752 |
| 1038 | Ga0496110_0261305 | 3300048913 | Bacteria | 1576 |
| 1039 | Ga0496110_0715854 | 3300048913 | Bacteria | 903 |
| 1040 | Ga0496111_0014930 | 3300048914 | Bacteria | 5319 |
| 1041 | Ga0496111_0342997 | 3300048914 | Bacteria | 1106 |
| 1042 | Ga0496113_0008457 | 3300048916 | Bacteria | 6707 |
| 1043 | Ga0496114_0439153 | 3300048917 | Bacteria | 1156 |
| 1044 | Ga0496115_0018367 | 3300048918 | Bacteria | 5367 |
| 1045 | Ga0496115_0020248 | 3300048918 | Bacteria | 5130 |
| 1046 | Ga0496115_0055871 | 3300048918 | Bacteria | 3172 |
| 1047 | Ga0496115_0220001 | 3300048918 | Bacteria | 1567 |
| 1048 | Ga0496115_0238318 | 3300048918 | Bacteria | 1500 |
| 1049 | Ga0496115_0276349 | 3300048918 | Bacteria | 1379 |
| 1050 | Ga0496116_0014132 | 3300048919 | Bacteria | 6391 |
| 1051 | Ga0496116_0026637 | 3300048919 | Bacteria | 4223 |
| 1052 | Ga0496116_0033774 | 3300048919 | Bacteria | 3623 |
| 1053 | Ga0496117_0028920 | 3300048920 | Bacteria | 4282 |
| 1054 | Ga0496117_0114372 | 3300048920 | Bacteria | 1673 |
| 1055 | Ga0496117_0121972 | 3300048920 | Bacteria | 1599 |
| 1056 | Ga0496118_0002886 | 3300048921 | Bacteria | 22384 |
| 1057 | Ga0496118_0040010 | 3300048921 | Bacteria | 3733 |
| 1058 | Ga0496118_0060865 | 3300048921 | Bacteria | 2800 |
| 1059 | Ga0496121_0014458 | 3300048924 | Bacteria | 8371 |
| 1060 | Ga0496121_0084985 | 3300048924 | Bacteria | 2492 |
| 1061 | Ga0496121_0197583 | 3300048924 | Bacteria | 1436 |
| 1062 | Ga0496122_0000261 | 3300048925 | Bacteria | 118793 |
| 1063 | Ga0496122_0000445 | 3300048925 | Bacteria | 86566 |
| 1064 | Ga0496122_0011752 | 3300048925 | Bacteria | 8821 |
| 1065 | Ga0496123_0000218 | 3300048926 | Bacteria | 116615 |
| 1066 | Ga0496123_0001568 | 3300048926 | Bacteria | 31272 |
| 1067 | Ga0496123_0007592 | 3300048926 | Bacteria | 10163 |
| 1068 | Ga0496124_0015077 | 3300048927 | Bacteria | 7431 |
| 1069 | Ga0496124_0015517 | 3300048927 | Bacteria | 7294 |
| 1070 | Ga0496124_0046689 | 3300048927 | Bacteria | 3707 |
| 1071 | Ga0496124_0097419 | 3300048927 | Bacteria | 2388 |
| 1072 | Ga0496124_0151501 | 3300048927 | Bacteria | 1818 |
| 1073 | Ga0496124_0237922 | 3300048927 | Bacteria | 1356 |
| 1074 | Ga0496124_0351417 | 3300048927 | Bacteria | 1043 |
| 1075 | Ga0496124_0429036 | 3300048927 | Bacteria | 908 |
| 1076 | Ga0496125_0000256 | 3300048928 | Bacteria | 109696 |
| 1077 | Ga0496125_0002859 | 3300048928 | Bacteria | 21722 |
| 1078 | Ga0496125_0067915 | 3300048928 | Bacteria | 2806 |
| 1079 | Ga0496126_0034799 | 3300048929 | Bacteria | 4726 |
| 1080 | Ga0496126_0054778 | 3300048929 | Bacteria | 3611 |
| 1081 | Ga0496126_0111802 | 3300048929 | Bacteria | 2379 |
| 1082 | Ga0501306_002557 | 3300049127 | Bacteria | 1880 |
| 1083 | Ga0501310_001443 | 3300049130 | Bacteria | 2171 |
| 1084 | Ga0495678_000042 | 3300049459 | Bacteria | 174125 |
| 1085 | Ga0495678_000316 | 3300049459 | Bacteria | 51625 |
| 1086 | Ga0495678_003135 | 3300049459 | Bacteria | 10459 |
| 1087 | Ga0495678_003427 | 3300049459 | Bacteria | 9828 |
| 1088 | Ga0495678_003924 | 3300049459 | Bacteria | 8918 |
| 1089 | Ga0495678_004684 | 3300049459 | Bacteria | 7829 |
| 1090 | Ga0495678_006389 | 3300049459 | Bacteria | 6281 |
| 1091 | Ga0495678_007748 | 3300049459 | Bacteria | 5531 |
| 1092 | Ga0495678_009881 | 3300049459 | Bacteria | 4678 |
| 1093 | Ga0495678_025595 | 3300049459 | Bacteria | 2532 |
| 1094 | Ga0495678_033817 | 3300049459 | Bacteria | 2108 |
| 1095 | Ga0495682_0000107 | 3300049460 | Bacteria | 73486 |
| 1096 | Ga0495682_0033786 | 3300049460 | Bacteria | 1887 |
| 1097 | Ga0495682_0038533 | 3300049460 | Bacteria | 1756 |
| 1098 | Ga0495682_0084729 | 3300049460 | Bacteria | 1139 |
| 1099 | Ga0495682_0094804 | 3300049460 | Bacteria | 1071 |
| 1100 | Ga0501039_0066319 | 3300049575 | Bacteria | 2802 |
| 1101 | Ga0501070_0147283 | 3300049586 | Bacteria | 1943 |
| 1102 | Ga0501198_000102 | 3300049649 | Bacteria | 16377 |
| 1103 | Ga0501222_000008 | 3300049662 | Bacteria | 120904 |
| 1104 | Ga0501227_039267 | 3300049665 | Bacteria | 1164 |
| 1105 | Ga0501249_003963 | 3300049679 | Bacteria | 2997 |
| 1106 | Ga0501269_000210 | 3300049766 | Bacteria | 17330 |
| 1107 | Ga0501279_000208 | 3300049775 | Bacteria | 8130 |
| 1108 | Ga0501279_004406 | 3300049775 | Bacteria | 1847 |
| 1109 | Ga0501279_036368 | 3300049775 | Bacteria | 744 |
| 1110 | nmdc:mga03683_277888_c1 | 3300050489 | Bacteria | 782 |
| 1111 | nmdc:mga0k408_132531_c1 | 3300050493 | Bacteria | 1480 |
| 1112 | nmdc:mga0k408_177614_c1 | 3300050493 | Bacteria | 1270 |
| 1113 | nmdc:mga0k408_196874_c1 | 3300050493 | Bacteria | 1203 |
| 1114 | nmdc:mga0k408_22887_c1 | 3300050493 | Bacteria | 1916 |
| 1115 | nmdc:mga0k408_487922_c1 | 3300050493 | Bacteria | 731 |
| 1116 | nmdc:mga0k408_59835_c1 | 3300050493 | Bacteria | 2214 |
| 1117 | nmdc:mga07m45_5487_c1 | 3300050496 | Bacteria | 6318 |
| 1118 | nmdc:mga08x19_12730_c1 | 3300050514 | Bacteria | 5072 |
| 1119 | Ga0495601_0030324 | 3300053077 | Bacteria | 3357 |
| 1120 | Ga0495601_0239427 | 3300053077 | Bacteria | 1185 |
| 1121 | Ga0500635_0000083 | 3300053080 | Bacteria | 61980 |
| 1122 | Ga0495595_0136294 | 3300053084 | Bacteria | 1202 |
| 1123 | Ga0500651_0112998 | 3300053093 | Bacteria | 1656 |
| 1124 | Ga0500595_003047 | 3300053119 | Bacteria | 7965 |
| 1125 | Ga0500619_000742 | 3300053154 | Bacteria | 5568 |
| 1126 | Ga0500634_0108608 | 3300053161 | Bacteria | 1374 |
| 1127 | Ga0500637_0152420 | 3300053178 | Bacteria | 1335 |
| 1128 | Ga0500587_000079 | 3300053739 | Bacteria | 8123 |
| 1129 | Ga0500661_006935 | 3300055283 | Bacteria | 2102 |
| 1130 | Ga0587091_002909 | 3300059511 | Bacteria | 2096 |
| 1131 | Ga0587062_001995 | 3300059639 | Bacteria | 1881 |
| 1132 | Ga0587111_0003612 | 3300060346 | Bacteria | 2220 |
| 1133 | Ga0466962_0002972 | 3300061719 | Bacteria | 8086 |
| 1134 | Ga0466962_0003937 | 3300061719 | Bacteria | 7106 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003323 | rootH1_10186258 | rootH1_101862582 | 200 |
| 2 | 3300003752 | Ga0055539_1000146 | Ga0055539_10001467 | 201 |
| 3 | 3300003756 | Ga0055533_1000150 | Ga0055533_10001507 | 201 |
| 4 | 3300003759 | Ga0055525_1000198 | Ga0055525_10001987 | 201 |
| 5 | 3300003841 | Ga0055541_1000098 | Ga0055541_10000987 | 201 |
| 6 | 3300021361 | Ga0213872_10002809 | Ga0213872_100028096 | 201 |
| 7 | 3300039447 | Ga0436361_0144599 | Ga0436361_0144599_92_706 | 201 |
| 8 | 3300002739 | JGI25158J39367_1001641 | JGI25158J39367_10016413 | 202 |
| 9 | 3300002774 | JGI25150J39212_1012636 | JGI25150J39212_10126362 | 202 |
| 10 | 3300002987 | JGI25159J45721_1005067 | JGI25159J45721_10050672 | 202 |
| 11 | 3300003354 | JGI25160J50197_1002021 | JGI25160J50197_10020215 | 202 |
| 12 | 3300003374 | JGI25161J50226_1001870 | JGI25161J50226_10018702 | 202 |
| 13 | 3300003771 | Ga0055526_1000827 | Ga0055526_10008277 | 202 |
| 14 | 3300003771 | Ga0055526_1003727 | Ga0055526_10037276 | 202 |
| 15 | 3300003773 | Ga0055537_1000111 | Ga0055537_100011112 | 202 |
| 16 | 3300003775 | Ga0055524_1002005 | Ga0055524_10020055 | 202 |
| 17 | 3300003775 | Ga0055524_1002542 | Ga0055524_10025425 | 202 |
| 18 | 3300003784 | Ga0055534_1000268 | Ga0055534_100026819 | 202 |
| 19 | 3300003784 | Ga0055534_1002782 | Ga0055534_10027822 | 202 |
| 20 | 3300003790 | Ga0055528_1000178 | Ga0055528_100017840 | 202 |
| 21 | 3300003791 | Ga0055530_10028903 | Ga0055530_100289032 | 202 |
| 22 | 3300003794 | Ga0055531_10021621 | Ga0055531_100216213 | 202 |
| 23 | 3300025208 | Ga0209436_100751 | Ga0209436_10075111 | 202 |
| 24 | 3300025258 | Ga0209129_1000093 | Ga0209129_1000093153 | 202 |
| 25 | 3300025263 | Ga0209565_1000009 | Ga0209565_1000009587 | 202 |
| 26 | 3300025263 | Ga0209565_1000946 | Ga0209565_10009468 | 202 |
| 27 | 3300025263 | Ga0209565_1001578 | Ga0209565_10015786 | 202 |
| 28 | 3300025273 | Ga0209673_1000036 | Ga0209673_100003695 | 202 |
| 29 | 3300025273 | Ga0209673_1006646 | Ga0209673_10066465 | 202 |
| 30 | 3300025284 | Ga0209130_1001278 | Ga0209130_100127810 | 202 |
| 31 | 3300025284 | Ga0209130_1001458 | Ga0209130_100145811 | 202 |
| 32 | 3300025291 | Ga0209675_1000013 | Ga0209675_100001395 | 202 |
| 33 | 3300025291 | Ga0209675_1000945 | Ga0209675_100094512 | 202 |
| 34 | 3300025295 | Ga0209564_1000122 | Ga0209564_100012295 | 202 |
| 35 | 3300025295 | Ga0209564_1003837 | Ga0209564_10038376 | 202 |
| 36 | 3300025298 | Ga0209050_1007847 | Ga0209050_10078476 | 202 |
| 37 | 3300025299 | Ga0209256_1000106 | Ga0209256_100010680 | 202 |
| 38 | 3300025299 | Ga0209256_1000269 | Ga0209256_100026996 | 202 |
| 39 | 3300025299 | Ga0209256_1002862 | Ga0209256_10028629 | 202 |
| 40 | 3300025302 | Ga0207426_1002626 | Ga0207426_10026268 | 202 |
| 41 | 3300025303 | Ga0209051_1016272 | Ga0209051_10162722 | 202 |
| 42 | 3300025304 | Ga0209257_1000010 | Ga0209257_10000101002 | 202 |
| 43 | 3300032002 | Ga0307416_100005407 | Ga0307416_1000054072 | 202 |
| 44 | 3300032004 | Ga0307414_10094204 | Ga0307414_100942042 | 202 |
| 45 | 3300041413 | Ga0439465_0120827 | Ga0439465_0120827_152_769 | 202 |
| 46 | 3300042008 | Ga0439450_007594 | Ga0439450_007594_560_1177 | 202 |
| 47 | 3300042461 | Ga0439460_0095082 | Ga0439460_0095082_140_757 | 202 |
| 48 | 3300046457 | Ga0495590_0018282 | Ga0495590_0018282_1477_2094 | 202 |
| 49 | 3300046474 | Ga0495605_0025196 | Ga0495605_0025196_536_1153 | 202 |
| 50 | 3300046491 | Ga0495584_0000560 | Ga0495584_0000560_1305_1922 | 202 |
| 51 | 3300046501 | Ga0495607_0005057 | Ga0495607_0005057_1074_1691 | 202 |
| 52 | 3300046513 | Ga0495616_0010511 | Ga0495616_0010511_4211_4828 | 202 |
| 53 | 3300046528 | Ga0495642_0041624 | Ga0495642_0041624_232_849 | 202 |
| 54 | 3300046538 | Ga0495609_0033768 | Ga0495609_0033768_224_841 | 202 |
| 55 | 3300046616 | Ga0495668_0034704 | Ga0495668_0034704_324_941 | 202 |
| 56 | 3300046664 | Ga0495659_0000919 | Ga0495659_0000919_7427_8044 | 202 |
| 57 | 3300046665 | Ga0495661_0004930 | Ga0495661_0004930_6880_7497 | 202 |
| 58 | 3300046692 | Ga0495671_0101401 | Ga0495671_0101401_268_885 | 202 |
| 59 | 3300046694 | Ga0495649_0006781 | Ga0495649_0006781_352_969 | 202 |
| 60 | 3300046810 | Ga0495660_0009441 | Ga0495660_0009441_4389_5003 | 202 |
| 61 | 3300046810 | Ga0495660_0071539 | Ga0495660_0071539_620_1237 | 202 |
| 62 | 3300047318 | Ga0495636_0028437 | Ga0495636_0028437_1312_1929 | 202 |
| 63 | 3300047443 | Ga0495687_008098 | Ga0495687_008098_2164_2781 | 202 |
| 64 | 3300047445 | Ga0495677_0009153 | Ga0495677_0009153_2034_2651 | 202 |
| 65 | 3300047446 | Ga0495679_021280 | Ga0495679_021280_830_1447 | 202 |
| 66 | 3300047470 | Ga0495681_0002505 | Ga0495681_0002505_8324_8938 | 202 |
| 67 | 3300047470 | Ga0495681_0028377 | Ga0495681_0028377_1632_2249 | 202 |
| 68 | 3300047472 | Ga0495686_0000288 | Ga0495686_0000288_12940_13566 | 202 |
| 69 | 3300048903 | Ga0496100_0458653 | Ga0496100_0458653_304_921 | 202 |
| 70 | 3300048927 | Ga0496124_0151501 | Ga0496124_0151501_926_1540 | 202 |
| 71 | 3300049127 | Ga0501306_002557 | Ga0501306_002557_509_1126 | 202 |
| 72 | 3300049459 | Ga0495678_000042 | Ga0495678_000042_172109_172723 | 202 |
| 73 | 3300049665 | Ga0501227_039267 | Ga0501227_039267_349_966 | 202 |
| 74 | 3300049775 | Ga0501279_004406 | Ga0501279_004406_849_1466 | 202 |
| 75 | 3300002738 | JGI25154J39366_1003202 | JGI25154J39366_10032023 | 203 |
| 76 | 3300003215 | JGI25153J46596_10017617 | JGI25153J46596_100176172 | 203 |
| 77 | 3300003771 | Ga0055526_1000161 | Ga0055526_100016149 | 203 |
| 78 | 3300003775 | Ga0055524_1000015 | Ga0055524_1000015177 | 203 |
| 79 | 3300005614 | Ga0068856_100257418 | Ga0068856_1002574182 | 203 |
| 80 | 3300005718 | Ga0068866_10309096 | Ga0068866_103090961 | 203 |
| 81 | 3300006358 | Ga0068871_100073893 | Ga0068871_1000738932 | 203 |
| 82 | 3300006881 | Ga0068865_100114600 | Ga0068865_1001146002 | 203 |
| 83 | 3300009036 | Ga0105244_10002953 | Ga0105244_1000295310 | 203 |
| 84 | 3300009036 | Ga0105244_10007523 | Ga0105244_100075236 | 203 |
| 85 | 3300009036 | Ga0105244_10061761 | Ga0105244_100617612 | 203 |
| 86 | 3300009148 | Ga0105243_10052625 | Ga0105243_100526253 | 203 |
| 87 | 3300009174 | Ga0105241_10019955 | Ga0105241_100199552 | 203 |
| 88 | 3300009176 | Ga0105242_10007036 | Ga0105242_1000703610 | 203 |
| 89 | 3300009551 | Ga0105238_10061774 | Ga0105238_100617743 | 203 |
| 90 | 3300011119 | Ga0105246_10099856 | Ga0105246_100998563 | 203 |
| 91 | 3300013100 | Ga0157373_10045986 | Ga0157373_100459862 | 203 |
| 92 | 3300013104 | Ga0157370_10764917 | Ga0157370_107649171 | 203 |
| 93 | 3300013296 | Ga0157374_10132950 | Ga0157374_101329503 | 203 |
| 94 | 3300013297 | Ga0157378_10248522 | Ga0157378_102485222 | 203 |
| 95 | 3300013307 | Ga0157372_10731731 | Ga0157372_107317311 | 203 |
| 96 | 3300014745 | Ga0157377_10228313 | Ga0157377_102283132 | 203 |
| 97 | 3300015262 | Ga0182007_10095791 | Ga0182007_100957912 | 203 |
| 98 | 3300021361 | Ga0213872_10000002 | Ga0213872_10000002242 | 203 |
| 99 | 3300021361 | Ga0213872_10019803 | Ga0213872_100198035 | 203 |
| 100 | 3300025263 | Ga0209565_1012113 | Ga0209565_10121132 | 203 |
| 101 | 3300025299 | Ga0209256_1000005 | Ga0209256_1000005177 | 203 |
| 102 | 3300027666 | Ga0209282_1000002 | Ga0209282_1000002751 | 203 |
| 103 | 3300031838 | Ga0307518_10127414 | Ga0307518_101274142 | 203 |
| 104 | 3300037471 | Ga0395905_0028213 | Ga0395905_0028213_4458_5078 | 203 |
| 105 | 3300046616 | Ga0495668_0000025 | Ga0495668_0000025_188562_189185 | 203 |
| 106 | 3300047472 | Ga0495686_0002328 | Ga0495686_0002328_2391_3014 | 203 |
| 107 | 3300049130 | Ga0501310_001443 | Ga0501310_001443_619_1239 | 203 |
| 108 | 3300049459 | Ga0495678_003924 | Ga0495678_003924_1609_2229 | 203 |
| 109 | 3300049459 | Ga0495678_033817 | Ga0495678_033817_1400_2023 | 203 |
| 110 | 3300049575 | Ga0501039_0066319 | Ga0501039_0066319_844_1458 | 203 |
| 111 | 3300049775 | Ga0501279_000208 | Ga0501279_000208_629_1249 | 203 |
| 112 | 3300003575 | Ga0007409J51694_1041494 | Ga0007409J51694_10414945 | 204 |
| 113 | 3300005262 | Ga0065165_1000286 | Ga0065165_100028649 | 204 |
| 114 | 3300021361 | Ga0213872_10038157 | Ga0213872_100381572 | 204 |
| 115 | 3300021361 | Ga0213872_10046973 | Ga0213872_100469732 | 204 |
| 116 | 3300021361 | Ga0213872_10141970 | Ga0213872_101419702 | 204 |
| 117 | 3300037471 | Ga0395905_0025730 | Ga0395905_0025730_2842_3459 | 204 |
| 118 | 3300039447 | Ga0436361_0600769 | Ga0436361_0600769_306_929 | 204 |
| 119 | 3300039447 | Ga0436361_0846070 | Ga0436361_0846070_3392_4021 | 204 |
| 120 | 3300044658 | Ga0466972_0000088 | Ga0466972_0000088_11498_12121 | 204 |
| 121 | 3300044658 | Ga0466972_0022575 | Ga0466972_0022575_1500_2123 | 204 |
| 122 | 3300044683 | Ga0466965_0000666 | Ga0466965_0000666_6497_7120 | 204 |
| 123 | 3300044706 | Ga0466964_0025767 | Ga0466964_0025767_1152_1775 | 204 |
| 124 | 3300044706 | Ga0466964_0056879 | Ga0466964_0056879_85_708 | 204 |
| 125 | 3300044706 | Ga0466964_0113758 | Ga0466964_0113758_353_976 | 204 |
| 126 | 3300045836 | Ga0466958_0587412 | Ga0466958_0587412_69_686 | 204 |
| 127 | 3300046452 | Ga0495617_000002 | Ga0495617_000002_640334_640951 | 204 |
| 128 | 3300046452 | Ga0495617_041726 | Ga0495617_041726_249_866 | 204 |
| 129 | 3300046453 | Ga0495627_000207 | Ga0495627_000207_5864_6481 | 204 |
| 130 | 3300046453 | Ga0495627_042518 | Ga0495627_042518_25_642 | 204 |
| 131 | 3300046453 | Ga0495627_046735 | Ga0495627_046735_625_1242 | 204 |
| 132 | 3300046455 | Ga0495603_0106430 | Ga0495603_0106430_67_684 | 204 |
| 133 | 3300046455 | Ga0495603_0364263 | Ga0495603_0364263_156_773 | 204 |
| 134 | 3300046457 | Ga0495590_0000025 | Ga0495590_0000025_72243_72860 | 204 |
| 135 | 3300046458 | Ga0495591_002755 | Ga0495591_002755_5178_5795 | 204 |
| 136 | 3300046460 | Ga0495638_0035516 | Ga0495638_0035516_711_1328 | 204 |
| 137 | 3300046460 | Ga0495638_0073932 | Ga0495638_0073932_688_1305 | 204 |
| 138 | 3300046463 | Ga0495653_0132732 | Ga0495653_0132732_53_670 | 204 |
| 139 | 3300046471 | Ga0495650_0000015 | Ga0495650_0000015_279391_280014 | 204 |
| 140 | 3300046471 | Ga0495650_0005573 | Ga0495650_0005573_7029_7652 | 204 |
| 141 | 3300046471 | Ga0495650_0007195 | Ga0495650_0007195_5175_5792 | 204 |
| 142 | 3300046471 | Ga0495650_0008662 | Ga0495650_0008662_1454_2071 | 204 |
| 143 | 3300046472 | Ga0495580_0115644 | Ga0495580_0115644_1083_1700 | 204 |
| 144 | 3300046473 | Ga0495582_0002333 | Ga0495582_0002333_655_1272 | 204 |
| 145 | 3300046474 | Ga0495605_0001284 | Ga0495605_0001284_10522_11139 | 204 |
| 146 | 3300046476 | Ga0495662_0386912 | Ga0495662_0386912_15_632 | 204 |
| 147 | 3300046491 | Ga0495584_0000070 | Ga0495584_0000070_65541_66158 | 204 |
| 148 | 3300046491 | Ga0495584_0005783 | Ga0495584_0005783_3466_4083 | 204 |
| 149 | 3300046491 | Ga0495584_0007322 | Ga0495584_0007322_775_1404 | 204 |
| 150 | 3300046491 | Ga0495584_0009129 | Ga0495584_0009129_1865_2482 | 204 |
| 151 | 3300046491 | Ga0495584_0288096 | Ga0495584_0288096_48_665 | 204 |
| 152 | 3300046492 | Ga0495585_0006233 | Ga0495585_0006233_3092_3709 | 204 |
| 153 | 3300046492 | Ga0495585_0010483 | Ga0495585_0010483_3621_4238 | 204 |
| 154 | 3300046492 | Ga0495585_0013461 | Ga0495585_0013461_3018_3635 | 204 |
| 155 | 3300046492 | Ga0495585_0026665 | Ga0495585_0026665_355_972 | 204 |
| 156 | 3300046492 | Ga0495585_0030854 | Ga0495585_0030854_598_1215 | 204 |
| 157 | 3300046492 | Ga0495585_0032874 | Ga0495585_0032874_473_1090 | 204 |
| 158 | 3300046492 | Ga0495585_0059514 | Ga0495585_0059514_970_1599 | 204 |
| 159 | 3300046492 | Ga0495585_0068952 | Ga0495585_0068952_953_1570 | 204 |
| 160 | 3300046492 | Ga0495585_0193122 | Ga0495585_0193122_96_713 | 204 |
| 161 | 3300046499 | Ga0495594_0005742 | Ga0495594_0005742_2944_3561 | 204 |
| 162 | 3300046499 | Ga0495594_0013918 | Ga0495594_0013918_995_1612 | 204 |
| 163 | 3300046499 | Ga0495594_0030537 | Ga0495594_0030537_2263_2880 | 204 |
| 164 | 3300046499 | Ga0495594_0069416 | Ga0495594_0069416_1303_1920 | 204 |
| 165 | 3300046500 | Ga0495596_0001839 | Ga0495596_0001839_3235_3852 | 204 |
| 166 | 3300046500 | Ga0495596_0008211 | Ga0495596_0008211_2201_2818 | 204 |
| 167 | 3300046500 | Ga0495596_0009505 | Ga0495596_0009505_2891_3508 | 204 |
| 168 | 3300046500 | Ga0495596_0011786 | Ga0495596_0011786_3013_3630 | 204 |
| 169 | 3300046500 | Ga0495596_0012683 | Ga0495596_0012683_2543_3160 | 204 |
| 170 | 3300046500 | Ga0495596_0033692 | Ga0495596_0033692_729_1358 | 204 |
| 171 | 3300046500 | Ga0495596_0041071 | Ga0495596_0041071_505_1122 | 204 |
| 172 | 3300046500 | Ga0495596_0196268 | Ga0495596_0196268_155_772 | 204 |
| 173 | 3300046501 | Ga0495607_0002594 | Ga0495607_0002594_11904_12533 | 204 |
| 174 | 3300046501 | Ga0495607_0004085 | Ga0495607_0004085_5861_6478 | 204 |
| 175 | 3300046501 | Ga0495607_0014386 | Ga0495607_0014386_11_628 | 204 |
| 176 | 3300046501 | Ga0495607_0017453 | Ga0495607_0017453_2905_3522 | 204 |
| 177 | 3300046501 | Ga0495607_0031280 | Ga0495607_0031280_1938_2555 | 204 |
| 178 | 3300046501 | Ga0495607_0307808 | Ga0495607_0307808_39_656 | 204 |
| 179 | 3300046506 | Ga0495583_0000372 | Ga0495583_0000372_55851_56480 | 204 |
| 180 | 3300046506 | Ga0495583_0000382 | Ga0495583_0000382_64126_64743 | 204 |
| 181 | 3300046506 | Ga0495583_0000864 | Ga0495583_0000864_36184_36801 | 204 |
| 182 | 3300046506 | Ga0495583_0023202 | Ga0495583_0023202_641_1258 | 204 |
| 183 | 3300046506 | Ga0495583_0056880 | Ga0495583_0056880_168_785 | 204 |
| 184 | 3300046506 | Ga0495583_0101613 | Ga0495583_0101613_81_698 | 204 |
| 185 | 3300046506 | Ga0495583_0167063 | Ga0495583_0167063_253_870 | 204 |
| 186 | 3300046506 | Ga0495583_0209989 | Ga0495583_0209989_44_661 | 204 |
| 187 | 3300046507 | Ga0495606_0004210 | Ga0495606_0004210_10727_11344 | 204 |
| 188 | 3300046507 | Ga0495606_0013849 | Ga0495606_0013849_988_1605 | 204 |
| 189 | 3300046507 | Ga0495606_0039674 | Ga0495606_0039674_1844_2461 | 204 |
| 190 | 3300046507 | Ga0495606_0306052 | Ga0495606_0306052_73_690 | 204 |
| 191 | 3300046512 | Ga0495610_0004511 | Ga0495610_0004511_2534_3151 | 204 |
| 192 | 3300046513 | Ga0495616_0003140 | Ga0495616_0003140_5988_6605 | 204 |
| 193 | 3300046513 | Ga0495616_0015188 | Ga0495616_0015188_2911_3528 | 204 |
| 194 | 3300046513 | Ga0495616_0015417 | Ga0495616_0015417_26_643 | 204 |
| 195 | 3300046513 | Ga0495616_0015591 | Ga0495616_0015591_1712_2329 | 204 |
| 196 | 3300046513 | Ga0495616_0028366 | Ga0495616_0028366_1175_1792 | 204 |
| 197 | 3300046513 | Ga0495616_0101666 | Ga0495616_0101666_45_662 | 204 |
| 198 | 3300046517 | Ga0495630_0058357 | Ga0495630_0058357_1399_2016 | 204 |
| 199 | 3300046518 | Ga0495631_0002820 | Ga0495631_0002820_5532_6149 | 204 |
| 200 | 3300046518 | Ga0495631_0003219 | Ga0495631_0003219_1063_1680 | 204 |
| 201 | 3300046518 | Ga0495631_0012520 | Ga0495631_0012520_2736_3365 | 204 |
| 202 | 3300046518 | Ga0495631_0014987 | Ga0495631_0014987_326_943 | 204 |
| 203 | 3300046518 | Ga0495631_0015637 | Ga0495631_0015637_2090_2707 | 204 |
| 204 | 3300046518 | Ga0495631_0016374 | Ga0495631_0016374_2409_3026 | 204 |
| 205 | 3300046518 | Ga0495631_0021138 | Ga0495631_0021138_375_992 | 204 |
| 206 | 3300046518 | Ga0495631_0045981 | Ga0495631_0045981_703_1320 | 204 |
| 207 | 3300046518 | Ga0495631_0144685 | Ga0495631_0144685_292_909 | 204 |
| 208 | 3300046518 | Ga0495631_0181164 | Ga0495631_0181164_185_802 | 204 |
| 209 | 3300046519 | Ga0495632_0000129 | Ga0495632_0000129_70250_70867 | 204 |
| 210 | 3300046519 | Ga0495632_0000296 | Ga0495632_0000296_5988_6605 | 204 |
| 211 | 3300046519 | Ga0495632_0000375 | Ga0495632_0000375_8666_9286 | 204 |
| 212 | 3300046519 | Ga0495632_0008199 | Ga0495632_0008199_3574_4203 | 204 |
| 213 | 3300046519 | Ga0495632_0022797 | Ga0495632_0022797_1970_2587 | 204 |
| 214 | 3300046519 | Ga0495632_0025075 | Ga0495632_0025075_1768_2385 | 204 |
| 215 | 3300046519 | Ga0495632_0026117 | Ga0495632_0026117_1800_2417 | 204 |
| 216 | 3300046520 | Ga0495637_0000126 | Ga0495637_0000126_42004_42621 | 204 |
| 217 | 3300046520 | Ga0495637_0023626 | Ga0495637_0023626_24_641 | 204 |
| 218 | 3300046520 | Ga0495637_0070124 | Ga0495637_0070124_390_1007 | 204 |
| 219 | 3300046522 | Ga0495643_0011985 | Ga0495643_0011985_4258_4875 | 204 |
| 220 | 3300046522 | Ga0495643_0031662 | Ga0495643_0031662_213_830 | 204 |
| 221 | 3300046522 | Ga0495643_0048513 | Ga0495643_0048513_1383_2000 | 204 |
| 222 | 3300046522 | Ga0495643_0125066 | Ga0495643_0125066_98_715 | 204 |
| 223 | 3300046522 | Ga0495643_0313931 | Ga0495643_0313931_25_642 | 204 |
| 224 | 3300046523 | Ga0495644_0000389 | Ga0495644_0000389_6184_6801 | 204 |
| 225 | 3300046523 | Ga0495644_0001948 | Ga0495644_0001948_4119_4748 | 204 |
| 226 | 3300046523 | Ga0495644_0003401 | Ga0495644_0003401_1592_2209 | 204 |
| 227 | 3300046523 | Ga0495644_0003438 | Ga0495644_0003438_2264_2881 | 204 |
| 228 | 3300046524 | Ga0495648_0000708 | Ga0495648_0000708_1328_1945 | 204 |
| 229 | 3300046524 | Ga0495648_0007168 | Ga0495648_0007168_1304_1921 | 204 |
| 230 | 3300046524 | Ga0495648_0011619 | Ga0495648_0011619_5793_6410 | 204 |
| 231 | 3300046524 | Ga0495648_0048317 | Ga0495648_0048317_695_1312 | 204 |
| 232 | 3300046524 | Ga0495648_0085064 | Ga0495648_0085064_51_668 | 204 |
| 233 | 3300046524 | Ga0495648_0215620 | Ga0495648_0215620_275_892 | 204 |
| 234 | 3300046525 | Ga0495663_0017672 | Ga0495663_0017672_978_1595 | 204 |
| 235 | 3300046525 | Ga0495663_0086948 | Ga0495663_0086948_149_766 | 204 |
| 236 | 3300046526 | Ga0495666_0000556 | Ga0495666_0000556_11419_12036 | 204 |
| 237 | 3300046526 | Ga0495666_0018785 | Ga0495666_0018785_819_1436 | 204 |
| 238 | 3300046526 | Ga0495666_0039750 | Ga0495666_0039750_255_872 | 204 |
| 239 | 3300046528 | Ga0495642_0000613 | Ga0495642_0000613_14291_14908 | 204 |
| 240 | 3300046528 | Ga0495642_0004874 | Ga0495642_0004874_924_1541 | 204 |
| 241 | 3300046528 | Ga0495642_0009239 | Ga0495642_0009239_764_1393 | 204 |
| 242 | 3300046528 | Ga0495642_0016483 | Ga0495642_0016483_1688_2305 | 204 |
| 243 | 3300046528 | Ga0495642_0066401 | Ga0495642_0066401_191_808 | 204 |
| 244 | 3300046528 | Ga0495642_0069897 | Ga0495642_0069897_796_1413 | 204 |
| 245 | 3300046530 | Ga0495654_0004611 | Ga0495654_0004611_2100_2717 | 204 |
| 246 | 3300046530 | Ga0495654_0018761 | Ga0495654_0018761_2583_3200 | 204 |
| 247 | 3300046530 | Ga0495654_0028918 | Ga0495654_0028918_1832_2449 | 204 |
| 248 | 3300046530 | Ga0495654_0107634 | Ga0495654_0107634_121_738 | 204 |
| 249 | 3300046530 | Ga0495654_0198012 | Ga0495654_0198012_17_634 | 204 |
| 250 | 3300046531 | Ga0495665_0049520 | Ga0495665_0049520_957_1574 | 204 |
| 251 | 3300046535 | Ga0495586_0009827 | Ga0495586_0009827_185_802 | 204 |
| 252 | 3300046535 | Ga0495586_0012802 | Ga0495586_0012802_3047_3664 | 204 |
| 253 | 3300046536 | Ga0495587_0243573 | Ga0495587_0243573_188_805 | 204 |
| 254 | 3300046538 | Ga0495609_0003442 | Ga0495609_0003442_6318_6935 | 204 |
| 255 | 3300046538 | Ga0495609_0004070 | Ga0495609_0004070_5886_6503 | 204 |
| 256 | 3300046538 | Ga0495609_0015930 | Ga0495609_0015930_1575_2192 | 204 |
| 257 | 3300046538 | Ga0495609_0016433 | Ga0495609_0016433_2088_2705 | 204 |
| 258 | 3300046538 | Ga0495609_0021815 | Ga0495609_0021815_144_761 | 204 |
| 259 | 3300046538 | Ga0495609_0029412 | Ga0495609_0029412_30_647 | 204 |
| 260 | 3300046538 | Ga0495609_0065495 | Ga0495609_0065495_130_747 | 204 |
| 261 | 3300046538 | Ga0495609_0099802 | Ga0495609_0099802_389_1018 | 204 |
| 262 | 3300046542 | Ga0495597_0001388 | Ga0495597_0001388_12562_13179 | 204 |
| 263 | 3300046542 | Ga0495597_0002423 | Ga0495597_0002423_5764_6381 | 204 |
| 264 | 3300046542 | Ga0495597_0003311 | Ga0495597_0003311_213_830 | 204 |
| 265 | 3300046542 | Ga0495597_0005681 | Ga0495597_0005681_742_1359 | 204 |
| 266 | 3300046542 | Ga0495597_0009715 | Ga0495597_0009715_577_1194 | 204 |
| 267 | 3300046542 | Ga0495597_0010710 | Ga0495597_0010710_516_1133 | 204 |
| 268 | 3300046542 | Ga0495597_0038705 | Ga0495597_0038705_689_1306 | 204 |
| 269 | 3300046542 | Ga0495597_0219965 | Ga0495597_0219965_113_730 | 204 |
| 270 | 3300046557 | Ga0495622_0000064 | Ga0495622_0000064_38673_39290 | 204 |
| 271 | 3300046557 | Ga0495622_0006368 | Ga0495622_0006368_3888_4505 | 204 |
| 272 | 3300046557 | Ga0495622_0032190 | Ga0495622_0032190_1715_2332 | 204 |
| 273 | 3300046557 | Ga0495622_0054258 | Ga0495622_0054258_247_864 | 204 |
| 274 | 3300046558 | Ga0495633_0004954 | Ga0495633_0004954_6604_7221 | 204 |
| 275 | 3300046558 | Ga0495633_0008291 | Ga0495633_0008291_1830_2447 | 204 |
| 276 | 3300046558 | Ga0495633_0060270 | Ga0495633_0060270_918_1547 | 204 |
| 277 | 3300046558 | Ga0495633_0079803 | Ga0495633_0079803_274_891 | 204 |
| 278 | 3300046615 | Ga0495656_0300791 | Ga0495656_0300791_78_707 | 204 |
| 279 | 3300046615 | Ga0495656_0386048 | Ga0495656_0386048_85_702 | 204 |
| 280 | 3300046616 | Ga0495668_0000544 | Ga0495668_0000544_10418_11035 | 204 |
| 281 | 3300046616 | Ga0495668_0000578 | Ga0495668_0000578_770_1387 | 204 |
| 282 | 3300046616 | Ga0495668_0003733 | Ga0495668_0003733_6899_7516 | 204 |
| 283 | 3300046616 | Ga0495668_0029684 | Ga0495668_0029684_775_1404 | 204 |
| 284 | 3300046616 | Ga0495668_0045031 | Ga0495668_0045031_1535_2152 | 204 |
| 285 | 3300046616 | Ga0495668_0066242 | Ga0495668_0066242_1354_1971 | 204 |
| 286 | 3300046648 | Ga0495611_0000946 | Ga0495611_0000946_771_1388 | 204 |
| 287 | 3300046648 | Ga0495611_0003308 | Ga0495611_0003308_3617_4234 | 204 |
| 288 | 3300046648 | Ga0495611_0033374 | Ga0495611_0033374_505_1122 | 204 |
| 289 | 3300046648 | Ga0495611_0125987 | Ga0495611_0125987_282_911 | 204 |
| 290 | 3300046660 | Ga0495625_0026121 | Ga0495625_0026121_2659_3276 | 204 |
| 291 | 3300046660 | Ga0495625_0040181 | Ga0495625_0040181_2743_3360 | 204 |
| 292 | 3300046660 | Ga0495625_0155060 | Ga0495625_0155060_754_1371 | 204 |
| 293 | 3300046660 | Ga0495625_0249643 | Ga0495625_0249643_428_1045 | 204 |
| 294 | 3300046663 | Ga0495635_0001292 | Ga0495635_0001292_2564_3181 | 204 |
| 295 | 3300046664 | Ga0495659_0008635 | Ga0495659_0008635_1256_1873 | 204 |
| 296 | 3300046664 | Ga0495659_0013224 | Ga0495659_0013224_1204_1821 | 204 |
| 297 | 3300046665 | Ga0495661_0002258 | Ga0495661_0002258_5477_6094 | 204 |
| 298 | 3300046665 | Ga0495661_0023263 | Ga0495661_0023263_1467_2084 | 204 |
| 299 | 3300046665 | Ga0495661_0024203 | Ga0495661_0024203_706_1323 | 204 |
| 300 | 3300046665 | Ga0495661_0038868 | Ga0495661_0038868_1659_2282 | 204 |
| 301 | 3300046665 | Ga0495661_0063697 | Ga0495661_0063697_1506_2123 | 204 |
| 302 | 3300046665 | Ga0495661_0088267 | Ga0495661_0088267_23_640 | 204 |
| 303 | 3300046665 | Ga0495661_0100596 | Ga0495661_0100596_703_1320 | 204 |
| 304 | 3300046665 | Ga0495661_0103250 | Ga0495661_0103250_276_893 | 204 |
| 305 | 3300046665 | Ga0495661_0218012 | Ga0495661_0218012_79_696 | 204 |
| 306 | 3300046665 | Ga0495661_0316595 | Ga0495661_0316595_37_654 | 204 |
| 307 | 3300046674 | Ga0495588_0003376 | Ga0495588_0003376_49_666 | 204 |
| 308 | 3300046674 | Ga0495588_0024317 | Ga0495588_0024317_584_1201 | 204 |
| 309 | 3300046674 | Ga0495588_0036417 | Ga0495588_0036417_321_938 | 204 |
| 310 | 3300046674 | Ga0495588_0046183 | Ga0495588_0046183_1520_2137 | 204 |
| 311 | 3300046674 | Ga0495588_0166293 | Ga0495588_0166293_126_743 | 204 |
| 312 | 3300046674 | Ga0495588_0189117 | Ga0495588_0189117_12_629 | 204 |
| 313 | 3300046679 | Ga0495623_0091236 | Ga0495623_0091236_869_1486 | 204 |
| 314 | 3300046679 | Ga0495623_0172788 | Ga0495623_0172788_396_1013 | 204 |
| 315 | 3300046680 | Ga0495646_0126911 | Ga0495646_0126911_184_801 | 204 |
| 316 | 3300046684 | Ga0495669_0000092 | Ga0495669_0000092_7321_7938 | 204 |
| 317 | 3300046684 | Ga0495669_0000583 | Ga0495669_0000583_6802_7419 | 204 |
| 318 | 3300046684 | Ga0495669_0002000 | Ga0495669_0002000_326_943 | 204 |
| 319 | 3300046684 | Ga0495669_0018903 | Ga0495669_0018903_800_1417 | 204 |
| 320 | 3300046684 | Ga0495669_0053696 | Ga0495669_0053696_415_1032 | 204 |
| 321 | 3300046684 | Ga0495669_0062837 | Ga0495669_0062837_729_1358 | 204 |
| 322 | 3300046689 | Ga0495613_0033961 | Ga0495613_0033961_2432_3049 | 204 |
| 323 | 3300046689 | Ga0495613_0108969 | Ga0495613_0108969_335_952 | 204 |
| 324 | 3300046690 | Ga0495624_0013356 | Ga0495624_0013356_3880_4497 | 204 |
| 325 | 3300046691 | Ga0495670_0001955 | Ga0495670_0001955_953_1570 | 204 |
| 326 | 3300046691 | Ga0495670_0023024 | Ga0495670_0023024_2173_2790 | 204 |
| 327 | 3300046691 | Ga0495670_0041036 | Ga0495670_0041036_1147_1764 | 204 |
| 328 | 3300046691 | Ga0495670_0053575 | Ga0495670_0053575_472_1089 | 204 |
| 329 | 3300046691 | Ga0495670_0106660 | Ga0495670_0106660_284_901 | 204 |
| 330 | 3300046691 | Ga0495670_0116948 | Ga0495670_0116948_233_862 | 204 |
| 331 | 3300046691 | Ga0495670_0263036 | Ga0495670_0263036_256_873 | 204 |
| 332 | 3300046692 | Ga0495671_0002518 | Ga0495671_0002518_10222_10839 | 204 |
| 333 | 3300046692 | Ga0495671_0011096 | Ga0495671_0011096_3427_4044 | 204 |
| 334 | 3300046692 | Ga0495671_0056700 | Ga0495671_0056700_827_1444 | 204 |
| 335 | 3300046692 | Ga0495671_0138840 | Ga0495671_0138840_195_812 | 204 |
| 336 | 3300046694 | Ga0495649_0003126 | Ga0495649_0003126_6942_7559 | 204 |
| 337 | 3300046694 | Ga0495649_0005200 | Ga0495649_0005200_4556_5173 | 204 |
| 338 | 3300046694 | Ga0495649_0015381 | Ga0495649_0015381_921_1538 | 204 |
| 339 | 3300046694 | Ga0495649_0029688 | Ga0495649_0029688_944_1561 | 204 |
| 340 | 3300046694 | Ga0495649_0063457 | Ga0495649_0063457_156_773 | 204 |
| 341 | 3300046694 | Ga0495649_0118121 | Ga0495649_0118121_249_866 | 204 |
| 342 | 3300046694 | Ga0495649_0152974 | Ga0495649_0152974_403_1032 | 204 |
| 343 | 3300046694 | Ga0495649_0194707 | Ga0495649_0194707_314_931 | 204 |
| 344 | 3300046694 | Ga0495649_0304778 | Ga0495649_0304778_177_794 | 204 |
| 345 | 3300046694 | Ga0495649_0319066 | Ga0495649_0319066_59_676 | 204 |
| 346 | 3300046794 | Ga0495589_0002314 | Ga0495589_0002314_5829_6446 | 204 |
| 347 | 3300046794 | Ga0495589_0004788 | Ga0495589_0004788_2303_2932 | 204 |
| 348 | 3300046794 | Ga0495589_0005625 | Ga0495589_0005625_5864_6481 | 204 |
| 349 | 3300046794 | Ga0495589_0013093 | Ga0495589_0013093_703_1320 | 204 |
| 350 | 3300046794 | Ga0495589_0103208 | Ga0495589_0103208_717_1334 | 204 |
| 351 | 3300046794 | Ga0495589_0115136 | Ga0495589_0115136_569_1186 | 204 |
| 352 | 3300046810 | Ga0495660_0010483 | Ga0495660_0010483_3358_3975 | 204 |
| 353 | 3300046810 | Ga0495660_0011814 | Ga0495660_0011814_700_1329 | 204 |
| 354 | 3300046810 | Ga0495660_0013996 | Ga0495660_0013996_3922_4539 | 204 |
| 355 | 3300046810 | Ga0495660_0042266 | Ga0495660_0042266_1772_2389 | 204 |
| 356 | 3300047315 | Ga0495581_0015215 | Ga0495581_0015215_2886_3503 | 204 |
| 357 | 3300047315 | Ga0495581_0015668 | Ga0495581_0015668_3012_3629 | 204 |
| 358 | 3300047317 | Ga0495604_0020165 | Ga0495604_0020165_3010_3627 | 204 |
| 359 | 3300047317 | Ga0495604_0030329 | Ga0495604_0030329_836_1453 | 204 |
| 360 | 3300047317 | Ga0495604_0038987 | Ga0495604_0038987_2442_3059 | 204 |
| 361 | 3300047317 | Ga0495604_0051135 | Ga0495604_0051135_36_653 | 204 |
| 362 | 3300047318 | Ga0495636_0042381 | Ga0495636_0042381_633_1250 | 204 |
| 363 | 3300047319 | Ga0495674_0400908 | Ga0495674_0400908_142_759 | 204 |
| 364 | 3300047320 | Ga0495672_0000041 | Ga0495672_0000041_203827_204444 | 204 |
| 365 | 3300047320 | Ga0495672_0004140 | Ga0495672_0004140_3818_4435 | 204 |
| 366 | 3300047320 | Ga0495672_0006589 | Ga0495672_0006589_2383_3000 | 204 |
| 367 | 3300047320 | Ga0495672_0042796 | Ga0495672_0042796_1473_2102 | 204 |
| 368 | 3300047321 | Ga0495676_0000235 | Ga0495676_0000235_70_687 | 204 |
| 369 | 3300047321 | Ga0495676_0025419 | Ga0495676_0025419_3173_3790 | 204 |
| 370 | 3300047322 | Ga0495680_0042503 | Ga0495680_0042503_190_807 | 204 |
| 371 | 3300047323 | Ga0495683_0003295 | Ga0495683_0003295_3646_4263 | 204 |
| 372 | 3300047323 | Ga0495683_0004350 | Ga0495683_0004350_3670_4299 | 204 |
| 373 | 3300047323 | Ga0495683_0030886 | Ga0495683_0030886_685_1302 | 204 |
| 374 | 3300047323 | Ga0495683_0114245 | Ga0495683_0114245_362_979 | 204 |
| 375 | 3300047443 | Ga0495687_000127 | Ga0495687_000127_72305_72922 | 204 |
| 376 | 3300047443 | Ga0495687_000143 | Ga0495687_000143_78075_78692 | 204 |
| 377 | 3300047443 | Ga0495687_004036 | Ga0495687_004036_5329_5946 | 204 |
| 378 | 3300047444 | Ga0495675_0081573 | Ga0495675_0081573_647_1264 | 204 |
| 379 | 3300047444 | Ga0495675_0532871 | Ga0495675_0532871_13_630 | 204 |
| 380 | 3300047445 | Ga0495677_0003200 | Ga0495677_0003200_3607_4224 | 204 |
| 381 | 3300047445 | Ga0495677_0005113 | Ga0495677_0005113_684_1301 | 204 |
| 382 | 3300047445 | Ga0495677_0026448 | Ga0495677_0026448_663_1280 | 204 |
| 383 | 3300047445 | Ga0495677_0049226 | Ga0495677_0049226_94_711 | 204 |
| 384 | 3300047445 | Ga0495677_0054027 | Ga0495677_0054027_338_967 | 204 |
| 385 | 3300047445 | Ga0495677_0076995 | Ga0495677_0076995_102_719 | 204 |
| 386 | 3300047445 | Ga0495677_0081048 | Ga0495677_0081048_13_630 | 204 |
| 387 | 3300047446 | Ga0495679_005470 | Ga0495679_005470_1242_1859 | 204 |
| 388 | 3300047446 | Ga0495679_033196 | Ga0495679_033196_475_1092 | 204 |
| 389 | 3300047447 | Ga0495685_001114 | Ga0495685_001114_3340_3957 | 204 |
| 390 | 3300047447 | Ga0495685_015742 | Ga0495685_015742_630_1247 | 204 |
| 391 | 3300047447 | Ga0495685_024327 | Ga0495685_024327_550_1167 | 204 |
| 392 | 3300047469 | Ga0495673_0006800 | Ga0495673_0006800_369_986 | 204 |
| 393 | 3300047470 | Ga0495681_0000694 | Ga0495681_0000694_3313_3930 | 204 |
| 394 | 3300047470 | Ga0495681_0001600 | Ga0495681_0001600_10467_11084 | 204 |
| 395 | 3300047470 | Ga0495681_0004999 | Ga0495681_0004999_7608_8225 | 204 |
| 396 | 3300047470 | Ga0495681_0019747 | Ga0495681_0019747_1357_1986 | 204 |
| 397 | 3300047470 | Ga0495681_0023569 | Ga0495681_0023569_1932_2549 | 204 |
| 398 | 3300047470 | Ga0495681_0066454 | Ga0495681_0066454_723_1340 | 204 |
| 399 | 3300047470 | Ga0495681_0075090 | Ga0495681_0075090_523_1140 | 204 |
| 400 | 3300047472 | Ga0495686_0000656 | Ga0495686_0000656_45883_46506 | 204 |
| 401 | 3300047472 | Ga0495686_0007355 | Ga0495686_0007355_7042_7659 | 204 |
| 402 | 3300047673 | Ga0495593_0012935 | Ga0495593_0012935_3754_4371 | 204 |
| 403 | 3300047673 | Ga0495593_0048888 | Ga0495593_0048888_1057_1674 | 204 |
| 404 | 3300048088 | Ga0495602_0062779 | Ga0495602_0062779_1377_1994 | 204 |
| 405 | 3300048088 | Ga0495602_0210740 | Ga0495602_0210740_160_777 | 204 |
| 406 | 3300048089 | Ga0495614_0006362 | Ga0495614_0006362_1614_2231 | 204 |
| 407 | 3300048089 | Ga0495614_0094288 | Ga0495614_0094288_371_988 | 204 |
| 408 | 3300048091 | Ga0495626_0002049 | Ga0495626_0002049_10531_11148 | 204 |
| 409 | 3300048091 | Ga0495626_0010705 | Ga0495626_0010705_3517_4134 | 204 |
| 410 | 3300048091 | Ga0495626_0017842 | Ga0495626_0017842_1136_1753 | 204 |
| 411 | 3300048091 | Ga0495626_0020742 | Ga0495626_0020742_564_1181 | 204 |
| 412 | 3300048091 | Ga0495626_0021140 | Ga0495626_0021140_59_676 | 204 |
| 413 | 3300048091 | Ga0495626_0031484 | Ga0495626_0031484_1335_1952 | 204 |
| 414 | 3300048091 | Ga0495626_0033862 | Ga0495626_0033862_377_994 | 204 |
| 415 | 3300048091 | Ga0495626_0038091 | Ga0495626_0038091_940_1557 | 204 |
| 416 | 3300048091 | Ga0495626_0059781 | Ga0495626_0059781_423_1052 | 204 |
| 417 | 3300048091 | Ga0495626_0074515 | Ga0495626_0074515_14_631 | 204 |
| 418 | 3300048091 | Ga0495626_0144554 | Ga0495626_0144554_376_993 | 204 |
| 419 | 3300048091 | Ga0495626_0163969 | Ga0495626_0163969_88_705 | 204 |
| 420 | 3300048903 | Ga0496100_0016601 | Ga0496100_0016601_1559_2176 | 204 |
| 421 | 3300048903 | Ga0496100_0482716 | Ga0496100_0482716_151_768 | 204 |
| 422 | 3300048904 | Ga0496101_0030388 | Ga0496101_0030388_920_1537 | 204 |
| 423 | 3300048905 | Ga0496102_0000931 | Ga0496102_0000931_23924_24541 | 204 |
| 424 | 3300048905 | Ga0496102_0401793 | Ga0496102_0401793_16_633 | 204 |
| 425 | 3300048906 | Ga0496103_0056910 | Ga0496103_0056910_278_952 | 204 |
| 426 | 3300048906 | Ga0496103_0529000 | Ga0496103_0529000_24_641 | 204 |
| 427 | 3300048910 | Ga0496107_0055316 | Ga0496107_0055316_758_1375 | 204 |
| 428 | 3300048912 | Ga0496109_0115613 | Ga0496109_0115613_1323_1940 | 204 |
| 429 | 3300048913 | Ga0496110_0029094 | Ga0496110_0029094_2776_3393 | 204 |
| 430 | 3300048913 | Ga0496110_0715854 | Ga0496110_0715854_199_816 | 204 |
| 431 | 3300048916 | Ga0496113_0008457 | Ga0496113_0008457_579_1196 | 204 |
| 432 | 3300048918 | Ga0496115_0018367 | Ga0496115_0018367_2393_3010 | 204 |
| 433 | 3300048918 | Ga0496115_0020248 | Ga0496115_0020248_429_1046 | 204 |
| 434 | 3300048918 | Ga0496115_0055871 | Ga0496115_0055871_747_1364 | 204 |
| 435 | 3300048918 | Ga0496115_0276349 | Ga0496115_0276349_48_665 | 204 |
| 436 | 3300048925 | Ga0496122_0000445 | Ga0496122_0000445_46082_46699 | 204 |
| 437 | 3300048926 | Ga0496123_0001568 | Ga0496123_0001568_22645_23262 | 204 |
| 438 | 3300048927 | Ga0496124_0046689 | Ga0496124_0046689_695_1312 | 204 |
| 439 | 3300048927 | Ga0496124_0097419 | Ga0496124_0097419_1308_1925 | 204 |
| 440 | 3300048927 | Ga0496124_0237922 | Ga0496124_0237922_725_1342 | 204 |
| 441 | 3300048927 | Ga0496124_0351417 | Ga0496124_0351417_82_699 | 204 |
| 442 | 3300048927 | Ga0496124_0429036 | Ga0496124_0429036_131_748 | 204 |
| 443 | 3300048928 | Ga0496125_0002859 | Ga0496125_0002859_5512_6129 | 204 |
| 444 | 3300049459 | Ga0495678_000316 | Ga0495678_000316_5794_6411 | 204 |
| 445 | 3300049459 | Ga0495678_003427 | Ga0495678_003427_2105_2722 | 204 |
| 446 | 3300049459 | Ga0495678_004684 | Ga0495678_004684_3367_3996 | 204 |
| 447 | 3300049459 | Ga0495678_006389 | Ga0495678_006389_4631_5248 | 204 |
| 448 | 3300049459 | Ga0495678_007748 | Ga0495678_007748_760_1377 | 204 |
| 449 | 3300049459 | Ga0495678_009881 | Ga0495678_009881_644_1270 | 204 |
| 450 | 3300049460 | Ga0495682_0000107 | Ga0495682_0000107_72147_72764 | 204 |
| 451 | 3300049460 | Ga0495682_0084729 | Ga0495682_0084729_46_663 | 204 |
| 452 | 3300049586 | Ga0501070_0147283 | Ga0501070_0147283_1092_1733 | 204 |
| 453 | 3300050514 | nmdc:mga08x19_12730_c1 | nmdc:mga08x19_12730_c1_32_685 | 204 |
| 454 | 3300003775 | Ga0055524_1005899 | Ga0055524_10058997 | 205 |
| 455 | 3300003791 | Ga0055530_10001043 | Ga0055530_1000104319 | 205 |
| 456 | 3300003792 | Ga0055540_1000001 | Ga0055540_1000001133 | 205 |
| 457 | 3300003794 | Ga0055531_10002737 | Ga0055531_1000273711 | 205 |
| 458 | 3300003794 | Ga0055531_10007375 | Ga0055531_100073752 | 205 |
| 459 | 3300005262 | Ga0065165_1058816 | Ga0065165_10588162 | 205 |
| 460 | 3300005327 | Ga0070658_10081833 | Ga0070658_100818332 | 205 |
| 461 | 3300005327 | Ga0070658_10646273 | Ga0070658_106462731 | 205 |
| 462 | 3300005366 | Ga0070659_100003171 | Ga0070659_1000031714 | 205 |
| 463 | 3300005455 | Ga0070663_100384565 | Ga0070663_1003845651 | 205 |
| 464 | 3300005563 | Ga0068855_100430825 | Ga0068855_1004308252 | 205 |
| 465 | 3300006048 | Ga0075363_100043109 | Ga0075363_1000431092 | 205 |
| 466 | 3300006353 | Ga0075370_10271119 | Ga0075370_102711192 | 205 |
| 467 | 3300006942 | Ga0099824_1036213 | Ga0099824_10362132 | 205 |
| 468 | 3300006944 | Ga0099823_1017932 | Ga0099823_10179325 | 205 |
| 469 | 3300006946 | Ga0079104_1000309 | Ga0079104_100030947 | 205 |
| 470 | 3300014326 | Ga0157380_10241647 | Ga0157380_102416472 | 205 |
| 471 | 3300015262 | Ga0182007_10081906 | Ga0182007_100819062 | 205 |
| 472 | 3300025253 | Ga0209677_100760 | Ga0209677_1007603 | 205 |
| 473 | 3300025291 | Ga0209675_1007213 | Ga0209675_10072132 | 205 |
| 474 | 3300025298 | Ga0209050_1000145 | Ga0209050_1000145134 | 205 |
| 475 | 3300025298 | Ga0209050_1012221 | Ga0209050_10122214 | 205 |
| 476 | 3300025299 | Ga0209256_1000061 | Ga0209256_1000061118 | 205 |
| 477 | 3300025299 | Ga0209256_1007013 | Ga0209256_10070138 | 205 |
| 478 | 3300025303 | Ga0209051_1000018 | Ga0209051_1000018319 | 205 |
| 479 | 3300025303 | Ga0209051_1005475 | Ga0209051_10054755 | 205 |
| 480 | 3300025304 | Ga0209257_1000084 | Ga0209257_100008453 | 205 |
| 481 | 3300025304 | Ga0209257_1004271 | Ga0209257_10042719 | 205 |
| 482 | 3300025909 | Ga0207705_10191215 | Ga0207705_101912152 | 205 |
| 483 | 3300025932 | Ga0207690_10004058 | Ga0207690_100040585 | 205 |
| 484 | 3300025933 | Ga0207706_10144106 | Ga0207706_101441062 | 205 |
| 485 | 3300026067 | Ga0207678_10422419 | Ga0207678_104224192 | 205 |
| 486 | 3300027111 | Ga0209281_1000103 | Ga0209281_1000103182 | 205 |
| 487 | 3300027526 | Ga0209968_1001095 | Ga0209968_10010953 | 205 |
| 488 | 3300027695 | Ga0209966_1000003 | Ga0209966_100000310 | 205 |
| 489 | 3300028794 | Ga0307515_10000708 | Ga0307515_1000070818 | 205 |
| 490 | 3300028794 | Ga0307515_10013083 | Ga0307515_100130832 | 205 |
| 491 | 3300028794 | Ga0307515_10470144 | Ga0307515_104701441 | 205 |
| 492 | 3300030522 | Ga0307512_10056000 | Ga0307512_100560002 | 205 |
| 493 | 3300031239 | Ga0265328_10005685 | Ga0265328_100056853 | 205 |
| 494 | 3300031251 | Ga0265327_10000479 | Ga0265327_1000047939 | 205 |
| 495 | 3300031507 | Ga0307509_10073712 | Ga0307509_100737125 | 205 |
| 496 | 3300031616 | Ga0307508_10000169 | Ga0307508_1000016961 | 205 |
| 497 | 3300031649 | Ga0307514_10085435 | Ga0307514_100854352 | 205 |
| 498 | 3300031730 | Ga0307516_10009988 | Ga0307516_100099882 | 205 |
| 499 | 3300031824 | Ga0307413_10273545 | Ga0307413_102735452 | 205 |
| 500 | 3300031852 | Ga0307410_10247607 | Ga0307410_102476071 | 205 |
| 501 | 3300031995 | Ga0307409_100226671 | Ga0307409_1002266711 | 205 |
| 502 | 3300031995 | Ga0307409_100280086 | Ga0307409_1002800861 | 205 |
| 503 | 3300032002 | Ga0307416_101791783 | Ga0307416_1017917831 | 205 |
| 504 | 3300037418 | Ga0395900_0000131 | Ga0395900_0000131_95657_96280 | 205 |
| 505 | 3300037466 | Ga0395898_0001532 | Ga0395898_0001532_3452_4075 | 205 |
| 506 | 3300037471 | Ga0395905_0017710 | Ga0395905_0017710_3248_3874 | 205 |
| 507 | 3300037471 | Ga0395905_0063403 | Ga0395905_0063403_1991_2614 | 205 |
| 508 | 3300038443 | Ga0395901_1173314 | Ga0395901_1173314_50_673 | 205 |
| 509 | 3300041410 | Ga0439461_0030468 | Ga0439461_0030468_116_745 | 205 |
| 510 | 3300041443 | Ga0451789_0491830 | Ga0451789_0491830_160_783 | 205 |
| 511 | 3300041456 | Ga0451795_0419335 | Ga0451795_0419335_88_711 | 205 |
| 512 | 3300041460 | Ga0451802_0970336 | Ga0451802_0970336_489_1112 | 205 |
| 513 | 3300041492 | Ga0451835_0864634 | Ga0451835_0864634_78_701 | 205 |
| 514 | 3300041496 | Ga0451839_0718016 | Ga0451839_0718016_155_778 | 205 |
| 515 | 3300041505 | Ga0451849_0077297 | Ga0451849_0077297_200_823 | 205 |
| 516 | 3300041507 | Ga0451851_0770517 | Ga0451851_0770517_145_768 | 205 |
| 517 | 3300041509 | Ga0451843_0223084 | Ga0451843_0223084_350_973 | 205 |
| 518 | 3300041997 | Ga0439431_0031742 | Ga0439431_0031742_185_814 | 205 |
| 519 | 3300042156 | Ga0439446_0014983 | Ga0439446_0014983_1173_1805 | 205 |
| 520 | 3300042435 | Ga0439434_0039325 | Ga0439434_0039325_761_1390 | 205 |
| 521 | 3300042531 | Ga0450918_001746 | Ga0450918_001746_1786_2418 | 205 |
| 522 | 3300042876 | Ga0451577_0091368 | Ga0451577_0091368_1811_2443 | 205 |
| 523 | 3300042876 | Ga0451577_0751880 | Ga0451577_0751880_32_658 | 205 |
| 524 | 3300044656 | Ga0466969_0058160 | Ga0466969_0058160_1072_1695 | 205 |
| 525 | 3300044684 | Ga0466966_0000687 | Ga0466966_0000687_8721_9344 | 205 |
| 526 | 3300044693 | Ga0466961_0007342 | Ga0466961_0007342_4637_5260 | 205 |
| 527 | 3300044694 | Ga0466963_0027945 | Ga0466963_0027945_904_1527 | 205 |
| 528 | 3300044706 | Ga0466964_0002548 | Ga0466964_0002548_2935_3558 | 205 |
| 529 | 3300044712 | Ga0453684_0023234 | Ga0453684_0023234_1629_2255 | 205 |
| 530 | 3300044719 | Ga0466971_0007302 | Ga0466971_0007302_3411_4034 | 205 |
| 531 | 3300044765 | Ga0466970_0031025 | Ga0466970_0031025_1173_1796 | 205 |
| 532 | 3300044842 | Ga0466957_0192226 | Ga0466957_0192226_188_811 | 205 |
| 533 | 3300045049 | Ga0466959_0000287 | Ga0466959_0000287_14502_15125 | 205 |
| 534 | 3300045051 | Ga0451576_0074320 | Ga0451576_0074320_1894_2520 | 205 |
| 535 | 3300045051 | Ga0451576_0194483 | Ga0451576_0194483_851_1483 | 205 |
| 536 | 3300045976 | Ga0466967_0024766 | Ga0466967_0024766_1438_2061 | 205 |
| 537 | 3300046492 | Ga0495585_0034744 | Ga0495585_0034744_618_1235 | 205 |
| 538 | 3300046500 | Ga0495596_0000240 | Ga0495596_0000240_14440_15057 | 205 |
| 539 | 3300046501 | Ga0495607_0106432 | Ga0495607_0106432_30_647 | 205 |
| 540 | 3300046515 | Ga0495620_0030549 | Ga0495620_0030549_1204_1827 | 205 |
| 541 | 3300046522 | Ga0495643_0026575 | Ga0495643_0026575_2534_3157 | 205 |
| 542 | 3300046523 | Ga0495644_0013643 | Ga0495644_0013643_834_1451 | 205 |
| 543 | 3300046529 | Ga0495652_0001577 | Ga0495652_0001577_21555_22226 | 205 |
| 544 | 3300046543 | Ga0495645_0037487 | Ga0495645_0037487_504_1175 | 205 |
| 545 | 3300046558 | Ga0495633_0032773 | Ga0495633_0032773_1430_2047 | 205 |
| 546 | 3300046615 | Ga0495656_0040418 | Ga0495656_0040418_1251_1868 | 205 |
| 547 | 3300046660 | Ga0495625_0004296 | Ga0495625_0004296_3649_4272 | 205 |
| 548 | 3300046665 | Ga0495661_0110688 | Ga0495661_0110688_428_1045 | 205 |
| 549 | 3300046680 | Ga0495646_0001272 | Ga0495646_0001272_9999_10670 | 205 |
| 550 | 3300046683 | Ga0495658_0229075 | Ga0495658_0229075_529_1152 | 205 |
| 551 | 3300046684 | Ga0495669_0014388 | Ga0495669_0014388_1652_2269 | 205 |
| 552 | 3300047472 | Ga0495686_0060892 | Ga0495686_0060892_1038_1667 | 205 |
| 553 | 3300048903 | Ga0496100_0171134 | Ga0496100_0171134_723_1358 | 205 |
| 554 | 3300048927 | Ga0496124_0015517 | Ga0496124_0015517_5877_6515 | 205 |
| 555 | 3300049649 | Ga0501198_000102 | Ga0501198_000102_9032_9658 | 205 |
| 556 | 3300049662 | Ga0501222_000008 | Ga0501222_000008_111248_111874 | 205 |
| 557 | 3300050489 | nmdc:mga03683_277888_c1 | nmdc:mga03683_277888_c1_69_692 | 205 |
| 558 | 3300050493 | nmdc:mga0k408_132531_c1 | nmdc:mga0k408_132531_c1_103_726 | 205 |
| 559 | 3300050493 | nmdc:mga0k408_177614_c1 | nmdc:mga0k408_177614_c1_603_1226 | 205 |
| 560 | 3300050493 | nmdc:mga0k408_196874_c1 | nmdc:mga0k408_196874_c1_268_891 | 205 |
| 561 | 3300050493 | nmdc:mga0k408_487922_c1 | nmdc:mga0k408_487922_c1_17_640 | 205 |
| 562 | 3300050493 | nmdc:mga0k408_59835_c1 | nmdc:mga0k408_59835_c1_798_1421 | 205 |
| 563 | 3300053080 | Ga0500635_0000083 | Ga0500635_0000083_44481_45110 | 205 |
| 564 | 3300053739 | Ga0500587_000079 | Ga0500587_000079_261_884 | 205 |
| 565 | iso_pu_bacteria | 2511231003 | 2511248376 | 205 |
| 566 | iso_pu_bacteria | 2548876994 | 2550693536 | 205 |
| 567 | iso_pu_bacteria | 2643221603 | 2644030407 | 205 |
| 568 | iso_pu_bacteria | 2818991436 | 2819542751 | 205 |
| 569 | iso_pu_bacteria | 2818991445 | 2819594530 | 205 |
| 570 | 3300002704 | JGI25155J39150_1000288 | JGI25155J39150_100028814 | 206 |
| 571 | 3300002705 | JGI25156J39149_1000695 | JGI25156J39149_100069514 | 206 |
| 572 | 3300002705 | JGI25156J39149_1002511 | JGI25156J39149_10025112 | 206 |
| 573 | 3300002738 | JGI25154J39366_1000350 | JGI25154J39366_10003507 | 206 |
| 574 | 3300002738 | JGI25154J39366_1000571 | JGI25154J39366_10005717 | 206 |
| 575 | 3300002741 | JGI25157J39369_1000773 | JGI25157J39369_100077311 | 206 |
| 576 | 3300003214 | JGI25165J46597_1000001 | JGI25165J46597_1000001260 | 206 |
| 577 | 3300003751 | Ga0055538_1000001 | Ga0055538_1000001772 | 206 |
| 578 | 3300003752 | Ga0055539_1000001 | Ga0055539_1000001772 | 206 |
| 579 | 3300003756 | Ga0055533_1000003 | Ga0055533_1000003260 | 206 |
| 580 | 3300003758 | Ga0055532_1000005 | Ga0055532_1000005423 | 206 |
| 581 | 3300003759 | Ga0055525_1000003 | Ga0055525_1000003260 | 206 |
| 582 | 3300003761 | Ga0055535_1002863 | Ga0055535_10028634 | 206 |
| 583 | 3300003841 | Ga0055541_1000001 | Ga0055541_1000001260 | 206 |
| 584 | 3300005614 | Ga0068856_100056975 | Ga0068856_1000569752 | 206 |
| 585 | 3300005616 | Ga0068852_100102675 | Ga0068852_1001026752 | 206 |
| 586 | 3300009011 | Ga0105251_10049399 | Ga0105251_100493992 | 206 |
| 587 | 3300009093 | Ga0105240_10012100 | Ga0105240_1001210013 | 206 |
| 588 | 3300009093 | Ga0105240_10017206 | Ga0105240_100172066 | 206 |
| 589 | 3300009545 | Ga0105237_10499422 | Ga0105237_104994222 | 206 |
| 590 | 3300009551 | Ga0105238_10030398 | Ga0105238_100303984 | 206 |
| 591 | 3300014497 | Ga0182008_10027616 | Ga0182008_100276162 | 206 |
| 592 | 3300015265 | Ga0182005_1000158 | Ga0182005_100015837 | 206 |
| 593 | 3300025206 | Ga0209435_100160 | Ga0209435_10016013 | 206 |
| 594 | 3300025206 | Ga0209435_100473 | Ga0209435_1004738 | 206 |
| 595 | 3300025224 | Ga0209784_100004 | Ga0209784_100004260 | 206 |
| 596 | 3300025225 | Ga0209566_100004 | Ga0209566_100004417 | 206 |
| 597 | 3300025226 | Ga0209674_100006 | Ga0209674_100006417 | 206 |
| 598 | 3300025229 | Ga0209147_100011 | Ga0209147_10001113 | 206 |
| 599 | 3300025230 | Ga0209563_100009 | Ga0209563_100009260 | 206 |
| 600 | 3300025231 | Ga0207427_101086 | Ga0207427_1010864 | 206 |
| 601 | 3300025233 | Ga0209437_100004 | Ga0209437_100004260 | 206 |
| 602 | 3300025233 | Ga0209437_100259 | Ga0209437_10025912 | 206 |
| 603 | 3300025242 | Ga0209258_100580 | Ga0209258_10058032 | 206 |
| 604 | 3300025246 | Ga0209646_1000403 | Ga0209646_10004037 | 206 |
| 605 | 3300025246 | Ga0209646_1000503 | Ga0209646_10005037 | 206 |
| 606 | 3300025250 | Ga0209026_1000760 | Ga0209026_10007607 | 206 |
| 607 | 3300025253 | Ga0209677_100005 | Ga0209677_100005260 | 206 |
| 608 | 3300025254 | Ga0209148_1005971 | Ga0209148_10059714 | 206 |
| 609 | 3300025256 | Ga0209759_1000253 | Ga0209759_10002537 | 206 |
| 610 | 3300025256 | Ga0209759_1001054 | Ga0209759_10010547 | 206 |
| 611 | 3300025261 | Ga0209233_1000005 | Ga0209233_1000005417 | 206 |
| 612 | 3300025913 | Ga0207695_10009547 | Ga0207695_100095472 | 206 |
| 613 | 3300025913 | Ga0207695_10032918 | Ga0207695_100329186 | 206 |
| 614 | 3300025923 | Ga0207681_10184195 | Ga0207681_101841952 | 206 |
| 615 | 3300026078 | Ga0207702_10058186 | Ga0207702_100581862 | 206 |
| 616 | 3300026142 | Ga0207698_10008917 | Ga0207698_100089172 | 206 |
| 617 | 3300037471 | Ga0395905_0000750 | Ga0395905_0000750_18342_19109 | 206 |
| 618 | 3300044842 | Ga0466957_0047867 | Ga0466957_0047867_458_1111 | 206 |
| 619 | 3300046452 | Ga0495617_085942 | Ga0495617_085942_41_661 | 206 |
| 620 | 3300046454 | Ga0495592_0100052 | Ga0495592_0100052_591_1211 | 206 |
| 621 | 3300046460 | Ga0495638_0016484 | Ga0495638_0016484_809_1429 | 206 |
| 622 | 3300046460 | Ga0495638_0244567 | Ga0495638_0244567_303_926 | 206 |
| 623 | 3300046462 | Ga0495651_0134207 | Ga0495651_0134207_1045_1674 | 206 |
| 624 | 3300046463 | Ga0495653_0105341 | Ga0495653_0105341_1130_1759 | 206 |
| 625 | 3300046472 | Ga0495580_0699376 | Ga0495580_0699376_21_644 | 206 |
| 626 | 3300046474 | Ga0495605_0012486 | Ga0495605_0012486_3437_4057 | 206 |
| 627 | 3300046491 | Ga0495584_0004898 | Ga0495584_0004898_5155_5775 | 206 |
| 628 | 3300046492 | Ga0495585_0000006 | Ga0495585_0000006_294902_295525 | 206 |
| 629 | 3300046492 | Ga0495585_0010286 | Ga0495585_0010286_4414_5037 | 206 |
| 630 | 3300046492 | Ga0495585_0154537 | Ga0495585_0154537_190_876 | 206 |
| 631 | 3300046499 | Ga0495594_0003640 | Ga0495594_0003640_1421_2044 | 206 |
| 632 | 3300046501 | Ga0495607_0009947 | Ga0495607_0009947_3813_4439 | 206 |
| 633 | 3300046501 | Ga0495607_0117837 | Ga0495607_0117837_422_1042 | 206 |
| 634 | 3300046506 | Ga0495583_0000056 | Ga0495583_0000056_120616_121236 | 206 |
| 635 | 3300046507 | Ga0495606_0133665 | Ga0495606_0133665_720_1343 | 206 |
| 636 | 3300046512 | Ga0495610_0020472 | Ga0495610_0020472_810_1430 | 206 |
| 637 | 3300046513 | Ga0495616_0000057 | Ga0495616_0000057_65167_65799 | 206 |
| 638 | 3300046515 | Ga0495620_0049791 | Ga0495620_0049791_513_1136 | 206 |
| 639 | 3300046518 | Ga0495631_0005293 | Ga0495631_0005293_5762_6385 | 206 |
| 640 | 3300046523 | Ga0495644_0007023 | Ga0495644_0007023_2993_3613 | 206 |
| 641 | 3300046523 | Ga0495644_0009481 | Ga0495644_0009481_240_926 | 206 |
| 642 | 3300046524 | Ga0495648_0001488 | Ga0495648_0001488_19258_19878 | 206 |
| 643 | 3300046526 | Ga0495666_0046494 | Ga0495666_0046494_1121_1744 | 206 |
| 644 | 3300046528 | Ga0495642_0012989 | Ga0495642_0012989_562_1185 | 206 |
| 645 | 3300046538 | Ga0495609_0001536 | Ga0495609_0001536_5867_6487 | 206 |
| 646 | 3300046543 | Ga0495645_0392211 | Ga0495645_0392211_145_774 | 206 |
| 647 | 3300046557 | Ga0495622_0102906 | Ga0495622_0102906_303_926 | 206 |
| 648 | 3300046558 | Ga0495633_0003338 | Ga0495633_0003338_663_1283 | 206 |
| 649 | 3300046558 | Ga0495633_0034346 | Ga0495633_0034346_85_708 | 206 |
| 650 | 3300046558 | Ga0495633_0260102 | Ga0495633_0260102_95_718 | 206 |
| 651 | 3300046615 | Ga0495656_0017670 | Ga0495656_0017670_720_1340 | 206 |
| 652 | 3300046642 | Ga0495634_0369017 | Ga0495634_0369017_124_753 | 206 |
| 653 | 3300046648 | Ga0495611_0011108 | Ga0495611_0011108_2861_3547 | 206 |
| 654 | 3300046648 | Ga0495611_0025380 | Ga0495611_0025380_261_884 | 206 |
| 655 | 3300046648 | Ga0495611_0030378 | Ga0495611_0030378_1280_1903 | 206 |
| 656 | 3300046660 | Ga0495625_0004306 | Ga0495625_0004306_9505_10134 | 206 |
| 657 | 3300046660 | Ga0495625_0029610 | Ga0495625_0029610_613_1233 | 206 |
| 658 | 3300046663 | Ga0495635_0121076 | Ga0495635_0121076_1068_1697 | 206 |
| 659 | 3300046664 | Ga0495659_0000526 | Ga0495659_0000526_9226_9846 | 206 |
| 660 | 3300046664 | Ga0495659_0316897 | Ga0495659_0316897_15_635 | 206 |
| 661 | 3300046665 | Ga0495661_0051612 | Ga0495661_0051612_1673_2293 | 206 |
| 662 | 3300046678 | Ga0495599_0175798 | Ga0495599_0175798_383_1012 | 206 |
| 663 | 3300046691 | Ga0495670_0003903 | Ga0495670_0003903_6271_6891 | 206 |
| 664 | 3300046691 | Ga0495670_0110917 | Ga0495670_0110917_236_859 | 206 |
| 665 | 3300046794 | Ga0495589_0024976 | Ga0495589_0024976_2236_2859 | 206 |
| 666 | 3300046809 | Ga0495600_0000474 | Ga0495600_0000474_4035_4664 | 206 |
| 667 | 3300046810 | Ga0495660_0025613 | Ga0495660_0025613_1971_2594 | 206 |
| 668 | 3300047318 | Ga0495636_0001913 | Ga0495636_0001913_551_1171 | 206 |
| 669 | 3300047318 | Ga0495636_0002620 | Ga0495636_0002620_2955_3578 | 206 |
| 670 | 3300047320 | Ga0495672_0156877 | Ga0495672_0156877_15_635 | 206 |
| 671 | 3300047321 | Ga0495676_0122523 | Ga0495676_0122523_323_946 | 206 |
| 672 | 3300047323 | Ga0495683_0001361 | Ga0495683_0001361_15037_15660 | 206 |
| 673 | 3300047323 | Ga0495683_0045537 | Ga0495683_0045537_1413_2033 | 206 |
| 674 | 3300047323 | Ga0495683_0229991 | Ga0495683_0229991_50_673 | 206 |
| 675 | 3300047443 | Ga0495687_001108 | Ga0495687_001108_12041_12661 | 206 |
| 676 | 3300047445 | Ga0495677_0007859 | Ga0495677_0007859_1354_1977 | 206 |
| 677 | 3300047447 | Ga0495685_000113 | Ga0495685_000113_12410_13030 | 206 |
| 678 | 3300047472 | Ga0495686_0053453 | Ga0495686_0053453_759_1379 | 206 |
| 679 | 3300048091 | Ga0495626_0109953 | Ga0495626_0109953_393_1025 | 206 |
| 680 | 3300048907 | Ga0496104_0338360 | Ga0496104_0338360_102_764 | 206 |
| 681 | 3300048913 | Ga0496110_0045736 | Ga0496110_0045736_2745_3380 | 206 |
| 682 | 3300048918 | Ga0496115_0220001 | Ga0496115_0220001_735_1358 | 206 |
| 683 | 3300048919 | Ga0496116_0033774 | Ga0496116_0033774_141_770 | 206 |
| 684 | 3300048921 | Ga0496118_0040010 | Ga0496118_0040010_769_1398 | 206 |
| 685 | 3300048925 | Ga0496122_0000261 | Ga0496122_0000261_109544_110173 | 206 |
| 686 | 3300048926 | Ga0496123_0000218 | Ga0496123_0000218_107105_107734 | 206 |
| 687 | 3300048928 | Ga0496125_0000256 | Ga0496125_0000256_5578_6198 | 206 |
| 688 | 3300048928 | Ga0496125_0067915 | Ga0496125_0067915_455_1084 | 206 |
| 689 | 3300049459 | Ga0495678_003135 | Ga0495678_003135_4144_4764 | 206 |
| 690 | 3300049460 | Ga0495682_0038533 | Ga0495682_0038533_412_1032 | 206 |
| 691 | 3300053077 | Ga0495601_0030324 | Ga0495601_0030324_1127_1756 | 206 |
| 692 | 3300053119 | Ga0500595_003047 | Ga0500595_003047_150_779 | 206 |
| 693 | 3300053154 | Ga0500619_000742 | Ga0500619_000742_518_1147 | 206 |
| 694 | 3300053161 | Ga0500634_0108608 | Ga0500634_0108608_184_813 | 206 |
| 695 | 3300006195 | Ga0075366_10197495 | Ga0075366_101974952 | 207 |
| 696 | 3300026067 | Ga0207678_10488071 | Ga0207678_104880712 | 207 |
| 697 | 3300031251 | Ga0265327_10031415 | Ga0265327_100314152 | 207 |
| 698 | 3300033179 | Ga0307507_10021968 | Ga0307507_100219682 | 207 |
| 699 | 3300037312 | Ga0395899_0001064 | Ga0395899_0001064_17549_18187 | 207 |
| 700 | 3300037312 | Ga0395899_0002813 | Ga0395899_0002813_12615_13253 | 207 |
| 701 | 3300037312 | Ga0395899_0003608 | Ga0395899_0003608_3990_4625 | 207 |
| 702 | 3300037418 | Ga0395900_0005698 | Ga0395900_0005698_9213_9848 | 207 |
| 703 | 3300037418 | Ga0395900_0283273 | Ga0395900_0283273_639_1277 | 207 |
| 704 | 3300037471 | Ga0395905_0208288 | Ga0395905_0208288_453_1088 | 207 |
| 705 | 3300038443 | Ga0395901_0000002 | Ga0395901_0000002_453141_453791 | 207 |
| 706 | 3300038443 | Ga0395901_0001718 | Ga0395901_0001718_3787_4437 | 207 |
| 707 | 3300038443 | Ga0395901_0136559 | Ga0395901_0136559_40_678 | 207 |
| 708 | 3300044684 | Ga0466966_0006128 | Ga0466966_0006128_3598_4233 | 207 |
| 709 | 3300044719 | Ga0466971_0017715 | Ga0466971_0017715_2226_2861 | 207 |
| 710 | 3300045049 | Ga0466959_0052023 | Ga0466959_0052023_511_1143 | 207 |
| 711 | 3300046506 | Ga0495583_0002345 | Ga0495583_0002345_11590_12222 | 207 |
| 712 | 3300046512 | Ga0495610_0035172 | Ga0495610_0035172_1838_2461 | 207 |
| 713 | 3300046522 | Ga0495643_0000415 | Ga0495643_0000415_31114_31746 | 207 |
| 714 | 3300046558 | Ga0495633_0065743 | Ga0495633_0065743_892_1527 | 207 |
| 715 | 3300048929 | Ga0496126_0054778 | Ga0496126_0054778_18_656 | 207 |
| 716 | 3300049679 | Ga0501249_003963 | Ga0501249_003963_2246_2869 | 207 |
| 717 | 3300049766 | Ga0501269_000210 | Ga0501269_000210_4293_4916 | 207 |
| 718 | 3300053178 | Ga0500637_0152420 | Ga0500637_0152420_397_1032 | 207 |
| 719 | 3300059511 | Ga0587091_002909 | Ga0587091_002909_1303_1938 | 207 |
| 720 | 3300059639 | Ga0587062_001995 | Ga0587062_001995_1145_1780 | 207 |
| 721 | 3300060346 | Ga0587111_0003612 | Ga0587111_0003612_450_1085 | 207 |
| 722 | 3300001989 | JGI24739J22299_10030478 | JGI24739J22299_100304781 | 208 |
| 723 | 3300001990 | JGI24737J22298_10012956 | JGI24737J22298_100129562 | 208 |
| 724 | 3300002067 | JGI24735J21928_10009274 | JGI24735J21928_100092743 | 208 |
| 725 | 3300002705 | JGI25156J39149_1007991 | JGI25156J39149_10079912 | 208 |
| 726 | 3300002738 | JGI25154J39366_1003796 | JGI25154J39366_10037962 | 208 |
| 727 | 3300002741 | JGI25157J39369_1000018 | JGI25157J39369_100001869 | 208 |
| 728 | 3300003187 | JGI25151J46595_10035406 | JGI25151J46595_100354062 | 208 |
| 729 | 3300003187 | JGI25151J46595_10055552 | JGI25151J46595_100555521 | 208 |
| 730 | 3300003320 | rootH2_10128398 | rootH2_101283981 | 208 |
| 731 | 3300003322 | rootL2_10017918 | rootL2_100179182 | 208 |
| 732 | 3300003323 | rootH1_10042583 | rootH1_100425832 | 208 |
| 733 | 3300003323 | rootH1_10042585 | rootH1_100425852 | 208 |
| 734 | 3300003752 | Ga0055539_1000240 | Ga0055539_10002403 | 208 |
| 735 | 3300003752 | Ga0055539_1001263 | Ga0055539_10012632 | 208 |
| 736 | 3300003756 | Ga0055533_1000103 | Ga0055533_100010313 | 208 |
| 737 | 3300003759 | Ga0055525_1001499 | Ga0055525_10014994 | 208 |
| 738 | 3300003775 | Ga0055524_1017165 | Ga0055524_10171652 | 208 |
| 739 | 3300003781 | Ga0055536_1000252 | Ga0055536_100025215 | 208 |
| 740 | 3300003784 | Ga0055534_1004596 | Ga0055534_10045961 | 208 |
| 741 | 3300005327 | Ga0070658_10086907 | Ga0070658_100869072 | 208 |
| 742 | 3300005327 | Ga0070658_10440175 | Ga0070658_104401752 | 208 |
| 743 | 3300005330 | Ga0070690_100031128 | Ga0070690_1000311282 | 208 |
| 744 | 3300005331 | Ga0070670_100273775 | Ga0070670_1002737752 | 208 |
| 745 | 3300005331 | Ga0070670_100295403 | Ga0070670_1002954032 | 208 |
| 746 | 3300005333 | Ga0070677_10023109 | Ga0070677_100231093 | 208 |
| 747 | 3300005334 | Ga0068869_100037044 | Ga0068869_1000370442 | 208 |
| 748 | 3300005335 | Ga0070666_10019648 | Ga0070666_100196482 | 208 |
| 749 | 3300005338 | Ga0068868_100195124 | Ga0068868_1001951242 | 208 |
| 750 | 3300005339 | Ga0070660_100227965 | Ga0070660_1002279652 | 208 |
| 751 | 3300005340 | Ga0070689_100346171 | Ga0070689_1003461712 | 208 |
| 752 | 3300005344 | Ga0070661_100023457 | Ga0070661_1000234576 | 208 |
| 753 | 3300005347 | Ga0070668_100059448 | Ga0070668_1000594483 | 208 |
| 754 | 3300005353 | Ga0070669_100004469 | Ga0070669_1000044694 | 208 |
| 755 | 3300005354 | Ga0070675_100066570 | Ga0070675_1000665703 | 208 |
| 756 | 3300005354 | Ga0070675_100501698 | Ga0070675_1005016981 | 208 |
| 757 | 3300005355 | Ga0070671_100031566 | Ga0070671_1000315662 | 208 |
| 758 | 3300005355 | Ga0070671_100187716 | Ga0070671_1001877162 | 208 |
| 759 | 3300005356 | Ga0070674_100028072 | Ga0070674_1000280724 | 208 |
| 760 | 3300005364 | Ga0070673_100028417 | Ga0070673_1000284172 | 208 |
| 761 | 3300005366 | Ga0070659_100174856 | Ga0070659_1001748561 | 208 |
| 762 | 3300005367 | Ga0070667_100002718 | Ga0070667_1000027186 | 208 |
| 763 | 3300005367 | Ga0070667_100246137 | Ga0070667_1002461372 | 208 |
| 764 | 3300005438 | Ga0070701_10066089 | Ga0070701_100660891 | 208 |
| 765 | 3300005455 | Ga0070663_100023240 | Ga0070663_1000232403 | 208 |
| 766 | 3300005456 | Ga0070678_100130407 | Ga0070678_1001304072 | 208 |
| 767 | 3300005457 | Ga0070662_100016597 | Ga0070662_1000165975 | 208 |
| 768 | 3300005459 | Ga0068867_100027789 | Ga0068867_1000277894 | 208 |
| 769 | 3300005459 | Ga0068867_100122049 | Ga0068867_1001220493 | 208 |
| 770 | 3300005459 | Ga0068867_100800152 | Ga0068867_1008001521 | 208 |
| 771 | 3300005535 | Ga0070684_100508873 | Ga0070684_1005088731 | 208 |
| 772 | 3300005539 | Ga0068853_100072486 | Ga0068853_1000724862 | 208 |
| 773 | 3300005539 | Ga0068853_100551899 | Ga0068853_1005518991 | 208 |
| 774 | 3300005543 | Ga0070672_100036953 | Ga0070672_1000369534 | 208 |
| 775 | 3300005544 | Ga0070686_100065917 | Ga0070686_1000659172 | 208 |
| 776 | 3300005563 | Ga0068855_100127299 | Ga0068855_1001272993 | 208 |
| 777 | 3300005577 | Ga0068857_100007953 | Ga0068857_1000079535 | 208 |
| 778 | 3300005578 | Ga0068854_100004599 | Ga0068854_1000045992 | 208 |
| 779 | 3300005614 | Ga0068856_100008259 | Ga0068856_1000082598 | 208 |
| 780 | 3300005616 | Ga0068852_100147709 | Ga0068852_1001477092 | 208 |
| 781 | 3300005616 | Ga0068852_100186438 | Ga0068852_1001864383 | 208 |
| 782 | 3300005616 | Ga0068852_100955562 | Ga0068852_1009555622 | 208 |
| 783 | 3300005618 | Ga0068864_100301443 | Ga0068864_1003014432 | 208 |
| 784 | 3300005618 | Ga0068864_100560238 | Ga0068864_1005602382 | 208 |
| 785 | 3300005718 | Ga0068866_10010619 | Ga0068866_100106194 | 208 |
| 786 | 3300005719 | Ga0068861_100016063 | Ga0068861_1000160637 | 208 |
| 787 | 3300005719 | Ga0068861_100158841 | Ga0068861_1001588412 | 208 |
| 788 | 3300005841 | Ga0068863_100019781 | Ga0068863_1000197818 | 208 |
| 789 | 3300005841 | Ga0068863_100473095 | Ga0068863_1004730952 | 208 |
| 790 | 3300005842 | Ga0068858_100017353 | Ga0068858_1000173532 | 208 |
| 791 | 3300005843 | Ga0068860_100565456 | Ga0068860_1005654562 | 208 |
| 792 | 3300006195 | Ga0075366_10099523 | Ga0075366_100995232 | 208 |
| 793 | 3300006353 | Ga0075370_10002946 | Ga0075370_100029464 | 208 |
| 794 | 3300006881 | Ga0068865_100269843 | Ga0068865_1002698432 | 208 |
| 795 | 3300006948 | Ga0099826_10000018 | Ga0099826_1000001877 | 208 |
| 796 | 3300009011 | Ga0105251_10002082 | Ga0105251_100020823 | 208 |
| 797 | 3300009011 | Ga0105251_10013210 | Ga0105251_100132105 | 208 |
| 798 | 3300009011 | Ga0105251_10024566 | Ga0105251_100245663 | 208 |
| 799 | 3300009093 | Ga0105240_10024629 | Ga0105240_100246296 | 208 |
| 800 | 3300009098 | Ga0105245_10262933 | Ga0105245_102629331 | 208 |
| 801 | 3300009148 | Ga0105243_10054161 | Ga0105243_100541613 | 208 |
| 802 | 3300009174 | Ga0105241_10186928 | Ga0105241_101869282 | 208 |
| 803 | 3300009177 | Ga0105248_10078637 | Ga0105248_100786374 | 208 |
| 804 | 3300009545 | Ga0105237_10755773 | Ga0105237_107557732 | 208 |
| 805 | 3300009551 | Ga0105238_10055566 | Ga0105238_100555661 | 208 |
| 806 | 3300009553 | Ga0105249_10007528 | Ga0105249_100075285 | 208 |
| 807 | 3300013102 | Ga0157371_10000001 | Ga0157371_10000001636 | 208 |
| 808 | 3300013102 | Ga0157371_10207645 | Ga0157371_102076452 | 208 |
| 809 | 3300013104 | Ga0157370_10366078 | Ga0157370_103660782 | 208 |
| 810 | 3300013105 | Ga0157369_10169148 | Ga0157369_101691482 | 208 |
| 811 | 3300013105 | Ga0157369_10236802 | Ga0157369_102368022 | 208 |
| 812 | 3300013105 | Ga0157369_10383864 | Ga0157369_103838641 | 208 |
| 813 | 3300013296 | Ga0157374_10036965 | Ga0157374_100369652 | 208 |
| 814 | 3300013306 | Ga0163162_10040965 | Ga0163162_100409652 | 208 |
| 815 | 3300013306 | Ga0163162_10728762 | Ga0163162_107287622 | 208 |
| 816 | 3300013307 | Ga0157372_10361837 | Ga0157372_103618372 | 208 |
| 817 | 3300013308 | Ga0157375_10008692 | Ga0157375_100086927 | 208 |
| 818 | 3300013308 | Ga0157375_10173565 | Ga0157375_101735653 | 208 |
| 819 | 3300014326 | Ga0157380_10051165 | Ga0157380_100511652 | 208 |
| 820 | 3300014969 | Ga0157376_10226589 | Ga0157376_102265892 | 208 |
| 821 | 3300014969 | Ga0157376_10345560 | Ga0157376_103455602 | 208 |
| 822 | 3300015262 | Ga0182007_10010110 | Ga0182007_100101101 | 208 |
| 823 | 3300021361 | Ga0213872_10052963 | Ga0213872_100529632 | 208 |
| 824 | 3300025226 | Ga0209674_100003 | Ga0209674_100003290 | 208 |
| 825 | 3300025230 | Ga0209563_100010 | Ga0209563_10001019 | 208 |
| 826 | 3300025242 | Ga0209258_100525 | Ga0209258_10052527 | 208 |
| 827 | 3300025246 | Ga0209646_1000067 | Ga0209646_10000674 | 208 |
| 828 | 3300025250 | Ga0209026_1000033 | Ga0209026_1000033227 | 208 |
| 829 | 3300025253 | Ga0209677_100068 | Ga0209677_100068103 | 208 |
| 830 | 3300025253 | Ga0209677_102920 | Ga0209677_1029204 | 208 |
| 831 | 3300025256 | Ga0209759_1000024 | Ga0209759_1000024227 | 208 |
| 832 | 3300025263 | Ga0209565_1002746 | Ga0209565_10027465 | 208 |
| 833 | 3300025291 | Ga0209675_1000100 | Ga0209675_1000100106 | 208 |
| 834 | 3300025291 | Ga0209675_1009393 | Ga0209675_10093933 | 208 |
| 835 | 3300025292 | Ga0209676_1000012 | Ga0209676_1000012750 | 208 |
| 836 | 3300025294 | Ga0209025_1001877 | Ga0209025_10018779 | 208 |
| 837 | 3300025294 | Ga0209025_1004210 | Ga0209025_10042109 | 208 |
| 838 | 3300025295 | Ga0209564_1003839 | Ga0209564_10038391 | 208 |
| 839 | 3300025295 | Ga0209564_1004073 | Ga0209564_10040737 | 208 |
| 840 | 3300025299 | Ga0209256_1000676 | Ga0209256_100067640 | 208 |
| 841 | 3300025303 | Ga0209051_1004528 | Ga0209051_10045285 | 208 |
| 842 | 3300025315 | Ga0207697_10031970 | Ga0207697_100319702 | 208 |
| 843 | 3300025321 | Ga0207656_10276333 | Ga0207656_102763331 | 208 |
| 844 | 3300025735 | Ga0207713_1000135 | Ga0207713_100013517 | 208 |
| 845 | 3300025735 | Ga0207713_1055329 | Ga0207713_10553292 | 208 |
| 846 | 3300025893 | Ga0207682_10006644 | Ga0207682_100066446 | 208 |
| 847 | 3300025893 | Ga0207682_10039046 | Ga0207682_100390463 | 208 |
| 848 | 3300025899 | Ga0207642_10016456 | Ga0207642_100164563 | 208 |
| 849 | 3300025903 | Ga0207680_10018874 | Ga0207680_100188741 | 208 |
| 850 | 3300025904 | Ga0207647_10035754 | Ga0207647_100357543 | 208 |
| 851 | 3300025907 | Ga0207645_10029160 | Ga0207645_100291602 | 208 |
| 852 | 3300025907 | Ga0207645_10414350 | Ga0207645_104143502 | 208 |
| 853 | 3300025908 | Ga0207643_10097419 | Ga0207643_100974192 | 208 |
| 854 | 3300025909 | Ga0207705_10106102 | Ga0207705_101061022 | 208 |
| 855 | 3300025911 | Ga0207654_10289787 | Ga0207654_102897872 | 208 |
| 856 | 3300025913 | Ga0207695_10010175 | Ga0207695_1001017510 | 208 |
| 857 | 3300025913 | Ga0207695_10079069 | Ga0207695_100790693 | 208 |
| 858 | 3300025914 | Ga0207671_10033303 | Ga0207671_100333031 | 208 |
| 859 | 3300025918 | Ga0207662_10002597 | Ga0207662_100025972 | 208 |
| 860 | 3300025919 | Ga0207657_10149395 | Ga0207657_101493952 | 208 |
| 861 | 3300025920 | Ga0207649_10252355 | Ga0207649_102523551 | 208 |
| 862 | 3300025923 | Ga0207681_10008770 | Ga0207681_100087703 | 208 |
| 863 | 3300025924 | Ga0207694_10059333 | Ga0207694_100593332 | 208 |
| 864 | 3300025925 | Ga0207650_10350312 | Ga0207650_103503122 | 208 |
| 865 | 3300025926 | Ga0207659_10032977 | Ga0207659_100329772 | 208 |
| 866 | 3300025926 | Ga0207659_10038293 | Ga0207659_100382932 | 208 |
| 867 | 3300025927 | Ga0207687_10034805 | Ga0207687_100348053 | 208 |
| 868 | 3300025931 | Ga0207644_10048134 | Ga0207644_100481343 | 208 |
| 869 | 3300025932 | Ga0207690_10507350 | Ga0207690_105073502 | 208 |
| 870 | 3300025933 | Ga0207706_10015322 | Ga0207706_100153224 | 208 |
| 871 | 3300025935 | Ga0207709_10002721 | Ga0207709_100027218 | 208 |
| 872 | 3300025936 | Ga0207670_10369958 | Ga0207670_103699582 | 208 |
| 873 | 3300025937 | Ga0207669_10006656 | Ga0207669_100066563 | 208 |
| 874 | 3300025940 | Ga0207691_10048281 | Ga0207691_100482812 | 208 |
| 875 | 3300025940 | Ga0207691_10093888 | Ga0207691_100938883 | 208 |
| 876 | 3300025940 | Ga0207691_10096426 | Ga0207691_100964263 | 208 |
| 877 | 3300025942 | Ga0207689_10011506 | Ga0207689_100115067 | 208 |
| 878 | 3300025942 | Ga0207689_10039908 | Ga0207689_100399082 | 208 |
| 879 | 3300025944 | Ga0207661_10052657 | Ga0207661_100526574 | 208 |
| 880 | 3300025949 | Ga0207667_10021476 | Ga0207667_100214765 | 208 |
| 881 | 3300025961 | Ga0207712_10009755 | Ga0207712_100097553 | 208 |
| 882 | 3300025972 | Ga0207668_10046072 | Ga0207668_100460723 | 208 |
| 883 | 3300025981 | Ga0207640_10079351 | Ga0207640_100793512 | 208 |
| 884 | 3300025981 | Ga0207640_10096861 | Ga0207640_100968612 | 208 |
| 885 | 3300025986 | Ga0207658_10013291 | Ga0207658_100132915 | 208 |
| 886 | 3300026023 | Ga0207677_10040223 | Ga0207677_100402233 | 208 |
| 887 | 3300026035 | Ga0207703_10005816 | Ga0207703_100058168 | 208 |
| 888 | 3300026067 | Ga0207678_10076301 | Ga0207678_100763013 | 208 |
| 889 | 3300026078 | Ga0207702_10001261 | Ga0207702_1000126113 | 208 |
| 890 | 3300026088 | Ga0207641_10005241 | Ga0207641_100052417 | 208 |
| 891 | 3300026089 | Ga0207648_10047299 | Ga0207648_100472992 | 208 |
| 892 | 3300026089 | Ga0207648_10225905 | Ga0207648_102259053 | 208 |
| 893 | 3300026089 | Ga0207648_10356977 | Ga0207648_103569772 | 208 |
| 894 | 3300026116 | Ga0207674_10057723 | Ga0207674_100577233 | 208 |
| 895 | 3300026118 | Ga0207675_100002925 | Ga0207675_10000292513 | 208 |
| 896 | 3300026118 | Ga0207675_100111936 | Ga0207675_1001119362 | 208 |
| 897 | 3300026121 | Ga0207683_10041387 | Ga0207683_100413874 | 208 |
| 898 | 3300026121 | Ga0207683_10377001 | Ga0207683_103770012 | 208 |
| 899 | 3300026142 | Ga0207698_10121456 | Ga0207698_101214561 | 208 |
| 900 | 3300027666 | Ga0209282_1000052 | Ga0209282_100005219 | 208 |
| 901 | 3300028379 | Ga0268266_10176480 | Ga0268266_101764802 | 208 |
| 902 | 3300028381 | Ga0268264_10001986 | Ga0268264_100019864 | 208 |
| 903 | 3300030521 | Ga0307511_10076838 | Ga0307511_100768383 | 208 |
| 904 | 3300031730 | Ga0307516_10008972 | Ga0307516_100089724 | 208 |
| 905 | 3300035410 | Ga0373924_0027378 | Ga0373924_0027378_1547_2191 | 208 |
| 906 | 3300035724 | Ga0373933_0320756 | Ga0373933_0320756_223_867 | 208 |
| 907 | 3300036401 | Ga0373937_0089551 | Ga0373937_0089551_1805_2449 | 208 |
| 908 | 3300036401 | Ga0373937_0468785 | Ga0373937_0468785_500_1144 | 208 |
| 909 | 3300037466 | Ga0395898_0097883 | Ga0395898_0097883_910_1551 | 208 |
| 910 | 3300039447 | Ga0436361_0338967 | Ga0436361_0338967_1117_1758 | 208 |
| 911 | 3300044684 | Ga0466966_0089471 | Ga0466966_0089471_325_975 | 208 |
| 912 | 3300044693 | Ga0466961_0018736 | Ga0466961_0018736_2046_2696 | 208 |
| 913 | 3300044694 | Ga0466963_0047308 | Ga0466963_0047308_593_1243 | 208 |
| 914 | 3300044706 | Ga0466964_0002848 | Ga0466964_0002848_2062_2712 | 208 |
| 915 | 3300044719 | Ga0466971_0005142 | Ga0466971_0005142_4563_5213 | 208 |
| 916 | 3300044765 | Ga0466970_0028412 | Ga0466970_0028412_1440_2090 | 208 |
| 917 | 3300045049 | Ga0466959_0009422 | Ga0466959_0009422_3941_4591 | 208 |
| 918 | 3300045836 | Ga0466958_0011505 | Ga0466958_0011505_684_1334 | 208 |
| 919 | 3300045976 | Ga0466967_0141742 | Ga0466967_0141742_476_1126 | 208 |
| 920 | 3300046454 | Ga0495592_0030409 | Ga0495592_0030409_3256_3909 | 208 |
| 921 | 3300046457 | Ga0495590_0021071 | Ga0495590_0021071_525_1178 | 208 |
| 922 | 3300046457 | Ga0495590_0054003 | Ga0495590_0054003_463_1116 | 208 |
| 923 | 3300046459 | Ga0495629_0000878 | Ga0495629_0000878_13605_14258 | 208 |
| 924 | 3300046459 | Ga0495629_0005319 | Ga0495629_0005319_1932_2585 | 208 |
| 925 | 3300046460 | Ga0495638_0013390 | Ga0495638_0013390_1855_2508 | 208 |
| 926 | 3300046462 | Ga0495651_0100121 | Ga0495651_0100121_1418_2071 | 208 |
| 927 | 3300046462 | Ga0495651_0351245 | Ga0495651_0351245_38_679 | 208 |
| 928 | 3300046463 | Ga0495653_0005181 | Ga0495653_0005181_1955_2608 | 208 |
| 929 | 3300046463 | Ga0495653_0007366 | Ga0495653_0007366_2555_3208 | 208 |
| 930 | 3300046463 | Ga0495653_0061355 | Ga0495653_0061355_980_1633 | 208 |
| 931 | 3300046471 | Ga0495650_0006345 | Ga0495650_0006345_3224_3877 | 208 |
| 932 | 3300046471 | Ga0495650_0009150 | Ga0495650_0009150_3295_3948 | 208 |
| 933 | 3300046472 | Ga0495580_0016442 | Ga0495580_0016442_3096_3749 | 208 |
| 934 | 3300046472 | Ga0495580_0020600 | Ga0495580_0020600_1367_2020 | 208 |
| 935 | 3300046472 | Ga0495580_0023359 | Ga0495580_0023359_3096_3749 | 208 |
| 936 | 3300046472 | Ga0495580_0050910 | Ga0495580_0050910_801_1454 | 208 |
| 937 | 3300046473 | Ga0495582_0027681 | Ga0495582_0027681_213_866 | 208 |
| 938 | 3300046473 | Ga0495582_0044024 | Ga0495582_0044024_1312_1965 | 208 |
| 939 | 3300046474 | Ga0495605_0003031 | Ga0495605_0003031_3463_4122 | 208 |
| 940 | 3300046477 | Ga0495664_0019005 | Ga0495664_0019005_2982_3635 | 208 |
| 941 | 3300046477 | Ga0495664_0495309 | Ga0495664_0495309_36_680 | 208 |
| 942 | 3300046500 | Ga0495596_0001004 | Ga0495596_0001004_3362_4021 | 208 |
| 943 | 3300046500 | Ga0495596_0031054 | Ga0495596_0031054_1027_1680 | 208 |
| 944 | 3300046500 | Ga0495596_0070668 | Ga0495596_0070668_109_762 | 208 |
| 945 | 3300046501 | Ga0495607_0068424 | Ga0495607_0068424_1214_1873 | 208 |
| 946 | 3300046506 | Ga0495583_0000159 | Ga0495583_0000159_110955_111596 | 208 |
| 947 | 3300046506 | Ga0495583_0004885 | Ga0495583_0004885_169_822 | 208 |
| 948 | 3300046507 | Ga0495606_0002998 | Ga0495606_0002998_12632_13273 | 208 |
| 949 | 3300046507 | Ga0495606_0038316 | Ga0495606_0038316_1361_2014 | 208 |
| 950 | 3300046507 | Ga0495606_0041103 | Ga0495606_0041103_196_849 | 208 |
| 951 | 3300046511 | Ga0495608_0072156 | Ga0495608_0072156_1297_1950 | 208 |
| 952 | 3300046512 | Ga0495610_0006028 | Ga0495610_0006028_4400_5059 | 208 |
| 953 | 3300046513 | Ga0495616_0004533 | Ga0495616_0004533_3416_4075 | 208 |
| 954 | 3300046515 | Ga0495620_0041244 | Ga0495620_0041244_1173_1826 | 208 |
| 955 | 3300046515 | Ga0495620_0049470 | Ga0495620_0049470_780_1433 | 208 |
| 956 | 3300046516 | Ga0495628_0029302 | Ga0495628_0029302_227_880 | 208 |
| 957 | 3300046516 | Ga0495628_0079729 | Ga0495628_0079729_1627_2280 | 208 |
| 958 | 3300046517 | Ga0495630_0044173 | Ga0495630_0044173_281_934 | 208 |
| 959 | 3300046523 | Ga0495644_0007542 | Ga0495644_0007542_2212_2841 | 208 |
| 960 | 3300046524 | Ga0495648_0036925 | Ga0495648_0036925_2424_3077 | 208 |
| 961 | 3300046524 | Ga0495648_0038209 | Ga0495648_0038209_160_819 | 208 |
| 962 | 3300046524 | Ga0495648_0165099 | Ga0495648_0165099_352_1005 | 208 |
| 963 | 3300046525 | Ga0495663_0002556 | Ga0495663_0002556_2125_2754 | 208 |
| 964 | 3300046526 | Ga0495666_0000318 | Ga0495666_0000318_9938_10591 | 208 |
| 965 | 3300046526 | Ga0495666_0008615 | Ga0495666_0008615_3088_3741 | 208 |
| 966 | 3300046531 | Ga0495665_0020210 | Ga0495665_0020210_2049_2702 | 208 |
| 967 | 3300046531 | Ga0495665_0060088 | Ga0495665_0060088_720_1373 | 208 |
| 968 | 3300046533 | Ga0495640_0017736 | Ga0495640_0017736_3536_4189 | 208 |
| 969 | 3300046535 | Ga0495586_0024342 | Ga0495586_0024342_1673_2326 | 208 |
| 970 | 3300046538 | Ga0495609_0003404 | Ga0495609_0003404_4357_5016 | 208 |
| 971 | 3300046538 | Ga0495609_0048047 | Ga0495609_0048047_858_1511 | 208 |
| 972 | 3300046542 | Ga0495597_0035088 | Ga0495597_0035088_968_1621 | 208 |
| 973 | 3300046543 | Ga0495645_0211290 | Ga0495645_0211290_408_1061 | 208 |
| 974 | 3300046557 | Ga0495622_0000570 | Ga0495622_0000570_7696_8349 | 208 |
| 975 | 3300046615 | Ga0495656_0073514 | Ga0495656_0073514_324_983 | 208 |
| 976 | 3300046616 | Ga0495668_0055234 | Ga0495668_0055234_216_857 | 208 |
| 977 | 3300046642 | Ga0495634_0053681 | Ga0495634_0053681_336_989 | 208 |
| 978 | 3300046648 | Ga0495611_0101818 | Ga0495611_0101818_167_820 | 208 |
| 979 | 3300046660 | Ga0495625_0052327 | Ga0495625_0052327_1381_2022 | 208 |
| 980 | 3300046660 | Ga0495625_0129530 | Ga0495625_0129530_406_1059 | 208 |
| 981 | 3300046663 | Ga0495635_0015435 | Ga0495635_0015435_2287_2940 | 208 |
| 982 | 3300046665 | Ga0495661_0009057 | Ga0495661_0009057_3041_3700 | 208 |
| 983 | 3300046665 | Ga0495661_0016750 | Ga0495661_0016750_3119_3757 | 208 |
| 984 | 3300046665 | Ga0495661_0175233 | Ga0495661_0175233_145_798 | 208 |
| 985 | 3300046674 | Ga0495588_0096087 | Ga0495588_0096087_371_1024 | 208 |
| 986 | 3300046678 | Ga0495599_0008525 | Ga0495599_0008525_2740_3393 | 208 |
| 987 | 3300046679 | Ga0495623_0002848 | Ga0495623_0002848_6868_7521 | 208 |
| 988 | 3300046680 | Ga0495646_0008984 | Ga0495646_0008984_1804_2457 | 208 |
| 989 | 3300046680 | Ga0495646_0119223 | Ga0495646_0119223_82_735 | 208 |
| 990 | 3300046684 | Ga0495669_0097430 | Ga0495669_0097430_444_1097 | 208 |
| 991 | 3300046689 | Ga0495613_0143776 | Ga0495613_0143776_651_1304 | 208 |
| 992 | 3300046690 | Ga0495624_0004719 | Ga0495624_0004719_7749_8402 | 208 |
| 993 | 3300046690 | Ga0495624_0018817 | Ga0495624_0018817_479_1132 | 208 |
| 994 | 3300046690 | Ga0495624_0021868 | Ga0495624_0021868_1779_2432 | 208 |
| 995 | 3300046691 | Ga0495670_0097054 | Ga0495670_0097054_759_1418 | 208 |
| 996 | 3300046692 | Ga0495671_0009131 | Ga0495671_0009131_4500_5159 | 208 |
| 997 | 3300046692 | Ga0495671_0029990 | Ga0495671_0029990_1236_1889 | 208 |
| 998 | 3300046694 | Ga0495649_0001463 | Ga0495649_0001463_11426_12067 | 208 |
| 999 | 3300046694 | Ga0495649_0006435 | Ga0495649_0006435_5363_6016 | 208 |
| 1000 | 3300046694 | Ga0495649_0009242 | Ga0495649_0009242_2973_3632 | 208 |
| 1001 | 3300046694 | Ga0495649_0122041 | Ga0495649_0122041_512_1165 | 208 |
| 1002 | 3300046794 | Ga0495589_0014852 | Ga0495589_0014852_1804_2445 | 208 |
| 1003 | 3300046794 | Ga0495589_0050404 | Ga0495589_0050404_1101_1754 | 208 |
| 1004 | 3300046809 | Ga0495600_0002069 | Ga0495600_0002069_2076_2729 | 208 |
| 1005 | 3300047315 | Ga0495581_0008394 | Ga0495581_0008394_3259_3912 | 208 |
| 1006 | 3300047317 | Ga0495604_0047559 | Ga0495604_0047559_469_1122 | 208 |
| 1007 | 3300047319 | Ga0495674_0004291 | Ga0495674_0004291_3096_3749 | 208 |
| 1008 | 3300047319 | Ga0495674_0008961 | Ga0495674_0008961_8138_8791 | 208 |
| 1009 | 3300047319 | Ga0495674_0359082 | Ga0495674_0359082_248_901 | 208 |
| 1010 | 3300047320 | Ga0495672_0052973 | Ga0495672_0052973_996_1655 | 208 |
| 1011 | 3300047320 | Ga0495672_0289083 | Ga0495672_0289083_60_713 | 208 |
| 1012 | 3300047321 | Ga0495676_0045906 | Ga0495676_0045906_2500_3153 | 208 |
| 1013 | 3300047323 | Ga0495683_0034026 | Ga0495683_0034026_1737_2390 | 208 |
| 1014 | 3300047323 | Ga0495683_0070388 | Ga0495683_0070388_525_1178 | 208 |
| 1015 | 3300047443 | Ga0495687_034999 | Ga0495687_034999_52_705 | 208 |
| 1016 | 3300047443 | Ga0495687_036591 | Ga0495687_036591_53_706 | 208 |
| 1017 | 3300047446 | Ga0495679_000037 | Ga0495679_000037_145489_146142 | 208 |
| 1018 | 3300047447 | Ga0495685_008745 | Ga0495685_008745_1082_1741 | 208 |
| 1019 | 3300047469 | Ga0495673_0040844 | Ga0495673_0040844_874_1527 | 208 |
| 1020 | 3300047469 | Ga0495673_0047964 | Ga0495673_0047964_656_1315 | 208 |
| 1021 | 3300047673 | Ga0495593_0012820 | Ga0495593_0012820_437_1090 | 208 |
| 1022 | 3300047673 | Ga0495593_0032542 | Ga0495593_0032542_1290_1943 | 208 |
| 1023 | 3300048088 | Ga0495602_0006574 | Ga0495602_0006574_2856_3509 | 208 |
| 1024 | 3300048088 | Ga0495602_0022460 | Ga0495602_0022460_3303_3956 | 208 |
| 1025 | 3300048089 | Ga0495614_0006654 | Ga0495614_0006654_2291_2944 | 208 |
| 1026 | 3300048091 | Ga0495626_0040299 | Ga0495626_0040299_652_1305 | 208 |
| 1027 | 3300048091 | Ga0495626_0065980 | Ga0495626_0065980_939_1592 | 208 |
| 1028 | 3300048913 | Ga0496110_0261305 | Ga0496110_0261305_628_1272 | 208 |
| 1029 | 3300048914 | Ga0496111_0342997 | Ga0496111_0342997_436_1080 | 208 |
| 1030 | 3300048917 | Ga0496114_0439153 | Ga0496114_0439153_274_918 | 208 |
| 1031 | 3300048919 | Ga0496116_0014132 | Ga0496116_0014132_3606_4265 | 208 |
| 1032 | 3300048919 | Ga0496116_0026637 | Ga0496116_0026637_2818_3471 | 208 |
| 1033 | 3300048920 | Ga0496117_0028920 | Ga0496117_0028920_1842_2495 | 208 |
| 1034 | 3300048920 | Ga0496117_0114372 | Ga0496117_0114372_980_1633 | 208 |
| 1035 | 3300048921 | Ga0496118_0002886 | Ga0496118_0002886_11763_12416 | 208 |
| 1036 | 3300048921 | Ga0496118_0060865 | Ga0496118_0060865_1868_2521 | 208 |
| 1037 | 3300048924 | Ga0496121_0014458 | Ga0496121_0014458_4386_5045 | 208 |
| 1038 | 3300048924 | Ga0496121_0084985 | Ga0496121_0084985_1505_2158 | 208 |
| 1039 | 3300048924 | Ga0496121_0197583 | Ga0496121_0197583_520_1173 | 208 |
| 1040 | 3300048925 | Ga0496122_0011752 | Ga0496122_0011752_4489_5148 | 208 |
| 1041 | 3300048926 | Ga0496123_0007592 | Ga0496123_0007592_3402_4061 | 208 |
| 1042 | 3300048929 | Ga0496126_0034799 | Ga0496126_0034799_1987_2640 | 208 |
| 1043 | 3300048929 | Ga0496126_0111802 | Ga0496126_0111802_316_975 | 208 |
| 1044 | 3300049459 | Ga0495678_025595 | Ga0495678_025595_548_1201 | 208 |
| 1045 | 3300049460 | Ga0495682_0094804 | Ga0495682_0094804_213_866 | 208 |
| 1046 | 3300050493 | nmdc:mga0k408_22887_c1 | nmdc:mga0k408_22887_c1_430_1113 | 208 |
| 1047 | 3300050496 | nmdc:mga07m45_5487_c1 | nmdc:mga07m45_5487_c1_3500_4141 | 208 |
| 1048 | 3300053077 | Ga0495601_0239427 | Ga0495601_0239427_268_912 | 208 |
| 1049 | 3300053084 | Ga0495595_0136294 | Ga0495595_0136294_339_983 | 208 |
| 1050 | 3300053093 | Ga0500651_0112998 | Ga0500651_0112998_155_796 | 208 |
| 1051 | 3300055283 | Ga0500661_006935 | Ga0500661_006935_461_1102 | 208 |
| 1052 | 3300061719 | Ga0466962_0002972 | Ga0466962_0002972_6524_7174 | 208 |
| 1053 | 3300009011 | Ga0105251_10005601 | Ga0105251_100056016 | 209 |
| 1054 | 3300009036 | Ga0105244_10001133 | Ga0105244_1000113320 | 209 |
| 1055 | 3300025728 | Ga0207655_1001288 | Ga0207655_100128822 | 209 |
| 1056 | 3300025735 | Ga0207713_1008988 | Ga0207713_10089881 | 209 |
| 1057 | 3300031727 | Ga0316576_10077095 | Ga0316576_100770952 | 209 |
| 1058 | 3300035398 | Ga0316574_0086518 | Ga0316574_0086518_1192_1857 | 209 |
| 1059 | 3300046474 | Ga0495605_0026070 | Ga0495605_0026070_619_1251 | 209 |
| 1060 | 3300046474 | Ga0495605_0240640 | Ga0495605_0240640_32_664 | 209 |
| 1061 | 3300046492 | Ga0495585_0006865 | Ga0495585_0006865_1119_1751 | 209 |
| 1062 | 3300046500 | Ga0495596_0008902 | Ga0495596_0008902_2960_3592 | 209 |
| 1063 | 3300046501 | Ga0495607_0046605 | Ga0495607_0046605_1112_1744 | 209 |
| 1064 | 3300046507 | Ga0495606_0133232 | Ga0495606_0133232_695_1327 | 209 |
| 1065 | 3300046513 | Ga0495616_0031036 | Ga0495616_0031036_1552_2184 | 209 |
| 1066 | 3300046518 | Ga0495631_0015837 | Ga0495631_0015837_1082_1714 | 209 |
| 1067 | 3300046518 | Ga0495631_0030586 | Ga0495631_0030586_573_1205 | 209 |
| 1068 | 3300046519 | Ga0495632_0022106 | Ga0495632_0022106_2057_2689 | 209 |
| 1069 | 3300046522 | Ga0495643_0095437 | Ga0495643_0095437_416_1048 | 209 |
| 1070 | 3300046528 | Ga0495642_0007226 | Ga0495642_0007226_568_1200 | 209 |
| 1071 | 3300046528 | Ga0495642_0011089 | Ga0495642_0011089_2641_3273 | 209 |
| 1072 | 3300046530 | Ga0495654_0000381 | Ga0495654_0000381_21197_21835 | 209 |
| 1073 | 3300046535 | Ga0495586_0152531 | Ga0495586_0152531_217_849 | 209 |
| 1074 | 3300046538 | Ga0495609_0004682 | Ga0495609_0004682_4309_4941 | 209 |
| 1075 | 3300046542 | Ga0495597_0171388 | Ga0495597_0171388_85_717 | 209 |
| 1076 | 3300046558 | Ga0495633_0115881 | Ga0495633_0115881_203_835 | 209 |
| 1077 | 3300046615 | Ga0495656_0002704 | Ga0495656_0002704_4211_4843 | 209 |
| 1078 | 3300046615 | Ga0495656_0044093 | Ga0495656_0044093_663_1298 | 209 |
| 1079 | 3300046616 | Ga0495668_0021923 | Ga0495668_0021923_1180_1812 | 209 |
| 1080 | 3300046648 | Ga0495611_0012399 | Ga0495611_0012399_473_1105 | 209 |
| 1081 | 3300046660 | Ga0495625_0051408 | Ga0495625_0051408_402_1034 | 209 |
| 1082 | 3300046660 | Ga0495625_0179307 | Ga0495625_0179307_367_999 | 209 |
| 1083 | 3300046663 | Ga0495635_0246513 | Ga0495635_0246513_376_1008 | 209 |
| 1084 | 3300046665 | Ga0495661_0168146 | Ga0495661_0168146_498_1130 | 209 |
| 1085 | 3300046691 | Ga0495670_0065194 | Ga0495670_0065194_341_973 | 209 |
| 1086 | 3300046692 | Ga0495671_0035806 | Ga0495671_0035806_1630_2262 | 209 |
| 1087 | 3300046794 | Ga0495589_0000032 | Ga0495589_0000032_42443_43081 | 209 |
| 1088 | 3300046794 | Ga0495589_0090532 | Ga0495589_0090532_749_1381 | 209 |
| 1089 | 3300046794 | Ga0495589_0146367 | Ga0495589_0146367_325_957 | 209 |
| 1090 | 3300047318 | Ga0495636_0051765 | Ga0495636_0051765_817_1449 | 209 |
| 1091 | 3300047323 | Ga0495683_0016473 | Ga0495683_0016473_1744_2376 | 209 |
| 1092 | 3300047445 | Ga0495677_0006278 | Ga0495677_0006278_2552_3184 | 209 |
| 1093 | 3300047445 | Ga0495677_0024912 | Ga0495677_0024912_1240_1872 | 209 |
| 1094 | 3300047447 | Ga0495685_014165 | Ga0495685_014165_540_1172 | 209 |
| 1095 | 3300047470 | Ga0495681_0019417 | Ga0495681_0019417_2288_2920 | 209 |
| 1096 | 3300048920 | Ga0496117_0121972 | Ga0496117_0121972_744_1382 | 209 |
| 1097 | 3300049460 | Ga0495682_0033786 | Ga0495682_0033786_452_1084 | 209 |
| 1098 | 3300049775 | Ga0501279_036368 | Ga0501279_036368_16_648 | 209 |
| 1099 | 3300025250 | Ga0209026_1000967 | Ga0209026_100096712 | 210 |
| 1100 | 3300048091 | Ga0495626_0022862 | Ga0495626_0022862_1416_2063 | 211 |
| 1101 | 3300042145 | Ga0450906_010415 | Ga0450906_010415_636_1277 | 212 |
| 1102 | 3300048927 | Ga0496124_0015077 | Ga0496124_0015077_3020_3661 | 212 |
| 1103 | 3300046539 | Ga0495621_0003776 | Ga0495621_0003776_1302_1943 | 213 |
| 1104 | 3300048906 | Ga0496103_0022931 | Ga0496103_0022931_374_1024 | 213 |
| 1105 | 3300048908 | Ga0496105_0087572 | Ga0496105_0087572_1191_1841 | 213 |
| 1106 | 3300048912 | Ga0496109_0009606 | Ga0496109_0009606_2776_3426 | 213 |
| 1107 | 3300048913 | Ga0496110_0047706 | Ga0496110_0047706_2963_3613 | 213 |
| 1108 | 3300048914 | Ga0496111_0014930 | Ga0496111_0014930_1320_1970 | 213 |
| 1109 | 3300048918 | Ga0496115_0238318 | Ga0496115_0238318_486_1136 | 213 |
| 1110 | 3300001979 | JGI24740J21852_10000527 | JGI24740J21852_1000052710 | 216 |
| 1111 | 3300002738 | JGI25154J39366_1001471 | JGI25154J39366_10014717 | 216 |
| 1112 | 3300003756 | Ga0055533_1001052 | Ga0055533_10010525 | 216 |
| 1113 | 3300003762 | Ga0055542_1002038 | Ga0055542_10020384 | 216 |
| 1114 | 3300003841 | Ga0055541_1000789 | Ga0055541_10007892 | 216 |
| 1115 | 3300005366 | Ga0070659_100004714 | Ga0070659_1000047145 | 216 |
| 1116 | 3300014497 | Ga0182008_10003842 | Ga0182008_100038428 | 216 |
| 1117 | 3300015261 | Ga0182006_1009422 | Ga0182006_10094224 | 216 |
| 1118 | 3300015262 | Ga0182007_10004447 | Ga0182007_100044475 | 216 |
| 1119 | 3300025206 | Ga0209435_109601 | Ga0209435_1096011 | 216 |
| 1120 | 3300025224 | Ga0209784_100365 | Ga0209784_10036511 | 216 |
| 1121 | 3300025225 | Ga0209566_100955 | Ga0209566_1009554 | 216 |
| 1122 | 3300025226 | Ga0209674_100184 | Ga0209674_1001849 | 216 |
| 1123 | 3300025246 | Ga0209646_1000035 | Ga0209646_1000035253 | 216 |
| 1124 | 3300025250 | Ga0209026_1002757 | Ga0209026_10027573 | 216 |
| 1125 | 3300025253 | Ga0209677_102322 | Ga0209677_1023226 | 216 |
| 1126 | 3300025254 | Ga0209148_1000293 | Ga0209148_100029359 | 216 |
| 1127 | 3300044671 | Ga0466978_0109275 | Ga0466978_0109275_140_790 | 216 |
| 1128 | 3300044683 | Ga0466965_0002051 | Ga0466965_0002051_4470_5120 | 216 |
| 1129 | 3300044693 | Ga0466961_0001458 | Ga0466961_0001458_5039_5689 | 216 |
| 1130 | 3300044706 | Ga0466964_0040051 | Ga0466964_0040051_301_951 | 216 |
| 1131 | 3300044719 | Ga0466971_0052756 | Ga0466971_0052756_508_1158 | 216 |
| 1132 | 3300044735 | Ga0466968_0063481 | Ga0466968_0063481_409_1059 | 216 |
| 1133 | 3300044765 | Ga0466970_0007806 | Ga0466970_0007806_2036_2686 | 216 |
| 1134 | 3300044842 | Ga0466957_0164008 | Ga0466957_0164008_299_949 | 216 |
| 1135 | 3300044901 | Ga0466960_0026488 | Ga0466960_0026488_1205_1855 | 216 |
| 1136 | 3300045049 | Ga0466959_0081458 | Ga0466959_0081458_891_1541 | 216 |
| 1137 | 3300045976 | Ga0466967_0090776 | Ga0466967_0090776_1630_2280 | 216 |
| 1138 | 3300061719 | Ga0466962_0003937 | Ga0466962_0003937_5457_6107 | 216 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1c2t-assembly1.cif.gz_A | new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. | 0.9676 | 3 | 199 |
| 1men-assembly1.cif.gz_A | complex structure of human gar tfase and substrate beta-gar | 0.9652 | 1 | 199 |
| 4zyv-assembly1.cif.gz_A | human gar transformylase in complex with gar and n-({5-[(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)butyl]thiophen-2-yl}carbonyl)-l-glutamic acid (agf71) | 0.9626 | 3 | 197 |
| 3auf-assembly1.cif.gz_A-2 | crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii | 0.9615 | 1 | 199 |
| 2ywr-assembly1.cif.gz_A | crystal structure of gar transformylase from aquifex aeolicus | 0.9615 | 1 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q20143_783_975_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9668 | 2 | 182 | 3.40.50.170 |
| 3aufA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9615 | 1 | 199 | 3.40.50.170 |
| 2ywrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9614 | 3 | 199 | 3.40.50.170 |
| 1njsA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9602 | 3 | 199 | 3.40.50.170 |
| af_Q2FZI7_1_188_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9552 | 1 | 183 | 3.40.50.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A561KLD6-F1-model_v4 | deleted | 0.9882 | 15 | 203 |
|
| AF-A0A5Q1FXV9-F1-model_v4 | deleted | 0.9843 | 2 | 200 |
|
| AF-A0A561KLD6-F1-model_v4 | deleted | 0.983 | 15 | 203 |
|
| AF-A0A1G0J2J2-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9807 | 3 | 183 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A090QZB5-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9805 | 1 | 156 |
GO:0004644
GO:0005829 GO:0006189 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar