F490666

General Info

Members Datasets Scaffolds Average Seq Length
1138 407 1134 210

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0000750|Ga0395905_0000750_18342_19109
Length 255
Sequence MPPISGLTRKSHSGCSTLSSNHFFLLCKPAIAAGFFISVAATRYGKMRAMKNIVILISGRGSNMQAIVRAAQAEQWPCRIAAVISNRADAEGLMFAAEHGIATEVVVSKEFPSRDAFDAALRLAIDRFAPDLVVLAGFMRILTPGFVEHYAGRMLNIHPSLLPSFPGLATHRQALAAGVKVHGATVHFVTAELDHGPIVAQAAVPVLPGDTEHSLAERVLVQEHVIYPRAVRWFVEGRLSIDNGLVHVNEAAPSA

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
3 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
4 2818991436 Collimonas arenae 515 Isolate Unclassified
5 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
25 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
27 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
28 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
29 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
88 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
89 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
90 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
121 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
196 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
198 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
203 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
204 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
207 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
208 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
209 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
210 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
231 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
232 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
233 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
234 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
235 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
236 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
237 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
238 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
239 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
240 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
241 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
242 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
243 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
244 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
248 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
249 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
256 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
257 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
262 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
265 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
266 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
267 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
268 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
269 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
280 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
281 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
282 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
283 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
284 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
285 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
286 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
287 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
288 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
294 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
295 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
296 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
297 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
298 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
299 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
300 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
301 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
304 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
305 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
306 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
307 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
308 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
309 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
310 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
311 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
312 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
313 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
314 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
320 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
321 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
322 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
328 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
329 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
330 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
331 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
332 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
333 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
334 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
335 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
336 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
337 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
338 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
339 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
340 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
341 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
342 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
343 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
344 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
347 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
348 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
349 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
350 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
351 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
352 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
353 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
354 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
355 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
356 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
357 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
358 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
359 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
360 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
361 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
362 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
363 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
364 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
365 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
366 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
369 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
370 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
371 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
372 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
373 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
374 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
375 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
376 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
377 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
378 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
381 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
382 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
384 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
385 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
386 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
387 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
388 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
389 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
390 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
391 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
392 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
393 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
394 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
395 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
398 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
399 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
400 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
401 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
402 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
403 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
404 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.53
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.78
Nodule 0.7
Rhizoplane 2.9
Rhizosphere 77.33
Stem 0
Stem Tuber 0
Unclassified 7.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000527 3300001979 Bacteria 16316
2 JGI24739J22299_10030478 3300001989 Bacteria 1870
3 JGI24737J22298_10012956 3300001990 Bacteria 2717
4 JGI24735J21928_10009274 3300002067 Bacteria 3165
5 JGI25155J39150_1000288 3300002704 Bacteria 17886
6 JGI25156J39149_1000695 3300002705 Bacteria 18063
7 JGI25156J39149_1002511 3300002705 Bacteria 6539
8 JGI25156J39149_1007991 3300002705 Bacteria 2711
9 JGI25154J39366_1000350 3300002738 Bacteria 26241
10 JGI25154J39366_1000571 3300002738 Bacteria 18063
11 JGI25154J39366_1001471 3300002738 Bacteria 8319
12 JGI25154J39366_1003202 3300002738 Bacteria 3600
13 JGI25154J39366_1003796 3300002738 Bacteria 2980
14 JGI25158J39367_1001641 3300002739 Bacteria 3856
15 JGI25157J39369_1000018 3300002741 Bacteria 177410
16 JGI25157J39369_1000773 3300002741 Bacteria 16575
17 JGI25150J39212_1012636 3300002774 Bacteria 1489
18 JGI25159J45721_1005067 3300002987 Bacteria 4197
19 JGI25151J46595_10035406 3300003187 Bacteria 1896
20 JGI25151J46595_10055552 3300003187 Bacteria 1304
21 JGI25165J46597_1000001 3300003214 Bacteria 1111887
22 JGI25153J46596_10017617 3300003215 Bacteria 2807
23 rootH2_10128398 3300003320 Bacteria 1100
24 rootL2_10017918 3300003322 Bacteria 1501
25 rootH1_10042583 3300003316 Bacteria 4075
26 rootH1_10042583 3300003323 Bacteria 1921
27 rootH1_10042585 3300003323 Bacteria 1207
28 rootH1_10186258 3300003323 Bacteria 1704
29 JGI25160J50197_1002021 3300003354 Bacteria 9671
30 JGI25161J50226_1001870 3300003374 Bacteria 5878
31 Ga0007409J51694_1041494 3300003575 Bacteria 3994
32 Ga0055538_1000001 3300003751 Bacteria 1111887
33 Ga0055539_1000001 3300003752 Bacteria 1111887
34 Ga0055539_1000146 3300003752 Bacteria 70677
35 Ga0055539_1000240 3300003752 Bacteria 36494
36 Ga0055539_1001263 3300003752 Bacteria 5036
37 Ga0055533_1000003 3300003756 Bacteria 1111887
38 Ga0055533_1000103 3300003756 Bacteria 107860
39 Ga0055533_1000150 3300003756 Bacteria 70677
40 Ga0055533_1001052 3300003756 Bacteria 7936
41 Ga0055532_1000005 3300003758 Bacteria 458107
42 Ga0055525_1000003 3300003759 Bacteria 962094
43 Ga0055525_1000198 3300003759 Bacteria 70677
44 Ga0055525_1001499 3300003759 Bacteria 4023
45 Ga0055535_1002863 3300003761 Bacteria 5417
46 Ga0055542_1002038 3300003762 Bacteria 7643
47 Ga0055526_1000161 3300003771 Bacteria 59705
48 Ga0055526_1000827 3300003771 Bacteria 23107
49 Ga0055526_1003727 3300003771 Bacteria 9515
50 Ga0055537_1000111 3300003773 Bacteria 61884
51 Ga0055524_1000015 3300003775 Bacteria 246493
52 Ga0055524_1002005 3300003775 Bacteria 10873
53 Ga0055524_1002542 3300003775 Bacteria 9325
54 Ga0055524_1005899 3300003775 Bacteria 5397
55 Ga0055524_1017165 3300003775 Bacteria 2563
56 Ga0055536_1000252 3300003781 Bacteria 42499
57 Ga0055534_1000268 3300003784 Bacteria 35791
58 Ga0055534_1002782 3300003784 Bacteria 5845
59 Ga0055534_1004596 3300003784 Bacteria 3938
60 Ga0055528_1000178 3300003790 Bacteria 53709
61 Ga0055530_10001043 3300003791 Bacteria 22076
62 Ga0055530_10028903 3300003791 Bacteria 1489
63 Ga0055540_1000001 3300003792 Bacteria 466834
64 Ga0055531_10002737 3300003794 Bacteria 11585
65 Ga0055531_10007375 3300003794 Bacteria 6022
66 Ga0055531_10021621 3300003794 Bacteria 2487
67 Ga0055541_1000001 3300003841 Bacteria 1111887
68 Ga0055541_1000098 3300003841 Bacteria 70677
69 Ga0055541_1000789 3300003841 Bacteria 7895
70 Ga0065165_1000286 3300005262 Bacteria 85993
71 Ga0065165_1058816 3300005262 Bacteria 1060
72 Ga0070658_10081833 3300005327 Bacteria 2653
73 Ga0070658_10086907 3300005327 Bacteria 2573
74 Ga0070658_10440175 3300005327 Bacteria 1122
75 Ga0070658_10646273 3300005327 Bacteria 918
76 Ga0070690_100031128 3300005330 Bacteria 3321
77 Ga0070670_100273775 3300005331 Bacteria 1473
78 Ga0070670_100295403 3300005331 Bacteria 1416
79 Ga0070677_10023109 3300005333 Bacteria 2299
80 Ga0068869_100037044 3300005334 Bacteria 3466
81 Ga0070666_10019648 3300005335 Bacteria 4365
82 Ga0068868_100195124 3300005338 Bacteria 1685
83 Ga0070660_100227965 3300005339 Bacteria 1515
84 Ga0070689_100346171 3300005340 Bacteria 1246
85 Ga0070661_100023457 3300005344 Bacteria 4422
86 Ga0070668_100059448 3300005347 Bacteria 2958
87 Ga0070669_100004469 3300005353 Bacteria 10075
88 Ga0070675_100066570 3300005354 Bacteria 2980
89 Ga0070675_100501698 3300005354 Bacteria 1093
90 Ga0070671_100031566 3300005355 Bacteria 4377
91 Ga0070671_100187716 3300005355 Bacteria 1751
92 Ga0070674_100028072 3300005356 Bacteria 3693
93 Ga0070673_100028417 3300005364 Bacteria 4159
94 Ga0070659_100003171 3300005366 Bacteria 11710
95 Ga0070659_100004714 3300005366 Bacteria 9733
96 Ga0070659_100174856 3300005366 Bacteria 1760
97 Ga0070667_100002718 3300005367 Bacteria 15313
98 Ga0070667_100246137 3300005367 Bacteria 1597
99 Ga0070701_10066089 3300005438 Bacteria 1921
100 Ga0070663_100023240 3300005455 Bacteria 4153
101 Ga0070663_100384565 3300005455 Bacteria 1144
102 Ga0070678_100130407 3300005456 Bacteria 1996
103 Ga0070662_100016597 3300005457 Bacteria 4947
104 Ga0068867_100027789 3300005459 Bacteria 4069
105 Ga0068867_100122049 3300005459 Bacteria 2015
106 Ga0068867_100800152 3300005459 Bacteria 841
107 Ga0070684_100508873 3300005535 Bacteria 1116
108 Ga0068853_100072486 3300005539 Bacteria 3001
109 Ga0068853_100551899 3300005539 Bacteria 1091
110 Ga0070672_100036953 3300005543 Bacteria 3724
111 Ga0070686_100065917 3300005544 Bacteria 2354
112 Ga0068855_100127299 3300005563 Bacteria 2911
113 Ga0068855_100430825 3300005563 Bacteria 1442
114 Ga0068857_100007953 3300005577 Bacteria 9152
115 Ga0068854_100004599 3300005578 Bacteria 8706
116 Ga0068856_100008259 3300005614 Bacteria 10149
117 Ga0068856_100056975 3300005614 Bacteria 3858
118 Ga0068856_100257418 3300005614 Bacteria 1760
119 Ga0068852_100102675 3300005616 Bacteria 2584
120 Ga0068852_100147709 3300005616 Bacteria 2182
121 Ga0068852_100186438 3300005616 Bacteria 1954
122 Ga0068852_100955562 3300005616 Bacteria 875
123 Ga0068864_100301443 3300005618 Bacteria 1500
124 Ga0068864_100560238 3300005618 Bacteria 1106
125 Ga0068866_10010619 3300005718 Bacteria 3954
126 Ga0068866_10309096 3300005718 Bacteria 990
127 Ga0068861_100016063 3300005719 Bacteria 5287
128 Ga0068861_100158841 3300005719 Bacteria 1863
129 Ga0068863_100019781 3300005841 Bacteria 6439
130 Ga0068863_100473095 3300005841 Bacteria 1231
131 Ga0068858_100017353 3300005842 Bacteria 6752
132 Ga0068860_100565456 3300005843 Bacteria 1140
133 Ga0075363_100043109 3300006048 Bacteria 2386
134 Ga0075366_10099523 3300006195 Bacteria 1744
135 Ga0075366_10197495 3300006195 Bacteria 1223
136 Ga0075370_10002946 3300006353 Bacteria 7999
137 Ga0075370_10271119 3300006353 Bacteria 1007
138 Ga0068871_100073893 3300006358 Bacteria 2812
139 Ga0068865_100114600 3300006881 Bacteria 1994
140 Ga0068865_100269843 3300006881 Bacteria 1350
141 Ga0099824_1036213 3300006942 Bacteria 1447
142 Ga0099823_1017932 3300006944 Bacteria 6859
143 Ga0079104_1000309 3300006946 Bacteria 61858
144 Ga0099826_10000018 3300006948 Bacteria 198330
145 Ga0105251_10002082 3300009011 Bacteria 16156
146 Ga0105251_10005601 3300009011 Bacteria 8174
147 Ga0105251_10013210 3300009011 Bacteria 4629
148 Ga0105251_10024566 3300009011 Bacteria 3093
149 Ga0105251_10049399 3300009011 Bacteria 2013
150 Ga0105244_10001133 3300009036 Bacteria 22165
151 Ga0105244_10002953 3300009036 Bacteria 12532
152 Ga0105244_10007523 3300009036 Bacteria 6913
153 Ga0105244_10061761 3300009036 Bacteria 1885
154 Ga0105240_10012100 3300009093 Bacteria 11952
155 Ga0105240_10017206 3300009093 Bacteria 9753
156 Ga0105240_10024629 3300009093 Bacteria 7928
157 Ga0105245_10262933 3300009098 Bacteria 1680
158 Ga0105243_10052625 3300009148 Bacteria 3226
159 Ga0105243_10054161 3300009148 Bacteria 3184
160 Ga0105241_10019955 3300009174 Bacteria 4947
161 Ga0105241_10186928 3300009174 Bacteria 1722
162 Ga0105242_10007036 3300009176 Bacteria 8688
163 Ga0105248_10078637 3300009177 Bacteria 3708
164 Ga0105237_10499422 3300009545 Bacteria 1223
165 Ga0105237_10755773 3300009545 Bacteria 979
166 Ga0105238_10030398 3300009551 Bacteria 5498
167 Ga0105238_10055566 3300009551 Bacteria 3974
168 Ga0105238_10061774 3300009551 Bacteria 3749
169 Ga0105249_10007528 3300009553 Bacteria 9500
170 Ga0105246_10099856 3300011119 Bacteria 2111
171 Ga0157373_10045986 3300013100 Bacteria 3115
172 Ga0157371_10000001 3300013102 Bacteria 1162285
173 Ga0157371_10207645 3300013102 Bacteria 1405
174 Ga0157370_10366078 3300013104 Bacteria 1328
175 Ga0157370_10764917 3300013104 Bacteria 880
176 Ga0157369_10169148 3300013105 Bacteria 2304
177 Ga0157369_10236802 3300013105 Bacteria 1907
178 Ga0157369_10383864 3300013105 Bacteria 1458
179 Ga0157374_10036965 3300013296 Bacteria 4477
180 Ga0157374_10132950 3300013296 Bacteria 2409
181 Ga0157378_10248522 3300013297 Bacteria 1702
182 Ga0163162_10040965 3300013306 Bacteria 4633
183 Ga0163162_10728762 3300013306 Bacteria 1112
184 Ga0157372_10361837 3300013307 Bacteria 1690
185 Ga0157372_10731731 3300013307 Bacteria 1150
186 Ga0157375_10008692 3300013308 Bacteria 8901
187 Ga0157375_10173565 3300013308 Bacteria 2304
188 Ga0157380_10051165 3300014326 Bacteria 3266
189 Ga0157380_10241647 3300014326 Bacteria 1628
190 Ga0182008_10003842 3300014497 Bacteria 8925
191 Ga0182008_10027616 3300014497 Bacteria 2873
192 Ga0157377_10228313 3300014745 Bacteria 1195
193 Ga0157376_10226589 3300014969 Bacteria 1734
194 Ga0157376_10345560 3300014969 Bacteria 1422
195 Ga0182006_1009422 3300015261 Bacteria 4374
196 Ga0182007_10004447 3300015262 Bacteria 6350
197 Ga0182007_10010110 3300015262 Bacteria 3748
198 Ga0182007_10081906 3300015262 Bacteria 1059
199 Ga0182007_10095791 3300015262 Bacteria 980
200 Ga0182005_1000158 3300015265 Bacteria 47201
201 Ga0213872_10000002 3300021361 Bacteria 554092
202 Ga0213872_10002809 3300021361 Bacteria 9960
203 Ga0213872_10019803 3300021361 Bacteria 3098
204 Ga0213872_10038157 3300021361 Bacteria 2193
205 Ga0213872_10046973 3300021361 Bacteria 1964
206 Ga0213872_10052963 3300021361 Bacteria 1841
207 Ga0213872_10141970 3300021361 Bacteria 1053
208 Ga0209435_100160 3300025206 Bacteria 21645
209 Ga0209435_100473 3300025206 Bacteria 7971
210 Ga0209435_109601 3300025206 Bacteria 1055
211 Ga0209436_100751 3300025208 Bacteria 13429
212 Ga0209784_100004 3300025224 Bacteria 1378156
213 Ga0209784_100365 3300025224 Bacteria 21497
214 Ga0209566_100004 3300025225 Bacteria 1531866
215 Ga0209566_100955 3300025225 Bacteria 13033
216 Ga0209674_100003 3300025226 Bacteria 2196646
217 Ga0209674_100006 3300025226 Bacteria 1531866
218 Ga0209674_100184 3300025226 Bacteria 68529
219 Ga0209147_100011 3300025229 Bacteria 702140
220 Ga0209563_100009 3300025230 Bacteria 1378156
221 Ga0209563_100010 3300025230 Bacteria 1337457
222 Ga0207427_101086 3300025231 Bacteria 11117
223 Ga0209437_100004 3300025233 Bacteria 1378156
224 Ga0209437_100259 3300025233 Bacteria 82489
225 Ga0209258_100525 3300025242 Bacteria 36665
226 Ga0209258_100580 3300025242 Bacteria 30726
227 Ga0209646_1000035 3300025246 Bacteria 363209
228 Ga0209646_1000067 3300025246 Bacteria 241595
229 Ga0209646_1000403 3300025246 Bacteria 25548
230 Ga0209646_1000503 3300025246 Bacteria 18211
231 Ga0209026_1000033 3300025250 Bacteria 318512
232 Ga0209026_1000760 3300025250 Bacteria 18093
233 Ga0209026_1000967 3300025250 Bacteria 14329
234 Ga0209026_1002757 3300025250 Bacteria 6282
235 Ga0209677_100005 3300025253 Bacteria 1378156
236 Ga0209677_100068 3300025253 Bacteria 146135
237 Ga0209677_100760 3300025253 Bacteria 16357
238 Ga0209677_102322 3300025253 Bacteria 7314
239 Ga0209677_102920 3300025253 Bacteria 5982
240 Ga0209148_1000293 3300025254 Bacteria 74776
241 Ga0209148_1005971 3300025254 Bacteria 2703
242 Ga0209759_1000024 3300025256 Bacteria 318512
243 Ga0209759_1000253 3300025256 Bacteria 79223
244 Ga0209759_1001054 3300025256 Bacteria 18214
245 Ga0209129_1000093 3300025258 Bacteria 173163
246 Ga0209233_1000005 3300025261 Bacteria 1531866
247 Ga0209565_1000009 3300025263 Bacteria 751701
248 Ga0209565_1000946 3300025263 Bacteria 15214
249 Ga0209565_1001578 3300025263 Bacteria 9718
250 Ga0209565_1002746 3300025263 Bacteria 6109
251 Ga0209565_1012113 3300025263 Bacteria 2071
252 Ga0209673_1000036 3300025273 Bacteria 323162
253 Ga0209673_1006646 3300025273 Bacteria 5523
254 Ga0209130_1001278 3300025284 Bacteria 17422
255 Ga0209130_1001458 3300025284 Bacteria 15552
256 Ga0209675_1000013 3300025291 Bacteria 448220
257 Ga0209675_1000100 3300025291 Bacteria 128565
258 Ga0209675_1000945 3300025291 Bacteria 18462
259 Ga0209675_1007213 3300025291 Bacteria 4304
260 Ga0209675_1009393 3300025291 Bacteria 3461
261 Ga0209676_1000012 3300025292 Bacteria 841431
262 Ga0209025_1001877 3300025294 Bacteria 24578
263 Ga0209025_1004210 3300025294 Bacteria 12682
264 Ga0209564_1000122 3300025295 Bacteria 203709
265 Ga0209564_1003837 3300025295 Bacteria 9718
266 Ga0209564_1003839 3300025295 Bacteria 9717
267 Ga0209564_1004073 3300025295 Bacteria 9216
268 Ga0209050_1000145 3300025298 Bacteria 168151
269 Ga0209050_1007847 3300025298 Bacteria 5863
270 Ga0209050_1012221 3300025298 Bacteria 3962
271 Ga0209256_1000005 3300025299 Bacteria 1315082
272 Ga0209256_1000061 3300025299 Bacteria 260890
273 Ga0209256_1000106 3300025299 Bacteria 187258
274 Ga0209256_1000269 3300025299 Bacteria 91493
275 Ga0209256_1000676 3300025299 Bacteria 46097
276 Ga0209256_1002862 3300025299 Bacteria 13132
277 Ga0209256_1007013 3300025299 Bacteria 5721
278 Ga0207426_1002626 3300025302 Bacteria 11130
279 Ga0209051_1000018 3300025303 Bacteria 527061
280 Ga0209051_1004528 3300025303 Bacteria 8521
281 Ga0209051_1005475 3300025303 Bacteria 7404
282 Ga0209051_1016272 3300025303 Bacteria 3376
283 Ga0209257_1000010 3300025304 Bacteria 1158682
284 Ga0209257_1000084 3300025304 Bacteria 291502
285 Ga0209257_1004271 3300025304 Bacteria 11259
286 Ga0207697_10031970 3300025315 Bacteria 2153
287 Ga0207656_10276333 3300025321 Bacteria 827
288 Ga0207655_1001288 3300025728 Bacteria 23781
289 Ga0207713_1000135 3300025735 Bacteria 112173
290 Ga0207713_1008988 3300025735 Bacteria 5683
291 Ga0207713_1055329 3300025735 Bacteria 1549
292 Ga0207682_10006644 3300025893 Bacteria 4648
293 Ga0207682_10039046 3300025893 Bacteria 1928
294 Ga0207642_10016456 3300025899 Bacteria 2786
295 Ga0207680_10018874 3300025903 Bacteria 3677
296 Ga0207647_10035754 3300025904 Bacteria 3163
297 Ga0207645_10029160 3300025907 Bacteria 3558
298 Ga0207645_10414350 3300025907 Bacteria 907
299 Ga0207643_10097419 3300025908 Bacteria 1721
300 Ga0207705_10106102 3300025909 Bacteria 2071
301 Ga0207705_10191215 3300025909 Bacteria 1548
302 Ga0207654_10289787 3300025911 Bacteria 1110
303 Ga0207695_10009547 3300025913 Bacteria 11996
304 Ga0207695_10010175 3300025913 Bacteria 11536
305 Ga0207695_10032918 3300025913 Bacteria 5665
306 Ga0207695_10079069 3300025913 Bacteria 3334
307 Ga0207671_10033303 3300025914 Bacteria 3833
308 Ga0207662_10002597 3300025918 Bacteria 9105
309 Ga0207657_10149395 3300025919 Bacteria 1904
310 Ga0207649_10252355 3300025920 Bacteria 1271
311 Ga0207681_10008770 3300025923 Bacteria 6176
312 Ga0207681_10184195 3300025923 Bacteria 1593
313 Ga0207694_10059333 3300025924 Bacteria 2975
314 Ga0207650_10350312 3300025925 Bacteria 1215
315 Ga0207659_10032977 3300025926 Bacteria 3559
316 Ga0207659_10038293 3300025926 Bacteria 3334
317 Ga0207687_10034805 3300025927 Bacteria 3423
318 Ga0207644_10048134 3300025931 Bacteria 3046
319 Ga0207690_10004058 3300025932 Bacteria 8649
320 Ga0207690_10507350 3300025932 Bacteria 976
321 Ga0207706_10015322 3300025933 Bacteria 6930
322 Ga0207706_10144106 3300025933 Bacteria 2096
323 Ga0207709_10002721 3300025935 Bacteria 10914
324 Ga0207670_10369958 3300025936 Bacteria 1139
325 Ga0207669_10006656 3300025937 Bacteria 5296
326 Ga0207691_10048281 3300025940 Bacteria 3904
327 Ga0207691_10093888 3300025940 Bacteria 2685
328 Ga0207691_10096426 3300025940 Bacteria 2644
329 Ga0207689_10011506 3300025942 Bacteria 7583
330 Ga0207689_10039908 3300025942 Bacteria 3886
331 Ga0207661_10052657 3300025944 Bacteria 3253
332 Ga0207667_10021476 3300025949 Bacteria 7152
333 Ga0207712_10009755 3300025961 Bacteria 6084
334 Ga0207668_10046072 3300025972 Bacteria 2977
335 Ga0207640_10079351 3300025981 Bacteria 2237
336 Ga0207640_10096861 3300025981 Bacteria 2058
337 Ga0207658_10013291 3300025986 Bacteria 5622
338 Ga0207677_10040223 3300026023 Bacteria 3080
339 Ga0207703_10005816 3300026035 Bacteria 9879
340 Ga0207678_10076301 3300026067 Bacteria 2871
341 Ga0207678_10422419 3300026067 Bacteria 1156
342 Ga0207678_10488071 3300026067 Bacteria 1073
343 Ga0207702_10001261 3300026078 Bacteria 25509
344 Ga0207702_10058186 3300026078 Bacteria 3288
345 Ga0207641_10005241 3300026088 Bacteria 11086
346 Ga0207648_10047299 3300026089 Bacteria 3772
347 Ga0207648_10225905 3300026089 Bacteria 1665
348 Ga0207648_10356977 3300026089 Bacteria 1318
349 Ga0207674_10057723 3300026116 Bacteria 3935
350 Ga0207675_100002925 3300026118 Bacteria 16801
351 Ga0207675_100111936 3300026118 Bacteria 2576
352 Ga0207683_10041387 3300026121 Bacteria 4024
353 Ga0207683_10377001 3300026121 Bacteria 1304
354 Ga0207698_10008917 3300026142 Bacteria 6359
355 Ga0207698_10121456 3300026142 Bacteria 2212
356 Ga0209281_1000103 3300027111 Bacteria 221425
357 Ga0209968_1001095 3300027526 Bacteria 4135
358 Ga0209282_1000002 3300027666 Bacteria 1067825
359 Ga0209282_1000052 3300027666 Bacteria 104317
360 Ga0209966_1000003 3300027695 Bacteria 111077
361 Ga0268266_10176480 3300028379 Bacteria 1943
362 Ga0268264_10001986 3300028381 Bacteria 18405
363 Ga0307515_10000708 3300028794 Bacteria 76903
364 Ga0307515_10013083 3300028794 Bacteria 15535
365 Ga0307515_10470144 3300028794 Bacteria 870
366 Ga0307511_10076838 3300030521 Bacteria 2383
367 Ga0307512_10056000 3300030522 Bacteria 3102
368 Ga0265328_10005685 3300031239 Bacteria 5326
369 Ga0265327_10000479 3300031251 Bacteria 70467
370 Ga0265327_10031415 3300031251 Bacteria 2984
371 Ga0307509_10073712 3300031507 Bacteria 3554
372 Ga0307508_10000169 3300031616 Bacteria 78769
373 Ga0307514_10085435 3300031649 Bacteria 2319
374 Ga0316576_10077095 3300031727 Bacteria 2468
375 Ga0307516_10008972 3300031730 Bacteria 11204
376 Ga0307516_10009988 3300031730 Bacteria 10508
377 Ga0307413_10273545 3300031824 Bacteria 1266
378 Ga0307518_10127414 3300031838 Bacteria 1794
379 Ga0307410_10247607 3300031852 Bacteria 1384
380 Ga0307409_100226671 3300031995 Bacteria 1691
381 Ga0307409_100280086 3300031995 Bacteria 1541
382 Ga0307416_100005407 3300032002 Bacteria 7838
383 Ga0307416_101791783 3300032002 Bacteria 718
384 Ga0307414_10094204 3300032004 Bacteria 2234
385 Ga0307507_10021968 3300033179 Bacteria 7077
386 Ga0316574_0086518 3300035398 Bacteria 1995
387 Ga0373924_0027378 3300035410 Bacteria 2266
388 Ga0373933_0320756 3300035724 Bacteria 1005
389 Ga0373937_0089551 3300036401 Bacteria 2849
390 Ga0373937_0468785 3300036401 Bacteria 1196
391 Ga0395899_0001064 3300037312 Bacteria 24780
392 Ga0395899_0002813 3300037312 Bacteria 14019
393 Ga0395899_0003608 3300037312 Bacteria 12242
394 Ga0395900_0000131 3300037418 Bacteria 125554
395 Ga0395900_0005698 3300037418 Bacteria 13021
396 Ga0395900_0283273 3300037418 Bacteria 1648
397 Ga0395898_0001532 3300037466 Bacteria 31823
398 Ga0395898_0097883 3300037466 Bacteria 2817
399 Ga0395905_0000750 3300037471 Bacteria 42802
400 Ga0395905_0017710 3300037471 Bacteria 6763
401 Ga0395905_0025730 3300037471 Bacteria 5549
402 Ga0395905_0028213 3300037471 Bacteria 5291
403 Ga0395905_0063403 3300037471 Bacteria 3458
404 Ga0395905_0208288 3300037471 Bacteria 1832
405 Ga0395901_0000002 3300038443 Bacteria 761045
406 Ga0395901_0001718 3300038443 Bacteria 22613
407 Ga0395901_0136559 3300038443 Bacteria 2577
408 Ga0395901_1173314 3300038443 Bacteria 735
409 Ga0436361_0144599 3300039447 Bacteria 904
410 Ga0436361_0338967 3300039447 Bacteria 4771
411 Ga0436361_0600769 3300039447 Bacteria 3349
412 Ga0436361_0846070 3300039447 Bacteria 4410
413 Ga0439461_0030468 3300041410 Bacteria 1122
414 Ga0439465_0120827 3300041413 Bacteria 918
415 Ga0451789_0491830 3300041443 Bacteria 1054
416 Ga0451795_0419335 3300041456 Bacteria 1283
417 Ga0451802_0970336 3300041460 Bacteria 1525
418 Ga0451835_0864634 3300041492 Bacteria 979
419 Ga0451839_0718016 3300041496 Bacteria 862
420 Ga0451849_0077297 3300041505 Bacteria 878
421 Ga0451851_0770517 3300041507 Bacteria 1466
422 Ga0451843_0223084 3300041509 Bacteria 989
423 Ga0439431_0031742 3300041997 Bacteria 1314
424 Ga0439450_007594 3300042008 Bacteria 1993
425 Ga0450906_010415 3300042145 Bacteria 1759
426 Ga0439446_0014983 3300042156 Bacteria 2146
427 Ga0439434_0039325 3300042435 Bacteria 1451
428 Ga0439460_0095082 3300042461 Bacteria 951
429 Ga0450918_001746 3300042531 Bacteria 4228
430 Ga0451577_0091368 3300042876 Bacteria 2717
431 Ga0451577_0751880 3300042876 Bacteria 882
432 Ga0466969_0058160 3300044656 Bacteria 1882
433 Ga0466972_0000088 3300044658 Bacteria 84167
434 Ga0466972_0022575 3300044658 Bacteria 3132
435 Ga0466978_0109275 3300044671 Bacteria 1714
436 Ga0466965_0000666 3300044683 Bacteria 12609
437 Ga0466965_0002051 3300044683 Bacteria 8434
438 Ga0466966_0000687 3300044684 Bacteria 21520
439 Ga0466966_0006128 3300044684 Bacteria 7946
440 Ga0466966_0089471 3300044684 Bacteria 1912
441 Ga0466961_0001458 3300044693 Bacteria 14699
442 Ga0466961_0007342 3300044693 Bacteria 7013
443 Ga0466961_0018736 3300044693 Bacteria 4453
444 Ga0466963_0027945 3300044694 Bacteria 3616
445 Ga0466963_0047308 3300044694 Bacteria 2839
446 Ga0466964_0002548 3300044706 Bacteria 6493
447 Ga0466964_0002848 3300044706 Bacteria 6238
448 Ga0466964_0025767 3300044706 Bacteria 2298
449 Ga0466964_0040051 3300044706 Bacteria 1890
450 Ga0466964_0056879 3300044706 Bacteria 1618
451 Ga0466964_0113758 3300044706 Bacteria 1210
452 Ga0453684_0023234 3300044712 Bacteria 9147
453 Ga0466971_0005142 3300044719 Bacteria 5665
454 Ga0466971_0007302 3300044719 Bacteria 4811
455 Ga0466971_0017715 3300044719 Bacteria 3154
456 Ga0466971_0052756 3300044719 Bacteria 1832
457 Ga0466968_0063481 3300044735 Bacteria 1596
458 Ga0466970_0007806 3300044765 Bacteria 5370
459 Ga0466970_0028412 3300044765 Bacteria 2938
460 Ga0466970_0031025 3300044765 Bacteria 2821
461 Ga0466957_0047867 3300044842 Bacteria 2598
462 Ga0466957_0164008 3300044842 Bacteria 1444
463 Ga0466957_0192226 3300044842 Bacteria 1337
464 Ga0466960_0026488 3300044901 Bacteria 2634
465 Ga0466959_0000287 3300045049 Bacteria 30550
466 Ga0466959_0009422 3300045049 Bacteria 6947
467 Ga0466959_0052023 3300045049 Bacteria 3001
468 Ga0466959_0081458 3300045049 Bacteria 2332
469 Ga0451576_0074320 3300045051 Bacteria 3537
470 Ga0451576_0194483 3300045051 Bacteria 2118
471 Ga0466958_0011505 3300045836 Bacteria 4983
472 Ga0466958_0587412 3300045836 Bacteria 724
473 Ga0466967_0024766 3300045976 Bacteria 4939
474 Ga0466967_0090776 3300045976 Bacteria 2775
475 Ga0466967_0141742 3300045976 Bacteria 2239
476 Ga0495617_000002 3300046452 Bacteria 710121
477 Ga0495617_041726 3300046452 Bacteria 1533
478 Ga0495617_085942 3300046452 Bacteria 1028
479 Ga0495627_000207 3300046453 Bacteria 63763
480 Ga0495627_042518 3300046453 Bacteria 1392
481 Ga0495627_046735 3300046453 Bacteria 1314
482 Ga0495592_0030409 3300046454 Bacteria 4085
483 Ga0495592_0100052 3300046454 Bacteria 2067
484 Ga0495603_0106430 3300046455 Bacteria 1636
485 Ga0495603_0364263 3300046455 Bacteria 829
486 Ga0495590_0000025 3300046457 Bacteria 165221
487 Ga0495590_0018282 3300046457 Bacteria 2510
488 Ga0495590_0021071 3300046457 Bacteria 2312
489 Ga0495590_0054003 3300046457 Bacteria 1403
490 Ga0495591_002755 3300046458 Bacteria 9489
491 Ga0495629_0000878 3300046459 Bacteria 24225
492 Ga0495629_0005319 3300046459 Bacteria 9625
493 Ga0495638_0013390 3300046460 Bacteria 5585
494 Ga0495638_0016484 3300046460 Bacteria 4948
495 Ga0495638_0035516 3300046460 Bacteria 3177
496 Ga0495638_0073932 3300046460 Bacteria 2079
497 Ga0495638_0244567 3300046460 Bacteria 992
498 Ga0495651_0100121 3300046462 Bacteria 2159
499 Ga0495651_0134207 3300046462 Bacteria 1803
500 Ga0495651_0351245 3300046462 Bacteria 974
501 Ga0495653_0005181 3300046463 Bacteria 10598
502 Ga0495653_0007366 3300046463 Bacteria 9015
503 Ga0495653_0061355 3300046463 Bacteria 2845
504 Ga0495653_0105341 3300046463 Bacteria 2036
505 Ga0495653_0132732 3300046463 Bacteria 1760
506 Ga0495650_0000015 3300046471 Bacteria 557595
507 Ga0495650_0005573 3300046471 Bacteria 8121
508 Ga0495650_0006345 3300046471 Bacteria 7391
509 Ga0495650_0007195 3300046471 Bacteria 6744
510 Ga0495650_0008662 3300046471 Bacteria 5893
511 Ga0495650_0009150 3300046471 Bacteria 5673
512 Ga0495580_0016442 3300046472 Bacteria 5551
513 Ga0495580_0020600 3300046472 Bacteria 4878
514 Ga0495580_0023359 3300046472 Bacteria 4542
515 Ga0495580_0050910 3300046472 Bacteria 2928
516 Ga0495580_0115644 3300046472 Bacteria 1863
517 Ga0495580_0699376 3300046472 Bacteria 663
518 Ga0495582_0002333 3300046473 Bacteria 10632
519 Ga0495582_0027681 3300046473 Bacteria 3109
520 Ga0495582_0044024 3300046473 Bacteria 2458
521 Ga0495605_0001284 3300046474 Bacteria 16646
522 Ga0495605_0003031 3300046474 Bacteria 10141
523 Ga0495605_0012486 3300046474 Bacteria 4711
524 Ga0495605_0025196 3300046474 Bacteria 3101
525 Ga0495605_0026070 3300046474 Bacteria 3040
526 Ga0495605_0240640 3300046474 Bacteria 777
527 Ga0495662_0386912 3300046476 Bacteria 687
528 Ga0495664_0019005 3300046477 Bacteria 3946
529 Ga0495664_0495309 3300046477 Bacteria 730
530 Ga0495584_0000070 3300046491 Bacteria 73237
531 Ga0495584_0000560 3300046491 Bacteria 25087
532 Ga0495584_0004898 3300046491 Bacteria 7146
533 Ga0495584_0005783 3300046491 Bacteria 6521
534 Ga0495584_0007322 3300046491 Bacteria 5754
535 Ga0495584_0009129 3300046491 Bacteria 5119
536 Ga0495584_0288096 3300046491 Bacteria 834
537 Ga0495585_0000006 3300046492 Bacteria 320556
538 Ga0495585_0006233 3300046492 Bacteria 7430
539 Ga0495585_0006865 3300046492 Bacteria 7017
540 Ga0495585_0010286 3300046492 Bacteria 5578
541 Ga0495585_0010483 3300046492 Bacteria 5512
542 Ga0495585_0013461 3300046492 Bacteria 4786
543 Ga0495585_0026665 3300046492 Bacteria 3300
544 Ga0495585_0030854 3300046492 Bacteria 3047
545 Ga0495585_0032874 3300046492 Bacteria 2937
546 Ga0495585_0034744 3300046492 Bacteria 2850
547 Ga0495585_0059514 3300046492 Bacteria 2104
548 Ga0495585_0068952 3300046492 Bacteria 1930
549 Ga0495585_0154537 3300046492 Bacteria 1194
550 Ga0495585_0193122 3300046492 Bacteria 1040
551 Ga0495594_0003640 3300046499 Bacteria 7930
552 Ga0495594_0005742 3300046499 Bacteria 6374
553 Ga0495594_0013918 3300046499 Bacteria 4209
554 Ga0495594_0030537 3300046499 Bacteria 2917
555 Ga0495594_0069416 3300046499 Bacteria 1957
556 Ga0495596_0000240 3300046500 Bacteria 37159
557 Ga0495596_0001004 3300046500 Bacteria 16768
558 Ga0495596_0001839 3300046500 Bacteria 11778
559 Ga0495596_0008211 3300046500 Bacteria 4655
560 Ga0495596_0008902 3300046500 Bacteria 4440
561 Ga0495596_0009505 3300046500 Bacteria 4274
562 Ga0495596_0011786 3300046500 Bacteria 3754
563 Ga0495596_0012683 3300046500 Bacteria 3598
564 Ga0495596_0031054 3300046500 Bacteria 2136
565 Ga0495596_0033692 3300046500 Bacteria 2038
566 Ga0495596_0041071 3300046500 Bacteria 1824
567 Ga0495596_0070668 3300046500 Bacteria 1356
568 Ga0495596_0196268 3300046500 Bacteria 784
569 Ga0495607_0002594 3300046501 Bacteria 14550
570 Ga0495607_0004085 3300046501 Bacteria 10913
571 Ga0495607_0005057 3300046501 Bacteria 9558
572 Ga0495607_0009947 3300046501 Bacteria 6404
573 Ga0495607_0014386 3300046501 Bacteria 5152
574 Ga0495607_0017453 3300046501 Bacteria 4607
575 Ga0495607_0031280 3300046501 Bacteria 3259
576 Ga0495607_0046605 3300046501 Bacteria 2544
577 Ga0495607_0068424 3300046501 Bacteria 1991
578 Ga0495607_0106432 3300046501 Bacteria 1493
579 Ga0495607_0117837 3300046501 Bacteria 1398
580 Ga0495607_0307808 3300046501 Bacteria 743
581 Ga0495583_0000056 3300046506 Bacteria 200858
582 Ga0495583_0000159 3300046506 Bacteria 113627
583 Ga0495583_0000372 3300046506 Bacteria 69750
584 Ga0495583_0000382 3300046506 Bacteria 68388
585 Ga0495583_0000864 3300046506 Bacteria 36820
586 Ga0495583_0002345 3300046506 Bacteria 16395
587 Ga0495583_0004885 3300046506 Bacteria 9353
588 Ga0495583_0023202 3300046506 Bacteria 3144
589 Ga0495583_0056880 3300046506 Bacteria 1761
590 Ga0495583_0101613 3300046506 Bacteria 1226
591 Ga0495583_0167063 3300046506 Bacteria 905
592 Ga0495583_0209989 3300046506 Bacteria 789
593 Ga0495606_0002998 3300046507 Bacteria 18539
594 Ga0495606_0004210 3300046507 Bacteria 14562
595 Ga0495606_0013849 3300046507 Bacteria 6332
596 Ga0495606_0038316 3300046507 Bacteria 3244
597 Ga0495606_0039674 3300046507 Bacteria 3169
598 Ga0495606_0041103 3300046507 Bacteria 3102
599 Ga0495606_0133232 3300046507 Bacteria 1475
600 Ga0495606_0133665 3300046507 Bacteria 1472
601 Ga0495606_0306052 3300046507 Bacteria 859
602 Ga0495608_0072156 3300046511 Bacteria 2252
603 Ga0495610_0004511 3300046512 Bacteria 10257
604 Ga0495610_0006028 3300046512 Bacteria 8463
605 Ga0495610_0020472 3300046512 Bacteria 3673
606 Ga0495610_0035172 3300046512 Bacteria 2574
607 Ga0495616_0000057 3300046513 Bacteria 100806
608 Ga0495616_0003140 3300046513 Bacteria 10676
609 Ga0495616_0004533 3300046513 Bacteria 8746
610 Ga0495616_0010511 3300046513 Bacteria 5355
611 Ga0495616_0015188 3300046513 Bacteria 4284
612 Ga0495616_0015417 3300046513 Bacteria 4251
613 Ga0495616_0015591 3300046513 Bacteria 4222
614 Ga0495616_0028366 3300046513 Bacteria 2964
615 Ga0495616_0031036 3300046513 Bacteria 2802
616 Ga0495616_0101666 3300046513 Bacteria 1347
617 Ga0495620_0030549 3300046515 Bacteria 2479
618 Ga0495620_0041244 3300046515 Bacteria 2026
619 Ga0495620_0049470 3300046515 Bacteria 1798
620 Ga0495620_0049791 3300046515 Bacteria 1790
621 Ga0495628_0029302 3300046516 Bacteria 4464
622 Ga0495628_0079729 3300046516 Bacteria 2545
623 Ga0495630_0044173 3300046517 Bacteria 3329
624 Ga0495630_0058357 3300046517 Bacteria 2893
625 Ga0495631_0002820 3300046518 Bacteria 9652
626 Ga0495631_0003219 3300046518 Bacteria 8985
627 Ga0495631_0005293 3300046518 Bacteria 6776
628 Ga0495631_0012520 3300046518 Bacteria 4139
629 Ga0495631_0014987 3300046518 Bacteria 3727
630 Ga0495631_0015637 3300046518 Bacteria 3630
631 Ga0495631_0015837 3300046518 Bacteria 3604
632 Ga0495631_0016374 3300046518 Bacteria 3536
633 Ga0495631_0021138 3300046518 Bacteria 3032
634 Ga0495631_0030586 3300046518 Bacteria 2441
635 Ga0495631_0045981 3300046518 Bacteria 1920
636 Ga0495631_0144685 3300046518 Bacteria 1020
637 Ga0495631_0181164 3300046518 Bacteria 902
638 Ga0495632_0000129 3300046519 Bacteria 77134
639 Ga0495632_0000296 3300046519 Bacteria 48157
640 Ga0495632_0000375 3300046519 Bacteria 42575
641 Ga0495632_0008199 3300046519 Bacteria 6452
642 Ga0495632_0022106 3300046519 Bacteria 3415
643 Ga0495632_0022797 3300046519 Bacteria 3351
644 Ga0495632_0025075 3300046519 Bacteria 3158
645 Ga0495632_0026117 3300046519 Bacteria 3078
646 Ga0495637_0000126 3300046520 Bacteria 57018
647 Ga0495637_0023626 3300046520 Bacteria 2790
648 Ga0495637_0070124 3300046520 Bacteria 1416
649 Ga0495643_0000415 3300046522 Bacteria 55824
650 Ga0495643_0011985 3300046522 Bacteria 5248
651 Ga0495643_0026575 3300046522 Bacteria 3264
652 Ga0495643_0031662 3300046522 Bacteria 2942
653 Ga0495643_0048513 3300046522 Bacteria 2294
654 Ga0495643_0095437 3300046522 Bacteria 1529
655 Ga0495643_0125066 3300046522 Bacteria 1295
656 Ga0495643_0313931 3300046522 Bacteria 710
657 Ga0495644_0000389 3300046523 Bacteria 19747
658 Ga0495644_0001948 3300046523 Bacteria 8291
659 Ga0495644_0003401 3300046523 Bacteria 6293
660 Ga0495644_0003438 3300046523 Bacteria 6265
661 Ga0495644_0007023 3300046523 Bacteria 4355
662 Ga0495644_0007542 3300046523 Bacteria 4194
663 Ga0495644_0009481 3300046523 Bacteria 3752
664 Ga0495644_0013643 3300046523 Bacteria 3117
665 Ga0495648_0000708 3300046524 Bacteria 35539
666 Ga0495648_0001488 3300046524 Bacteria 22912
667 Ga0495648_0007168 3300046524 Bacteria 8955
668 Ga0495648_0011619 3300046524 Bacteria 6616
669 Ga0495648_0036925 3300046524 Bacteria 3144
670 Ga0495648_0038209 3300046524 Bacteria 3074
671 Ga0495648_0048317 3300046524 Bacteria 2620
672 Ga0495648_0085064 3300046524 Bacteria 1788
673 Ga0495648_0165099 3300046524 Bacteria 1140
674 Ga0495648_0215620 3300046524 Bacteria 950
675 Ga0495663_0002556 3300046525 Bacteria 5436
676 Ga0495663_0017672 3300046525 Bacteria 2026
677 Ga0495663_0086948 3300046525 Bacteria 1014
678 Ga0495666_0000318 3300046526 Bacteria 20936
679 Ga0495666_0000556 3300046526 Bacteria 16645
680 Ga0495666_0008615 3300046526 Bacteria 5110
681 Ga0495666_0018785 3300046526 Bacteria 3434
682 Ga0495666_0039750 3300046526 Bacteria 2282
683 Ga0495666_0046494 3300046526 Bacteria 2092
684 Ga0495642_0000613 3300046528 Bacteria 17935
685 Ga0495642_0004874 3300046528 Bacteria 5186
686 Ga0495642_0007226 3300046528 Bacteria 4262
687 Ga0495642_0009239 3300046528 Bacteria 3774
688 Ga0495642_0011089 3300046528 Bacteria 3456
689 Ga0495642_0012989 3300046528 Bacteria 3215
690 Ga0495642_0016483 3300046528 Bacteria 2880
691 Ga0495642_0041624 3300046528 Bacteria 1869
692 Ga0495642_0066401 3300046528 Bacteria 1503
693 Ga0495642_0069897 3300046528 Bacteria 1467
694 Ga0495652_0001577 3300046529 Bacteria 24927
695 Ga0495654_0000381 3300046530 Bacteria 38197
696 Ga0495654_0004611 3300046530 Bacteria 8134
697 Ga0495654_0018761 3300046530 Bacteria 3621
698 Ga0495654_0028918 3300046530 Bacteria 2830
699 Ga0495654_0107634 3300046530 Bacteria 1275
700 Ga0495654_0198012 3300046530 Bacteria 861
701 Ga0495665_0020210 3300046531 Bacteria 3578
702 Ga0495665_0049520 3300046531 Bacteria 2227
703 Ga0495665_0060088 3300046531 Bacteria 2006
704 Ga0495640_0017736 3300046533 Bacteria 5297
705 Ga0495586_0009827 3300046535 Bacteria 5093
706 Ga0495586_0012802 3300046535 Bacteria 4445
707 Ga0495586_0024342 3300046535 Bacteria 3236
708 Ga0495586_0152531 3300046535 Bacteria 1300
709 Ga0495587_0243573 3300046536 Bacteria 1012
710 Ga0495609_0001536 3300046538 Bacteria 15150
711 Ga0495609_0003404 3300046538 Bacteria 9126
712 Ga0495609_0003442 3300046538 Bacteria 9060
713 Ga0495609_0004070 3300046538 Bacteria 8147
714 Ga0495609_0004682 3300046538 Bacteria 7411
715 Ga0495609_0015930 3300046538 Bacteria 3509
716 Ga0495609_0016433 3300046538 Bacteria 3448
717 Ga0495609_0021815 3300046538 Bacteria 2954
718 Ga0495609_0029412 3300046538 Bacteria 2502
719 Ga0495609_0033768 3300046538 Bacteria 2321
720 Ga0495609_0048047 3300046538 Bacteria 1908
721 Ga0495609_0065495 3300046538 Bacteria 1601
722 Ga0495609_0099802 3300046538 Bacteria 1258
723 Ga0495621_0003776 3300046539 Bacteria 4199
724 Ga0495597_0001388 3300046542 Bacteria 17478
725 Ga0495597_0002423 3300046542 Bacteria 11849
726 Ga0495597_0003311 3300046542 Bacteria 9513
727 Ga0495597_0005681 3300046542 Bacteria 6565
728 Ga0495597_0009715 3300046542 Bacteria 4739
729 Ga0495597_0010710 3300046542 Bacteria 4471
730 Ga0495597_0035088 3300046542 Bacteria 2264
731 Ga0495597_0038705 3300046542 Bacteria 2137
732 Ga0495597_0171388 3300046542 Bacteria 881
733 Ga0495597_0219965 3300046542 Bacteria 754
734 Ga0495645_0037487 3300046543 Bacteria 3534
735 Ga0495645_0211290 3300046543 Bacteria 1310
736 Ga0495645_0392211 3300046543 Bacteria 886
737 Ga0495622_0000064 3300046557 Bacteria 93789
738 Ga0495622_0000570 3300046557 Bacteria 22156
739 Ga0495622_0006368 3300046557 Bacteria 5479
740 Ga0495622_0032190 3300046557 Bacteria 2448
741 Ga0495622_0054258 3300046557 Bacteria 1860
742 Ga0495622_0102906 3300046557 Bacteria 1308
743 Ga0495633_0003338 3300046558 Bacteria 10778
744 Ga0495633_0004954 3300046558 Bacteria 8314
745 Ga0495633_0008291 3300046558 Bacteria 5875
746 Ga0495633_0032773 3300046558 Bacteria 2508
747 Ga0495633_0034346 3300046558 Bacteria 2440
748 Ga0495633_0060270 3300046558 Bacteria 1778
749 Ga0495633_0065743 3300046558 Bacteria 1694
750 Ga0495633_0079803 3300046558 Bacteria 1523
751 Ga0495633_0115881 3300046558 Bacteria 1241
752 Ga0495633_0260102 3300046558 Bacteria 791
753 Ga0495656_0002704 3300046615 Bacteria 5923
754 Ga0495656_0017670 3300046615 Bacteria 2724
755 Ga0495656_0040418 3300046615 Bacteria 1943
756 Ga0495656_0044093 3300046615 Bacteria 1876
757 Ga0495656_0073514 3300046615 Bacteria 1525
758 Ga0495656_0300791 3300046615 Bacteria 822
759 Ga0495656_0386048 3300046615 Bacteria 730
760 Ga0495668_0000025 3300046616 Bacteria 304546
761 Ga0495668_0000544 3300046616 Bacteria 46835
762 Ga0495668_0000578 3300046616 Bacteria 44611
763 Ga0495668_0003733 3300046616 Bacteria 11198
764 Ga0495668_0021923 3300046616 Bacteria 3655
765 Ga0495668_0029684 3300046616 Bacteria 3088
766 Ga0495668_0034704 3300046616 Bacteria 2828
767 Ga0495668_0045031 3300046616 Bacteria 2452
768 Ga0495668_0055234 3300046616 Bacteria 2193
769 Ga0495668_0066242 3300046616 Bacteria 1987
770 Ga0495634_0053681 3300046642 Bacteria 2699
771 Ga0495634_0369017 3300046642 Bacteria 857
772 Ga0495611_0000946 3300046648 Bacteria 15555
773 Ga0495611_0003308 3300046648 Bacteria 7123
774 Ga0495611_0011108 3300046648 Bacteria 3814
775 Ga0495611_0012399 3300046648 Bacteria 3624
776 Ga0495611_0025380 3300046648 Bacteria 2582
777 Ga0495611_0030378 3300046648 Bacteria 2375
778 Ga0495611_0033374 3300046648 Bacteria 2270
779 Ga0495611_0101818 3300046648 Bacteria 1334
780 Ga0495611_0125987 3300046648 Bacteria 1194
781 Ga0495625_0004296 3300046660 Bacteria 13552
782 Ga0495625_0004306 3300046660 Bacteria 13526
783 Ga0495625_0026121 3300046660 Bacteria 4416
784 Ga0495625_0029610 3300046660 Bacteria 4091
785 Ga0495625_0040181 3300046660 Bacteria 3414
786 Ga0495625_0051408 3300046660 Bacteria 2954
787 Ga0495625_0052327 3300046660 Bacteria 2925
788 Ga0495625_0129530 3300046660 Bacteria 1710
789 Ga0495625_0155060 3300046660 Bacteria 1537
790 Ga0495625_0179307 3300046660 Bacteria 1410
791 Ga0495625_0249643 3300046660 Bacteria 1152
792 Ga0495635_0001292 3300046663 Bacteria 16730
793 Ga0495635_0015435 3300046663 Bacteria 5341
794 Ga0495635_0121076 3300046663 Bacteria 1785
795 Ga0495635_0246513 3300046663 Bacteria 1205
796 Ga0495659_0000526 3300046664 Bacteria 14120
797 Ga0495659_0000919 3300046664 Bacteria 10459
798 Ga0495659_0008635 3300046664 Bacteria 3243
799 Ga0495659_0013224 3300046664 Bacteria 2686
800 Ga0495659_0316897 3300046664 Bacteria 661
801 Ga0495661_0002258 3300046665 Bacteria 14917
802 Ga0495661_0004930 3300046665 Bacteria 9550
803 Ga0495661_0009057 3300046665 Bacteria 6849
804 Ga0495661_0016750 3300046665 Bacteria 4849
805 Ga0495661_0023263 3300046665 Bacteria 4022
806 Ga0495661_0024203 3300046665 Bacteria 3931
807 Ga0495661_0038868 3300046665 Bacteria 2961
808 Ga0495661_0051612 3300046665 Bacteria 2482
809 Ga0495661_0063697 3300046665 Bacteria 2178
810 Ga0495661_0088267 3300046665 Bacteria 1770
811 Ga0495661_0100596 3300046665 Bacteria 1627
812 Ga0495661_0103250 3300046665 Bacteria 1600
813 Ga0495661_0110688 3300046665 Bacteria 1531
814 Ga0495661_0168146 3300046665 Bacteria 1171
815 Ga0495661_0175233 3300046665 Bacteria 1140
816 Ga0495661_0218012 3300046665 Bacteria 990
817 Ga0495661_0316595 3300046665 Bacteria 776
818 Ga0495588_0003376 3300046674 Bacteria 6937
819 Ga0495588_0024317 3300046674 Bacteria 3008
820 Ga0495588_0036417 3300046674 Bacteria 2496
821 Ga0495588_0046183 3300046674 Bacteria 2233
822 Ga0495588_0096087 3300046674 Bacteria 1554
823 Ga0495588_0166293 3300046674 Bacteria 1166
824 Ga0495588_0189117 3300046674 Bacteria 1087
825 Ga0495599_0008525 3300046678 Bacteria 6237
826 Ga0495599_0175798 3300046678 Bacteria 1320
827 Ga0495623_0002848 3300046679 Bacteria 11409
828 Ga0495623_0091236 3300046679 Bacteria 1869
829 Ga0495623_0172788 3300046679 Bacteria 1261
830 Ga0495646_0001272 3300046680 Bacteria 14827
831 Ga0495646_0008984 3300046680 Bacteria 6344
832 Ga0495646_0119223 3300046680 Bacteria 1494
833 Ga0495646_0126911 3300046680 Bacteria 1439
834 Ga0495658_0229075 3300046683 Bacteria 1165
835 Ga0495669_0000092 3300046684 Bacteria 59765
836 Ga0495669_0000583 3300046684 Bacteria 16207
837 Ga0495669_0002000 3300046684 Bacteria 8364
838 Ga0495669_0014388 3300046684 Bacteria 3382
839 Ga0495669_0018903 3300046684 Bacteria 2968
840 Ga0495669_0053696 3300046684 Bacteria 1812
841 Ga0495669_0062837 3300046684 Bacteria 1683
842 Ga0495669_0097430 3300046684 Bacteria 1363
843 Ga0495613_0033961 3300046689 Bacteria 3789
844 Ga0495613_0108969 3300046689 Bacteria 1997
845 Ga0495613_0143776 3300046689 Bacteria 1703
846 Ga0495624_0004719 3300046690 Bacteria 9913
847 Ga0495624_0013356 3300046690 Bacteria 5600
848 Ga0495624_0018817 3300046690 Bacteria 4616
849 Ga0495624_0021868 3300046690 Bacteria 4236
850 Ga0495670_0001955 3300046691 Bacteria 10140
851 Ga0495670_0003903 3300046691 Bacteria 7323
852 Ga0495670_0023024 3300046691 Bacteria 3075
853 Ga0495670_0041036 3300046691 Bacteria 2308
854 Ga0495670_0053575 3300046691 Bacteria 2020
855 Ga0495670_0065194 3300046691 Bacteria 1835
856 Ga0495670_0097054 3300046691 Bacteria 1514
857 Ga0495670_0106660 3300046691 Bacteria 1447
858 Ga0495670_0110917 3300046691 Bacteria 1419
859 Ga0495670_0116948 3300046691 Bacteria 1383
860 Ga0495670_0263036 3300046691 Bacteria 921
861 Ga0495671_0002518 3300046692 Bacteria 11533
862 Ga0495671_0009131 3300046692 Bacteria 5552
863 Ga0495671_0011096 3300046692 Bacteria 4972
864 Ga0495671_0029990 3300046692 Bacteria 2788
865 Ga0495671_0035806 3300046692 Bacteria 2519
866 Ga0495671_0056700 3300046692 Bacteria 1939
867 Ga0495671_0101401 3300046692 Bacteria 1407
868 Ga0495671_0138840 3300046692 Bacteria 1184
869 Ga0495649_0001463 3300046694 Bacteria 17755
870 Ga0495649_0003126 3300046694 Bacteria 11347
871 Ga0495649_0005200 3300046694 Bacteria 8334
872 Ga0495649_0006435 3300046694 Bacteria 7310
873 Ga0495649_0006781 3300046694 Bacteria 7093
874 Ga0495649_0009242 3300046694 Bacteria 5871
875 Ga0495649_0015381 3300046694 Bacteria 4357
876 Ga0495649_0029688 3300046694 Bacteria 3022
877 Ga0495649_0063457 3300046694 Bacteria 1984
878 Ga0495649_0118121 3300046694 Bacteria 1403
879 Ga0495649_0122041 3300046694 Bacteria 1377
880 Ga0495649_0152974 3300046694 Bacteria 1211
881 Ga0495649_0194707 3300046694 Bacteria 1054
882 Ga0495649_0304778 3300046694 Bacteria 810
883 Ga0495649_0319066 3300046694 Bacteria 789
884 Ga0495589_0000032 3300046794 Bacteria 167736
885 Ga0495589_0002314 3300046794 Bacteria 10704
886 Ga0495589_0004788 3300046794 Bacteria 7194
887 Ga0495589_0005625 3300046794 Bacteria 6611
888 Ga0495589_0013093 3300046794 Bacteria 4283
889 Ga0495589_0014852 3300046794 Bacteria 4006
890 Ga0495589_0024976 3300046794 Bacteria 3034
891 Ga0495589_0050404 3300046794 Bacteria 2059
892 Ga0495589_0090532 3300046794 Bacteria 1485
893 Ga0495589_0103208 3300046794 Bacteria 1378
894 Ga0495589_0115136 3300046794 Bacteria 1296
895 Ga0495589_0146367 3300046794 Bacteria 1129
896 Ga0495600_0000474 3300046809 Bacteria 20802
897 Ga0495600_0002069 3300046809 Bacteria 11320
898 Ga0495660_0009441 3300046810 Bacteria 5688
899 Ga0495660_0010483 3300046810 Bacteria 5390
900 Ga0495660_0011814 3300046810 Bacteria 5062
901 Ga0495660_0013996 3300046810 Bacteria 4651
902 Ga0495660_0025613 3300046810 Bacteria 3349
903 Ga0495660_0042266 3300046810 Bacteria 2519
904 Ga0495660_0071539 3300046810 Bacteria 1839
905 Ga0495581_0008394 3300047315 Bacteria 5987
906 Ga0495581_0015215 3300047315 Bacteria 4465
907 Ga0495581_0015668 3300047315 Bacteria 4399
908 Ga0495604_0020165 3300047317 Bacteria 5327
909 Ga0495604_0030329 3300047317 Bacteria 4295
910 Ga0495604_0038987 3300047317 Bacteria 3735
911 Ga0495604_0047559 3300047317 Bacteria 3340
912 Ga0495604_0051135 3300047317 Bacteria 3205
913 Ga0495636_0001913 3300047318 Bacteria 7964
914 Ga0495636_0002620 3300047318 Bacteria 6925
915 Ga0495636_0028437 3300047318 Bacteria 2280
916 Ga0495636_0042381 3300047318 Bacteria 1891
917 Ga0495636_0051765 3300047318 Bacteria 1722
918 Ga0495674_0004291 3300047319 Bacteria 13716
919 Ga0495674_0008961 3300047319 Bacteria 9507
920 Ga0495674_0359082 3300047319 Bacteria 1181
921 Ga0495674_0400908 3300047319 Bacteria 1107
922 Ga0495672_0000041 3300047320 Bacteria 267545
923 Ga0495672_0004140 3300047320 Bacteria 12054
924 Ga0495672_0006589 3300047320 Bacteria 8943
925 Ga0495672_0042796 3300047320 Bacteria 2728
926 Ga0495672_0052973 3300047320 Bacteria 2380
927 Ga0495672_0156877 3300047320 Bacteria 1174
928 Ga0495672_0289083 3300047320 Bacteria 780
929 Ga0495676_0000235 3300047321 Bacteria 44374
930 Ga0495676_0025419 3300047321 Bacteria 5113
931 Ga0495676_0045906 3300047321 Bacteria 3551
932 Ga0495676_0122523 3300047321 Bacteria 1889
933 Ga0495680_0042503 3300047322 Bacteria 3605
934 Ga0495683_0001361 3300047323 Bacteria 16273
935 Ga0495683_0003295 3300047323 Bacteria 9440
936 Ga0495683_0004350 3300047323 Bacteria 8069
937 Ga0495683_0016473 3300047323 Bacteria 3838
938 Ga0495683_0030886 3300047323 Bacteria 2731
939 Ga0495683_0034026 3300047323 Bacteria 2592
940 Ga0495683_0045537 3300047323 Bacteria 2204
941 Ga0495683_0070388 3300047323 Bacteria 1717
942 Ga0495683_0114245 3300047323 Bacteria 1286
943 Ga0495683_0229991 3300047323 Bacteria 823
944 Ga0495687_000127 3300047443 Bacteria 117520
945 Ga0495687_000143 3300047443 Bacteria 108306
946 Ga0495687_001108 3300047443 Bacteria 26234
947 Ga0495687_004036 3300047443 Bacteria 10188
948 Ga0495687_008098 3300047443 Bacteria 6072
949 Ga0495687_034999 3300047443 Bacteria 2263
950 Ga0495687_036591 3300047443 Bacteria 2195
951 Ga0495675_0081573 3300047444 Bacteria 2036
952 Ga0495675_0532871 3300047444 Bacteria 671
953 Ga0495677_0003200 3300047445 Bacteria 6384
954 Ga0495677_0005113 3300047445 Bacteria 4995
955 Ga0495677_0006278 3300047445 Bacteria 4490
956 Ga0495677_0007859 3300047445 Bacteria 3969
957 Ga0495677_0009153 3300047445 Bacteria 3659
958 Ga0495677_0024912 3300047445 Bacteria 2170
959 Ga0495677_0026448 3300047445 Bacteria 2105
960 Ga0495677_0049226 3300047445 Bacteria 1548
961 Ga0495677_0054027 3300047445 Bacteria 1481
962 Ga0495677_0076995 3300047445 Bacteria 1247
963 Ga0495677_0081048 3300047445 Bacteria 1216
964 Ga0495679_000037 3300047446 Bacteria 158099
965 Ga0495679_005470 3300047446 Bacteria 5628
966 Ga0495679_021280 3300047446 Bacteria 2243
967 Ga0495679_033196 3300047446 Bacteria 1650
968 Ga0495685_000113 3300047447 Bacteria 28884
969 Ga0495685_001114 3300047447 Bacteria 8216
970 Ga0495685_008745 3300047447 Bacteria 3372
971 Ga0495685_014165 3300047447 Bacteria 2708
972 Ga0495685_015742 3300047447 Bacteria 2582
973 Ga0495685_024327 3300047447 Bacteria 2084
974 Ga0495673_0006800 3300047469 Bacteria 6678
975 Ga0495673_0040844 3300047469 Bacteria 2091
976 Ga0495673_0047964 3300047469 Bacteria 1885
977 Ga0495681_0000694 3300047470 Bacteria 25709
978 Ga0495681_0001600 3300047470 Bacteria 16834
979 Ga0495681_0002505 3300047470 Bacteria 13086
980 Ga0495681_0004999 3300047470 Bacteria 8943
981 Ga0495681_0019417 3300047470 Bacteria 3712
982 Ga0495681_0019747 3300047470 Bacteria 3670
983 Ga0495681_0023569 3300047470 Bacteria 3267
984 Ga0495681_0028377 3300047470 Bacteria 2880
985 Ga0495681_0066454 3300047470 Bacteria 1645
986 Ga0495681_0075090 3300047470 Bacteria 1522
987 Ga0495686_0000288 3300047472 Bacteria 88523
988 Ga0495686_0000656 3300047472 Bacteria 47216
989 Ga0495686_0002328 3300047472 Bacteria 18154
990 Ga0495686_0007355 3300047472 Bacteria 8260
991 Ga0495686_0053453 3300047472 Bacteria 2531
992 Ga0495686_0060892 3300047472 Bacteria 2345
993 Ga0495593_0012820 3300047673 Bacteria 4788
994 Ga0495593_0012935 3300047673 Bacteria 4765
995 Ga0495593_0032542 3300047673 Bacteria 2842
996 Ga0495593_0048888 3300047673 Bacteria 2246
997 Ga0495602_0006574 3300048088 Bacteria 12184
998 Ga0495602_0022460 3300048088 Bacteria 6174
999 Ga0495602_0062779 3300048088 Bacteria 3222
1000 Ga0495602_0210740 3300048088 Bacteria 1475
1001 Ga0495614_0006362 3300048089 Bacteria 5305
1002 Ga0495614_0006654 3300048089 Bacteria 5174
1003 Ga0495614_0094288 3300048089 Bacteria 1304
1004 Ga0495626_0002049 3300048091 Bacteria 14744
1005 Ga0495626_0010705 3300048091 Bacteria 4878
1006 Ga0495626_0017842 3300048091 Bacteria 3579
1007 Ga0495626_0020742 3300048091 Bacteria 3270
1008 Ga0495626_0021140 3300048091 Bacteria 3232
1009 Ga0495626_0022862 3300048091 Bacteria 3085
1010 Ga0495626_0031484 3300048091 Bacteria 2552
1011 Ga0495626_0033862 3300048091 Bacteria 2446
1012 Ga0495626_0038091 3300048091 Bacteria 2281
1013 Ga0495626_0040299 3300048091 Bacteria 2207
1014 Ga0495626_0059781 3300048091 Bacteria 1738
1015 Ga0495626_0065980 3300048091 Bacteria 1637
1016 Ga0495626_0074515 3300048091 Bacteria 1518
1017 Ga0495626_0109953 3300048091 Bacteria 1194
1018 Ga0495626_0144554 3300048091 Bacteria 1006
1019 Ga0495626_0163969 3300048091 Bacteria 930
1020 Ga0496100_0016601 3300048903 Bacteria 4327
1021 Ga0496100_0171134 3300048903 Bacteria 1564
1022 Ga0496100_0458653 3300048903 Bacteria 978
1023 Ga0496100_0482716 3300048903 Bacteria 953
1024 Ga0496101_0030388 3300048904 Bacteria 3787
1025 Ga0496102_0000931 3300048905 Bacteria 27579
1026 Ga0496102_0401793 3300048905 Bacteria 1288
1027 Ga0496103_0022931 3300048906 Bacteria 3762
1028 Ga0496103_0056910 3300048906 Bacteria 2427
1029 Ga0496103_0529000 3300048906 Bacteria 753
1030 Ga0496104_0338360 3300048907 Bacteria 1418
1031 Ga0496105_0087572 3300048908 Bacteria 2573
1032 Ga0496107_0055316 3300048910 Bacteria 2866
1033 Ga0496109_0009606 3300048912 Bacteria 8249
1034 Ga0496109_0115613 3300048912 Bacteria 2496
1035 Ga0496110_0029094 3300048913 Bacteria 4750
1036 Ga0496110_0045736 3300048913 Bacteria 3827
1037 Ga0496110_0047706 3300048913 Bacteria 3752
1038 Ga0496110_0261305 3300048913 Bacteria 1576
1039 Ga0496110_0715854 3300048913 Bacteria 903
1040 Ga0496111_0014930 3300048914 Bacteria 5319
1041 Ga0496111_0342997 3300048914 Bacteria 1106
1042 Ga0496113_0008457 3300048916 Bacteria 6707
1043 Ga0496114_0439153 3300048917 Bacteria 1156
1044 Ga0496115_0018367 3300048918 Bacteria 5367
1045 Ga0496115_0020248 3300048918 Bacteria 5130
1046 Ga0496115_0055871 3300048918 Bacteria 3172
1047 Ga0496115_0220001 3300048918 Bacteria 1567
1048 Ga0496115_0238318 3300048918 Bacteria 1500
1049 Ga0496115_0276349 3300048918 Bacteria 1379
1050 Ga0496116_0014132 3300048919 Bacteria 6391
1051 Ga0496116_0026637 3300048919 Bacteria 4223
1052 Ga0496116_0033774 3300048919 Bacteria 3623
1053 Ga0496117_0028920 3300048920 Bacteria 4282
1054 Ga0496117_0114372 3300048920 Bacteria 1673
1055 Ga0496117_0121972 3300048920 Bacteria 1599
1056 Ga0496118_0002886 3300048921 Bacteria 22384
1057 Ga0496118_0040010 3300048921 Bacteria 3733
1058 Ga0496118_0060865 3300048921 Bacteria 2800
1059 Ga0496121_0014458 3300048924 Bacteria 8371
1060 Ga0496121_0084985 3300048924 Bacteria 2492
1061 Ga0496121_0197583 3300048924 Bacteria 1436
1062 Ga0496122_0000261 3300048925 Bacteria 118793
1063 Ga0496122_0000445 3300048925 Bacteria 86566
1064 Ga0496122_0011752 3300048925 Bacteria 8821
1065 Ga0496123_0000218 3300048926 Bacteria 116615
1066 Ga0496123_0001568 3300048926 Bacteria 31272
1067 Ga0496123_0007592 3300048926 Bacteria 10163
1068 Ga0496124_0015077 3300048927 Bacteria 7431
1069 Ga0496124_0015517 3300048927 Bacteria 7294
1070 Ga0496124_0046689 3300048927 Bacteria 3707
1071 Ga0496124_0097419 3300048927 Bacteria 2388
1072 Ga0496124_0151501 3300048927 Bacteria 1818
1073 Ga0496124_0237922 3300048927 Bacteria 1356
1074 Ga0496124_0351417 3300048927 Bacteria 1043
1075 Ga0496124_0429036 3300048927 Bacteria 908
1076 Ga0496125_0000256 3300048928 Bacteria 109696
1077 Ga0496125_0002859 3300048928 Bacteria 21722
1078 Ga0496125_0067915 3300048928 Bacteria 2806
1079 Ga0496126_0034799 3300048929 Bacteria 4726
1080 Ga0496126_0054778 3300048929 Bacteria 3611
1081 Ga0496126_0111802 3300048929 Bacteria 2379
1082 Ga0501306_002557 3300049127 Bacteria 1880
1083 Ga0501310_001443 3300049130 Bacteria 2171
1084 Ga0495678_000042 3300049459 Bacteria 174125
1085 Ga0495678_000316 3300049459 Bacteria 51625
1086 Ga0495678_003135 3300049459 Bacteria 10459
1087 Ga0495678_003427 3300049459 Bacteria 9828
1088 Ga0495678_003924 3300049459 Bacteria 8918
1089 Ga0495678_004684 3300049459 Bacteria 7829
1090 Ga0495678_006389 3300049459 Bacteria 6281
1091 Ga0495678_007748 3300049459 Bacteria 5531
1092 Ga0495678_009881 3300049459 Bacteria 4678
1093 Ga0495678_025595 3300049459 Bacteria 2532
1094 Ga0495678_033817 3300049459 Bacteria 2108
1095 Ga0495682_0000107 3300049460 Bacteria 73486
1096 Ga0495682_0033786 3300049460 Bacteria 1887
1097 Ga0495682_0038533 3300049460 Bacteria 1756
1098 Ga0495682_0084729 3300049460 Bacteria 1139
1099 Ga0495682_0094804 3300049460 Bacteria 1071
1100 Ga0501039_0066319 3300049575 Bacteria 2802
1101 Ga0501070_0147283 3300049586 Bacteria 1943
1102 Ga0501198_000102 3300049649 Bacteria 16377
1103 Ga0501222_000008 3300049662 Bacteria 120904
1104 Ga0501227_039267 3300049665 Bacteria 1164
1105 Ga0501249_003963 3300049679 Bacteria 2997
1106 Ga0501269_000210 3300049766 Bacteria 17330
1107 Ga0501279_000208 3300049775 Bacteria 8130
1108 Ga0501279_004406 3300049775 Bacteria 1847
1109 Ga0501279_036368 3300049775 Bacteria 744
1110 nmdc:mga03683_277888_c1 3300050489 Bacteria 782
1111 nmdc:mga0k408_132531_c1 3300050493 Bacteria 1480
1112 nmdc:mga0k408_177614_c1 3300050493 Bacteria 1270
1113 nmdc:mga0k408_196874_c1 3300050493 Bacteria 1203
1114 nmdc:mga0k408_22887_c1 3300050493 Bacteria 1916
1115 nmdc:mga0k408_487922_c1 3300050493 Bacteria 731
1116 nmdc:mga0k408_59835_c1 3300050493 Bacteria 2214
1117 nmdc:mga07m45_5487_c1 3300050496 Bacteria 6318
1118 nmdc:mga08x19_12730_c1 3300050514 Bacteria 5072
1119 Ga0495601_0030324 3300053077 Bacteria 3357
1120 Ga0495601_0239427 3300053077 Bacteria 1185
1121 Ga0500635_0000083 3300053080 Bacteria 61980
1122 Ga0495595_0136294 3300053084 Bacteria 1202
1123 Ga0500651_0112998 3300053093 Bacteria 1656
1124 Ga0500595_003047 3300053119 Bacteria 7965
1125 Ga0500619_000742 3300053154 Bacteria 5568
1126 Ga0500634_0108608 3300053161 Bacteria 1374
1127 Ga0500637_0152420 3300053178 Bacteria 1335
1128 Ga0500587_000079 3300053739 Bacteria 8123
1129 Ga0500661_006935 3300055283 Bacteria 2102
1130 Ga0587091_002909 3300059511 Bacteria 2096
1131 Ga0587062_001995 3300059639 Bacteria 1881
1132 Ga0587111_0003612 3300060346 Bacteria 2220
1133 Ga0466962_0002972 3300061719 Bacteria 8086
1134 Ga0466962_0003937 3300061719 Bacteria 7106

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10186258 rootH1_101862582 200
2 3300003752 Ga0055539_1000146 Ga0055539_10001467 201
3 3300003756 Ga0055533_1000150 Ga0055533_10001507 201
4 3300003759 Ga0055525_1000198 Ga0055525_10001987 201
5 3300003841 Ga0055541_1000098 Ga0055541_10000987 201
6 3300021361 Ga0213872_10002809 Ga0213872_100028096 201
7 3300039447 Ga0436361_0144599 Ga0436361_0144599_92_706 201
8 3300002739 JGI25158J39367_1001641 JGI25158J39367_10016413 202
9 3300002774 JGI25150J39212_1012636 JGI25150J39212_10126362 202
10 3300002987 JGI25159J45721_1005067 JGI25159J45721_10050672 202
11 3300003354 JGI25160J50197_1002021 JGI25160J50197_10020215 202
12 3300003374 JGI25161J50226_1001870 JGI25161J50226_10018702 202
13 3300003771 Ga0055526_1000827 Ga0055526_10008277 202
14 3300003771 Ga0055526_1003727 Ga0055526_10037276 202
15 3300003773 Ga0055537_1000111 Ga0055537_100011112 202
16 3300003775 Ga0055524_1002005 Ga0055524_10020055 202
17 3300003775 Ga0055524_1002542 Ga0055524_10025425 202
18 3300003784 Ga0055534_1000268 Ga0055534_100026819 202
19 3300003784 Ga0055534_1002782 Ga0055534_10027822 202
20 3300003790 Ga0055528_1000178 Ga0055528_100017840 202
21 3300003791 Ga0055530_10028903 Ga0055530_100289032 202
22 3300003794 Ga0055531_10021621 Ga0055531_100216213 202
23 3300025208 Ga0209436_100751 Ga0209436_10075111 202
24 3300025258 Ga0209129_1000093 Ga0209129_1000093153 202
25 3300025263 Ga0209565_1000009 Ga0209565_1000009587 202
26 3300025263 Ga0209565_1000946 Ga0209565_10009468 202
27 3300025263 Ga0209565_1001578 Ga0209565_10015786 202
28 3300025273 Ga0209673_1000036 Ga0209673_100003695 202
29 3300025273 Ga0209673_1006646 Ga0209673_10066465 202
30 3300025284 Ga0209130_1001278 Ga0209130_100127810 202
31 3300025284 Ga0209130_1001458 Ga0209130_100145811 202
32 3300025291 Ga0209675_1000013 Ga0209675_100001395 202
33 3300025291 Ga0209675_1000945 Ga0209675_100094512 202
34 3300025295 Ga0209564_1000122 Ga0209564_100012295 202
35 3300025295 Ga0209564_1003837 Ga0209564_10038376 202
36 3300025298 Ga0209050_1007847 Ga0209050_10078476 202
37 3300025299 Ga0209256_1000106 Ga0209256_100010680 202
38 3300025299 Ga0209256_1000269 Ga0209256_100026996 202
39 3300025299 Ga0209256_1002862 Ga0209256_10028629 202
40 3300025302 Ga0207426_1002626 Ga0207426_10026268 202
41 3300025303 Ga0209051_1016272 Ga0209051_10162722 202
42 3300025304 Ga0209257_1000010 Ga0209257_10000101002 202
43 3300032002 Ga0307416_100005407 Ga0307416_1000054072 202
44 3300032004 Ga0307414_10094204 Ga0307414_100942042 202
45 3300041413 Ga0439465_0120827 Ga0439465_0120827_152_769 202
46 3300042008 Ga0439450_007594 Ga0439450_007594_560_1177 202
47 3300042461 Ga0439460_0095082 Ga0439460_0095082_140_757 202
48 3300046457 Ga0495590_0018282 Ga0495590_0018282_1477_2094 202
49 3300046474 Ga0495605_0025196 Ga0495605_0025196_536_1153 202
50 3300046491 Ga0495584_0000560 Ga0495584_0000560_1305_1922 202
51 3300046501 Ga0495607_0005057 Ga0495607_0005057_1074_1691 202
52 3300046513 Ga0495616_0010511 Ga0495616_0010511_4211_4828 202
53 3300046528 Ga0495642_0041624 Ga0495642_0041624_232_849 202
54 3300046538 Ga0495609_0033768 Ga0495609_0033768_224_841 202
55 3300046616 Ga0495668_0034704 Ga0495668_0034704_324_941 202
56 3300046664 Ga0495659_0000919 Ga0495659_0000919_7427_8044 202
57 3300046665 Ga0495661_0004930 Ga0495661_0004930_6880_7497 202
58 3300046692 Ga0495671_0101401 Ga0495671_0101401_268_885 202
59 3300046694 Ga0495649_0006781 Ga0495649_0006781_352_969 202
60 3300046810 Ga0495660_0009441 Ga0495660_0009441_4389_5003 202
61 3300046810 Ga0495660_0071539 Ga0495660_0071539_620_1237 202
62 3300047318 Ga0495636_0028437 Ga0495636_0028437_1312_1929 202
63 3300047443 Ga0495687_008098 Ga0495687_008098_2164_2781 202
64 3300047445 Ga0495677_0009153 Ga0495677_0009153_2034_2651 202
65 3300047446 Ga0495679_021280 Ga0495679_021280_830_1447 202
66 3300047470 Ga0495681_0002505 Ga0495681_0002505_8324_8938 202
67 3300047470 Ga0495681_0028377 Ga0495681_0028377_1632_2249 202
68 3300047472 Ga0495686_0000288 Ga0495686_0000288_12940_13566 202
69 3300048903 Ga0496100_0458653 Ga0496100_0458653_304_921 202
70 3300048927 Ga0496124_0151501 Ga0496124_0151501_926_1540 202
71 3300049127 Ga0501306_002557 Ga0501306_002557_509_1126 202
72 3300049459 Ga0495678_000042 Ga0495678_000042_172109_172723 202
73 3300049665 Ga0501227_039267 Ga0501227_039267_349_966 202
74 3300049775 Ga0501279_004406 Ga0501279_004406_849_1466 202
75 3300002738 JGI25154J39366_1003202 JGI25154J39366_10032023 203
76 3300003215 JGI25153J46596_10017617 JGI25153J46596_100176172 203
77 3300003771 Ga0055526_1000161 Ga0055526_100016149 203
78 3300003775 Ga0055524_1000015 Ga0055524_1000015177 203
79 3300005614 Ga0068856_100257418 Ga0068856_1002574182 203
80 3300005718 Ga0068866_10309096 Ga0068866_103090961 203
81 3300006358 Ga0068871_100073893 Ga0068871_1000738932 203
82 3300006881 Ga0068865_100114600 Ga0068865_1001146002 203
83 3300009036 Ga0105244_10002953 Ga0105244_1000295310 203
84 3300009036 Ga0105244_10007523 Ga0105244_100075236 203
85 3300009036 Ga0105244_10061761 Ga0105244_100617612 203
86 3300009148 Ga0105243_10052625 Ga0105243_100526253 203
87 3300009174 Ga0105241_10019955 Ga0105241_100199552 203
88 3300009176 Ga0105242_10007036 Ga0105242_1000703610 203
89 3300009551 Ga0105238_10061774 Ga0105238_100617743 203
90 3300011119 Ga0105246_10099856 Ga0105246_100998563 203
91 3300013100 Ga0157373_10045986 Ga0157373_100459862 203
92 3300013104 Ga0157370_10764917 Ga0157370_107649171 203
93 3300013296 Ga0157374_10132950 Ga0157374_101329503 203
94 3300013297 Ga0157378_10248522 Ga0157378_102485222 203
95 3300013307 Ga0157372_10731731 Ga0157372_107317311 203
96 3300014745 Ga0157377_10228313 Ga0157377_102283132 203
97 3300015262 Ga0182007_10095791 Ga0182007_100957912 203
98 3300021361 Ga0213872_10000002 Ga0213872_10000002242 203
99 3300021361 Ga0213872_10019803 Ga0213872_100198035 203
100 3300025263 Ga0209565_1012113 Ga0209565_10121132 203
101 3300025299 Ga0209256_1000005 Ga0209256_1000005177 203
102 3300027666 Ga0209282_1000002 Ga0209282_1000002751 203
103 3300031838 Ga0307518_10127414 Ga0307518_101274142 203
104 3300037471 Ga0395905_0028213 Ga0395905_0028213_4458_5078 203
105 3300046616 Ga0495668_0000025 Ga0495668_0000025_188562_189185 203
106 3300047472 Ga0495686_0002328 Ga0495686_0002328_2391_3014 203
107 3300049130 Ga0501310_001443 Ga0501310_001443_619_1239 203
108 3300049459 Ga0495678_003924 Ga0495678_003924_1609_2229 203
109 3300049459 Ga0495678_033817 Ga0495678_033817_1400_2023 203
110 3300049575 Ga0501039_0066319 Ga0501039_0066319_844_1458 203
111 3300049775 Ga0501279_000208 Ga0501279_000208_629_1249 203
112 3300003575 Ga0007409J51694_1041494 Ga0007409J51694_10414945 204
113 3300005262 Ga0065165_1000286 Ga0065165_100028649 204
114 3300021361 Ga0213872_10038157 Ga0213872_100381572 204
115 3300021361 Ga0213872_10046973 Ga0213872_100469732 204
116 3300021361 Ga0213872_10141970 Ga0213872_101419702 204
117 3300037471 Ga0395905_0025730 Ga0395905_0025730_2842_3459 204
118 3300039447 Ga0436361_0600769 Ga0436361_0600769_306_929 204
119 3300039447 Ga0436361_0846070 Ga0436361_0846070_3392_4021 204
120 3300044658 Ga0466972_0000088 Ga0466972_0000088_11498_12121 204
121 3300044658 Ga0466972_0022575 Ga0466972_0022575_1500_2123 204
122 3300044683 Ga0466965_0000666 Ga0466965_0000666_6497_7120 204
123 3300044706 Ga0466964_0025767 Ga0466964_0025767_1152_1775 204
124 3300044706 Ga0466964_0056879 Ga0466964_0056879_85_708 204
125 3300044706 Ga0466964_0113758 Ga0466964_0113758_353_976 204
126 3300045836 Ga0466958_0587412 Ga0466958_0587412_69_686 204
127 3300046452 Ga0495617_000002 Ga0495617_000002_640334_640951 204
128 3300046452 Ga0495617_041726 Ga0495617_041726_249_866 204
129 3300046453 Ga0495627_000207 Ga0495627_000207_5864_6481 204
130 3300046453 Ga0495627_042518 Ga0495627_042518_25_642 204
131 3300046453 Ga0495627_046735 Ga0495627_046735_625_1242 204
132 3300046455 Ga0495603_0106430 Ga0495603_0106430_67_684 204
133 3300046455 Ga0495603_0364263 Ga0495603_0364263_156_773 204
134 3300046457 Ga0495590_0000025 Ga0495590_0000025_72243_72860 204
135 3300046458 Ga0495591_002755 Ga0495591_002755_5178_5795 204
136 3300046460 Ga0495638_0035516 Ga0495638_0035516_711_1328 204
137 3300046460 Ga0495638_0073932 Ga0495638_0073932_688_1305 204
138 3300046463 Ga0495653_0132732 Ga0495653_0132732_53_670 204
139 3300046471 Ga0495650_0000015 Ga0495650_0000015_279391_280014 204
140 3300046471 Ga0495650_0005573 Ga0495650_0005573_7029_7652 204
141 3300046471 Ga0495650_0007195 Ga0495650_0007195_5175_5792 204
142 3300046471 Ga0495650_0008662 Ga0495650_0008662_1454_2071 204
143 3300046472 Ga0495580_0115644 Ga0495580_0115644_1083_1700 204
144 3300046473 Ga0495582_0002333 Ga0495582_0002333_655_1272 204
145 3300046474 Ga0495605_0001284 Ga0495605_0001284_10522_11139 204
146 3300046476 Ga0495662_0386912 Ga0495662_0386912_15_632 204
147 3300046491 Ga0495584_0000070 Ga0495584_0000070_65541_66158 204
148 3300046491 Ga0495584_0005783 Ga0495584_0005783_3466_4083 204
149 3300046491 Ga0495584_0007322 Ga0495584_0007322_775_1404 204
150 3300046491 Ga0495584_0009129 Ga0495584_0009129_1865_2482 204
151 3300046491 Ga0495584_0288096 Ga0495584_0288096_48_665 204
152 3300046492 Ga0495585_0006233 Ga0495585_0006233_3092_3709 204
153 3300046492 Ga0495585_0010483 Ga0495585_0010483_3621_4238 204
154 3300046492 Ga0495585_0013461 Ga0495585_0013461_3018_3635 204
155 3300046492 Ga0495585_0026665 Ga0495585_0026665_355_972 204
156 3300046492 Ga0495585_0030854 Ga0495585_0030854_598_1215 204
157 3300046492 Ga0495585_0032874 Ga0495585_0032874_473_1090 204
158 3300046492 Ga0495585_0059514 Ga0495585_0059514_970_1599 204
159 3300046492 Ga0495585_0068952 Ga0495585_0068952_953_1570 204
160 3300046492 Ga0495585_0193122 Ga0495585_0193122_96_713 204
161 3300046499 Ga0495594_0005742 Ga0495594_0005742_2944_3561 204
162 3300046499 Ga0495594_0013918 Ga0495594_0013918_995_1612 204
163 3300046499 Ga0495594_0030537 Ga0495594_0030537_2263_2880 204
164 3300046499 Ga0495594_0069416 Ga0495594_0069416_1303_1920 204
165 3300046500 Ga0495596_0001839 Ga0495596_0001839_3235_3852 204
166 3300046500 Ga0495596_0008211 Ga0495596_0008211_2201_2818 204
167 3300046500 Ga0495596_0009505 Ga0495596_0009505_2891_3508 204
168 3300046500 Ga0495596_0011786 Ga0495596_0011786_3013_3630 204
169 3300046500 Ga0495596_0012683 Ga0495596_0012683_2543_3160 204
170 3300046500 Ga0495596_0033692 Ga0495596_0033692_729_1358 204
171 3300046500 Ga0495596_0041071 Ga0495596_0041071_505_1122 204
172 3300046500 Ga0495596_0196268 Ga0495596_0196268_155_772 204
173 3300046501 Ga0495607_0002594 Ga0495607_0002594_11904_12533 204
174 3300046501 Ga0495607_0004085 Ga0495607_0004085_5861_6478 204
175 3300046501 Ga0495607_0014386 Ga0495607_0014386_11_628 204
176 3300046501 Ga0495607_0017453 Ga0495607_0017453_2905_3522 204
177 3300046501 Ga0495607_0031280 Ga0495607_0031280_1938_2555 204
178 3300046501 Ga0495607_0307808 Ga0495607_0307808_39_656 204
179 3300046506 Ga0495583_0000372 Ga0495583_0000372_55851_56480 204
180 3300046506 Ga0495583_0000382 Ga0495583_0000382_64126_64743 204
181 3300046506 Ga0495583_0000864 Ga0495583_0000864_36184_36801 204
182 3300046506 Ga0495583_0023202 Ga0495583_0023202_641_1258 204
183 3300046506 Ga0495583_0056880 Ga0495583_0056880_168_785 204
184 3300046506 Ga0495583_0101613 Ga0495583_0101613_81_698 204
185 3300046506 Ga0495583_0167063 Ga0495583_0167063_253_870 204
186 3300046506 Ga0495583_0209989 Ga0495583_0209989_44_661 204
187 3300046507 Ga0495606_0004210 Ga0495606_0004210_10727_11344 204
188 3300046507 Ga0495606_0013849 Ga0495606_0013849_988_1605 204
189 3300046507 Ga0495606_0039674 Ga0495606_0039674_1844_2461 204
190 3300046507 Ga0495606_0306052 Ga0495606_0306052_73_690 204
191 3300046512 Ga0495610_0004511 Ga0495610_0004511_2534_3151 204
192 3300046513 Ga0495616_0003140 Ga0495616_0003140_5988_6605 204
193 3300046513 Ga0495616_0015188 Ga0495616_0015188_2911_3528 204
194 3300046513 Ga0495616_0015417 Ga0495616_0015417_26_643 204
195 3300046513 Ga0495616_0015591 Ga0495616_0015591_1712_2329 204
196 3300046513 Ga0495616_0028366 Ga0495616_0028366_1175_1792 204
197 3300046513 Ga0495616_0101666 Ga0495616_0101666_45_662 204
198 3300046517 Ga0495630_0058357 Ga0495630_0058357_1399_2016 204
199 3300046518 Ga0495631_0002820 Ga0495631_0002820_5532_6149 204
200 3300046518 Ga0495631_0003219 Ga0495631_0003219_1063_1680 204
201 3300046518 Ga0495631_0012520 Ga0495631_0012520_2736_3365 204
202 3300046518 Ga0495631_0014987 Ga0495631_0014987_326_943 204
203 3300046518 Ga0495631_0015637 Ga0495631_0015637_2090_2707 204
204 3300046518 Ga0495631_0016374 Ga0495631_0016374_2409_3026 204
205 3300046518 Ga0495631_0021138 Ga0495631_0021138_375_992 204
206 3300046518 Ga0495631_0045981 Ga0495631_0045981_703_1320 204
207 3300046518 Ga0495631_0144685 Ga0495631_0144685_292_909 204
208 3300046518 Ga0495631_0181164 Ga0495631_0181164_185_802 204
209 3300046519 Ga0495632_0000129 Ga0495632_0000129_70250_70867 204
210 3300046519 Ga0495632_0000296 Ga0495632_0000296_5988_6605 204
211 3300046519 Ga0495632_0000375 Ga0495632_0000375_8666_9286 204
212 3300046519 Ga0495632_0008199 Ga0495632_0008199_3574_4203 204
213 3300046519 Ga0495632_0022797 Ga0495632_0022797_1970_2587 204
214 3300046519 Ga0495632_0025075 Ga0495632_0025075_1768_2385 204
215 3300046519 Ga0495632_0026117 Ga0495632_0026117_1800_2417 204
216 3300046520 Ga0495637_0000126 Ga0495637_0000126_42004_42621 204
217 3300046520 Ga0495637_0023626 Ga0495637_0023626_24_641 204
218 3300046520 Ga0495637_0070124 Ga0495637_0070124_390_1007 204
219 3300046522 Ga0495643_0011985 Ga0495643_0011985_4258_4875 204
220 3300046522 Ga0495643_0031662 Ga0495643_0031662_213_830 204
221 3300046522 Ga0495643_0048513 Ga0495643_0048513_1383_2000 204
222 3300046522 Ga0495643_0125066 Ga0495643_0125066_98_715 204
223 3300046522 Ga0495643_0313931 Ga0495643_0313931_25_642 204
224 3300046523 Ga0495644_0000389 Ga0495644_0000389_6184_6801 204
225 3300046523 Ga0495644_0001948 Ga0495644_0001948_4119_4748 204
226 3300046523 Ga0495644_0003401 Ga0495644_0003401_1592_2209 204
227 3300046523 Ga0495644_0003438 Ga0495644_0003438_2264_2881 204
228 3300046524 Ga0495648_0000708 Ga0495648_0000708_1328_1945 204
229 3300046524 Ga0495648_0007168 Ga0495648_0007168_1304_1921 204
230 3300046524 Ga0495648_0011619 Ga0495648_0011619_5793_6410 204
231 3300046524 Ga0495648_0048317 Ga0495648_0048317_695_1312 204
232 3300046524 Ga0495648_0085064 Ga0495648_0085064_51_668 204
233 3300046524 Ga0495648_0215620 Ga0495648_0215620_275_892 204
234 3300046525 Ga0495663_0017672 Ga0495663_0017672_978_1595 204
235 3300046525 Ga0495663_0086948 Ga0495663_0086948_149_766 204
236 3300046526 Ga0495666_0000556 Ga0495666_0000556_11419_12036 204
237 3300046526 Ga0495666_0018785 Ga0495666_0018785_819_1436 204
238 3300046526 Ga0495666_0039750 Ga0495666_0039750_255_872 204
239 3300046528 Ga0495642_0000613 Ga0495642_0000613_14291_14908 204
240 3300046528 Ga0495642_0004874 Ga0495642_0004874_924_1541 204
241 3300046528 Ga0495642_0009239 Ga0495642_0009239_764_1393 204
242 3300046528 Ga0495642_0016483 Ga0495642_0016483_1688_2305 204
243 3300046528 Ga0495642_0066401 Ga0495642_0066401_191_808 204
244 3300046528 Ga0495642_0069897 Ga0495642_0069897_796_1413 204
245 3300046530 Ga0495654_0004611 Ga0495654_0004611_2100_2717 204
246 3300046530 Ga0495654_0018761 Ga0495654_0018761_2583_3200 204
247 3300046530 Ga0495654_0028918 Ga0495654_0028918_1832_2449 204
248 3300046530 Ga0495654_0107634 Ga0495654_0107634_121_738 204
249 3300046530 Ga0495654_0198012 Ga0495654_0198012_17_634 204
250 3300046531 Ga0495665_0049520 Ga0495665_0049520_957_1574 204
251 3300046535 Ga0495586_0009827 Ga0495586_0009827_185_802 204
252 3300046535 Ga0495586_0012802 Ga0495586_0012802_3047_3664 204
253 3300046536 Ga0495587_0243573 Ga0495587_0243573_188_805 204
254 3300046538 Ga0495609_0003442 Ga0495609_0003442_6318_6935 204
255 3300046538 Ga0495609_0004070 Ga0495609_0004070_5886_6503 204
256 3300046538 Ga0495609_0015930 Ga0495609_0015930_1575_2192 204
257 3300046538 Ga0495609_0016433 Ga0495609_0016433_2088_2705 204
258 3300046538 Ga0495609_0021815 Ga0495609_0021815_144_761 204
259 3300046538 Ga0495609_0029412 Ga0495609_0029412_30_647 204
260 3300046538 Ga0495609_0065495 Ga0495609_0065495_130_747 204
261 3300046538 Ga0495609_0099802 Ga0495609_0099802_389_1018 204
262 3300046542 Ga0495597_0001388 Ga0495597_0001388_12562_13179 204
263 3300046542 Ga0495597_0002423 Ga0495597_0002423_5764_6381 204
264 3300046542 Ga0495597_0003311 Ga0495597_0003311_213_830 204
265 3300046542 Ga0495597_0005681 Ga0495597_0005681_742_1359 204
266 3300046542 Ga0495597_0009715 Ga0495597_0009715_577_1194 204
267 3300046542 Ga0495597_0010710 Ga0495597_0010710_516_1133 204
268 3300046542 Ga0495597_0038705 Ga0495597_0038705_689_1306 204
269 3300046542 Ga0495597_0219965 Ga0495597_0219965_113_730 204
270 3300046557 Ga0495622_0000064 Ga0495622_0000064_38673_39290 204
271 3300046557 Ga0495622_0006368 Ga0495622_0006368_3888_4505 204
272 3300046557 Ga0495622_0032190 Ga0495622_0032190_1715_2332 204
273 3300046557 Ga0495622_0054258 Ga0495622_0054258_247_864 204
274 3300046558 Ga0495633_0004954 Ga0495633_0004954_6604_7221 204
275 3300046558 Ga0495633_0008291 Ga0495633_0008291_1830_2447 204
276 3300046558 Ga0495633_0060270 Ga0495633_0060270_918_1547 204
277 3300046558 Ga0495633_0079803 Ga0495633_0079803_274_891 204
278 3300046615 Ga0495656_0300791 Ga0495656_0300791_78_707 204
279 3300046615 Ga0495656_0386048 Ga0495656_0386048_85_702 204
280 3300046616 Ga0495668_0000544 Ga0495668_0000544_10418_11035 204
281 3300046616 Ga0495668_0000578 Ga0495668_0000578_770_1387 204
282 3300046616 Ga0495668_0003733 Ga0495668_0003733_6899_7516 204
283 3300046616 Ga0495668_0029684 Ga0495668_0029684_775_1404 204
284 3300046616 Ga0495668_0045031 Ga0495668_0045031_1535_2152 204
285 3300046616 Ga0495668_0066242 Ga0495668_0066242_1354_1971 204
286 3300046648 Ga0495611_0000946 Ga0495611_0000946_771_1388 204
287 3300046648 Ga0495611_0003308 Ga0495611_0003308_3617_4234 204
288 3300046648 Ga0495611_0033374 Ga0495611_0033374_505_1122 204
289 3300046648 Ga0495611_0125987 Ga0495611_0125987_282_911 204
290 3300046660 Ga0495625_0026121 Ga0495625_0026121_2659_3276 204
291 3300046660 Ga0495625_0040181 Ga0495625_0040181_2743_3360 204
292 3300046660 Ga0495625_0155060 Ga0495625_0155060_754_1371 204
293 3300046660 Ga0495625_0249643 Ga0495625_0249643_428_1045 204
294 3300046663 Ga0495635_0001292 Ga0495635_0001292_2564_3181 204
295 3300046664 Ga0495659_0008635 Ga0495659_0008635_1256_1873 204
296 3300046664 Ga0495659_0013224 Ga0495659_0013224_1204_1821 204
297 3300046665 Ga0495661_0002258 Ga0495661_0002258_5477_6094 204
298 3300046665 Ga0495661_0023263 Ga0495661_0023263_1467_2084 204
299 3300046665 Ga0495661_0024203 Ga0495661_0024203_706_1323 204
300 3300046665 Ga0495661_0038868 Ga0495661_0038868_1659_2282 204
301 3300046665 Ga0495661_0063697 Ga0495661_0063697_1506_2123 204
302 3300046665 Ga0495661_0088267 Ga0495661_0088267_23_640 204
303 3300046665 Ga0495661_0100596 Ga0495661_0100596_703_1320 204
304 3300046665 Ga0495661_0103250 Ga0495661_0103250_276_893 204
305 3300046665 Ga0495661_0218012 Ga0495661_0218012_79_696 204
306 3300046665 Ga0495661_0316595 Ga0495661_0316595_37_654 204
307 3300046674 Ga0495588_0003376 Ga0495588_0003376_49_666 204
308 3300046674 Ga0495588_0024317 Ga0495588_0024317_584_1201 204
309 3300046674 Ga0495588_0036417 Ga0495588_0036417_321_938 204
310 3300046674 Ga0495588_0046183 Ga0495588_0046183_1520_2137 204
311 3300046674 Ga0495588_0166293 Ga0495588_0166293_126_743 204
312 3300046674 Ga0495588_0189117 Ga0495588_0189117_12_629 204
313 3300046679 Ga0495623_0091236 Ga0495623_0091236_869_1486 204
314 3300046679 Ga0495623_0172788 Ga0495623_0172788_396_1013 204
315 3300046680 Ga0495646_0126911 Ga0495646_0126911_184_801 204
316 3300046684 Ga0495669_0000092 Ga0495669_0000092_7321_7938 204
317 3300046684 Ga0495669_0000583 Ga0495669_0000583_6802_7419 204
318 3300046684 Ga0495669_0002000 Ga0495669_0002000_326_943 204
319 3300046684 Ga0495669_0018903 Ga0495669_0018903_800_1417 204
320 3300046684 Ga0495669_0053696 Ga0495669_0053696_415_1032 204
321 3300046684 Ga0495669_0062837 Ga0495669_0062837_729_1358 204
322 3300046689 Ga0495613_0033961 Ga0495613_0033961_2432_3049 204
323 3300046689 Ga0495613_0108969 Ga0495613_0108969_335_952 204
324 3300046690 Ga0495624_0013356 Ga0495624_0013356_3880_4497 204
325 3300046691 Ga0495670_0001955 Ga0495670_0001955_953_1570 204
326 3300046691 Ga0495670_0023024 Ga0495670_0023024_2173_2790 204
327 3300046691 Ga0495670_0041036 Ga0495670_0041036_1147_1764 204
328 3300046691 Ga0495670_0053575 Ga0495670_0053575_472_1089 204
329 3300046691 Ga0495670_0106660 Ga0495670_0106660_284_901 204
330 3300046691 Ga0495670_0116948 Ga0495670_0116948_233_862 204
331 3300046691 Ga0495670_0263036 Ga0495670_0263036_256_873 204
332 3300046692 Ga0495671_0002518 Ga0495671_0002518_10222_10839 204
333 3300046692 Ga0495671_0011096 Ga0495671_0011096_3427_4044 204
334 3300046692 Ga0495671_0056700 Ga0495671_0056700_827_1444 204
335 3300046692 Ga0495671_0138840 Ga0495671_0138840_195_812 204
336 3300046694 Ga0495649_0003126 Ga0495649_0003126_6942_7559 204
337 3300046694 Ga0495649_0005200 Ga0495649_0005200_4556_5173 204
338 3300046694 Ga0495649_0015381 Ga0495649_0015381_921_1538 204
339 3300046694 Ga0495649_0029688 Ga0495649_0029688_944_1561 204
340 3300046694 Ga0495649_0063457 Ga0495649_0063457_156_773 204
341 3300046694 Ga0495649_0118121 Ga0495649_0118121_249_866 204
342 3300046694 Ga0495649_0152974 Ga0495649_0152974_403_1032 204
343 3300046694 Ga0495649_0194707 Ga0495649_0194707_314_931 204
344 3300046694 Ga0495649_0304778 Ga0495649_0304778_177_794 204
345 3300046694 Ga0495649_0319066 Ga0495649_0319066_59_676 204
346 3300046794 Ga0495589_0002314 Ga0495589_0002314_5829_6446 204
347 3300046794 Ga0495589_0004788 Ga0495589_0004788_2303_2932 204
348 3300046794 Ga0495589_0005625 Ga0495589_0005625_5864_6481 204
349 3300046794 Ga0495589_0013093 Ga0495589_0013093_703_1320 204
350 3300046794 Ga0495589_0103208 Ga0495589_0103208_717_1334 204
351 3300046794 Ga0495589_0115136 Ga0495589_0115136_569_1186 204
352 3300046810 Ga0495660_0010483 Ga0495660_0010483_3358_3975 204
353 3300046810 Ga0495660_0011814 Ga0495660_0011814_700_1329 204
354 3300046810 Ga0495660_0013996 Ga0495660_0013996_3922_4539 204
355 3300046810 Ga0495660_0042266 Ga0495660_0042266_1772_2389 204
356 3300047315 Ga0495581_0015215 Ga0495581_0015215_2886_3503 204
357 3300047315 Ga0495581_0015668 Ga0495581_0015668_3012_3629 204
358 3300047317 Ga0495604_0020165 Ga0495604_0020165_3010_3627 204
359 3300047317 Ga0495604_0030329 Ga0495604_0030329_836_1453 204
360 3300047317 Ga0495604_0038987 Ga0495604_0038987_2442_3059 204
361 3300047317 Ga0495604_0051135 Ga0495604_0051135_36_653 204
362 3300047318 Ga0495636_0042381 Ga0495636_0042381_633_1250 204
363 3300047319 Ga0495674_0400908 Ga0495674_0400908_142_759 204
364 3300047320 Ga0495672_0000041 Ga0495672_0000041_203827_204444 204
365 3300047320 Ga0495672_0004140 Ga0495672_0004140_3818_4435 204
366 3300047320 Ga0495672_0006589 Ga0495672_0006589_2383_3000 204
367 3300047320 Ga0495672_0042796 Ga0495672_0042796_1473_2102 204
368 3300047321 Ga0495676_0000235 Ga0495676_0000235_70_687 204
369 3300047321 Ga0495676_0025419 Ga0495676_0025419_3173_3790 204
370 3300047322 Ga0495680_0042503 Ga0495680_0042503_190_807 204
371 3300047323 Ga0495683_0003295 Ga0495683_0003295_3646_4263 204
372 3300047323 Ga0495683_0004350 Ga0495683_0004350_3670_4299 204
373 3300047323 Ga0495683_0030886 Ga0495683_0030886_685_1302 204
374 3300047323 Ga0495683_0114245 Ga0495683_0114245_362_979 204
375 3300047443 Ga0495687_000127 Ga0495687_000127_72305_72922 204
376 3300047443 Ga0495687_000143 Ga0495687_000143_78075_78692 204
377 3300047443 Ga0495687_004036 Ga0495687_004036_5329_5946 204
378 3300047444 Ga0495675_0081573 Ga0495675_0081573_647_1264 204
379 3300047444 Ga0495675_0532871 Ga0495675_0532871_13_630 204
380 3300047445 Ga0495677_0003200 Ga0495677_0003200_3607_4224 204
381 3300047445 Ga0495677_0005113 Ga0495677_0005113_684_1301 204
382 3300047445 Ga0495677_0026448 Ga0495677_0026448_663_1280 204
383 3300047445 Ga0495677_0049226 Ga0495677_0049226_94_711 204
384 3300047445 Ga0495677_0054027 Ga0495677_0054027_338_967 204
385 3300047445 Ga0495677_0076995 Ga0495677_0076995_102_719 204
386 3300047445 Ga0495677_0081048 Ga0495677_0081048_13_630 204
387 3300047446 Ga0495679_005470 Ga0495679_005470_1242_1859 204
388 3300047446 Ga0495679_033196 Ga0495679_033196_475_1092 204
389 3300047447 Ga0495685_001114 Ga0495685_001114_3340_3957 204
390 3300047447 Ga0495685_015742 Ga0495685_015742_630_1247 204
391 3300047447 Ga0495685_024327 Ga0495685_024327_550_1167 204
392 3300047469 Ga0495673_0006800 Ga0495673_0006800_369_986 204
393 3300047470 Ga0495681_0000694 Ga0495681_0000694_3313_3930 204
394 3300047470 Ga0495681_0001600 Ga0495681_0001600_10467_11084 204
395 3300047470 Ga0495681_0004999 Ga0495681_0004999_7608_8225 204
396 3300047470 Ga0495681_0019747 Ga0495681_0019747_1357_1986 204
397 3300047470 Ga0495681_0023569 Ga0495681_0023569_1932_2549 204
398 3300047470 Ga0495681_0066454 Ga0495681_0066454_723_1340 204
399 3300047470 Ga0495681_0075090 Ga0495681_0075090_523_1140 204
400 3300047472 Ga0495686_0000656 Ga0495686_0000656_45883_46506 204
401 3300047472 Ga0495686_0007355 Ga0495686_0007355_7042_7659 204
402 3300047673 Ga0495593_0012935 Ga0495593_0012935_3754_4371 204
403 3300047673 Ga0495593_0048888 Ga0495593_0048888_1057_1674 204
404 3300048088 Ga0495602_0062779 Ga0495602_0062779_1377_1994 204
405 3300048088 Ga0495602_0210740 Ga0495602_0210740_160_777 204
406 3300048089 Ga0495614_0006362 Ga0495614_0006362_1614_2231 204
407 3300048089 Ga0495614_0094288 Ga0495614_0094288_371_988 204
408 3300048091 Ga0495626_0002049 Ga0495626_0002049_10531_11148 204
409 3300048091 Ga0495626_0010705 Ga0495626_0010705_3517_4134 204
410 3300048091 Ga0495626_0017842 Ga0495626_0017842_1136_1753 204
411 3300048091 Ga0495626_0020742 Ga0495626_0020742_564_1181 204
412 3300048091 Ga0495626_0021140 Ga0495626_0021140_59_676 204
413 3300048091 Ga0495626_0031484 Ga0495626_0031484_1335_1952 204
414 3300048091 Ga0495626_0033862 Ga0495626_0033862_377_994 204
415 3300048091 Ga0495626_0038091 Ga0495626_0038091_940_1557 204
416 3300048091 Ga0495626_0059781 Ga0495626_0059781_423_1052 204
417 3300048091 Ga0495626_0074515 Ga0495626_0074515_14_631 204
418 3300048091 Ga0495626_0144554 Ga0495626_0144554_376_993 204
419 3300048091 Ga0495626_0163969 Ga0495626_0163969_88_705 204
420 3300048903 Ga0496100_0016601 Ga0496100_0016601_1559_2176 204
421 3300048903 Ga0496100_0482716 Ga0496100_0482716_151_768 204
422 3300048904 Ga0496101_0030388 Ga0496101_0030388_920_1537 204
423 3300048905 Ga0496102_0000931 Ga0496102_0000931_23924_24541 204
424 3300048905 Ga0496102_0401793 Ga0496102_0401793_16_633 204
425 3300048906 Ga0496103_0056910 Ga0496103_0056910_278_952 204
426 3300048906 Ga0496103_0529000 Ga0496103_0529000_24_641 204
427 3300048910 Ga0496107_0055316 Ga0496107_0055316_758_1375 204
428 3300048912 Ga0496109_0115613 Ga0496109_0115613_1323_1940 204
429 3300048913 Ga0496110_0029094 Ga0496110_0029094_2776_3393 204
430 3300048913 Ga0496110_0715854 Ga0496110_0715854_199_816 204
431 3300048916 Ga0496113_0008457 Ga0496113_0008457_579_1196 204
432 3300048918 Ga0496115_0018367 Ga0496115_0018367_2393_3010 204
433 3300048918 Ga0496115_0020248 Ga0496115_0020248_429_1046 204
434 3300048918 Ga0496115_0055871 Ga0496115_0055871_747_1364 204
435 3300048918 Ga0496115_0276349 Ga0496115_0276349_48_665 204
436 3300048925 Ga0496122_0000445 Ga0496122_0000445_46082_46699 204
437 3300048926 Ga0496123_0001568 Ga0496123_0001568_22645_23262 204
438 3300048927 Ga0496124_0046689 Ga0496124_0046689_695_1312 204
439 3300048927 Ga0496124_0097419 Ga0496124_0097419_1308_1925 204
440 3300048927 Ga0496124_0237922 Ga0496124_0237922_725_1342 204
441 3300048927 Ga0496124_0351417 Ga0496124_0351417_82_699 204
442 3300048927 Ga0496124_0429036 Ga0496124_0429036_131_748 204
443 3300048928 Ga0496125_0002859 Ga0496125_0002859_5512_6129 204
444 3300049459 Ga0495678_000316 Ga0495678_000316_5794_6411 204
445 3300049459 Ga0495678_003427 Ga0495678_003427_2105_2722 204
446 3300049459 Ga0495678_004684 Ga0495678_004684_3367_3996 204
447 3300049459 Ga0495678_006389 Ga0495678_006389_4631_5248 204
448 3300049459 Ga0495678_007748 Ga0495678_007748_760_1377 204
449 3300049459 Ga0495678_009881 Ga0495678_009881_644_1270 204
450 3300049460 Ga0495682_0000107 Ga0495682_0000107_72147_72764 204
451 3300049460 Ga0495682_0084729 Ga0495682_0084729_46_663 204
452 3300049586 Ga0501070_0147283 Ga0501070_0147283_1092_1733 204
453 3300050514 nmdc:mga08x19_12730_c1 nmdc:mga08x19_12730_c1_32_685 204
454 3300003775 Ga0055524_1005899 Ga0055524_10058997 205
455 3300003791 Ga0055530_10001043 Ga0055530_1000104319 205
456 3300003792 Ga0055540_1000001 Ga0055540_1000001133 205
457 3300003794 Ga0055531_10002737 Ga0055531_1000273711 205
458 3300003794 Ga0055531_10007375 Ga0055531_100073752 205
459 3300005262 Ga0065165_1058816 Ga0065165_10588162 205
460 3300005327 Ga0070658_10081833 Ga0070658_100818332 205
461 3300005327 Ga0070658_10646273 Ga0070658_106462731 205
462 3300005366 Ga0070659_100003171 Ga0070659_1000031714 205
463 3300005455 Ga0070663_100384565 Ga0070663_1003845651 205
464 3300005563 Ga0068855_100430825 Ga0068855_1004308252 205
465 3300006048 Ga0075363_100043109 Ga0075363_1000431092 205
466 3300006353 Ga0075370_10271119 Ga0075370_102711192 205
467 3300006942 Ga0099824_1036213 Ga0099824_10362132 205
468 3300006944 Ga0099823_1017932 Ga0099823_10179325 205
469 3300006946 Ga0079104_1000309 Ga0079104_100030947 205
470 3300014326 Ga0157380_10241647 Ga0157380_102416472 205
471 3300015262 Ga0182007_10081906 Ga0182007_100819062 205
472 3300025253 Ga0209677_100760 Ga0209677_1007603 205
473 3300025291 Ga0209675_1007213 Ga0209675_10072132 205
474 3300025298 Ga0209050_1000145 Ga0209050_1000145134 205
475 3300025298 Ga0209050_1012221 Ga0209050_10122214 205
476 3300025299 Ga0209256_1000061 Ga0209256_1000061118 205
477 3300025299 Ga0209256_1007013 Ga0209256_10070138 205
478 3300025303 Ga0209051_1000018 Ga0209051_1000018319 205
479 3300025303 Ga0209051_1005475 Ga0209051_10054755 205
480 3300025304 Ga0209257_1000084 Ga0209257_100008453 205
481 3300025304 Ga0209257_1004271 Ga0209257_10042719 205
482 3300025909 Ga0207705_10191215 Ga0207705_101912152 205
483 3300025932 Ga0207690_10004058 Ga0207690_100040585 205
484 3300025933 Ga0207706_10144106 Ga0207706_101441062 205
485 3300026067 Ga0207678_10422419 Ga0207678_104224192 205
486 3300027111 Ga0209281_1000103 Ga0209281_1000103182 205
487 3300027526 Ga0209968_1001095 Ga0209968_10010953 205
488 3300027695 Ga0209966_1000003 Ga0209966_100000310 205
489 3300028794 Ga0307515_10000708 Ga0307515_1000070818 205
490 3300028794 Ga0307515_10013083 Ga0307515_100130832 205
491 3300028794 Ga0307515_10470144 Ga0307515_104701441 205
492 3300030522 Ga0307512_10056000 Ga0307512_100560002 205
493 3300031239 Ga0265328_10005685 Ga0265328_100056853 205
494 3300031251 Ga0265327_10000479 Ga0265327_1000047939 205
495 3300031507 Ga0307509_10073712 Ga0307509_100737125 205
496 3300031616 Ga0307508_10000169 Ga0307508_1000016961 205
497 3300031649 Ga0307514_10085435 Ga0307514_100854352 205
498 3300031730 Ga0307516_10009988 Ga0307516_100099882 205
499 3300031824 Ga0307413_10273545 Ga0307413_102735452 205
500 3300031852 Ga0307410_10247607 Ga0307410_102476071 205
501 3300031995 Ga0307409_100226671 Ga0307409_1002266711 205
502 3300031995 Ga0307409_100280086 Ga0307409_1002800861 205
503 3300032002 Ga0307416_101791783 Ga0307416_1017917831 205
504 3300037418 Ga0395900_0000131 Ga0395900_0000131_95657_96280 205
505 3300037466 Ga0395898_0001532 Ga0395898_0001532_3452_4075 205
506 3300037471 Ga0395905_0017710 Ga0395905_0017710_3248_3874 205
507 3300037471 Ga0395905_0063403 Ga0395905_0063403_1991_2614 205
508 3300038443 Ga0395901_1173314 Ga0395901_1173314_50_673 205
509 3300041410 Ga0439461_0030468 Ga0439461_0030468_116_745 205
510 3300041443 Ga0451789_0491830 Ga0451789_0491830_160_783 205
511 3300041456 Ga0451795_0419335 Ga0451795_0419335_88_711 205
512 3300041460 Ga0451802_0970336 Ga0451802_0970336_489_1112 205
513 3300041492 Ga0451835_0864634 Ga0451835_0864634_78_701 205
514 3300041496 Ga0451839_0718016 Ga0451839_0718016_155_778 205
515 3300041505 Ga0451849_0077297 Ga0451849_0077297_200_823 205
516 3300041507 Ga0451851_0770517 Ga0451851_0770517_145_768 205
517 3300041509 Ga0451843_0223084 Ga0451843_0223084_350_973 205
518 3300041997 Ga0439431_0031742 Ga0439431_0031742_185_814 205
519 3300042156 Ga0439446_0014983 Ga0439446_0014983_1173_1805 205
520 3300042435 Ga0439434_0039325 Ga0439434_0039325_761_1390 205
521 3300042531 Ga0450918_001746 Ga0450918_001746_1786_2418 205
522 3300042876 Ga0451577_0091368 Ga0451577_0091368_1811_2443 205
523 3300042876 Ga0451577_0751880 Ga0451577_0751880_32_658 205
524 3300044656 Ga0466969_0058160 Ga0466969_0058160_1072_1695 205
525 3300044684 Ga0466966_0000687 Ga0466966_0000687_8721_9344 205
526 3300044693 Ga0466961_0007342 Ga0466961_0007342_4637_5260 205
527 3300044694 Ga0466963_0027945 Ga0466963_0027945_904_1527 205
528 3300044706 Ga0466964_0002548 Ga0466964_0002548_2935_3558 205
529 3300044712 Ga0453684_0023234 Ga0453684_0023234_1629_2255 205
530 3300044719 Ga0466971_0007302 Ga0466971_0007302_3411_4034 205
531 3300044765 Ga0466970_0031025 Ga0466970_0031025_1173_1796 205
532 3300044842 Ga0466957_0192226 Ga0466957_0192226_188_811 205
533 3300045049 Ga0466959_0000287 Ga0466959_0000287_14502_15125 205
534 3300045051 Ga0451576_0074320 Ga0451576_0074320_1894_2520 205
535 3300045051 Ga0451576_0194483 Ga0451576_0194483_851_1483 205
536 3300045976 Ga0466967_0024766 Ga0466967_0024766_1438_2061 205
537 3300046492 Ga0495585_0034744 Ga0495585_0034744_618_1235 205
538 3300046500 Ga0495596_0000240 Ga0495596_0000240_14440_15057 205
539 3300046501 Ga0495607_0106432 Ga0495607_0106432_30_647 205
540 3300046515 Ga0495620_0030549 Ga0495620_0030549_1204_1827 205
541 3300046522 Ga0495643_0026575 Ga0495643_0026575_2534_3157 205
542 3300046523 Ga0495644_0013643 Ga0495644_0013643_834_1451 205
543 3300046529 Ga0495652_0001577 Ga0495652_0001577_21555_22226 205
544 3300046543 Ga0495645_0037487 Ga0495645_0037487_504_1175 205
545 3300046558 Ga0495633_0032773 Ga0495633_0032773_1430_2047 205
546 3300046615 Ga0495656_0040418 Ga0495656_0040418_1251_1868 205
547 3300046660 Ga0495625_0004296 Ga0495625_0004296_3649_4272 205
548 3300046665 Ga0495661_0110688 Ga0495661_0110688_428_1045 205
549 3300046680 Ga0495646_0001272 Ga0495646_0001272_9999_10670 205
550 3300046683 Ga0495658_0229075 Ga0495658_0229075_529_1152 205
551 3300046684 Ga0495669_0014388 Ga0495669_0014388_1652_2269 205
552 3300047472 Ga0495686_0060892 Ga0495686_0060892_1038_1667 205
553 3300048903 Ga0496100_0171134 Ga0496100_0171134_723_1358 205
554 3300048927 Ga0496124_0015517 Ga0496124_0015517_5877_6515 205
555 3300049649 Ga0501198_000102 Ga0501198_000102_9032_9658 205
556 3300049662 Ga0501222_000008 Ga0501222_000008_111248_111874 205
557 3300050489 nmdc:mga03683_277888_c1 nmdc:mga03683_277888_c1_69_692 205
558 3300050493 nmdc:mga0k408_132531_c1 nmdc:mga0k408_132531_c1_103_726 205
559 3300050493 nmdc:mga0k408_177614_c1 nmdc:mga0k408_177614_c1_603_1226 205
560 3300050493 nmdc:mga0k408_196874_c1 nmdc:mga0k408_196874_c1_268_891 205
561 3300050493 nmdc:mga0k408_487922_c1 nmdc:mga0k408_487922_c1_17_640 205
562 3300050493 nmdc:mga0k408_59835_c1 nmdc:mga0k408_59835_c1_798_1421 205
563 3300053080 Ga0500635_0000083 Ga0500635_0000083_44481_45110 205
564 3300053739 Ga0500587_000079 Ga0500587_000079_261_884 205
565 iso_pu_bacteria 2511231003 2511248376 205
566 iso_pu_bacteria 2548876994 2550693536 205
567 iso_pu_bacteria 2643221603 2644030407 205
568 iso_pu_bacteria 2818991436 2819542751 205
569 iso_pu_bacteria 2818991445 2819594530 205
570 3300002704 JGI25155J39150_1000288 JGI25155J39150_100028814 206
571 3300002705 JGI25156J39149_1000695 JGI25156J39149_100069514 206
572 3300002705 JGI25156J39149_1002511 JGI25156J39149_10025112 206
573 3300002738 JGI25154J39366_1000350 JGI25154J39366_10003507 206
574 3300002738 JGI25154J39366_1000571 JGI25154J39366_10005717 206
575 3300002741 JGI25157J39369_1000773 JGI25157J39369_100077311 206
576 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001260 206
577 3300003751 Ga0055538_1000001 Ga0055538_1000001772 206
578 3300003752 Ga0055539_1000001 Ga0055539_1000001772 206
579 3300003756 Ga0055533_1000003 Ga0055533_1000003260 206
580 3300003758 Ga0055532_1000005 Ga0055532_1000005423 206
581 3300003759 Ga0055525_1000003 Ga0055525_1000003260 206
582 3300003761 Ga0055535_1002863 Ga0055535_10028634 206
583 3300003841 Ga0055541_1000001 Ga0055541_1000001260 206
584 3300005614 Ga0068856_100056975 Ga0068856_1000569752 206
585 3300005616 Ga0068852_100102675 Ga0068852_1001026752 206
586 3300009011 Ga0105251_10049399 Ga0105251_100493992 206
587 3300009093 Ga0105240_10012100 Ga0105240_1001210013 206
588 3300009093 Ga0105240_10017206 Ga0105240_100172066 206
589 3300009545 Ga0105237_10499422 Ga0105237_104994222 206
590 3300009551 Ga0105238_10030398 Ga0105238_100303984 206
591 3300014497 Ga0182008_10027616 Ga0182008_100276162 206
592 3300015265 Ga0182005_1000158 Ga0182005_100015837 206
593 3300025206 Ga0209435_100160 Ga0209435_10016013 206
594 3300025206 Ga0209435_100473 Ga0209435_1004738 206
595 3300025224 Ga0209784_100004 Ga0209784_100004260 206
596 3300025225 Ga0209566_100004 Ga0209566_100004417 206
597 3300025226 Ga0209674_100006 Ga0209674_100006417 206
598 3300025229 Ga0209147_100011 Ga0209147_10001113 206
599 3300025230 Ga0209563_100009 Ga0209563_100009260 206
600 3300025231 Ga0207427_101086 Ga0207427_1010864 206
601 3300025233 Ga0209437_100004 Ga0209437_100004260 206
602 3300025233 Ga0209437_100259 Ga0209437_10025912 206
603 3300025242 Ga0209258_100580 Ga0209258_10058032 206
604 3300025246 Ga0209646_1000403 Ga0209646_10004037 206
605 3300025246 Ga0209646_1000503 Ga0209646_10005037 206
606 3300025250 Ga0209026_1000760 Ga0209026_10007607 206
607 3300025253 Ga0209677_100005 Ga0209677_100005260 206
608 3300025254 Ga0209148_1005971 Ga0209148_10059714 206
609 3300025256 Ga0209759_1000253 Ga0209759_10002537 206
610 3300025256 Ga0209759_1001054 Ga0209759_10010547 206
611 3300025261 Ga0209233_1000005 Ga0209233_1000005417 206
612 3300025913 Ga0207695_10009547 Ga0207695_100095472 206
613 3300025913 Ga0207695_10032918 Ga0207695_100329186 206
614 3300025923 Ga0207681_10184195 Ga0207681_101841952 206
615 3300026078 Ga0207702_10058186 Ga0207702_100581862 206
616 3300026142 Ga0207698_10008917 Ga0207698_100089172 206
617 3300037471 Ga0395905_0000750 Ga0395905_0000750_18342_19109 206
618 3300044842 Ga0466957_0047867 Ga0466957_0047867_458_1111 206
619 3300046452 Ga0495617_085942 Ga0495617_085942_41_661 206
620 3300046454 Ga0495592_0100052 Ga0495592_0100052_591_1211 206
621 3300046460 Ga0495638_0016484 Ga0495638_0016484_809_1429 206
622 3300046460 Ga0495638_0244567 Ga0495638_0244567_303_926 206
623 3300046462 Ga0495651_0134207 Ga0495651_0134207_1045_1674 206
624 3300046463 Ga0495653_0105341 Ga0495653_0105341_1130_1759 206
625 3300046472 Ga0495580_0699376 Ga0495580_0699376_21_644 206
626 3300046474 Ga0495605_0012486 Ga0495605_0012486_3437_4057 206
627 3300046491 Ga0495584_0004898 Ga0495584_0004898_5155_5775 206
628 3300046492 Ga0495585_0000006 Ga0495585_0000006_294902_295525 206
629 3300046492 Ga0495585_0010286 Ga0495585_0010286_4414_5037 206
630 3300046492 Ga0495585_0154537 Ga0495585_0154537_190_876 206
631 3300046499 Ga0495594_0003640 Ga0495594_0003640_1421_2044 206
632 3300046501 Ga0495607_0009947 Ga0495607_0009947_3813_4439 206
633 3300046501 Ga0495607_0117837 Ga0495607_0117837_422_1042 206
634 3300046506 Ga0495583_0000056 Ga0495583_0000056_120616_121236 206
635 3300046507 Ga0495606_0133665 Ga0495606_0133665_720_1343 206
636 3300046512 Ga0495610_0020472 Ga0495610_0020472_810_1430 206
637 3300046513 Ga0495616_0000057 Ga0495616_0000057_65167_65799 206
638 3300046515 Ga0495620_0049791 Ga0495620_0049791_513_1136 206
639 3300046518 Ga0495631_0005293 Ga0495631_0005293_5762_6385 206
640 3300046523 Ga0495644_0007023 Ga0495644_0007023_2993_3613 206
641 3300046523 Ga0495644_0009481 Ga0495644_0009481_240_926 206
642 3300046524 Ga0495648_0001488 Ga0495648_0001488_19258_19878 206
643 3300046526 Ga0495666_0046494 Ga0495666_0046494_1121_1744 206
644 3300046528 Ga0495642_0012989 Ga0495642_0012989_562_1185 206
645 3300046538 Ga0495609_0001536 Ga0495609_0001536_5867_6487 206
646 3300046543 Ga0495645_0392211 Ga0495645_0392211_145_774 206
647 3300046557 Ga0495622_0102906 Ga0495622_0102906_303_926 206
648 3300046558 Ga0495633_0003338 Ga0495633_0003338_663_1283 206
649 3300046558 Ga0495633_0034346 Ga0495633_0034346_85_708 206
650 3300046558 Ga0495633_0260102 Ga0495633_0260102_95_718 206
651 3300046615 Ga0495656_0017670 Ga0495656_0017670_720_1340 206
652 3300046642 Ga0495634_0369017 Ga0495634_0369017_124_753 206
653 3300046648 Ga0495611_0011108 Ga0495611_0011108_2861_3547 206
654 3300046648 Ga0495611_0025380 Ga0495611_0025380_261_884 206
655 3300046648 Ga0495611_0030378 Ga0495611_0030378_1280_1903 206
656 3300046660 Ga0495625_0004306 Ga0495625_0004306_9505_10134 206
657 3300046660 Ga0495625_0029610 Ga0495625_0029610_613_1233 206
658 3300046663 Ga0495635_0121076 Ga0495635_0121076_1068_1697 206
659 3300046664 Ga0495659_0000526 Ga0495659_0000526_9226_9846 206
660 3300046664 Ga0495659_0316897 Ga0495659_0316897_15_635 206
661 3300046665 Ga0495661_0051612 Ga0495661_0051612_1673_2293 206
662 3300046678 Ga0495599_0175798 Ga0495599_0175798_383_1012 206
663 3300046691 Ga0495670_0003903 Ga0495670_0003903_6271_6891 206
664 3300046691 Ga0495670_0110917 Ga0495670_0110917_236_859 206
665 3300046794 Ga0495589_0024976 Ga0495589_0024976_2236_2859 206
666 3300046809 Ga0495600_0000474 Ga0495600_0000474_4035_4664 206
667 3300046810 Ga0495660_0025613 Ga0495660_0025613_1971_2594 206
668 3300047318 Ga0495636_0001913 Ga0495636_0001913_551_1171 206
669 3300047318 Ga0495636_0002620 Ga0495636_0002620_2955_3578 206
670 3300047320 Ga0495672_0156877 Ga0495672_0156877_15_635 206
671 3300047321 Ga0495676_0122523 Ga0495676_0122523_323_946 206
672 3300047323 Ga0495683_0001361 Ga0495683_0001361_15037_15660 206
673 3300047323 Ga0495683_0045537 Ga0495683_0045537_1413_2033 206
674 3300047323 Ga0495683_0229991 Ga0495683_0229991_50_673 206
675 3300047443 Ga0495687_001108 Ga0495687_001108_12041_12661 206
676 3300047445 Ga0495677_0007859 Ga0495677_0007859_1354_1977 206
677 3300047447 Ga0495685_000113 Ga0495685_000113_12410_13030 206
678 3300047472 Ga0495686_0053453 Ga0495686_0053453_759_1379 206
679 3300048091 Ga0495626_0109953 Ga0495626_0109953_393_1025 206
680 3300048907 Ga0496104_0338360 Ga0496104_0338360_102_764 206
681 3300048913 Ga0496110_0045736 Ga0496110_0045736_2745_3380 206
682 3300048918 Ga0496115_0220001 Ga0496115_0220001_735_1358 206
683 3300048919 Ga0496116_0033774 Ga0496116_0033774_141_770 206
684 3300048921 Ga0496118_0040010 Ga0496118_0040010_769_1398 206
685 3300048925 Ga0496122_0000261 Ga0496122_0000261_109544_110173 206
686 3300048926 Ga0496123_0000218 Ga0496123_0000218_107105_107734 206
687 3300048928 Ga0496125_0000256 Ga0496125_0000256_5578_6198 206
688 3300048928 Ga0496125_0067915 Ga0496125_0067915_455_1084 206
689 3300049459 Ga0495678_003135 Ga0495678_003135_4144_4764 206
690 3300049460 Ga0495682_0038533 Ga0495682_0038533_412_1032 206
691 3300053077 Ga0495601_0030324 Ga0495601_0030324_1127_1756 206
692 3300053119 Ga0500595_003047 Ga0500595_003047_150_779 206
693 3300053154 Ga0500619_000742 Ga0500619_000742_518_1147 206
694 3300053161 Ga0500634_0108608 Ga0500634_0108608_184_813 206
695 3300006195 Ga0075366_10197495 Ga0075366_101974952 207
696 3300026067 Ga0207678_10488071 Ga0207678_104880712 207
697 3300031251 Ga0265327_10031415 Ga0265327_100314152 207
698 3300033179 Ga0307507_10021968 Ga0307507_100219682 207
699 3300037312 Ga0395899_0001064 Ga0395899_0001064_17549_18187 207
700 3300037312 Ga0395899_0002813 Ga0395899_0002813_12615_13253 207
701 3300037312 Ga0395899_0003608 Ga0395899_0003608_3990_4625 207
702 3300037418 Ga0395900_0005698 Ga0395900_0005698_9213_9848 207
703 3300037418 Ga0395900_0283273 Ga0395900_0283273_639_1277 207
704 3300037471 Ga0395905_0208288 Ga0395905_0208288_453_1088 207
705 3300038443 Ga0395901_0000002 Ga0395901_0000002_453141_453791 207
706 3300038443 Ga0395901_0001718 Ga0395901_0001718_3787_4437 207
707 3300038443 Ga0395901_0136559 Ga0395901_0136559_40_678 207
708 3300044684 Ga0466966_0006128 Ga0466966_0006128_3598_4233 207
709 3300044719 Ga0466971_0017715 Ga0466971_0017715_2226_2861 207
710 3300045049 Ga0466959_0052023 Ga0466959_0052023_511_1143 207
711 3300046506 Ga0495583_0002345 Ga0495583_0002345_11590_12222 207
712 3300046512 Ga0495610_0035172 Ga0495610_0035172_1838_2461 207
713 3300046522 Ga0495643_0000415 Ga0495643_0000415_31114_31746 207
714 3300046558 Ga0495633_0065743 Ga0495633_0065743_892_1527 207
715 3300048929 Ga0496126_0054778 Ga0496126_0054778_18_656 207
716 3300049679 Ga0501249_003963 Ga0501249_003963_2246_2869 207
717 3300049766 Ga0501269_000210 Ga0501269_000210_4293_4916 207
718 3300053178 Ga0500637_0152420 Ga0500637_0152420_397_1032 207
719 3300059511 Ga0587091_002909 Ga0587091_002909_1303_1938 207
720 3300059639 Ga0587062_001995 Ga0587062_001995_1145_1780 207
721 3300060346 Ga0587111_0003612 Ga0587111_0003612_450_1085 207
722 3300001989 JGI24739J22299_10030478 JGI24739J22299_100304781 208
723 3300001990 JGI24737J22298_10012956 JGI24737J22298_100129562 208
724 3300002067 JGI24735J21928_10009274 JGI24735J21928_100092743 208
725 3300002705 JGI25156J39149_1007991 JGI25156J39149_10079912 208
726 3300002738 JGI25154J39366_1003796 JGI25154J39366_10037962 208
727 3300002741 JGI25157J39369_1000018 JGI25157J39369_100001869 208
728 3300003187 JGI25151J46595_10035406 JGI25151J46595_100354062 208
729 3300003187 JGI25151J46595_10055552 JGI25151J46595_100555521 208
730 3300003320 rootH2_10128398 rootH2_101283981 208
731 3300003322 rootL2_10017918 rootL2_100179182 208
732 3300003323 rootH1_10042583 rootH1_100425832 208
733 3300003323 rootH1_10042585 rootH1_100425852 208
734 3300003752 Ga0055539_1000240 Ga0055539_10002403 208
735 3300003752 Ga0055539_1001263 Ga0055539_10012632 208
736 3300003756 Ga0055533_1000103 Ga0055533_100010313 208
737 3300003759 Ga0055525_1001499 Ga0055525_10014994 208
738 3300003775 Ga0055524_1017165 Ga0055524_10171652 208
739 3300003781 Ga0055536_1000252 Ga0055536_100025215 208
740 3300003784 Ga0055534_1004596 Ga0055534_10045961 208
741 3300005327 Ga0070658_10086907 Ga0070658_100869072 208
742 3300005327 Ga0070658_10440175 Ga0070658_104401752 208
743 3300005330 Ga0070690_100031128 Ga0070690_1000311282 208
744 3300005331 Ga0070670_100273775 Ga0070670_1002737752 208
745 3300005331 Ga0070670_100295403 Ga0070670_1002954032 208
746 3300005333 Ga0070677_10023109 Ga0070677_100231093 208
747 3300005334 Ga0068869_100037044 Ga0068869_1000370442 208
748 3300005335 Ga0070666_10019648 Ga0070666_100196482 208
749 3300005338 Ga0068868_100195124 Ga0068868_1001951242 208
750 3300005339 Ga0070660_100227965 Ga0070660_1002279652 208
751 3300005340 Ga0070689_100346171 Ga0070689_1003461712 208
752 3300005344 Ga0070661_100023457 Ga0070661_1000234576 208
753 3300005347 Ga0070668_100059448 Ga0070668_1000594483 208
754 3300005353 Ga0070669_100004469 Ga0070669_1000044694 208
755 3300005354 Ga0070675_100066570 Ga0070675_1000665703 208
756 3300005354 Ga0070675_100501698 Ga0070675_1005016981 208
757 3300005355 Ga0070671_100031566 Ga0070671_1000315662 208
758 3300005355 Ga0070671_100187716 Ga0070671_1001877162 208
759 3300005356 Ga0070674_100028072 Ga0070674_1000280724 208
760 3300005364 Ga0070673_100028417 Ga0070673_1000284172 208
761 3300005366 Ga0070659_100174856 Ga0070659_1001748561 208
762 3300005367 Ga0070667_100002718 Ga0070667_1000027186 208
763 3300005367 Ga0070667_100246137 Ga0070667_1002461372 208
764 3300005438 Ga0070701_10066089 Ga0070701_100660891 208
765 3300005455 Ga0070663_100023240 Ga0070663_1000232403 208
766 3300005456 Ga0070678_100130407 Ga0070678_1001304072 208
767 3300005457 Ga0070662_100016597 Ga0070662_1000165975 208
768 3300005459 Ga0068867_100027789 Ga0068867_1000277894 208
769 3300005459 Ga0068867_100122049 Ga0068867_1001220493 208
770 3300005459 Ga0068867_100800152 Ga0068867_1008001521 208
771 3300005535 Ga0070684_100508873 Ga0070684_1005088731 208
772 3300005539 Ga0068853_100072486 Ga0068853_1000724862 208
773 3300005539 Ga0068853_100551899 Ga0068853_1005518991 208
774 3300005543 Ga0070672_100036953 Ga0070672_1000369534 208
775 3300005544 Ga0070686_100065917 Ga0070686_1000659172 208
776 3300005563 Ga0068855_100127299 Ga0068855_1001272993 208
777 3300005577 Ga0068857_100007953 Ga0068857_1000079535 208
778 3300005578 Ga0068854_100004599 Ga0068854_1000045992 208
779 3300005614 Ga0068856_100008259 Ga0068856_1000082598 208
780 3300005616 Ga0068852_100147709 Ga0068852_1001477092 208
781 3300005616 Ga0068852_100186438 Ga0068852_1001864383 208
782 3300005616 Ga0068852_100955562 Ga0068852_1009555622 208
783 3300005618 Ga0068864_100301443 Ga0068864_1003014432 208
784 3300005618 Ga0068864_100560238 Ga0068864_1005602382 208
785 3300005718 Ga0068866_10010619 Ga0068866_100106194 208
786 3300005719 Ga0068861_100016063 Ga0068861_1000160637 208
787 3300005719 Ga0068861_100158841 Ga0068861_1001588412 208
788 3300005841 Ga0068863_100019781 Ga0068863_1000197818 208
789 3300005841 Ga0068863_100473095 Ga0068863_1004730952 208
790 3300005842 Ga0068858_100017353 Ga0068858_1000173532 208
791 3300005843 Ga0068860_100565456 Ga0068860_1005654562 208
792 3300006195 Ga0075366_10099523 Ga0075366_100995232 208
793 3300006353 Ga0075370_10002946 Ga0075370_100029464 208
794 3300006881 Ga0068865_100269843 Ga0068865_1002698432 208
795 3300006948 Ga0099826_10000018 Ga0099826_1000001877 208
796 3300009011 Ga0105251_10002082 Ga0105251_100020823 208
797 3300009011 Ga0105251_10013210 Ga0105251_100132105 208
798 3300009011 Ga0105251_10024566 Ga0105251_100245663 208
799 3300009093 Ga0105240_10024629 Ga0105240_100246296 208
800 3300009098 Ga0105245_10262933 Ga0105245_102629331 208
801 3300009148 Ga0105243_10054161 Ga0105243_100541613 208
802 3300009174 Ga0105241_10186928 Ga0105241_101869282 208
803 3300009177 Ga0105248_10078637 Ga0105248_100786374 208
804 3300009545 Ga0105237_10755773 Ga0105237_107557732 208
805 3300009551 Ga0105238_10055566 Ga0105238_100555661 208
806 3300009553 Ga0105249_10007528 Ga0105249_100075285 208
807 3300013102 Ga0157371_10000001 Ga0157371_10000001636 208
808 3300013102 Ga0157371_10207645 Ga0157371_102076452 208
809 3300013104 Ga0157370_10366078 Ga0157370_103660782 208
810 3300013105 Ga0157369_10169148 Ga0157369_101691482 208
811 3300013105 Ga0157369_10236802 Ga0157369_102368022 208
812 3300013105 Ga0157369_10383864 Ga0157369_103838641 208
813 3300013296 Ga0157374_10036965 Ga0157374_100369652 208
814 3300013306 Ga0163162_10040965 Ga0163162_100409652 208
815 3300013306 Ga0163162_10728762 Ga0163162_107287622 208
816 3300013307 Ga0157372_10361837 Ga0157372_103618372 208
817 3300013308 Ga0157375_10008692 Ga0157375_100086927 208
818 3300013308 Ga0157375_10173565 Ga0157375_101735653 208
819 3300014326 Ga0157380_10051165 Ga0157380_100511652 208
820 3300014969 Ga0157376_10226589 Ga0157376_102265892 208
821 3300014969 Ga0157376_10345560 Ga0157376_103455602 208
822 3300015262 Ga0182007_10010110 Ga0182007_100101101 208
823 3300021361 Ga0213872_10052963 Ga0213872_100529632 208
824 3300025226 Ga0209674_100003 Ga0209674_100003290 208
825 3300025230 Ga0209563_100010 Ga0209563_10001019 208
826 3300025242 Ga0209258_100525 Ga0209258_10052527 208
827 3300025246 Ga0209646_1000067 Ga0209646_10000674 208
828 3300025250 Ga0209026_1000033 Ga0209026_1000033227 208
829 3300025253 Ga0209677_100068 Ga0209677_100068103 208
830 3300025253 Ga0209677_102920 Ga0209677_1029204 208
831 3300025256 Ga0209759_1000024 Ga0209759_1000024227 208
832 3300025263 Ga0209565_1002746 Ga0209565_10027465 208
833 3300025291 Ga0209675_1000100 Ga0209675_1000100106 208
834 3300025291 Ga0209675_1009393 Ga0209675_10093933 208
835 3300025292 Ga0209676_1000012 Ga0209676_1000012750 208
836 3300025294 Ga0209025_1001877 Ga0209025_10018779 208
837 3300025294 Ga0209025_1004210 Ga0209025_10042109 208
838 3300025295 Ga0209564_1003839 Ga0209564_10038391 208
839 3300025295 Ga0209564_1004073 Ga0209564_10040737 208
840 3300025299 Ga0209256_1000676 Ga0209256_100067640 208
841 3300025303 Ga0209051_1004528 Ga0209051_10045285 208
842 3300025315 Ga0207697_10031970 Ga0207697_100319702 208
843 3300025321 Ga0207656_10276333 Ga0207656_102763331 208
844 3300025735 Ga0207713_1000135 Ga0207713_100013517 208
845 3300025735 Ga0207713_1055329 Ga0207713_10553292 208
846 3300025893 Ga0207682_10006644 Ga0207682_100066446 208
847 3300025893 Ga0207682_10039046 Ga0207682_100390463 208
848 3300025899 Ga0207642_10016456 Ga0207642_100164563 208
849 3300025903 Ga0207680_10018874 Ga0207680_100188741 208
850 3300025904 Ga0207647_10035754 Ga0207647_100357543 208
851 3300025907 Ga0207645_10029160 Ga0207645_100291602 208
852 3300025907 Ga0207645_10414350 Ga0207645_104143502 208
853 3300025908 Ga0207643_10097419 Ga0207643_100974192 208
854 3300025909 Ga0207705_10106102 Ga0207705_101061022 208
855 3300025911 Ga0207654_10289787 Ga0207654_102897872 208
856 3300025913 Ga0207695_10010175 Ga0207695_1001017510 208
857 3300025913 Ga0207695_10079069 Ga0207695_100790693 208
858 3300025914 Ga0207671_10033303 Ga0207671_100333031 208
859 3300025918 Ga0207662_10002597 Ga0207662_100025972 208
860 3300025919 Ga0207657_10149395 Ga0207657_101493952 208
861 3300025920 Ga0207649_10252355 Ga0207649_102523551 208
862 3300025923 Ga0207681_10008770 Ga0207681_100087703 208
863 3300025924 Ga0207694_10059333 Ga0207694_100593332 208
864 3300025925 Ga0207650_10350312 Ga0207650_103503122 208
865 3300025926 Ga0207659_10032977 Ga0207659_100329772 208
866 3300025926 Ga0207659_10038293 Ga0207659_100382932 208
867 3300025927 Ga0207687_10034805 Ga0207687_100348053 208
868 3300025931 Ga0207644_10048134 Ga0207644_100481343 208
869 3300025932 Ga0207690_10507350 Ga0207690_105073502 208
870 3300025933 Ga0207706_10015322 Ga0207706_100153224 208
871 3300025935 Ga0207709_10002721 Ga0207709_100027218 208
872 3300025936 Ga0207670_10369958 Ga0207670_103699582 208
873 3300025937 Ga0207669_10006656 Ga0207669_100066563 208
874 3300025940 Ga0207691_10048281 Ga0207691_100482812 208
875 3300025940 Ga0207691_10093888 Ga0207691_100938883 208
876 3300025940 Ga0207691_10096426 Ga0207691_100964263 208
877 3300025942 Ga0207689_10011506 Ga0207689_100115067 208
878 3300025942 Ga0207689_10039908 Ga0207689_100399082 208
879 3300025944 Ga0207661_10052657 Ga0207661_100526574 208
880 3300025949 Ga0207667_10021476 Ga0207667_100214765 208
881 3300025961 Ga0207712_10009755 Ga0207712_100097553 208
882 3300025972 Ga0207668_10046072 Ga0207668_100460723 208
883 3300025981 Ga0207640_10079351 Ga0207640_100793512 208
884 3300025981 Ga0207640_10096861 Ga0207640_100968612 208
885 3300025986 Ga0207658_10013291 Ga0207658_100132915 208
886 3300026023 Ga0207677_10040223 Ga0207677_100402233 208
887 3300026035 Ga0207703_10005816 Ga0207703_100058168 208
888 3300026067 Ga0207678_10076301 Ga0207678_100763013 208
889 3300026078 Ga0207702_10001261 Ga0207702_1000126113 208
890 3300026088 Ga0207641_10005241 Ga0207641_100052417 208
891 3300026089 Ga0207648_10047299 Ga0207648_100472992 208
892 3300026089 Ga0207648_10225905 Ga0207648_102259053 208
893 3300026089 Ga0207648_10356977 Ga0207648_103569772 208
894 3300026116 Ga0207674_10057723 Ga0207674_100577233 208
895 3300026118 Ga0207675_100002925 Ga0207675_10000292513 208
896 3300026118 Ga0207675_100111936 Ga0207675_1001119362 208
897 3300026121 Ga0207683_10041387 Ga0207683_100413874 208
898 3300026121 Ga0207683_10377001 Ga0207683_103770012 208
899 3300026142 Ga0207698_10121456 Ga0207698_101214561 208
900 3300027666 Ga0209282_1000052 Ga0209282_100005219 208
901 3300028379 Ga0268266_10176480 Ga0268266_101764802 208
902 3300028381 Ga0268264_10001986 Ga0268264_100019864 208
903 3300030521 Ga0307511_10076838 Ga0307511_100768383 208
904 3300031730 Ga0307516_10008972 Ga0307516_100089724 208
905 3300035410 Ga0373924_0027378 Ga0373924_0027378_1547_2191 208
906 3300035724 Ga0373933_0320756 Ga0373933_0320756_223_867 208
907 3300036401 Ga0373937_0089551 Ga0373937_0089551_1805_2449 208
908 3300036401 Ga0373937_0468785 Ga0373937_0468785_500_1144 208
909 3300037466 Ga0395898_0097883 Ga0395898_0097883_910_1551 208
910 3300039447 Ga0436361_0338967 Ga0436361_0338967_1117_1758 208
911 3300044684 Ga0466966_0089471 Ga0466966_0089471_325_975 208
912 3300044693 Ga0466961_0018736 Ga0466961_0018736_2046_2696 208
913 3300044694 Ga0466963_0047308 Ga0466963_0047308_593_1243 208
914 3300044706 Ga0466964_0002848 Ga0466964_0002848_2062_2712 208
915 3300044719 Ga0466971_0005142 Ga0466971_0005142_4563_5213 208
916 3300044765 Ga0466970_0028412 Ga0466970_0028412_1440_2090 208
917 3300045049 Ga0466959_0009422 Ga0466959_0009422_3941_4591 208
918 3300045836 Ga0466958_0011505 Ga0466958_0011505_684_1334 208
919 3300045976 Ga0466967_0141742 Ga0466967_0141742_476_1126 208
920 3300046454 Ga0495592_0030409 Ga0495592_0030409_3256_3909 208
921 3300046457 Ga0495590_0021071 Ga0495590_0021071_525_1178 208
922 3300046457 Ga0495590_0054003 Ga0495590_0054003_463_1116 208
923 3300046459 Ga0495629_0000878 Ga0495629_0000878_13605_14258 208
924 3300046459 Ga0495629_0005319 Ga0495629_0005319_1932_2585 208
925 3300046460 Ga0495638_0013390 Ga0495638_0013390_1855_2508 208
926 3300046462 Ga0495651_0100121 Ga0495651_0100121_1418_2071 208
927 3300046462 Ga0495651_0351245 Ga0495651_0351245_38_679 208
928 3300046463 Ga0495653_0005181 Ga0495653_0005181_1955_2608 208
929 3300046463 Ga0495653_0007366 Ga0495653_0007366_2555_3208 208
930 3300046463 Ga0495653_0061355 Ga0495653_0061355_980_1633 208
931 3300046471 Ga0495650_0006345 Ga0495650_0006345_3224_3877 208
932 3300046471 Ga0495650_0009150 Ga0495650_0009150_3295_3948 208
933 3300046472 Ga0495580_0016442 Ga0495580_0016442_3096_3749 208
934 3300046472 Ga0495580_0020600 Ga0495580_0020600_1367_2020 208
935 3300046472 Ga0495580_0023359 Ga0495580_0023359_3096_3749 208
936 3300046472 Ga0495580_0050910 Ga0495580_0050910_801_1454 208
937 3300046473 Ga0495582_0027681 Ga0495582_0027681_213_866 208
938 3300046473 Ga0495582_0044024 Ga0495582_0044024_1312_1965 208
939 3300046474 Ga0495605_0003031 Ga0495605_0003031_3463_4122 208
940 3300046477 Ga0495664_0019005 Ga0495664_0019005_2982_3635 208
941 3300046477 Ga0495664_0495309 Ga0495664_0495309_36_680 208
942 3300046500 Ga0495596_0001004 Ga0495596_0001004_3362_4021 208
943 3300046500 Ga0495596_0031054 Ga0495596_0031054_1027_1680 208
944 3300046500 Ga0495596_0070668 Ga0495596_0070668_109_762 208
945 3300046501 Ga0495607_0068424 Ga0495607_0068424_1214_1873 208
946 3300046506 Ga0495583_0000159 Ga0495583_0000159_110955_111596 208
947 3300046506 Ga0495583_0004885 Ga0495583_0004885_169_822 208
948 3300046507 Ga0495606_0002998 Ga0495606_0002998_12632_13273 208
949 3300046507 Ga0495606_0038316 Ga0495606_0038316_1361_2014 208
950 3300046507 Ga0495606_0041103 Ga0495606_0041103_196_849 208
951 3300046511 Ga0495608_0072156 Ga0495608_0072156_1297_1950 208
952 3300046512 Ga0495610_0006028 Ga0495610_0006028_4400_5059 208
953 3300046513 Ga0495616_0004533 Ga0495616_0004533_3416_4075 208
954 3300046515 Ga0495620_0041244 Ga0495620_0041244_1173_1826 208
955 3300046515 Ga0495620_0049470 Ga0495620_0049470_780_1433 208
956 3300046516 Ga0495628_0029302 Ga0495628_0029302_227_880 208
957 3300046516 Ga0495628_0079729 Ga0495628_0079729_1627_2280 208
958 3300046517 Ga0495630_0044173 Ga0495630_0044173_281_934 208
959 3300046523 Ga0495644_0007542 Ga0495644_0007542_2212_2841 208
960 3300046524 Ga0495648_0036925 Ga0495648_0036925_2424_3077 208
961 3300046524 Ga0495648_0038209 Ga0495648_0038209_160_819 208
962 3300046524 Ga0495648_0165099 Ga0495648_0165099_352_1005 208
963 3300046525 Ga0495663_0002556 Ga0495663_0002556_2125_2754 208
964 3300046526 Ga0495666_0000318 Ga0495666_0000318_9938_10591 208
965 3300046526 Ga0495666_0008615 Ga0495666_0008615_3088_3741 208
966 3300046531 Ga0495665_0020210 Ga0495665_0020210_2049_2702 208
967 3300046531 Ga0495665_0060088 Ga0495665_0060088_720_1373 208
968 3300046533 Ga0495640_0017736 Ga0495640_0017736_3536_4189 208
969 3300046535 Ga0495586_0024342 Ga0495586_0024342_1673_2326 208
970 3300046538 Ga0495609_0003404 Ga0495609_0003404_4357_5016 208
971 3300046538 Ga0495609_0048047 Ga0495609_0048047_858_1511 208
972 3300046542 Ga0495597_0035088 Ga0495597_0035088_968_1621 208
973 3300046543 Ga0495645_0211290 Ga0495645_0211290_408_1061 208
974 3300046557 Ga0495622_0000570 Ga0495622_0000570_7696_8349 208
975 3300046615 Ga0495656_0073514 Ga0495656_0073514_324_983 208
976 3300046616 Ga0495668_0055234 Ga0495668_0055234_216_857 208
977 3300046642 Ga0495634_0053681 Ga0495634_0053681_336_989 208
978 3300046648 Ga0495611_0101818 Ga0495611_0101818_167_820 208
979 3300046660 Ga0495625_0052327 Ga0495625_0052327_1381_2022 208
980 3300046660 Ga0495625_0129530 Ga0495625_0129530_406_1059 208
981 3300046663 Ga0495635_0015435 Ga0495635_0015435_2287_2940 208
982 3300046665 Ga0495661_0009057 Ga0495661_0009057_3041_3700 208
983 3300046665 Ga0495661_0016750 Ga0495661_0016750_3119_3757 208
984 3300046665 Ga0495661_0175233 Ga0495661_0175233_145_798 208
985 3300046674 Ga0495588_0096087 Ga0495588_0096087_371_1024 208
986 3300046678 Ga0495599_0008525 Ga0495599_0008525_2740_3393 208
987 3300046679 Ga0495623_0002848 Ga0495623_0002848_6868_7521 208
988 3300046680 Ga0495646_0008984 Ga0495646_0008984_1804_2457 208
989 3300046680 Ga0495646_0119223 Ga0495646_0119223_82_735 208
990 3300046684 Ga0495669_0097430 Ga0495669_0097430_444_1097 208
991 3300046689 Ga0495613_0143776 Ga0495613_0143776_651_1304 208
992 3300046690 Ga0495624_0004719 Ga0495624_0004719_7749_8402 208
993 3300046690 Ga0495624_0018817 Ga0495624_0018817_479_1132 208
994 3300046690 Ga0495624_0021868 Ga0495624_0021868_1779_2432 208
995 3300046691 Ga0495670_0097054 Ga0495670_0097054_759_1418 208
996 3300046692 Ga0495671_0009131 Ga0495671_0009131_4500_5159 208
997 3300046692 Ga0495671_0029990 Ga0495671_0029990_1236_1889 208
998 3300046694 Ga0495649_0001463 Ga0495649_0001463_11426_12067 208
999 3300046694 Ga0495649_0006435 Ga0495649_0006435_5363_6016 208
1000 3300046694 Ga0495649_0009242 Ga0495649_0009242_2973_3632 208
1001 3300046694 Ga0495649_0122041 Ga0495649_0122041_512_1165 208
1002 3300046794 Ga0495589_0014852 Ga0495589_0014852_1804_2445 208
1003 3300046794 Ga0495589_0050404 Ga0495589_0050404_1101_1754 208
1004 3300046809 Ga0495600_0002069 Ga0495600_0002069_2076_2729 208
1005 3300047315 Ga0495581_0008394 Ga0495581_0008394_3259_3912 208
1006 3300047317 Ga0495604_0047559 Ga0495604_0047559_469_1122 208
1007 3300047319 Ga0495674_0004291 Ga0495674_0004291_3096_3749 208
1008 3300047319 Ga0495674_0008961 Ga0495674_0008961_8138_8791 208
1009 3300047319 Ga0495674_0359082 Ga0495674_0359082_248_901 208
1010 3300047320 Ga0495672_0052973 Ga0495672_0052973_996_1655 208
1011 3300047320 Ga0495672_0289083 Ga0495672_0289083_60_713 208
1012 3300047321 Ga0495676_0045906 Ga0495676_0045906_2500_3153 208
1013 3300047323 Ga0495683_0034026 Ga0495683_0034026_1737_2390 208
1014 3300047323 Ga0495683_0070388 Ga0495683_0070388_525_1178 208
1015 3300047443 Ga0495687_034999 Ga0495687_034999_52_705 208
1016 3300047443 Ga0495687_036591 Ga0495687_036591_53_706 208
1017 3300047446 Ga0495679_000037 Ga0495679_000037_145489_146142 208
1018 3300047447 Ga0495685_008745 Ga0495685_008745_1082_1741 208
1019 3300047469 Ga0495673_0040844 Ga0495673_0040844_874_1527 208
1020 3300047469 Ga0495673_0047964 Ga0495673_0047964_656_1315 208
1021 3300047673 Ga0495593_0012820 Ga0495593_0012820_437_1090 208
1022 3300047673 Ga0495593_0032542 Ga0495593_0032542_1290_1943 208
1023 3300048088 Ga0495602_0006574 Ga0495602_0006574_2856_3509 208
1024 3300048088 Ga0495602_0022460 Ga0495602_0022460_3303_3956 208
1025 3300048089 Ga0495614_0006654 Ga0495614_0006654_2291_2944 208
1026 3300048091 Ga0495626_0040299 Ga0495626_0040299_652_1305 208
1027 3300048091 Ga0495626_0065980 Ga0495626_0065980_939_1592 208
1028 3300048913 Ga0496110_0261305 Ga0496110_0261305_628_1272 208
1029 3300048914 Ga0496111_0342997 Ga0496111_0342997_436_1080 208
1030 3300048917 Ga0496114_0439153 Ga0496114_0439153_274_918 208
1031 3300048919 Ga0496116_0014132 Ga0496116_0014132_3606_4265 208
1032 3300048919 Ga0496116_0026637 Ga0496116_0026637_2818_3471 208
1033 3300048920 Ga0496117_0028920 Ga0496117_0028920_1842_2495 208
1034 3300048920 Ga0496117_0114372 Ga0496117_0114372_980_1633 208
1035 3300048921 Ga0496118_0002886 Ga0496118_0002886_11763_12416 208
1036 3300048921 Ga0496118_0060865 Ga0496118_0060865_1868_2521 208
1037 3300048924 Ga0496121_0014458 Ga0496121_0014458_4386_5045 208
1038 3300048924 Ga0496121_0084985 Ga0496121_0084985_1505_2158 208
1039 3300048924 Ga0496121_0197583 Ga0496121_0197583_520_1173 208
1040 3300048925 Ga0496122_0011752 Ga0496122_0011752_4489_5148 208
1041 3300048926 Ga0496123_0007592 Ga0496123_0007592_3402_4061 208
1042 3300048929 Ga0496126_0034799 Ga0496126_0034799_1987_2640 208
1043 3300048929 Ga0496126_0111802 Ga0496126_0111802_316_975 208
1044 3300049459 Ga0495678_025595 Ga0495678_025595_548_1201 208
1045 3300049460 Ga0495682_0094804 Ga0495682_0094804_213_866 208
1046 3300050493 nmdc:mga0k408_22887_c1 nmdc:mga0k408_22887_c1_430_1113 208
1047 3300050496 nmdc:mga07m45_5487_c1 nmdc:mga07m45_5487_c1_3500_4141 208
1048 3300053077 Ga0495601_0239427 Ga0495601_0239427_268_912 208
1049 3300053084 Ga0495595_0136294 Ga0495595_0136294_339_983 208
1050 3300053093 Ga0500651_0112998 Ga0500651_0112998_155_796 208
1051 3300055283 Ga0500661_006935 Ga0500661_006935_461_1102 208
1052 3300061719 Ga0466962_0002972 Ga0466962_0002972_6524_7174 208
1053 3300009011 Ga0105251_10005601 Ga0105251_100056016 209
1054 3300009036 Ga0105244_10001133 Ga0105244_1000113320 209
1055 3300025728 Ga0207655_1001288 Ga0207655_100128822 209
1056 3300025735 Ga0207713_1008988 Ga0207713_10089881 209
1057 3300031727 Ga0316576_10077095 Ga0316576_100770952 209
1058 3300035398 Ga0316574_0086518 Ga0316574_0086518_1192_1857 209
1059 3300046474 Ga0495605_0026070 Ga0495605_0026070_619_1251 209
1060 3300046474 Ga0495605_0240640 Ga0495605_0240640_32_664 209
1061 3300046492 Ga0495585_0006865 Ga0495585_0006865_1119_1751 209
1062 3300046500 Ga0495596_0008902 Ga0495596_0008902_2960_3592 209
1063 3300046501 Ga0495607_0046605 Ga0495607_0046605_1112_1744 209
1064 3300046507 Ga0495606_0133232 Ga0495606_0133232_695_1327 209
1065 3300046513 Ga0495616_0031036 Ga0495616_0031036_1552_2184 209
1066 3300046518 Ga0495631_0015837 Ga0495631_0015837_1082_1714 209
1067 3300046518 Ga0495631_0030586 Ga0495631_0030586_573_1205 209
1068 3300046519 Ga0495632_0022106 Ga0495632_0022106_2057_2689 209
1069 3300046522 Ga0495643_0095437 Ga0495643_0095437_416_1048 209
1070 3300046528 Ga0495642_0007226 Ga0495642_0007226_568_1200 209
1071 3300046528 Ga0495642_0011089 Ga0495642_0011089_2641_3273 209
1072 3300046530 Ga0495654_0000381 Ga0495654_0000381_21197_21835 209
1073 3300046535 Ga0495586_0152531 Ga0495586_0152531_217_849 209
1074 3300046538 Ga0495609_0004682 Ga0495609_0004682_4309_4941 209
1075 3300046542 Ga0495597_0171388 Ga0495597_0171388_85_717 209
1076 3300046558 Ga0495633_0115881 Ga0495633_0115881_203_835 209
1077 3300046615 Ga0495656_0002704 Ga0495656_0002704_4211_4843 209
1078 3300046615 Ga0495656_0044093 Ga0495656_0044093_663_1298 209
1079 3300046616 Ga0495668_0021923 Ga0495668_0021923_1180_1812 209
1080 3300046648 Ga0495611_0012399 Ga0495611_0012399_473_1105 209
1081 3300046660 Ga0495625_0051408 Ga0495625_0051408_402_1034 209
1082 3300046660 Ga0495625_0179307 Ga0495625_0179307_367_999 209
1083 3300046663 Ga0495635_0246513 Ga0495635_0246513_376_1008 209
1084 3300046665 Ga0495661_0168146 Ga0495661_0168146_498_1130 209
1085 3300046691 Ga0495670_0065194 Ga0495670_0065194_341_973 209
1086 3300046692 Ga0495671_0035806 Ga0495671_0035806_1630_2262 209
1087 3300046794 Ga0495589_0000032 Ga0495589_0000032_42443_43081 209
1088 3300046794 Ga0495589_0090532 Ga0495589_0090532_749_1381 209
1089 3300046794 Ga0495589_0146367 Ga0495589_0146367_325_957 209
1090 3300047318 Ga0495636_0051765 Ga0495636_0051765_817_1449 209
1091 3300047323 Ga0495683_0016473 Ga0495683_0016473_1744_2376 209
1092 3300047445 Ga0495677_0006278 Ga0495677_0006278_2552_3184 209
1093 3300047445 Ga0495677_0024912 Ga0495677_0024912_1240_1872 209
1094 3300047447 Ga0495685_014165 Ga0495685_014165_540_1172 209
1095 3300047470 Ga0495681_0019417 Ga0495681_0019417_2288_2920 209
1096 3300048920 Ga0496117_0121972 Ga0496117_0121972_744_1382 209
1097 3300049460 Ga0495682_0033786 Ga0495682_0033786_452_1084 209
1098 3300049775 Ga0501279_036368 Ga0501279_036368_16_648 209
1099 3300025250 Ga0209026_1000967 Ga0209026_100096712 210
1100 3300048091 Ga0495626_0022862 Ga0495626_0022862_1416_2063 211
1101 3300042145 Ga0450906_010415 Ga0450906_010415_636_1277 212
1102 3300048927 Ga0496124_0015077 Ga0496124_0015077_3020_3661 212
1103 3300046539 Ga0495621_0003776 Ga0495621_0003776_1302_1943 213
1104 3300048906 Ga0496103_0022931 Ga0496103_0022931_374_1024 213
1105 3300048908 Ga0496105_0087572 Ga0496105_0087572_1191_1841 213
1106 3300048912 Ga0496109_0009606 Ga0496109_0009606_2776_3426 213
1107 3300048913 Ga0496110_0047706 Ga0496110_0047706_2963_3613 213
1108 3300048914 Ga0496111_0014930 Ga0496111_0014930_1320_1970 213
1109 3300048918 Ga0496115_0238318 Ga0496115_0238318_486_1136 213
1110 3300001979 JGI24740J21852_10000527 JGI24740J21852_1000052710 216
1111 3300002738 JGI25154J39366_1001471 JGI25154J39366_10014717 216
1112 3300003756 Ga0055533_1001052 Ga0055533_10010525 216
1113 3300003762 Ga0055542_1002038 Ga0055542_10020384 216
1114 3300003841 Ga0055541_1000789 Ga0055541_10007892 216
1115 3300005366 Ga0070659_100004714 Ga0070659_1000047145 216
1116 3300014497 Ga0182008_10003842 Ga0182008_100038428 216
1117 3300015261 Ga0182006_1009422 Ga0182006_10094224 216
1118 3300015262 Ga0182007_10004447 Ga0182007_100044475 216
1119 3300025206 Ga0209435_109601 Ga0209435_1096011 216
1120 3300025224 Ga0209784_100365 Ga0209784_10036511 216
1121 3300025225 Ga0209566_100955 Ga0209566_1009554 216
1122 3300025226 Ga0209674_100184 Ga0209674_1001849 216
1123 3300025246 Ga0209646_1000035 Ga0209646_1000035253 216
1124 3300025250 Ga0209026_1002757 Ga0209026_10027573 216
1125 3300025253 Ga0209677_102322 Ga0209677_1023226 216
1126 3300025254 Ga0209148_1000293 Ga0209148_100029359 216
1127 3300044671 Ga0466978_0109275 Ga0466978_0109275_140_790 216
1128 3300044683 Ga0466965_0002051 Ga0466965_0002051_4470_5120 216
1129 3300044693 Ga0466961_0001458 Ga0466961_0001458_5039_5689 216
1130 3300044706 Ga0466964_0040051 Ga0466964_0040051_301_951 216
1131 3300044719 Ga0466971_0052756 Ga0466971_0052756_508_1158 216
1132 3300044735 Ga0466968_0063481 Ga0466968_0063481_409_1059 216
1133 3300044765 Ga0466970_0007806 Ga0466970_0007806_2036_2686 216
1134 3300044842 Ga0466957_0164008 Ga0466957_0164008_299_949 216
1135 3300044901 Ga0466960_0026488 Ga0466960_0026488_1205_1855 216
1136 3300045049 Ga0466959_0081458 Ga0466959_0081458_891_1541 216
1137 3300045976 Ga0466967_0090776 Ga0466967_0090776_1630_2280 216
1138 3300061719 Ga0466962_0003937 Ga0466962_0003937_5457_6107 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

51

231

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c2t-assembly1.cif.gz_A new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. 0.9676 3 199
1men-assembly1.cif.gz_A complex structure of human gar tfase and substrate beta-gar 0.9652 1 199
4zyv-assembly1.cif.gz_A human gar transformylase in complex with gar and n-({5-[(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)butyl]thiophen-2-yl}carbonyl)-l-glutamic acid (agf71) 0.9626 3 197
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9615 1 199
2ywr-assembly1.cif.gz_A crystal structure of gar transformylase from aquifex aeolicus 0.9615 1 199
ID Description Score Start End Superfamily
af_Q20143_783_975_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9668 2 182 3.40.50.170
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9615 1 199 3.40.50.170
2ywrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9614 3 199 3.40.50.170
1njsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9602 3 199 3.40.50.170
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9552 1 183 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A561KLD6-F1-model_v4 deleted 0.9882 15 203
AF-A0A5Q1FXV9-F1-model_v4 deleted 0.9843 2 200
AF-A0A561KLD6-F1-model_v4 deleted 0.983 15 203
AF-A0A1G0J2J2-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9807 3 183 GO:0004644
GO:0005829
GO:0006189
AF-A0A090QZB5-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9805 1 156 GO:0004644
GO:0005829
GO:0006189

Feature Viewer

pLDDT pTM Quality
93.29 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map