F490544
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1131 | 912 | 440 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10002216|Ga0157373_100022166 |
| Length | 324 |
| Sequence | MEVEKNKGKARQEGPHPMGIAFTFPGQGSQAIGMGKELADTYPEARAVFQEVDDALGQKLSDIMWNGPEETLTLTANAQPALMAVSMAVMRVLEARGLKLSDAVSYVAGHSLGEYSALCAAGTFSIADTARLLRIRGNAMQAAVPVGEGAMAAIIGLEHDAVSAICEEASILGVCQIANDNGGXXLVIEKAAAIASEKGAKRAIMLPVSAPFHSALMAPAAEAMREALAAVEKNNPVVPVIANVRAAPVSDANEIAALLVEQVTGQVRWRETVEWFAANNVTQLYEIGSGKVLTGLARRIDKTVNGVAVNGAADIDQLLATLIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 3 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 4 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 5 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 6 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 7 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 8 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 9 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 10 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 11 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 12 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 13 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 14 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 15 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 16 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 17 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 18 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 19 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 20 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 21 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 22 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 23 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 24 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 25 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 26 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 27 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 28 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 29 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 30 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 31 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 32 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 33 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 34 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 35 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 36 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 37 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 38 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 39 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 40 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 41 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 42 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 43 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 44 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 45 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 46 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 47 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 48 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 49 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 50 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 51 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 52 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 53 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 54 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 55 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 56 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 57 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 58 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 59 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 60 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 61 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 62 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 63 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 64 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 65 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 66 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 67 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 68 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 69 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 70 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 71 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 72 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 73 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 74 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 75 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 76 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 77 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 78 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 79 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 80 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 81 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 82 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 83 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 84 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 85 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 86 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 87 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 88 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 89 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 90 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 91 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 92 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 93 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 94 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 95 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 96 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 97 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 98 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 99 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 100 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 101 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 102 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 103 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 104 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 105 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 106 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 107 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 108 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 109 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 110 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 111 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 112 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 113 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 114 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 115 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 116 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 117 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 118 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 119 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 120 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 121 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 122 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 123 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 124 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 125 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 126 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 127 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 128 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 129 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 130 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 131 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 132 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 133 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 134 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 135 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 136 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 137 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 138 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 139 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 140 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 141 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 142 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 143 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 144 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 145 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 146 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 147 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 148 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 149 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 150 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 151 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 152 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 153 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 154 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 155 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 156 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 157 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 158 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 159 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 160 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 161 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 162 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 163 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 164 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 165 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 166 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 167 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 168 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 169 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 170 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 171 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 172 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 173 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 174 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 175 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 176 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 177 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 178 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 179 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 180 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 181 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 182 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 183 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 184 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 185 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 186 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 187 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 188 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 189 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 190 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 191 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 192 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 193 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 194 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 195 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 196 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 197 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 198 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 199 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 200 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 201 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 202 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 203 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 204 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 205 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 206 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 207 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 208 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 209 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 210 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 211 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 212 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 213 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 214 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 215 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 216 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 217 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 218 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 219 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 220 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 221 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 222 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 223 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 224 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 225 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 226 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 227 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 228 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 229 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 230 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 231 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 232 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 233 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 234 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 235 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 236 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 237 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 238 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 239 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 240 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 241 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 242 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 243 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 244 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 245 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 246 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 247 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 248 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 249 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 250 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 251 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 252 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 253 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 254 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 255 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 256 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 257 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 258 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 259 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 260 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 261 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 262 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 263 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 264 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 265 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 266 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 267 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 268 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 269 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 270 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 271 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 272 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 273 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 274 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 275 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 276 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 277 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 278 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 279 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 280 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 281 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 282 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 283 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 284 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 285 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 286 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 287 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 288 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 289 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 290 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 291 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 292 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 293 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 294 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 295 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 296 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 297 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 298 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 299 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 300 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 301 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 302 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 303 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 304 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 305 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 306 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 307 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 308 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 309 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 310 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 311 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 312 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 313 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 314 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 315 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 316 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 317 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 318 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 319 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 320 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 321 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 322 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 323 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 324 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 325 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 326 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 327 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 328 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 329 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 330 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 331 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 332 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 333 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 334 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 335 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 336 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 337 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 338 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 339 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 340 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 341 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 342 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 343 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 344 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 345 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 346 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 347 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 348 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 349 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 350 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 351 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 352 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 353 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 354 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 355 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 356 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 357 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 358 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 359 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 360 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 361 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 362 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 363 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 364 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 365 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 366 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 367 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 368 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 369 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 370 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 371 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 372 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 373 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 374 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 375 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 376 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 377 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 378 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 379 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 380 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 381 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 382 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 383 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 384 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 385 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 386 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 387 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 388 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 389 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 390 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 391 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 392 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 393 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 394 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 395 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 396 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 397 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 398 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 399 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 400 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 401 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 402 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 403 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 404 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 405 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 406 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 407 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 408 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 409 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 410 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 411 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 412 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 413 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 414 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 415 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 416 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 417 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 418 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 419 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 420 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 421 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 422 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 423 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 424 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 425 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 426 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 427 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 428 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 429 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 430 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 431 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 432 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 433 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 434 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 435 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 436 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 437 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 438 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 439 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 440 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 441 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 442 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 443 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 444 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 445 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 446 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 447 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 448 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 449 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 450 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 451 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 452 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 453 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 454 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 455 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 456 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 457 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 458 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 459 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 460 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 461 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 462 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 463 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 464 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 465 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 466 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 467 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 468 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 469 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 470 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 471 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 472 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 473 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 474 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 475 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 476 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 477 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 478 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 479 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 480 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 481 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 482 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 483 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 484 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 485 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 486 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 487 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 488 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 489 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 490 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 491 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 492 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 493 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 494 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 495 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 496 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 497 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 498 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 499 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 500 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 501 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 502 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 503 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 504 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 505 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 506 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 507 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 508 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 509 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 510 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 511 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 512 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 513 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 514 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 515 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 516 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 517 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 518 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 519 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 520 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 521 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 522 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 523 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 524 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 525 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 526 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 527 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 528 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 529 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 530 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 531 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 532 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 533 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 534 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 535 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 536 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 537 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 538 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 539 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 540 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 541 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 542 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 543 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 544 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 545 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 546 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 547 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 548 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 549 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 550 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 551 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 552 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 553 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 554 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 555 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 556 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 557 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 558 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 559 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 560 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 561 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 562 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 563 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 564 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 565 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 566 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 567 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 568 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 569 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 570 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 571 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 572 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 573 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 574 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 575 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 576 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 577 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 578 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 579 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 580 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 581 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 582 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 583 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 584 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 585 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 586 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 587 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 588 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 589 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 590 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 591 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 592 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 593 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 594 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 595 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 596 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 597 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 598 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 599 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 600 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 601 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 602 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 603 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 604 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 605 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 606 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 607 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 608 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 609 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 610 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 611 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 612 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 613 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 614 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 615 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 616 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 617 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 618 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 619 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 620 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 621 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 622 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 623 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 624 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 625 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 626 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 627 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 628 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 629 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 630 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 631 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 632 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 633 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 634 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 635 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 636 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 637 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 638 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 639 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 640 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 641 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 642 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 643 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 644 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 645 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 646 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 647 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 648 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 649 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 650 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 651 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 652 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 653 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 654 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 655 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 656 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 657 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 658 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 659 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 660 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 661 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 662 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 663 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 664 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 665 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 666 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 667 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 668 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 669 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 670 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 671 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 672 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 673 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 674 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 675 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 676 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 677 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 678 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 679 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 680 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 681 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 682 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 683 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 684 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 685 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 686 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 687 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 688 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 689 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 690 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 691 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 692 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 693 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 694 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 695 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 696 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 697 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 698 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 699 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 700 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 701 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 702 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 703 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 704 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 705 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 706 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 707 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 708 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 709 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 710 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 711 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 712 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 713 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 714 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 715 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 716 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 717 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 718 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 719 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 720 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 721 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 722 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 723 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 724 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 725 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 726 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 727 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 728 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 729 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 730 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 731 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 732 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 733 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 734 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 735 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 736 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 737 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 738 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 739 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 740 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 741 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 742 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 743 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 744 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 745 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 746 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 747 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 748 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 749 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 750 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 751 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 752 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 753 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 754 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 755 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 756 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 757 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 761 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 764 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 765 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 766 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 767 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 774 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 777 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 778 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 779 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 780 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 781 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 782 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 783 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 784 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 785 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 786 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 787 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 788 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 789 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 790 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 791 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 792 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 793 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 794 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 795 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 796 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 797 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 798 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 799 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 800 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 801 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 802 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 803 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 804 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 805 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 806 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 807 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 808 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 809 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 810 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 811 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 812 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 813 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 814 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 815 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 816 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 817 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 818 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 819 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 820 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 821 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 822 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 823 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 824 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 825 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 826 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 827 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 828 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 829 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 830 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 831 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 832 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 833 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 834 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 835 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 836 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 837 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 838 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 839 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 840 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 841 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 842 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 843 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 844 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 845 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 846 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 847 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 848 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 849 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 850 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 851 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 852 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 853 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 854 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 855 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 856 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 857 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 858 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 859 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 860 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 861 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 862 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 863 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 864 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 865 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 866 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 867 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 868 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 869 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 870 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 871 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 872 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 873 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 874 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 875 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 876 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 877 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 878 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 879 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 880 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 881 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 882 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 883 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 884 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 885 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 886 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 887 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 888 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 889 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 890 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 891 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 892 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 893 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 894 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 895 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 896 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 897 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 898 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 899 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 900 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 901 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 902 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 903 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 904 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 905 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 906 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 907 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 908 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 909 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 910 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 911 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 912 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 38.9 |
| Metatranscriptomes | 0 |
| Isolates | 61.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.44 |
| Bulb | 0 |
| Endosphere | 13.44 |
| Nodule | 46.24 |
| Rhizoplane | 2.48 |
| Rhizosphere | 22.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10007068 | 3300001989 | Bacteria | 4225 |
| 2 | JGI25162J39368_1004608 | 3300002737 | Bacteria | 3114 |
| 3 | JGI25158J39367_1000407 | 3300002739 | Bacteria | 8986 |
| 4 | JGI25152J39213_1005768 | 3300002773 | Bacteria | 3526 |
| 5 | JGI25152J39213_1006937 | 3300002773 | Bacteria | 2993 |
| 6 | JGI25150J39212_1001462 | 3300002774 | Bacteria | 6581 |
| 7 | JGI25159J45721_1000002 | 3300002987 | Bacteria | 289163 |
| 8 | JGI25159J45721_1000299 | 3300002987 | Bacteria | 23242 |
| 9 | JGI25159J45721_1001244 | 3300002987 | Bacteria | 10748 |
| 10 | JGI25151J46595_10015298 | 3300003187 | Bacteria | 3386 |
| 11 | JGI25165J46597_1005540 | 3300003214 | Bacteria | 2412 |
| 12 | JGI25165J46597_1008647 | 3300003214 | Bacteria | 1583 |
| 13 | JGI25153J46596_10009883 | 3300003215 | Bacteria | 4375 |
| 14 | JGI25153J46596_10010716 | 3300003215 | Bacteria | 4121 |
| 15 | JGI25160J50197_1000008 | 3300003354 | Bacteria | 289163 |
| 16 | JGI25160J50197_1000015 | 3300003354 | Bacteria | 250902 |
| 17 | JGI25161J50226_1000005 | 3300003374 | Bacteria | 292548 |
| 18 | JGI25161J50226_1001391 | 3300003374 | Bacteria | 7366 |
| 19 | JGI25161J50226_1001583 | 3300003374 | Bacteria | 6654 |
| 20 | Ga0055526_1004652 | 3300003771 | Bacteria | 8162 |
| 21 | Ga0055526_1009202 | 3300003771 | Bacteria | 4794 |
| 22 | Ga0055526_1010667 | 3300003771 | Bacteria | 4244 |
| 23 | Ga0055524_1003638 | 3300003775 | Bacteria | 7408 |
| 24 | Ga0055524_1006936 | 3300003775 | Bacteria | 4870 |
| 25 | Ga0055524_1009966 | 3300003775 | Bacteria | 3818 |
| 26 | Ga0055536_1015294 | 3300003781 | Bacteria | 2636 |
| 27 | Ga0055528_1005083 | 3300003790 | Bacteria | 6203 |
| 28 | Ga0055528_1007761 | 3300003790 | Bacteria | 4695 |
| 29 | Ga0055528_1012526 | 3300003790 | Bacteria | 3283 |
| 30 | Ga0055528_1023932 | 3300003790 | Bacteria | 1847 |
| 31 | Ga0055530_10005675 | 3300003791 | Bacteria | 5836 |
| 32 | Ga0055540_1002625 | 3300003792 | Bacteria | 9328 |
| 33 | Ga0055540_1008490 | 3300003792 | Bacteria | 3692 |
| 34 | Ga0055531_10002261 | 3300003794 | Bacteria | 13034 |
| 35 | Ga0055531_10007612 | 3300003794 | Bacteria | 5869 |
| 36 | Ga0058692_1002692 | 3300003856 | Bacteria | 5849 |
| 37 | Ga0058692_1011160 | 3300003856 | Bacteria | 2187 |
| 38 | Ga0055543_1000012 | 3300004625 | Bacteria | 186581 |
| 39 | Ga0055543_1000040 | 3300004625 | Bacteria | 122485 |
| 40 | Ga0055543_1001946 | 3300004625 | Bacteria | 7366 |
| 41 | Ga0065165_1000015 | 3300005262 | Bacteria | 289201 |
| 42 | Ga0065165_1002531 | 3300005262 | Bacteria | 15197 |
| 43 | Ga0065165_1003987 | 3300005262 | Bacteria | 9651 |
| 44 | Ga0065165_1007707 | 3300005262 | Bacteria | 5214 |
| 45 | Ga0065165_1011545 | 3300005262 | Bacteria | 3669 |
| 46 | Ga0070670_100009711 | 3300005331 | Bacteria | 8216 |
| 47 | Ga0070661_100002760 | 3300005344 | Bacteria | 12042 |
| 48 | Ga0070661_100006288 | 3300005344 | Bacteria | 8194 |
| 49 | Ga0070661_100312143 | 3300005344 | Bacteria | 1226 |
| 50 | Ga0070671_100009450 | 3300005355 | Bacteria | 7827 |
| 51 | Ga0070667_100335353 | 3300005367 | Bacteria | 1367 |
| 52 | Ga0068853_100004761 | 3300005539 | Bacteria | 10552 |
| 53 | Ga0068853_100078999 | 3300005539 | Bacteria | 2876 |
| 54 | Ga0070665_100100746 | 3300005548 | Bacteria | 2893 |
| 55 | Ga0070665_100192330 | 3300005548 | Bacteria | 2041 |
| 56 | Ga0068854_100034747 | 3300005578 | Bacteria | 3523 |
| 57 | Ga0068851_10005798 | 3300005834 | Bacteria | 5627 |
| 58 | Ga0075365_10001318 | 3300006038 | Bacteria | 11080 |
| 59 | Ga0075365_10003852 | 3300006038 | Bacteria | 7835 |
| 60 | Ga0075365_10077370 | 3300006038 | Bacteria | 2248 |
| 61 | Ga0075365_10232344 | 3300006038 | Bacteria | 1295 |
| 62 | Ga0075368_10004614 | 3300006042 | Bacteria | 4684 |
| 63 | Ga0075363_100256935 | 3300006048 | Bacteria | 1007 |
| 64 | Ga0075364_10003962 | 3300006051 | Bacteria | 8500 |
| 65 | Ga0075364_10069082 | 3300006051 | Bacteria | 2324 |
| 66 | Ga0075367_10012849 | 3300006178 | Bacteria | 4483 |
| 67 | Ga0075367_10115807 | 3300006178 | Bacteria | 1648 |
| 68 | Ga0075369_10019091 | 3300006186 | Bacteria | 2796 |
| 69 | Ga0075369_10034254 | 3300006186 | Bacteria | 2155 |
| 70 | Ga0075366_10176209 | 3300006195 | Bacteria | 1298 |
| 71 | Ga0075370_10204801 | 3300006353 | Bacteria | 1164 |
| 72 | Ga0079104_1000032 | 3300006946 | Bacteria | 203094 |
| 73 | Ga0099826_10078772 | 3300006948 | Bacteria | 2062 |
| 74 | Ga0099826_10079873 | 3300006948 | Bacteria | 2042 |
| 75 | Ga0105240_10000032 | 3300009093 | Bacteria | 283907 |
| 76 | Ga0105248_10093909 | 3300009177 | Bacteria | 3378 |
| 77 | Ga0105237_10000754 | 3300009545 | Bacteria | 44371 |
| 78 | Ga0105237_10302382 | 3300009545 | Bacteria | 1603 |
| 79 | Ga0123342_1031086 | 3300009766 | Bacteria | 2617 |
| 80 | Ga0105239_10003143 | 3300010375 | Bacteria | 20495 |
| 81 | Ga0105239_10015417 | 3300010375 | Bacteria | 8467 |
| 82 | Ga0157373_10002216 | 3300013100 | Bacteria | 14709 |
| 83 | Ga0157373_10066043 | 3300013100 | Bacteria | 2560 |
| 84 | Ga0157371_10000073 | 3300013102 | Bacteria | 163215 |
| 85 | Ga0157371_10014140 | 3300013102 | Bacteria | 6034 |
| 86 | Ga0157370_10000972 | 3300013104 | Bacteria | 36292 |
| 87 | Ga0157369_10063657 | 3300013105 | Bacteria | 3973 |
| 88 | Ga0157369_10196501 | 3300013105 | Bacteria | 2118 |
| 89 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 90 | Ga0182007_10005040 | 3300015262 | Bacteria | 5865 |
| 91 | Ga0182005_1012560 | 3300015265 | Bacteria | 2390 |
| 92 | Ga0183363_1451 | 3300015690 | Bacteria | 2565 |
| 93 | Ga0214544_1000017 | 3300021320 | Bacteria | 193638 |
| 94 | Ga0214542_1000006 | 3300021321 | Bacteria | 345164 |
| 95 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 96 | Ga0214543_1000014 | 3300021327 | Bacteria | 324986 |
| 97 | Ga0228711_1000001 | 3300022739 | Bacteria | 357377 |
| 98 | Ga0228710_1000001 | 3300022740 | Bacteria | 314328 |
| 99 | Ga0209436_100315 | 3300025208 | Bacteria | 22202 |
| 100 | Ga0209436_101147 | 3300025208 | Bacteria | 9795 |
| 101 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 102 | Ga0209677_101323 | 3300025253 | Bacteria | 10926 |
| 103 | Ga0209759_1013620 | 3300025256 | Bacteria | 2191 |
| 104 | Ga0209129_1000420 | 3300025258 | Bacteria | 32649 |
| 105 | Ga0209129_1003371 | 3300025258 | Bacteria | 7023 |
| 106 | Ga0209129_1003477 | 3300025258 | Bacteria | 6822 |
| 107 | Ga0209129_1008011 | 3300025258 | Bacteria | 3012 |
| 108 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 109 | Ga0209233_1000209 | 3300025261 | Bacteria | 115124 |
| 110 | Ga0209673_1000041 | 3300025273 | Bacteria | 307397 |
| 111 | Ga0209673_1000319 | 3300025273 | Bacteria | 88129 |
| 112 | Ga0209673_1000603 | 3300025273 | Bacteria | 55646 |
| 113 | Ga0209673_1009838 | 3300025273 | Bacteria | 4094 |
| 114 | Ga0209673_1011121 | 3300025273 | Bacteria | 3734 |
| 115 | Ga0209673_1037998 | 3300025273 | Bacteria | 1407 |
| 116 | Ga0209130_1000006 | 3300025284 | Bacteria | 596528 |
| 117 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 118 | Ga0209130_1000018 | 3300025284 | Bacteria | 388301 |
| 119 | Ga0209130_1011895 | 3300025284 | Bacteria | 2307 |
| 120 | Ga0209130_1013814 | 3300025284 | Bacteria | 2053 |
| 121 | Ga0209676_1003497 | 3300025292 | Bacteria | 9618 |
| 122 | Ga0209676_1016484 | 3300025292 | Bacteria | 2664 |
| 123 | Ga0209676_1022064 | 3300025292 | Bacteria | 2118 |
| 124 | Ga0209025_1000074 | 3300025294 | Bacteria | 277445 |
| 125 | Ga0209025_1000080 | 3300025294 | Bacteria | 267244 |
| 126 | Ga0209025_1000100 | 3300025294 | Bacteria | 229182 |
| 127 | Ga0209025_1001440 | 3300025294 | Bacteria | 31293 |
| 128 | Ga0209025_1008335 | 3300025294 | Bacteria | 7472 |
| 129 | Ga0209025_1013593 | 3300025294 | Bacteria | 5098 |
| 130 | Ga0209025_1024975 | 3300025294 | Bacteria | 3061 |
| 131 | Ga0209564_1000425 | 3300025295 | Bacteria | 74279 |
| 132 | Ga0209564_1000439 | 3300025295 | Bacteria | 71637 |
| 133 | Ga0209564_1004856 | 3300025295 | Bacteria | 7991 |
| 134 | Ga0209564_1011003 | 3300025295 | Bacteria | 4099 |
| 135 | Ga0209564_1027287 | 3300025295 | Bacteria | 1858 |
| 136 | Ga0209758_1000554 | 3300025297 | Bacteria | 59218 |
| 137 | Ga0209758_1002005 | 3300025297 | Bacteria | 21904 |
| 138 | Ga0209758_1017001 | 3300025297 | Bacteria | 3653 |
| 139 | Ga0209758_1017730 | 3300025297 | Bacteria | 3525 |
| 140 | Ga0209758_1021436 | 3300025297 | Bacteria | 3012 |
| 141 | Ga0209758_1029384 | 3300025297 | Bacteria | 2300 |
| 142 | Ga0209050_1006521 | 3300025298 | Bacteria | 6879 |
| 143 | Ga0209050_1016786 | 3300025298 | Bacteria | 2968 |
| 144 | Ga0209256_1000994 | 3300025299 | Bacteria | 33764 |
| 145 | Ga0209256_1002348 | 3300025299 | Bacteria | 15760 |
| 146 | Ga0209256_1002894 | 3300025299 | Bacteria | 13006 |
| 147 | Ga0209256_1005095 | 3300025299 | Bacteria | 7802 |
| 148 | Ga0209256_1011458 | 3300025299 | Bacteria | 3541 |
| 149 | Ga0209256_1011586 | 3300025299 | Bacteria | 3505 |
| 150 | Ga0209256_1022664 | 3300025299 | Bacteria | 1894 |
| 151 | Ga0207426_1000044 | 3300025302 | Bacteria | 428043 |
| 152 | Ga0207426_1000064 | 3300025302 | Bacteria | 358276 |
| 153 | Ga0207426_1000106 | 3300025302 | Bacteria | 244368 |
| 154 | Ga0209051_1000459 | 3300025303 | Bacteria | 53735 |
| 155 | Ga0209051_1000514 | 3300025303 | Bacteria | 48877 |
| 156 | Ga0209051_1001705 | 3300025303 | Bacteria | 17601 |
| 157 | Ga0209051_1002690 | 3300025303 | Bacteria | 12386 |
| 158 | Ga0209257_1002541 | 3300025304 | Bacteria | 17865 |
| 159 | Ga0209257_1007417 | 3300025304 | Bacteria | 6627 |
| 160 | Ga0207656_10003313 | 3300025321 | Bacteria | 5518 |
| 161 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 162 | Ga0207671_10003700 | 3300025914 | Bacteria | 15077 |
| 163 | Ga0207657_10019763 | 3300025919 | Bacteria | 6385 |
| 164 | Ga0207657_10154095 | 3300025919 | Bacteria | 1870 |
| 165 | Ga0207650_10001915 | 3300025925 | Bacteria | 14658 |
| 166 | Ga0207644_10067027 | 3300025931 | Bacteria | 2615 |
| 167 | Ga0207711_10181472 | 3300025941 | Bacteria | 1914 |
| 168 | Ga0207667_10020644 | 3300025949 | Bacteria | 7321 |
| 169 | Ga0207668_10155547 | 3300025972 | Bacteria | 1776 |
| 170 | Ga0207658_10310535 | 3300025986 | Bacteria | 1362 |
| 171 | Ga0207639_10010406 | 3300026041 | Bacteria | 6441 |
| 172 | Ga0207678_10023512 | 3300026067 | Bacteria | 5389 |
| 173 | Ga0207678_10161027 | 3300026067 | Bacteria | 1917 |
| 174 | Ga0207698_10013180 | 3300026142 | Bacteria | 5443 |
| 175 | Ga0209281_1000053 | 3300027111 | Bacteria | 309587 |
| 176 | Ga0209281_1000266 | 3300027111 | Bacteria | 100574 |
| 177 | Ga0209371_1000021 | 3300027312 | Bacteria | 555864 |
| 178 | Ga0209282_1000007 | 3300027666 | Bacteria | 254917 |
| 179 | Ga0209282_1000102 | 3300027666 | Bacteria | 57412 |
| 180 | Ga0268266_10377822 | 3300028379 | Bacteria | 1336 |
| 181 | Ga0307515_10000070 | 3300028794 | Bacteria | 239322 |
| 182 | Ga0307515_10003572 | 3300028794 | Bacteria | 32658 |
| 183 | Ga0307515_10010166 | 3300028794 | Bacteria | 18072 |
| 184 | Ga0307515_10231489 | 3300028794 | Bacteria | 1639 |
| 185 | Ga0268256_1000020 | 3300030500 | Bacteria | 557873 |
| 186 | Ga0316181_1097764 | 3300030744 | Bacteria | 4086 |
| 187 | Ga0307513_10008740 | 3300031456 | Bacteria | 12903 |
| 188 | Ga0307408_100149344 | 3300031548 | Bacteria | 1843 |
| 189 | Ga0307516_10042951 | 3300031730 | Bacteria | 4482 |
| 190 | Ga0315914_1000006 | 3300031967 | Bacteria | 239817 |
| 191 | Ga0307414_10016210 | 3300032004 | Bacteria | 4523 |
| 192 | Ga0315913_1000002 | 3300033430 | Bacteria | 241452 |
| 193 | Ga0315915_1000001 | 3300033464 | Bacteria | 481518 |
| 194 | Ga0373946_0022994 | 3300035171 | Bacteria | 2432 |
| 195 | Ga0373927_0000925 | 3300035695 | Bacteria | 22236 |
| 196 | Ga0316582_0089496 | 3300036647 | Bacteria | 2024 |
| 197 | Ga0373925_0003381 | 3300037068 | Bacteria | 12371 |
| 198 | Ga0395899_0000213 | 3300037312 | Bacteria | 83403 |
| 199 | Ga0395900_0000121 | 3300037418 | Bacteria | 135026 |
| 200 | Ga0395900_0094881 | 3300037418 | Bacteria | 3065 |
| 201 | Ga0395898_0000247 | 3300037466 | Bacteria | 135026 |
| 202 | Ga0395905_0000112 | 3300037471 | Bacteria | 135010 |
| 203 | Ga0395905_0017948 | 3300037471 | Bacteria | 6719 |
| 204 | Ga0395901_0000078 | 3300038443 | Bacteria | 135026 |
| 205 | Ga0395901_0404396 | 3300038443 | Bacteria | 1402 |
| 206 | Ga0439436_0025006 | 3300041404 | Bacteria | 1758 |
| 207 | Ga0439439_0036435 | 3300041406 | Bacteria | 1266 |
| 208 | Ga0439447_019582 | 3300041407 | Bacteria | 1803 |
| 209 | Ga0439465_0015848 | 3300041413 | Bacteria | 2351 |
| 210 | Ga0439465_0062662 | 3300041413 | Bacteria | 1234 |
| 211 | Ga0439431_0023859 | 3300041997 | Bacteria | 1484 |
| 212 | Ga0439432_062411 | 3300042006 | Bacteria | 1147 |
| 213 | Ga0439449_0001282 | 3300042007 | Bacteria | 9833 |
| 214 | Ga0450910_008733 | 3300042147 | Bacteria | 1428 |
| 215 | Ga0495627_028880 | 3300046453 | Bacteria | 1769 |
| 216 | Ga0495592_0050385 | 3300046454 | Bacteria | 3093 |
| 217 | Ga0495638_0020463 | 3300046460 | Bacteria | 4372 |
| 218 | Ga0495638_0024146 | 3300046460 | Bacteria | 3967 |
| 219 | Ga0495651_0101369 | 3300046462 | Bacteria | 2143 |
| 220 | Ga0495605_0052384 | 3300046474 | Bacteria | 1983 |
| 221 | Ga0495662_0006888 | 3300046476 | Bacteria | 5647 |
| 222 | Ga0495664_0257039 | 3300046477 | Bacteria | 1056 |
| 223 | Ga0495607_0036799 | 3300046501 | Bacteria | 2946 |
| 224 | Ga0495607_0107832 | 3300046501 | Bacteria | 1481 |
| 225 | Ga0495583_0028074 | 3300046506 | Bacteria | 2771 |
| 226 | Ga0495606_0015352 | 3300046507 | Bacteria | 5907 |
| 227 | Ga0495606_0017659 | 3300046507 | Bacteria | 5384 |
| 228 | Ga0495606_0081796 | 3300046507 | Bacteria | 2007 |
| 229 | Ga0495606_0170967 | 3300046507 | Bacteria | 1260 |
| 230 | Ga0495610_0023089 | 3300046512 | Bacteria | 3389 |
| 231 | Ga0495610_0049229 | 3300046512 | Bacteria | 2064 |
| 232 | Ga0495610_0158542 | 3300046512 | Bacteria | 959 |
| 233 | Ga0495620_0012599 | 3300046515 | Bacteria | 4358 |
| 234 | Ga0495620_0092744 | 3300046515 | Bacteria | 1210 |
| 235 | Ga0495632_0059265 | 3300046519 | Bacteria | 1863 |
| 236 | Ga0495643_0002659 | 3300046522 | Bacteria | 13838 |
| 237 | Ga0495642_0167483 | 3300046528 | Bacteria | 954 |
| 238 | Ga0495654_0000092 | 3300046530 | Bacteria | 101504 |
| 239 | Ga0495597_0005990 | 3300046542 | Bacteria | 6341 |
| 240 | Ga0495668_0051012 | 3300046616 | Bacteria | 2291 |
| 241 | Ga0495625_0012288 | 3300046660 | Bacteria | 6944 |
| 242 | Ga0495625_0073006 | 3300046660 | Bacteria | 2406 |
| 243 | Ga0495661_0087487 | 3300046665 | Bacteria | 1781 |
| 244 | Ga0495588_0037721 | 3300046674 | Bacteria | 2456 |
| 245 | Ga0495657_0143833 | 3300046675 | Bacteria | 1485 |
| 246 | Ga0495658_0076066 | 3300046683 | Bacteria | 1961 |
| 247 | Ga0495600_0009138 | 3300046809 | Bacteria | 6113 |
| 248 | Ga0495660_0001564 | 3300046810 | Bacteria | 15371 |
| 249 | Ga0495604_0032390 | 3300047317 | Bacteria | 4143 |
| 250 | Ga0495681_0010747 | 3300047470 | Bacteria | 5516 |
| 251 | Ga0495686_0008600 | 3300047472 | Bacteria | 7470 |
| 252 | Ga0495686_0027080 | 3300047472 | Bacteria | 3746 |
| 253 | Ga0495686_0146621 | 3300047472 | Bacteria | 1388 |
| 254 | Ga0496100_0230528 | 3300048903 | Bacteria | 1362 |
| 255 | Ga0496102_0015568 | 3300048905 | Bacteria | 6625 |
| 256 | Ga0496104_0360796 | 3300048907 | Bacteria | 1365 |
| 257 | Ga0496105_0055157 | 3300048908 | Bacteria | 3281 |
| 258 | Ga0496106_0003362 | 3300048909 | Bacteria | 11925 |
| 259 | Ga0496106_0023088 | 3300048909 | Bacteria | 4620 |
| 260 | Ga0496106_0089404 | 3300048909 | Bacteria | 2375 |
| 261 | Ga0496106_0299690 | 3300048909 | Bacteria | 1289 |
| 262 | Ga0496108_0178435 | 3300048911 | Bacteria | 1839 |
| 263 | Ga0496109_0299691 | 3300048912 | Bacteria | 1516 |
| 264 | Ga0496110_0138134 | 3300048913 | Bacteria | 2203 |
| 265 | Ga0496110_0239681 | 3300048913 | Bacteria | 1650 |
| 266 | Ga0496111_0000236 | 3300048914 | Bacteria | 26454 |
| 267 | Ga0496111_0146862 | 3300048914 | Bacteria | 1748 |
| 268 | Ga0496112_0190380 | 3300048915 | Bacteria | 2014 |
| 269 | Ga0496112_0360785 | 3300048915 | Bacteria | 1395 |
| 270 | Ga0496113_0198265 | 3300048916 | Bacteria | 1595 |
| 271 | Ga0496114_0257392 | 3300048917 | Bacteria | 1536 |
| 272 | Ga0496116_0000036 | 3300048919 | Bacteria | 388508 |
| 273 | Ga0496116_0017649 | 3300048919 | Bacteria | 5530 |
| 274 | Ga0496116_0026294 | 3300048919 | Bacteria | 4260 |
| 275 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 276 | Ga0496117_0025724 | 3300048920 | Bacteria | 4620 |
| 277 | Ga0496117_0047076 | 3300048920 | Bacteria | 3096 |
| 278 | Ga0496117_0074025 | 3300048920 | Bacteria | 2270 |
| 279 | Ga0496117_0103427 | 3300048920 | Bacteria | 1795 |
| 280 | Ga0496118_0000214 | 3300048921 | Bacteria | 100898 |
| 281 | Ga0496118_0002790 | 3300048921 | Bacteria | 22870 |
| 282 | Ga0496118_0003651 | 3300048921 | Bacteria | 19121 |
| 283 | Ga0496118_0054586 | 3300048921 | Bacteria | 3025 |
| 284 | Ga0496118_0055489 | 3300048921 | Bacteria | 2989 |
| 285 | Ga0496119_0013733 | 3300048922 | Bacteria | 6418 |
| 286 | Ga0496119_0016653 | 3300048922 | Bacteria | 5578 |
| 287 | Ga0496119_0018153 | 3300048922 | Bacteria | 5253 |
| 288 | Ga0496120_0000125 | 3300048923 | Bacteria | 128983 |
| 289 | Ga0496120_0011845 | 3300048923 | Bacteria | 5967 |
| 290 | Ga0496120_0075534 | 3300048923 | Bacteria | 1839 |
| 291 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 292 | Ga0496121_0001948 | 3300048924 | Bacteria | 32895 |
| 293 | Ga0496121_0005233 | 3300048924 | Bacteria | 16787 |
| 294 | Ga0496121_0023150 | 3300048924 | Bacteria | 5996 |
| 295 | Ga0496121_0024937 | 3300048924 | Bacteria | 5699 |
| 296 | Ga0496121_0034281 | 3300048924 | Bacteria | 4571 |
| 297 | Ga0496121_0051611 | 3300048924 | Bacteria | 3462 |
| 298 | Ga0496121_0252673 | 3300048924 | Bacteria | 1221 |
| 299 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 300 | Ga0496122_0000160 | 3300048925 | Bacteria | 159236 |
| 301 | Ga0496122_0024031 | 3300048925 | Bacteria | 5346 |
| 302 | Ga0496122_0061635 | 3300048925 | Bacteria | 2751 |
| 303 | Ga0496122_0089662 | 3300048925 | Bacteria | 2101 |
| 304 | Ga0496122_0094524 | 3300048925 | Bacteria | 2023 |
| 305 | Ga0496122_0128832 | 3300048925 | Bacteria | 1613 |
| 306 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 307 | Ga0496123_0000034 | 3300048926 | Bacteria | 274836 |
| 308 | Ga0496123_0022771 | 3300048926 | Bacteria | 4816 |
| 309 | Ga0496123_0059455 | 3300048926 | Bacteria | 2471 |
| 310 | Ga0496123_0085878 | 3300048926 | Bacteria | 1890 |
| 311 | Ga0496123_0112713 | 3300048926 | Bacteria | 1550 |
| 312 | Ga0496124_0000349 | 3300048927 | Bacteria | 84498 |
| 313 | Ga0496124_0008594 | 3300048927 | Bacteria | 10654 |
| 314 | Ga0496124_0030968 | 3300048927 | Bacteria | 4739 |
| 315 | Ga0496124_0032626 | 3300048927 | Bacteria | 4594 |
| 316 | Ga0496124_0060590 | 3300048927 | Bacteria | 3174 |
| 317 | Ga0496124_0078365 | 3300048927 | Bacteria | 2723 |
| 318 | Ga0496124_0131015 | 3300048927 | Bacteria | 1992 |
| 319 | Ga0496124_0152290 | 3300048927 | Bacteria | 1812 |
| 320 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 321 | Ga0496125_0008785 | 3300048928 | Bacteria | 10509 |
| 322 | Ga0496125_0053355 | 3300048928 | Bacteria | 3314 |
| 323 | Ga0496126_0000156 | 3300048929 | Bacteria | 158537 |
| 324 | Ga0496126_0001886 | 3300048929 | Bacteria | 30413 |
| 325 | Ga0496126_0077009 | 3300048929 | Bacteria | 2958 |
| 326 | Ga0496126_0154530 | 3300048929 | Bacteria | 1964 |
| 327 | Ga0496126_0210657 | 3300048929 | Bacteria | 1636 |
| 328 | Ga0501031_0000060 | 3300049568 | Bacteria | 58759 |
| 329 | Ga0501031_0002553 | 3300049568 | Bacteria | 11599 |
| 330 | Ga0501031_0065131 | 3300049568 | Bacteria | 2374 |
| 331 | Ga0501032_0000015 | 3300049569 | Bacteria | 176755 |
| 332 | Ga0501032_0000025 | 3300049569 | Bacteria | 138521 |
| 333 | Ga0501032_0030787 | 3300049569 | Bacteria | 3681 |
| 334 | Ga0501032_0053548 | 3300049569 | Bacteria | 2717 |
| 335 | Ga0501033_0000023 | 3300049570 | Bacteria | 176725 |
| 336 | Ga0501033_0000229 | 3300049570 | Bacteria | 54036 |
| 337 | Ga0501033_0000742 | 3300049570 | Bacteria | 29975 |
| 338 | Ga0501033_0086334 | 3300049570 | Bacteria | 2297 |
| 339 | Ga0501034_0000073 | 3300049571 | Bacteria | 176737 |
| 340 | Ga0501034_0001654 | 3300049571 | Bacteria | 28764 |
| 341 | Ga0501034_0020740 | 3300049571 | Bacteria | 6709 |
| 342 | Ga0501034_0086434 | 3300049571 | Bacteria | 3136 |
| 343 | Ga0501034_0175292 | 3300049571 | Bacteria | 2110 |
| 344 | Ga0501034_0211689 | 3300049571 | Bacteria | 1894 |
| 345 | Ga0501036_0000002 | 3300049572 | Bacteria | 293106 |
| 346 | Ga0501036_0000151 | 3300049572 | Bacteria | 45499 |
| 347 | Ga0501036_0354583 | 3300049572 | Bacteria | 1225 |
| 348 | Ga0501037_0000048 | 3300049573 | Bacteria | 113375 |
| 349 | Ga0501037_0000176 | 3300049573 | Bacteria | 60011 |
| 350 | Ga0501038_0000002 | 3300049574 | Bacteria | 330446 |
| 351 | Ga0501038_0000046 | 3300049574 | Bacteria | 106465 |
| 352 | Ga0501039_0000002 | 3300049575 | Bacteria | 375152 |
| 353 | Ga0501039_0000003 | 3300049575 | Bacteria | 357424 |
| 354 | Ga0501040_0002028 | 3300049576 | Bacteria | 13049 |
| 355 | Ga0501040_0099885 | 3300049576 | Bacteria | 2023 |
| 356 | Ga0501043_0000029 | 3300049579 | Bacteria | 143328 |
| 357 | Ga0501043_0000051 | 3300049579 | Bacteria | 106957 |
| 358 | Ga0501043_0001754 | 3300049579 | Bacteria | 18691 |
| 359 | Ga0501043_0072000 | 3300049579 | Bacteria | 2715 |
| 360 | Ga0501046_0164079 | 3300049580 | Bacteria | 1669 |
| 361 | Ga0501046_0215598 | 3300049580 | Bacteria | 1423 |
| 362 | Ga0501047_0000801 | 3300049581 | Bacteria | 32872 |
| 363 | Ga0501047_0052981 | 3300049581 | Bacteria | 3922 |
| 364 | Ga0501047_0060138 | 3300049581 | Bacteria | 3667 |
| 365 | Ga0501047_0268666 | 3300049581 | Bacteria | 1552 |
| 366 | Ga0501048_0197354 | 3300049582 | Bacteria | 1426 |
| 367 | Ga0501069_0000031 | 3300049585 | Bacteria | 97968 |
| 368 | Ga0501069_0143906 | 3300049585 | Bacteria | 1368 |
| 369 | Ga0501070_0000045 | 3300049586 | Bacteria | 107880 |
| 370 | Ga0501070_0011905 | 3300049586 | Bacteria | 7346 |
| 371 | Ga0501070_0075850 | 3300049586 | Bacteria | 2783 |
| 372 | Ga0501071_0002491 | 3300049587 | Bacteria | 11196 |
| 373 | Ga0501073_0046869 | 3300049589 | Bacteria | 3039 |
| 374 | Ga0501073_0318334 | 3300049589 | Bacteria | 1073 |
| 375 | Ga0501074_0000012 | 3300049590 | Bacteria | 83803 |
| 376 | Ga0501074_0032004 | 3300049590 | Bacteria | 3812 |
| 377 | Ga0501074_0118258 | 3300049590 | Bacteria | 1896 |
| 378 | Ga0501076_0111306 | 3300049592 | Bacteria | 2213 |
| 379 | Ga0501079_0128745 | 3300049741 | Bacteria | 1970 |
| 380 | Ga0501080_0004574 | 3300049742 | Bacteria | 12329 |
| 381 | Ga0501080_0008984 | 3300049742 | Bacteria | 9093 |
| 382 | Ga0501080_0159814 | 3300049742 | Bacteria | 2081 |
| 383 | Ga0501083_0000078 | 3300049744 | Bacteria | 65280 |
| 384 | Ga0501083_0060708 | 3300049744 | Bacteria | 2525 |
| 385 | Ga0501083_0216665 | 3300049744 | Bacteria | 1248 |
| 386 | Ga0501280_011254 | 3300049776 | Bacteria | 1250 |
| 387 | Ga0501035_0000022 | 3300049822 | Bacteria | 208622 |
| 388 | Ga0501035_0000102 | 3300049822 | Bacteria | 106915 |
| 389 | Ga0501035_0000950 | 3300049822 | Bacteria | 30620 |
| 390 | Ga0501035_0003111 | 3300049822 | Bacteria | 15940 |
| 391 | Ga0501035_0005408 | 3300049822 | Bacteria | 12072 |
| 392 | Ga0501035_0093191 | 3300049822 | Bacteria | 2650 |
| 393 | Ga0501035_0148745 | 3300049822 | Bacteria | 2033 |
| 394 | Ga0501044_0000002 | 3300049823 | Bacteria | 375152 |
| 395 | Ga0501044_0000113 | 3300049823 | Bacteria | 97940 |
| 396 | Ga0501044_0057809 | 3300049823 | Bacteria | 3979 |
| 397 | Ga0501044_0065523 | 3300049823 | Bacteria | 3705 |
| 398 | Ga0501044_0071517 | 3300049823 | Bacteria | 3527 |
| 399 | Ga0501044_0079931 | 3300049823 | Bacteria | 3312 |
| 400 | Ga0501044_0189940 | 3300049823 | Bacteria | 2017 |
| 401 | Ga0501045_0138904 | 3300049824 | Bacteria | 1807 |
| 402 | Ga0501045_0318137 | 3300049824 | Bacteria | 1158 |
| 403 | nmdc:mga03683_47427_c1 | 3300050489 | Bacteria | 1783 |
| 404 | nmdc:mga03n38_228760_c1 | 3300050490 | Bacteria | 974 |
| 405 | nmdc:mga00v17_3380_c1 | 3300050491 | Bacteria | 8235 |
| 406 | nmdc:mga00v17_591_c1 | 3300050491 | Bacteria | 20204 |
| 407 | nmdc:mga0yw44_13656_c1 | 3300050492 | Bacteria | 4283 |
| 408 | nmdc:mga0yw44_19308_c1 | 3300050492 | Bacteria | 3756 |
| 409 | nmdc:mga0yw44_41468_c1 | 3300050492 | Bacteria | 2364 |
| 410 | nmdc:mga0yw44_756_c1 | 3300050492 | Bacteria | 11985 |
| 411 | nmdc:mga0k408_14695_c1 | 3300050493 | Bacteria | 4319 |
| 412 | nmdc:mga06z11_11622_c1 | 3300050494 | Bacteria | 3804 |
| 413 | nmdc:mga0sz30_299_c1 | 3300050516 | Bacteria | 19018 |
| 414 | Ga0495601_0226625 | 3300053077 | Bacteria | 1221 |
| 415 | Ga0500641_0048969 | 3300053096 | Bacteria | 1732 |
| 416 | Ga0500560_002179 | 3300053107 | Bacteria | 3672 |
| 417 | Ga0500569_048241 | 3300053109 | Bacteria | 1275 |
| 418 | Ga0500572_009295 | 3300053111 | Bacteria | 2321 |
| 419 | Ga0500593_002181 | 3300053117 | Bacteria | 7128 |
| 420 | Ga0500607_132347 | 3300053121 | Bacteria | 1187 |
| 421 | Ga0500608_042476 | 3300053122 | Bacteria | 2182 |
| 422 | Ga0500618_000227 | 3300053125 | Bacteria | 44231 |
| 423 | Ga0500618_005699 | 3300053125 | Bacteria | 3755 |
| 424 | Ga0500618_024443 | 3300053125 | Bacteria | 1455 |
| 425 | Ga0500658_0032453 | 3300053134 | Bacteria | 2048 |
| 426 | Ga0500561_0000742 | 3300053137 | Bacteria | 5173 |
| 427 | Ga0500568_0000001 | 3300053139 | Bacteria | 988705 |
| 428 | Ga0500568_0000143 | 3300053139 | Bacteria | 63442 |
| 429 | Ga0500568_0012950 | 3300053139 | Bacteria | 3817 |
| 430 | Ga0500590_001584 | 3300053148 | Bacteria | 9477 |
| 431 | Ga0500616_0003869 | 3300053153 | Bacteria | 11034 |
| 432 | Ga0500616_0055492 | 3300053153 | Bacteria | 2072 |
| 433 | Ga0500616_0144953 | 3300053153 | Bacteria | 1106 |
| 434 | Ga0500622_0004006 | 3300053156 | Bacteria | 9491 |
| 435 | Ga0500622_0033890 | 3300053156 | Bacteria | 2678 |
| 436 | Ga0500624_003548 | 3300053157 | Bacteria | 2045 |
| 437 | Ga0500634_0000112 | 3300053161 | Bacteria | 30260 |
| 438 | Ga0500636_0000070 | 3300053177 | Bacteria | 50168 |
| 439 | Ga0500636_0031858 | 3300053177 | Bacteria | 3119 |
| 440 | Ga0501084_0162387 | 3300054114 | Bacteria | 1885 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048921 | Ga0496118_0054586 | Ga0496118_0054586_1304_2311 | 275 |
| 2 | 3300050489 | nmdc:mga03683_47427_c1 | nmdc:mga03683_47427_c1_34_888 | 276 |
| 3 | 3300003790 | Ga0055528_1005083 | Ga0055528_10050838 | 278 |
| 4 | 3300053139 | Ga0500568_0000143 | Ga0500568_0000143_4434_5453 | 279 |
| 5 | iso_pu_bacteria | 3004289098 | 3004291408 | 281 |
| 6 | 3300053077 | Ga0495601_0226625 | Ga0495601_0226625_53_997 | 283 |
| 7 | 3300053148 | Ga0500590_001584 | Ga0500590_001584_1078_2022 | 283 |
| 8 | 3300006178 | Ga0075367_10012849 | Ga0075367_100128495 | 284 |
| 9 | 3300046476 | Ga0495662_0006888 | Ga0495662_0006888_3000_3944 | 286 |
| 10 | 3300046477 | Ga0495664_0257039 | Ga0495664_0257039_98_1042 | 286 |
| 11 | 3300046674 | Ga0495588_0037721 | Ga0495588_0037721_905_1849 | 286 |
| 12 | 3300046683 | Ga0495658_0076066 | Ga0495658_0076066_879_1823 | 286 |
| 13 | 3300049744 | Ga0501083_0216665 | Ga0501083_0216665_313_1209 | 286 |
| 14 | 3300053121 | Ga0500607_132347 | Ga0500607_132347_207_1151 | 286 |
| 15 | 3300046474 | Ga0495605_0052384 | Ga0495605_0052384_230_1174 | 288 |
| 16 | 3300046665 | Ga0495661_0087487 | Ga0495661_0087487_704_1648 | 288 |
| 17 | 3300053161 | Ga0500634_0000112 | Ga0500634_0000112_11100_12044 | 288 |
| 18 | 3300053177 | Ga0500636_0000070 | Ga0500636_0000070_6566_7510 | 289 |
| 19 | 3300041413 | Ga0439465_0015848 | Ga0439465_0015848_643_1587 | 291 |
| 20 | iso_pu_bacteria | 3004232784 | 3004237744 | 292 |
| 21 | iso_pu_bacteria | 2690316117 | 2692316815 | 293 |
| 22 | 3300003792 | Ga0055540_1008490 | Ga0055540_10084903 | 294 |
| 23 | 3300025273 | Ga0209673_1011121 | Ga0209673_10111212 | 294 |
| 24 | 3300025292 | Ga0209676_1022064 | Ga0209676_10220642 | 294 |
| 25 | 3300025298 | Ga0209050_1006521 | Ga0209050_10065217 | 294 |
| 26 | 3300025303 | Ga0209051_1000514 | Ga0209051_10005143 | 294 |
| 27 | 3300025304 | Ga0209257_1007417 | Ga0209257_10074177 | 294 |
| 28 | 3300003214 | JGI25165J46597_1008647 | JGI25165J46597_10086472 | 295 |
| 29 | 3300005548 | Ga0070665_100192330 | Ga0070665_1001923302 | 295 |
| 30 | 3300009093 | Ga0105240_10000032 | Ga0105240_10000032212 | 295 |
| 31 | 3300009545 | Ga0105237_10000754 | Ga0105237_1000075423 | 295 |
| 32 | 3300010375 | Ga0105239_10003143 | Ga0105239_1000314315 | 295 |
| 33 | 3300013104 | Ga0157370_10000972 | Ga0157370_1000097220 | 295 |
| 34 | 3300015262 | Ga0182007_10005040 | Ga0182007_100050403 | 295 |
| 35 | 3300015265 | Ga0182005_1012560 | Ga0182005_10125602 | 295 |
| 36 | 3300022739 | Ga0228711_1000001 | Ga0228711_100000162 | 295 |
| 37 | 3300022740 | Ga0228710_1000001 | Ga0228710_1000001263 | 295 |
| 38 | 3300025253 | Ga0209677_101323 | Ga0209677_1013234 | 295 |
| 39 | 3300025261 | Ga0209233_1000209 | Ga0209233_100020967 | 295 |
| 40 | 3300025913 | Ga0207695_10000024 | Ga0207695_10000024213 | 295 |
| 41 | 3300025914 | Ga0207671_10003700 | Ga0207671_1000370013 | 295 |
| 42 | 3300027111 | Ga0209281_1000266 | Ga0209281_100026635 | 295 |
| 43 | 3300027666 | Ga0209282_1000007 | Ga0209282_1000007190 | 295 |
| 44 | 3300031967 | Ga0315914_1000006 | Ga0315914_100000653 | 295 |
| 45 | 3300033430 | Ga0315913_1000002 | Ga0315913_1000002190 | 295 |
| 46 | 3300033464 | Ga0315915_1000001 | Ga0315915_1000001297 | 295 |
| 47 | 3300048919 | Ga0496116_0026294 | Ga0496116_0026294_2203_3147 | 295 |
| 48 | 3300048920 | Ga0496117_0025724 | Ga0496117_0025724_663_1607 | 295 |
| 49 | 3300048921 | Ga0496118_0002790 | Ga0496118_0002790_21267_22211 | 295 |
| 50 | 3300048922 | Ga0496119_0018153 | Ga0496119_0018153_1571_2515 | 295 |
| 51 | 3300048924 | Ga0496121_0005233 | Ga0496121_0005233_15764_16708 | 295 |
| 52 | 3300048925 | Ga0496122_0089662 | Ga0496122_0089662_677_1621 | 295 |
| 53 | 3300048926 | Ga0496123_0085878 | Ga0496123_0085878_366_1310 | 295 |
| 54 | 3300048927 | Ga0496124_0008594 | Ga0496124_0008594_2306_3250 | 295 |
| 55 | 3300048929 | Ga0496126_0210657 | Ga0496126_0210657_71_1015 | 295 |
| 56 | 3300025273 | Ga0209673_1000319 | Ga0209673_10003198 | 296 |
| 57 | 3300025295 | Ga0209564_1004856 | Ga0209564_10048563 | 296 |
| 58 | 3300025299 | Ga0209256_1005095 | Ga0209256_10050952 | 296 |
| 59 | 3300046507 | Ga0495606_0081796 | Ga0495606_0081796_707_1651 | 296 |
| 60 | 3300048920 | Ga0496117_0074025 | Ga0496117_0074025_976_1920 | 296 |
| 61 | 3300048921 | Ga0496118_0003651 | Ga0496118_0003651_12300_13244 | 296 |
| 62 | 3300013105 | Ga0157369_10063657 | Ga0157369_100636571 | 297 |
| 63 | 3300037312 | Ga0395899_0000213 | Ga0395899_0000213_58761_59654 | 297 |
| 64 | 3300037418 | Ga0395900_0000121 | Ga0395900_0000121_110384_111277 | 297 |
| 65 | 3300037466 | Ga0395898_0000247 | Ga0395898_0000247_23750_24643 | 297 |
| 66 | 3300037471 | Ga0395905_0000112 | Ga0395905_0000112_23734_24627 | 297 |
| 67 | 3300038443 | Ga0395901_0000078 | Ga0395901_0000078_110384_111277 | 297 |
| 68 | 3300042147 | Ga0450910_008733 | Ga0450910_008733_520_1416 | 297 |
| 69 | 3300046512 | Ga0495610_0158542 | Ga0495610_0158542_36_932 | 297 |
| 70 | 3300046528 | Ga0495642_0167483 | Ga0495642_0167483_20_916 | 297 |
| 71 | 3300046660 | Ga0495625_0073006 | Ga0495625_0073006_844_1740 | 297 |
| 72 | 3300046675 | Ga0495657_0143833 | Ga0495657_0143833_17_913 | 297 |
| 73 | 3300049568 | Ga0501031_0065131 | Ga0501031_0065131_37_930 | 297 |
| 74 | 3300049569 | Ga0501032_0030787 | Ga0501032_0030787_1931_2824 | 297 |
| 75 | 3300049580 | Ga0501046_0164079 | Ga0501046_0164079_738_1631 | 297 |
| 76 | 3300050490 | nmdc:mga03n38_228760_c1 | nmdc:mga03n38_228760_c1_52_945 | 297 |
| 77 | 3300053125 | Ga0500618_024443 | Ga0500618_024443_530_1426 | 297 |
| 78 | 3300053153 | Ga0500616_0144953 | Ga0500616_0144953_43_939 | 297 |
| 79 | 3300042007 | Ga0439449_0001282 | Ga0439449_0001282_4035_4997 | 299 |
| 80 | iso_pu_bacteria | 2924214083 | 2924218742 | 299 |
| 81 | 3300026067 | Ga0207678_10023512 | Ga0207678_100235125 | 300 |
| 82 | 3300049776 | Ga0501280_011254 | Ga0501280_011254_58_1002 | 300 |
| 83 | 3300006038 | Ga0075365_10001318 | Ga0075365_1000131810 | 301 |
| 84 | 3300009766 | Ga0123342_1031086 | Ga0123342_10310862 | 301 |
| 85 | 3300003771 | Ga0055526_1010667 | Ga0055526_10106671 | 302 |
| 86 | 3300003775 | Ga0055524_1009966 | Ga0055524_10099664 | 302 |
| 87 | 3300003790 | Ga0055528_1023932 | Ga0055528_10239322 | 302 |
| 88 | 3300003856 | Ga0058692_1011160 | Ga0058692_10111601 | 302 |
| 89 | 3300005355 | Ga0070671_100009450 | Ga0070671_1000094504 | 302 |
| 90 | 3300005367 | Ga0070667_100335353 | Ga0070667_1003353532 | 302 |
| 91 | 3300006042 | Ga0075368_10004614 | Ga0075368_100046142 | 302 |
| 92 | 3300006178 | Ga0075367_10115807 | Ga0075367_101158072 | 302 |
| 93 | 3300006186 | Ga0075369_10019091 | Ga0075369_100190912 | 302 |
| 94 | 3300006195 | Ga0075366_10176209 | Ga0075366_101762092 | 302 |
| 95 | 3300006353 | Ga0075370_10204801 | Ga0075370_102048011 | 302 |
| 96 | 3300006948 | Ga0099826_10078772 | Ga0099826_100787723 | 302 |
| 97 | 3300006948 | Ga0099826_10079873 | Ga0099826_100798733 | 302 |
| 98 | 3300009177 | Ga0105248_10093909 | Ga0105248_100939092 | 302 |
| 99 | 3300013102 | Ga0157371_10000073 | Ga0157371_100000733 | 302 |
| 100 | 3300025258 | Ga0209129_1003371 | Ga0209129_10033713 | 302 |
| 101 | 3300025273 | Ga0209673_1009838 | Ga0209673_10098383 | 302 |
| 102 | 3300025294 | Ga0209025_1001440 | Ga0209025_100144032 | 302 |
| 103 | 3300025299 | Ga0209256_1011458 | Ga0209256_10114583 | 302 |
| 104 | 3300025931 | Ga0207644_10067027 | Ga0207644_100670272 | 302 |
| 105 | 3300025941 | Ga0207711_10181472 | Ga0207711_101814722 | 302 |
| 106 | 3300025972 | Ga0207668_10155547 | Ga0207668_101555472 | 302 |
| 107 | 3300025986 | Ga0207658_10310535 | Ga0207658_103105351 | 302 |
| 108 | 3300026067 | Ga0207678_10161027 | Ga0207678_101610272 | 302 |
| 109 | 3300027666 | Ga0209282_1000102 | Ga0209282_100010231 | 302 |
| 110 | 3300030744 | Ga0316181_1097764 | Ga0316181_10977643 | 302 |
| 111 | 3300036647 | Ga0316582_0089496 | Ga0316582_0089496_452_1399 | 302 |
| 112 | 3300048903 | Ga0496100_0230528 | Ga0496100_0230528_169_1113 | 302 |
| 113 | 3300048905 | Ga0496102_0015568 | Ga0496102_0015568_629_1573 | 302 |
| 114 | 3300048907 | Ga0496104_0360796 | Ga0496104_0360796_252_1196 | 302 |
| 115 | 3300048908 | Ga0496105_0055157 | Ga0496105_0055157_903_1847 | 302 |
| 116 | 3300048909 | Ga0496106_0023088 | Ga0496106_0023088_127_1071 | 302 |
| 117 | 3300048911 | Ga0496108_0178435 | Ga0496108_0178435_508_1452 | 302 |
| 118 | 3300048912 | Ga0496109_0299691 | Ga0496109_0299691_299_1243 | 302 |
| 119 | 3300048913 | Ga0496110_0138134 | Ga0496110_0138134_1116_2060 | 302 |
| 120 | 3300048914 | Ga0496111_0146862 | Ga0496111_0146862_22_966 | 302 |
| 121 | 3300048915 | Ga0496112_0190380 | Ga0496112_0190380_687_1631 | 302 |
| 122 | 3300048915 | Ga0496112_0360785 | Ga0496112_0360785_402_1346 | 302 |
| 123 | 3300048916 | Ga0496113_0198265 | Ga0496113_0198265_428_1372 | 302 |
| 124 | 3300048917 | Ga0496114_0257392 | Ga0496114_0257392_157_1101 | 302 |
| 125 | 3300048919 | Ga0496116_0017649 | Ga0496116_0017649_3554_4498 | 302 |
| 126 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_1487402_1488346 | 302 |
| 127 | 3300048921 | Ga0496118_0000214 | Ga0496118_0000214_60644_61588 | 302 |
| 128 | 3300048922 | Ga0496119_0013733 | Ga0496119_0013733_1100_2044 | 302 |
| 129 | 3300048922 | Ga0496119_0016653 | Ga0496119_0016653_772_1767 | 302 |
| 130 | 3300048923 | Ga0496120_0000125 | Ga0496120_0000125_56049_56993 | 302 |
| 131 | 3300048924 | Ga0496121_0024937 | Ga0496121_0024937_3526_4470 | 302 |
| 132 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_858191_859135 | 302 |
| 133 | 3300048925 | Ga0496122_0024031 | Ga0496122_0024031_863_1807 | 302 |
| 134 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_861922_862866 | 302 |
| 135 | 3300048926 | Ga0496123_0112713 | Ga0496123_0112713_456_1400 | 302 |
| 136 | 3300048929 | Ga0496126_0154530 | Ga0496126_0154530_877_1821 | 302 |
| 137 | 3300050493 | nmdc:mga0k408_14695_c1 | nmdc:mga0k408_14695_c1_3131_4126 | 302 |
| 138 | 3300050494 | nmdc:mga06z11_11622_c1 | nmdc:mga06z11_11622_c1_1896_2891 | 302 |
| 139 | 3300025284 | Ga0209130_1011895 | Ga0209130_10118951 | 303 |
| 140 | 3300048920 | Ga0496117_0047076 | Ga0496117_0047076_1736_2725 | 303 |
| 141 | 3300003775 | Ga0055524_1006936 | Ga0055524_10069364 | 306 |
| 142 | 3300013100 | Ga0157373_10002216 | Ga0157373_100022166 | 306 |
| 143 | 3300025299 | Ga0209256_1000994 | Ga0209256_100099412 | 306 |
| 144 | 3300048927 | Ga0496124_0032626 | Ga0496124_0032626_2899_3843 | 306 |
| 145 | 3300050491 | nmdc:mga00v17_591_c1 | nmdc:mga00v17_591_c1_7181_8125 | 306 |
| 146 | 3300050492 | nmdc:mga0yw44_756_c1 | nmdc:mga0yw44_756_c1_2317_3261 | 306 |
| 147 | 3300050516 | nmdc:mga0sz30_299_c1 | nmdc:mga0sz30_299_c1_11104_12048 | 306 |
| 148 | 3300053137 | Ga0500561_0000742 | Ga0500561_0000742_514_1509 | 306 |
| 149 | 3300049579 | Ga0501043_0072000 | Ga0501043_0072000_1618_2559 | 307 |
| 150 | 3300049581 | Ga0501047_0052981 | Ga0501047_0052981_1095_2036 | 307 |
| 151 | 3300049586 | Ga0501070_0011905 | Ga0501070_0011905_5312_6253 | 307 |
| 152 | 3300049589 | Ga0501073_0046869 | Ga0501073_0046869_1004_1945 | 307 |
| 153 | 3300049590 | Ga0501074_0032004 | Ga0501074_0032004_2050_2991 | 307 |
| 154 | 3300049742 | Ga0501080_0008984 | Ga0501080_0008984_6985_7926 | 307 |
| 155 | 3300049822 | Ga0501035_0005408 | Ga0501035_0005408_1111_2052 | 307 |
| 156 | 3300049823 | Ga0501044_0071517 | Ga0501044_0071517_1702_2643 | 307 |
| 157 | iso_pu_bacteria | 2757320392 | 2757570806 | 308 |
| 158 | 3300053117 | Ga0500593_002181 | Ga0500593_002181_1442_2374 | 309 |
| 159 | 3300053139 | Ga0500568_0000001 | Ga0500568_0000001_323750_324682 | 309 |
| 160 | iso_pu_bacteria | 2508501122 | 2509108528 | 309 |
| 161 | iso_pu_bacteria | 2509276018 | 2509371839 | 309 |
| 162 | iso_pu_bacteria | 2509276019 | 2509374446 | 309 |
| 163 | iso_pu_bacteria | 2509276021 | 2509387712 | 309 |
| 164 | iso_pu_bacteria | 2509276033 | 2509443071 | 309 |
| 165 | iso_pu_bacteria | 2510065019 | 2510132301 | 309 |
| 166 | iso_pu_bacteria | 2510065057 | 2510307236 | 309 |
| 167 | iso_pu_bacteria | 2510065059 | 2510318988 | 309 |
| 168 | iso_pu_bacteria | 2510461069 | 2510839685 | 309 |
| 169 | iso_pu_bacteria | 2510461076 | 2510898640 | 309 |
| 170 | iso_pu_bacteria | 2510917022 | 2511137034 | 309 |
| 171 | iso_pu_bacteria | 2510917028 | 2511186366 | 309 |
| 172 | iso_pu_bacteria | 2510917030 | 2511197191 | 309 |
| 173 | iso_pu_bacteria | 2511231027 | 2511392637 | 309 |
| 174 | iso_pu_bacteria | 2511231052 | 2511501028 | 309 |
| 175 | iso_pu_bacteria | 2512875026 | 2512972233 | 309 |
| 176 | iso_pu_bacteria | 2513237084 | 2513569139 | 309 |
| 177 | iso_pu_bacteria | 2513237085 | 2513578809 | 309 |
| 178 | iso_pu_bacteria | 2513237086 | 2513586964 | 309 |
| 179 | iso_pu_bacteria | 2513237088 | 2513596256 | 309 |
| 180 | iso_pu_bacteria | 2513237089 | 2513603312 | 309 |
| 181 | iso_pu_bacteria | 2513237091 | 2513618959 | 309 |
| 182 | iso_pu_bacteria | 2513237093 | 2513632753 | 309 |
| 183 | iso_pu_bacteria | 2513237103 | 2513709204 | 309 |
| 184 | iso_pu_bacteria | 2513237138 | 2513868776 | 309 |
| 185 | iso_pu_bacteria | 2513237140 | 2513881083 | 309 |
| 186 | iso_pu_bacteria | 2513237143 | 2513902319 | 309 |
| 187 | iso_pu_bacteria | 2513237144 | 2513907518 | 309 |
| 188 | iso_pu_bacteria | 2513237146 | 2513925710 | 309 |
| 189 | iso_pu_bacteria | 2513237156 | 2513983918 | 309 |
| 190 | iso_pu_bacteria | 2513237160 | 2514004767 | 309 |
| 191 | iso_pu_bacteria | 2513237162 | 2514020749 | 309 |
| 192 | iso_pu_bacteria | 2515075009 | 2515111286 | 309 |
| 193 | iso_pu_bacteria | 2515154107 | 2515608140 | 309 |
| 194 | iso_pu_bacteria | 2515154113 | 2515637834 | 309 |
| 195 | iso_pu_bacteria | 2515154114 | 2515642580 | 309 |
| 196 | iso_pu_bacteria | 2515154116 | 2515659189 | 309 |
| 197 | iso_pu_bacteria | 2515154134 | 2515740466 | 309 |
| 198 | iso_pu_bacteria | 2516143018 | 2516208891 | 309 |
| 199 | iso_pu_bacteria | 2516653046 | 2516892310 | 309 |
| 200 | iso_pu_bacteria | 2516653077 | 2517039926 | 309 |
| 201 | iso_pu_bacteria | 2516653085 | 2517075471 | 309 |
| 202 | iso_pu_bacteria | 2517093000 | 2517094058 | 309 |
| 203 | iso_pu_bacteria | 2517287029 | 2517405878 | 309 |
| 204 | iso_pu_bacteria | 2517487022 | 2517569101 | 309 |
| 205 | iso_pu_bacteria | 2519899620 | 2520375271 | 309 |
| 206 | iso_pu_bacteria | 2524023207 | 2524451122 | 309 |
| 207 | iso_pu_bacteria | 2524023209 | 2524460643 | 309 |
| 208 | iso_pu_bacteria | 2529292951 | 2530643889 | 309 |
| 209 | iso_pu_bacteria | 2534681786 | 2535484219 | 309 |
| 210 | iso_pu_bacteria | 2534681796 | 2535515725 | 309 |
| 211 | iso_pu_bacteria | 2537561587 | 2537874085 | 309 |
| 212 | iso_pu_bacteria | 2551306084 | 2551680900 | 309 |
| 213 | iso_pu_bacteria | 2551306085 | 2551684082 | 309 |
| 214 | iso_pu_bacteria | 2551306086 | 2551695739 | 309 |
| 215 | iso_pu_bacteria | 2551306087 | 2551702991 | 309 |
| 216 | iso_pu_bacteria | 2551306089 | 2551708474 | 309 |
| 217 | iso_pu_bacteria | 2551306090 | 2551724087 | 309 |
| 218 | iso_pu_bacteria | 2551306091 | 2551729769 | 309 |
| 219 | iso_pu_bacteria | 2551306092 | 2551739216 | 309 |
| 220 | iso_pu_bacteria | 2551306093 | 2551742896 | 309 |
| 221 | iso_pu_bacteria | 2554235003 | 2554247118 | 309 |
| 222 | iso_pu_bacteria | 2558860100 | 2558863474 | 309 |
| 223 | iso_pu_bacteria | 2558860242 | 2559294342 | 309 |
| 224 | iso_pu_bacteria | 2558860983 | 2561466064 | 309 |
| 225 | iso_pu_bacteria | 2582581283 | 2585165562 | 309 |
| 226 | iso_pu_bacteria | 2582581294 | 2585203085 | 309 |
| 227 | iso_pu_bacteria | 2582581298 | 2585220998 | 309 |
| 228 | iso_pu_bacteria | 2582581299 | 2585231488 | 309 |
| 229 | iso_pu_bacteria | 2582581306 | 2585266157 | 309 |
| 230 | iso_pu_bacteria | 2582581307 | 2585273256 | 309 |
| 231 | iso_pu_bacteria | 2582581308 | 2585278910 | 309 |
| 232 | iso_pu_bacteria | 2582581315 | 2585325476 | 309 |
| 233 | iso_pu_bacteria | 2582581316 | 2585329633 | 309 |
| 234 | iso_pu_bacteria | 2582581865 | 2585387159 | 309 |
| 235 | iso_pu_bacteria | 2582581866 | 2585392726 | 309 |
| 236 | iso_pu_bacteria | 2582581867 | 2585400117 | 309 |
| 237 | iso_pu_bacteria | 2585427526 | 2585527967 | 309 |
| 238 | iso_pu_bacteria | 2585427527 | 2585530707 | 309 |
| 239 | iso_pu_bacteria | 2585427529 | 2585549902 | 309 |
| 240 | iso_pu_bacteria | 2585427530 | 2585554887 | 309 |
| 241 | iso_pu_bacteria | 2585427531 | 2585559444 | 309 |
| 242 | iso_pu_bacteria | 2585427590 | 2585822676 | 309 |
| 243 | iso_pu_bacteria | 2585427594 | 2585847211 | 309 |
| 244 | iso_pu_bacteria | 2585427608 | 2585902115 | 309 |
| 245 | iso_pu_bacteria | 2585427609 | 2585905180 | 309 |
| 246 | iso_pu_bacteria | 2585428125 | 2587979705 | 309 |
| 247 | iso_pu_bacteria | 2599185156 | 2599333761 | 309 |
| 248 | iso_pu_bacteria | 2599185170 | 2599418587 | 309 |
| 249 | iso_pu_bacteria | 2599185210 | 2599602593 | 309 |
| 250 | iso_pu_bacteria | 2599185301 | 2599940415 | 309 |
| 251 | iso_pu_bacteria | 2599185352 | 2600191944 | 309 |
| 252 | iso_pu_bacteria | 2600255279 | 2601608673 | 309 |
| 253 | iso_pu_bacteria | 2600255308 | 2601745447 | 309 |
| 254 | iso_pu_bacteria | 2615840624 | 2616296209 | 309 |
| 255 | iso_pu_bacteria | 2615840626 | 2616305817 | 309 |
| 256 | iso_pu_bacteria | 2615840698 | 2616553941 | 309 |
| 257 | iso_pu_bacteria | 2617270742 | 2617383865 | 309 |
| 258 | iso_pu_bacteria | 2643221550 | 2643773611 | 309 |
| 259 | iso_pu_bacteria | 2643221557 | 2643807191 | 309 |
| 260 | iso_pu_bacteria | 2643221558 | 2643810001 | 309 |
| 261 | iso_pu_bacteria | 2643221564 | 2643837786 | 309 |
| 262 | iso_pu_bacteria | 2643221568 | 2643855863 | 309 |
| 263 | iso_pu_bacteria | 2643221582 | 2643918716 | 309 |
| 264 | iso_pu_bacteria | 2643221599 | 2644007932 | 309 |
| 265 | iso_pu_bacteria | 2643221607 | 2644046563 | 309 |
| 266 | iso_pu_bacteria | 2643221610 | 2644069543 | 309 |
| 267 | iso_pu_bacteria | 2643221618 | 2644108981 | 309 |
| 268 | iso_pu_bacteria | 2643221623 | 2644132921 | 309 |
| 269 | iso_pu_bacteria | 2643221626 | 2644151503 | 309 |
| 270 | iso_pu_bacteria | 2643221634 | 2644196521 | 309 |
| 271 | iso_pu_bacteria | 2643221636 | 2644202269 | 309 |
| 272 | iso_pu_bacteria | 2643221637 | 2644206191 | 309 |
| 273 | iso_pu_bacteria | 2643221643 | 2644242889 | 309 |
| 274 | iso_pu_bacteria | 2643221653 | 2644296826 | 309 |
| 275 | iso_pu_bacteria | 2643221655 | 2644311637 | 309 |
| 276 | iso_pu_bacteria | 2643221659 | 2644329895 | 309 |
| 277 | iso_pu_bacteria | 2643221668 | 2644380573 | 309 |
| 278 | iso_pu_bacteria | 2643221675 | 2644420697 | 309 |
| 279 | iso_pu_bacteria | 2643221680 | 2644454222 | 309 |
| 280 | iso_pu_bacteria | 2643221686 | 2644479353 | 309 |
| 281 | iso_pu_bacteria | 2643221688 | 2644493386 | 309 |
| 282 | iso_pu_bacteria | 2643221689 | 2644502396 | 309 |
| 283 | iso_pu_bacteria | 2643221693 | 2644518740 | 309 |
| 284 | iso_pu_bacteria | 2643221698 | 2644546569 | 309 |
| 285 | iso_pu_bacteria | 2643221712 | 2644617436 | 309 |
| 286 | iso_pu_bacteria | 2643221718 | 2644649838 | 309 |
| 287 | iso_pu_bacteria | 2643221719 | 2644655080 | 309 |
| 288 | iso_pu_bacteria | 2643221723 | 2644675639 | 309 |
| 289 | iso_pu_bacteria | 2643221726 | 2644689559 | 309 |
| 290 | iso_pu_bacteria | 2657244999 | 2657683251 | 309 |
| 291 | iso_pu_bacteria | 2667528174 | 2671115304 | 309 |
| 292 | iso_pu_bacteria | 2687453392 | 2688600139 | 309 |
| 293 | iso_pu_bacteria | 2718217927 | 2719384863 | 309 |
| 294 | iso_pu_bacteria | 2718217997 | 2719664618 | 309 |
| 295 | iso_pu_bacteria | 2718218199 | 2720491038 | 309 |
| 296 | iso_pu_bacteria | 2718218232 | 2720612400 | 309 |
| 297 | iso_pu_bacteria | 2718218233 | 2720619239 | 309 |
| 298 | iso_pu_bacteria | 2718218235 | 2720630639 | 309 |
| 299 | iso_pu_bacteria | 2718218269 | 2720774332 | 309 |
| 300 | iso_pu_bacteria | 2718218423 | 2721398583 | 309 |
| 301 | iso_pu_bacteria | 2721755556 | 2723026059 | 309 |
| 302 | iso_pu_bacteria | 2721755684 | 2723559604 | 309 |
| 303 | iso_pu_bacteria | 2721755685 | 2723566220 | 309 |
| 304 | iso_pu_bacteria | 2721755809 | 2724037396 | 309 |
| 305 | iso_pu_bacteria | 2721755819 | 2724088939 | 309 |
| 306 | iso_pu_bacteria | 2721755822 | 2724103485 | 309 |
| 307 | iso_pu_bacteria | 2721755823 | 2724109331 | 309 |
| 308 | iso_pu_bacteria | 2728369352 | 2730106995 | 309 |
| 309 | iso_pu_bacteria | 2738541293 | 2738802168 | 309 |
| 310 | iso_pu_bacteria | 2738541317 | 2738946538 | 309 |
| 311 | iso_pu_bacteria | 2738541333 | 2739035899 | 309 |
| 312 | iso_pu_bacteria | 2751185800 | 2753358810 | 309 |
| 313 | iso_pu_bacteria | 2751185821 | 2753460819 | 309 |
| 314 | iso_pu_bacteria | 2758568016 | 2758641044 | 309 |
| 315 | iso_pu_bacteria | 2775506902 | 2776271942 | 309 |
| 316 | iso_pu_bacteria | 2775506904 | 2776279541 | 309 |
| 317 | iso_pu_bacteria | 2775507049 | 2776912780 | 309 |
| 318 | iso_pu_bacteria | 2775507266 | 2778177491 | 309 |
| 319 | iso_pu_bacteria | 2791355082 | 2792584176 | 309 |
| 320 | iso_pu_bacteria | 2791355091 | 2792622673 | 309 |
| 321 | iso_pu_bacteria | 2791355092 | 2792628406 | 309 |
| 322 | iso_pu_bacteria | 2791355253 | 2793282315 | 309 |
| 323 | iso_pu_bacteria | 2791355256 | 2793296201 | 309 |
| 324 | iso_pu_bacteria | 2791355259 | 2793317527 | 309 |
| 325 | iso_pu_bacteria | 2791355261 | 2793327127 | 309 |
| 326 | iso_pu_bacteria | 2791355262 | 2793333616 | 309 |
| 327 | iso_pu_bacteria | 2791355264 | 2793347937 | 309 |
| 328 | iso_pu_bacteria | 2791355265 | 2793353575 | 309 |
| 329 | iso_pu_bacteria | 2791355267 | 2793367852 | 309 |
| 330 | iso_pu_bacteria | 2802428858 | 2802717745 | 309 |
| 331 | iso_pu_bacteria | 2802428859 | 2802723327 | 309 |
| 332 | iso_pu_bacteria | 2802428860 | 2802733189 | 309 |
| 333 | iso_pu_bacteria | 2802428861 | 2802736229 | 309 |
| 334 | iso_pu_bacteria | 2802428862 | 2802743561 | 309 |
| 335 | iso_pu_bacteria | 2802428863 | 2802750726 | 309 |
| 336 | iso_pu_bacteria | 2802429268 | 2804751360 | 309 |
| 337 | iso_pu_bacteria | 2802429605 | 2805926576 | 309 |
| 338 | iso_pu_bacteria | 2802429633 | 2806046922 | 309 |
| 339 | iso_pu_bacteria | 2802429634 | 2806052505 | 309 |
| 340 | iso_pu_bacteria | 2802429635 | 2806058724 | 309 |
| 341 | iso_pu_bacteria | 2802429636 | 2806067508 | 309 |
| 342 | iso_pu_bacteria | 2802429637 | 2806073987 | 309 |
| 343 | iso_pu_bacteria | 2808606387 | 2808985885 | 309 |
| 344 | iso_pu_bacteria | 2818991272 | 2819242538 | 309 |
| 345 | iso_pu_bacteria | 2818991439 | 2819556004 | 309 |
| 346 | iso_pu_bacteria | 2818991448 | 2819612205 | 309 |
| 347 | iso_pu_bacteria | 2818991453 | 2819639246 | 309 |
| 348 | iso_pu_bacteria | 2818991461 | 2819684111 | 309 |
| 349 | iso_pu_bacteria | 2821123053 | 2821124283 | 309 |
| 350 | iso_pu_bacteria | 2838016132 | 2838017288 | 309 |
| 351 | iso_pu_bacteria | 2838022645 | 2838023156 | 309 |
| 352 | iso_pu_bacteria | 2838029111 | 2838031429 | 309 |
| 353 | iso_pu_bacteria | 2838035591 | 2838037718 | 309 |
| 354 | iso_pu_bacteria | 2838042994 | 2838047982 | 309 |
| 355 | iso_pu_bacteria | 2838048938 | 2838049228 | 309 |
| 356 | iso_pu_bacteria | 2838061910 | 2838063326 | 309 |
| 357 | iso_pu_bacteria | 2838068647 | 2838074152 | 309 |
| 358 | iso_pu_bacteria | 2838074704 | 2838076453 | 309 |
| 359 | iso_pu_bacteria | 2838661181 | 2838662730 | 309 |
| 360 | iso_pu_bacteria | 2838668709 | 2838670848 | 309 |
| 361 | iso_pu_bacteria | 2838675328 | 2838676730 | 309 |
| 362 | iso_pu_bacteria | 2838680041 | 2838681342 | 309 |
| 363 | iso_pu_bacteria | 2838686498 | 2838688613 | 309 |
| 364 | iso_pu_bacteria | 2838694306 | 2838694623 | 309 |
| 365 | iso_pu_bacteria | 2838701080 | 2838703219 | 309 |
| 366 | iso_pu_bacteria | 2838707686 | 2838708001 | 309 |
| 367 | iso_pu_bacteria | 2838714209 | 2838715614 | 309 |
| 368 | iso_pu_bacteria | 2838719591 | 2838720586 | 309 |
| 369 | iso_pu_bacteria | 2838724970 | 2838726370 | 309 |
| 370 | iso_pu_bacteria | 2838729681 | 2838730908 | 309 |
| 371 | iso_pu_bacteria | 2838736955 | 2838741224 | 309 |
| 372 | iso_pu_bacteria | 2838742623 | 2838744198 | 309 |
| 373 | iso_pu_bacteria | 2839993093 | 2839995891 | 309 |
| 374 | iso_pu_bacteria | 2840764183 | 2840769677 | 309 |
| 375 | iso_pu_bacteria | 2841840854 | 2841844879 | 309 |
| 376 | iso_pu_bacteria | 2841846520 | 2841847521 | 309 |
| 377 | iso_pu_bacteria | 2841851746 | 2841856879 | 309 |
| 378 | iso_pu_bacteria | 2841859092 | 2841859943 | 309 |
| 379 | iso_pu_bacteria | 2841864319 | 2841865472 | 309 |
| 380 | iso_pu_bacteria | 2842077413 | 2842080768 | 309 |
| 381 | iso_pu_bacteria | 2842110456 | 2842114977 | 309 |
| 382 | iso_pu_bacteria | 2842118031 | 2842121387 | 309 |
| 383 | iso_pu_bacteria | 2842124991 | 2842126449 | 309 |
| 384 | iso_pu_bacteria | 2842130223 | 2842131623 | 309 |
| 385 | iso_pu_bacteria | 2842140634 | 2842144601 | 309 |
| 386 | iso_pu_bacteria | 2842146304 | 2842147557 | 309 |
| 387 | iso_pu_bacteria | 2842152218 | 2842153208 | 309 |
| 388 | iso_pu_bacteria | 2842156927 | 2842160049 | 309 |
| 389 | iso_pu_bacteria | 2842163707 | 2842168292 | 309 |
| 390 | iso_pu_bacteria | 2842170452 | 2842171857 | 309 |
| 391 | iso_pu_bacteria | 2842175837 | 2842176827 | 309 |
| 392 | iso_pu_bacteria | 2842180545 | 2842183334 | 309 |
| 393 | iso_pu_bacteria | 2842187318 | 2842188722 | 309 |
| 394 | iso_pu_bacteria | 2842192696 | 2842197951 | 309 |
| 395 | iso_pu_bacteria | 2842198810 | 2842199584 | 309 |
| 396 | iso_pu_bacteria | 2842205361 | 2842207696 | 309 |
| 397 | iso_pu_bacteria | 2842211629 | 2842213033 | 309 |
| 398 | iso_pu_bacteria | 2842217011 | 2842221204 | 309 |
| 399 | iso_pu_bacteria | 2842224351 | 2842225348 | 309 |
| 400 | iso_pu_bacteria | 2842229732 | 2842235065 | 309 |
| 401 | iso_pu_bacteria | 2842237096 | 2842237412 | 309 |
| 402 | iso_pu_bacteria | 2842243621 | 2842245662 | 309 |
| 403 | iso_pu_bacteria | 2842250916 | 2842252623 | 309 |
| 404 | iso_pu_bacteria | 2842257432 | 2842259688 | 309 |
| 405 | iso_pu_bacteria | 2842264693 | 2842266927 | 309 |
| 406 | iso_pu_bacteria | 2842271015 | 2842274527 | 309 |
| 407 | iso_pu_bacteria | 2842278818 | 2842281509 | 309 |
| 408 | iso_pu_bacteria | 2842285085 | 2842287116 | 309 |
| 409 | iso_pu_bacteria | 2842291075 | 2842294424 | 309 |
| 410 | iso_pu_bacteria | 2842298080 | 2842302447 | 309 |
| 411 | iso_pu_bacteria | 2842304105 | 2842306771 | 309 |
| 412 | iso_pu_bacteria | 2842311132 | 2842314747 | 309 |
| 413 | iso_pu_bacteria | 2842317721 | 2842318650 | 309 |
| 414 | iso_pu_bacteria | 2842341865 | 2842343591 | 309 |
| 415 | iso_pu_bacteria | 2842357229 | 2842360820 | 309 |
| 416 | iso_pu_bacteria | 2842363717 | 2842365252 | 309 |
| 417 | iso_pu_bacteria | 2842370503 | 2842371805 | 309 |
| 418 | iso_pu_bacteria | 2842377471 | 2842380822 | 309 |
| 419 | iso_pu_bacteria | 2842384541 | 2842387893 | 309 |
| 420 | iso_pu_bacteria | 2842395702 | 2842398264 | 309 |
| 421 | iso_pu_bacteria | 2842402390 | 2842404384 | 309 |
| 422 | iso_pu_bacteria | 2842409023 | 2842410931 | 309 |
| 423 | iso_pu_bacteria | 2842415677 | 2842417613 | 309 |
| 424 | iso_pu_bacteria | 2842422224 | 2842427357 | 309 |
| 425 | iso_pu_bacteria | 2842428310 | 2842431058 | 309 |
| 426 | iso_pu_bacteria | 2842434925 | 2842436944 | 309 |
| 427 | iso_pu_bacteria | 2842441272 | 2842443022 | 309 |
| 428 | iso_pu_bacteria | 2842447887 | 2842453244 | 309 |
| 429 | iso_pu_bacteria | 2842462802 | 2842465033 | 309 |
| 430 | iso_pu_bacteria | 2842469257 | 2842471741 | 309 |
| 431 | iso_pu_bacteria | 2842475841 | 2842477976 | 309 |
| 432 | iso_pu_bacteria | 2842482326 | 2842482856 | 309 |
| 433 | iso_pu_bacteria | 2842489311 | 2842493758 | 309 |
| 434 | iso_pu_bacteria | 2842495871 | 2842497285 | 309 |
| 435 | iso_pu_bacteria | 2842502639 | 2842504785 | 309 |
| 436 | iso_pu_bacteria | 2842509118 | 2842509731 | 309 |
| 437 | iso_pu_bacteria | 2842515876 | 2842516728 | 309 |
| 438 | iso_pu_bacteria | 2842521101 | 2842526337 | 309 |
| 439 | iso_pu_bacteria | 2842871566 | 2842874501 | 309 |
| 440 | iso_pu_bacteria | 2842922631 | 2842924801 | 309 |
| 441 | iso_pu_bacteria | 2844009547 | 2844015452 | 309 |
| 442 | iso_pu_bacteria | 2844163670 | 2844168506 | 309 |
| 443 | iso_pu_bacteria | 2844454524 | 2844455129 | 309 |
| 444 | iso_pu_bacteria | 2847417321 | 2847418120 | 309 |
| 445 | iso_pu_bacteria | 2848992105 | 2848993095 | 309 |
| 446 | iso_pu_bacteria | 2850079185 | 2850080488 | 309 |
| 447 | iso_pu_bacteria | 2852387548 | 2852389077 | 309 |
| 448 | iso_pu_bacteria | 2854896431 | 2854897184 | 309 |
| 449 | iso_pu_bacteria | 2854911287 | 2854914386 | 309 |
| 450 | iso_pu_bacteria | 2854916844 | 2854918195 | 309 |
| 451 | iso_pu_bacteria | 2855825444 | 2855831380 | 309 |
| 452 | iso_pu_bacteria | 2855839649 | 2855840506 | 309 |
| 453 | iso_pu_bacteria | 2855872281 | 2855876374 | 309 |
| 454 | iso_pu_bacteria | 2856320880 | 2856324401 | 309 |
| 455 | iso_pu_bacteria | 2856328259 | 2856333394 | 309 |
| 456 | iso_pu_bacteria | 2856334872 | 2856335704 | 309 |
| 457 | iso_pu_bacteria | 2857367948 | 2857375525 | 309 |
| 458 | iso_pu_bacteria | 2857516855 | 2857520291 | 309 |
| 459 | iso_pu_bacteria | 2857531043 | 2857531863 | 309 |
| 460 | iso_pu_bacteria | 2858800743 | 2858801034 | 309 |
| 461 | iso_pu_bacteria | 2869169390 | 2869171478 | 309 |
| 462 | iso_pu_bacteria | 2869242130 | 2869245745 | 309 |
| 463 | iso_pu_bacteria | 2869249662 | 2869256476 | 309 |
| 464 | iso_pu_bacteria | 2869256925 | 2869260177 | 309 |
| 465 | iso_pu_bacteria | 2869264136 | 2869264442 | 309 |
| 466 | iso_pu_bacteria | 2869271264 | 2869276520 | 309 |
| 467 | iso_pu_bacteria | 2869278585 | 2869281601 | 309 |
| 468 | iso_pu_bacteria | 2871435913 | 2871440443 | 309 |
| 469 | iso_pu_bacteria | 2871451962 | 2871458377 | 309 |
| 470 | iso_pu_bacteria | 2871459585 | 2871462204 | 309 |
| 471 | iso_pu_bacteria | 2874116593 | 2874121573 | 309 |
| 472 | iso_pu_bacteria | 2874131515 | 2874132706 | 309 |
| 473 | iso_pu_bacteria | 2874139085 | 2874140735 | 309 |
| 474 | iso_pu_bacteria | 2874162495 | 2874163476 | 309 |
| 475 | iso_pu_bacteria | 2876386047 | 2876389061 | 309 |
| 476 | iso_pu_bacteria | 2876399893 | 2876406252 | 309 |
| 477 | iso_pu_bacteria | 2876406927 | 2876411925 | 309 |
| 478 | iso_pu_bacteria | 2876420981 | 2876425170 | 309 |
| 479 | iso_pu_bacteria | 2878738818 | 2878742516 | 309 |
| 480 | iso_pu_bacteria | 2878774303 | 2878775924 | 309 |
| 481 | iso_pu_bacteria | 2878781027 | 2878783501 | 309 |
| 482 | iso_pu_bacteria | 2888337043 | 2888341315 | 309 |
| 483 | iso_pu_bacteria | 2889790730 | 2889794254 | 309 |
| 484 | iso_pu_bacteria | 2889914905 | 2889916789 | 309 |
| 485 | iso_pu_bacteria | 2891048133 | 2891051631 | 309 |
| 486 | iso_pu_bacteria | 2891373044 | 2891374681 | 309 |
| 487 | iso_pu_bacteria | 2894652903 | 2894654872 | 309 |
| 488 | iso_pu_bacteria | 2896384573 | 2896386652 | 309 |
| 489 | iso_pu_bacteria | 2899792073 | 2899796610 | 309 |
| 490 | iso_pu_bacteria | 2899803654 | 2899803781 | 309 |
| 491 | iso_pu_bacteria | 2899845264 | 2899847129 | 309 |
| 492 | iso_pu_bacteria | 2903513507 | 2903514434 | 309 |
| 493 | iso_pu_bacteria | 2904578770 | 2904581374 | 309 |
| 494 | iso_pu_bacteria | 2906363423 | 2906365542 | 309 |
| 495 | iso_pu_bacteria | 2906370794 | 2906374091 | 309 |
| 496 | iso_pu_bacteria | 2906386501 | 2906389493 | 309 |
| 497 | iso_pu_bacteria | 2906393657 | 2906394262 | 309 |
| 498 | iso_pu_bacteria | 2906401398 | 2906407898 | 309 |
| 499 | iso_pu_bacteria | 2906408224 | 2906411693 | 309 |
| 500 | iso_pu_bacteria | 2913295892 | 2913297432 | 309 |
| 501 | iso_pu_bacteria | 2913308742 | 2913310955 | 309 |
| 502 | iso_pu_bacteria | 2915650412 | 2915651269 | 309 |
| 503 | iso_pu_bacteria | 2915980308 | 2915986225 | 309 |
| 504 | iso_pu_bacteria | 2915986958 | 2915991194 | 309 |
| 505 | iso_pu_bacteria | 2915993759 | 2915996201 | 309 |
| 506 | iso_pu_bacteria | 2916000859 | 2916001226 | 309 |
| 507 | iso_pu_bacteria | 2916007675 | 2916013281 | 309 |
| 508 | iso_pu_bacteria | 2916014648 | 2916020474 | 309 |
| 509 | iso_pu_bacteria | 2916021584 | 2916027229 | 309 |
| 510 | iso_pu_bacteria | 2916028427 | 2916033801 | 309 |
| 511 | iso_pu_bacteria | 2916035215 | 2916040301 | 309 |
| 512 | iso_pu_bacteria | 2916041962 | 2916047659 | 309 |
| 513 | iso_pu_bacteria | 2916048683 | 2916052523 | 309 |
| 514 | iso_pu_bacteria | 2916055098 | 2916055300 | 309 |
| 515 | iso_pu_bacteria | 2916061851 | 2916062875 | 309 |
| 516 | iso_pu_bacteria | 2916068649 | 2916069406 | 309 |
| 517 | iso_pu_bacteria | 2916076590 | 2916077517 | 309 |
| 518 | iso_pu_bacteria | 2919100787 | 2919103835 | 309 |
| 519 | iso_pu_bacteria | 2919114240 | 2919115816 | 309 |
| 520 | iso_pu_bacteria | 2919119836 | 2919122610 | 309 |
| 521 | iso_pu_bacteria | 2919166419 | 2919167371 | 309 |
| 522 | iso_pu_bacteria | 2919408235 | 2919409311 | 309 |
| 523 | iso_pu_bacteria | 2920760137 | 2920762863 | 309 |
| 524 | iso_pu_bacteria | 2920822456 | 2920823854 | 309 |
| 525 | iso_pu_bacteria | 2921201388 | 2921202234 | 309 |
| 526 | iso_pu_bacteria | 2921208531 | 2921214014 | 309 |
| 527 | iso_pu_bacteria | 2921237296 | 2921240088 | 309 |
| 528 | iso_pu_bacteria | 2921244191 | 2921248355 | 309 |
| 529 | iso_pu_bacteria | 2921250672 | 2921251006 | 309 |
| 530 | iso_pu_bacteria | 2921257292 | 2921262508 | 309 |
| 531 | iso_pu_bacteria | 2921263974 | 2921264177 | 309 |
| 532 | iso_pu_bacteria | 2921282425 | 2921288128 | 309 |
| 533 | iso_pu_bacteria | 2921289301 | 2921295444 | 309 |
| 534 | iso_pu_bacteria | 2922151315 | 2922154117 | 309 |
| 535 | iso_pu_bacteria | 2922172374 | 2922176881 | 309 |
| 536 | iso_pu_bacteria | 2922178524 | 2922184635 | 309 |
| 537 | iso_pu_bacteria | 2923556063 | 2923557564 | 309 |
| 538 | iso_pu_bacteria | 2924144063 | 2924145541 | 309 |
| 539 | iso_pu_bacteria | 2924150972 | 2924156944 | 309 |
| 540 | iso_pu_bacteria | 2924158325 | 2924160633 | 309 |
| 541 | iso_pu_bacteria | 2924165586 | 2924171566 | 309 |
| 542 | iso_pu_bacteria | 2924172951 | 2924177566 | 309 |
| 543 | iso_pu_bacteria | 2924179722 | 2924180705 | 309 |
| 544 | iso_pu_bacteria | 2924186466 | 2924192133 | 309 |
| 545 | iso_pu_bacteria | 2924193448 | 2924199721 | 309 |
| 546 | iso_pu_bacteria | 2924200457 | 2924205443 | 309 |
| 547 | iso_pu_bacteria | 2924207177 | 2924212321 | 309 |
| 548 | iso_pu_bacteria | 2924221636 | 2924222367 | 309 |
| 549 | iso_pu_bacteria | 2924228884 | 2924234212 | 309 |
| 550 | iso_pu_bacteria | 2924718760 | 2924723270 | 309 |
| 551 | iso_pu_bacteria | 2924733363 | 2924735393 | 309 |
| 552 | iso_pu_bacteria | 2924748358 | 2924751704 | 309 |
| 553 | iso_pu_bacteria | 2924776078 | 2924780316 | 309 |
| 554 | iso_pu_bacteria | 2926754445 | 2926756757 | 309 |
| 555 | iso_pu_bacteria | 2926760298 | 2926760996 | 309 |
| 556 | iso_pu_bacteria | 2928521798 | 2928524664 | 309 |
| 557 | iso_pu_bacteria | 2929138655 | 2929139527 | 309 |
| 558 | iso_pu_bacteria | 2933006813 | 2933007851 | 309 |
| 559 | iso_pu_bacteria | 2933011516 | 2933012630 | 309 |
| 560 | iso_pu_bacteria | 2933016740 | 2933016844 | 309 |
| 561 | iso_pu_bacteria | 2933570622 | 2933573115 | 309 |
| 562 | iso_pu_bacteria | 2933594066 | 2933595070 | 309 |
| 563 | iso_pu_bacteria | 2933599457 | 2933604606 | 309 |
| 564 | iso_pu_bacteria | 2935901341 | 2935904135 | 309 |
| 565 | iso_pu_bacteria | 2936367885 | 2936368121 | 309 |
| 566 | iso_pu_bacteria | 2936375103 | 2936381486 | 309 |
| 567 | iso_pu_bacteria | 2936996657 | 2937001042 | 309 |
| 568 | iso_pu_bacteria | 2937002841 | 2937008715 | 309 |
| 569 | iso_pu_bacteria | 2937009748 | 2937015074 | 309 |
| 570 | iso_pu_bacteria | 2937016420 | 2937018926 | 309 |
| 571 | iso_pu_bacteria | 2937023124 | 2937028460 | 309 |
| 572 | iso_pu_bacteria | 2937029754 | 2937029814 | 309 |
| 573 | iso_pu_bacteria | 2937036028 | 2937036840 | 309 |
| 574 | iso_pu_bacteria | 2937042894 | 2937043439 | 309 |
| 575 | iso_pu_bacteria | 2937049772 | 2937056225 | 309 |
| 576 | iso_pu_bacteria | 2937056579 | 2937062309 | 309 |
| 577 | iso_pu_bacteria | 2937063883 | 2937069237 | 309 |
| 578 | iso_pu_bacteria | 2937071275 | 2937077457 | 309 |
| 579 | iso_pu_bacteria | 2937078374 | 2937082921 | 309 |
| 580 | iso_pu_bacteria | 2937084907 | 2937091199 | 309 |
| 581 | iso_pu_bacteria | 2937091812 | 2937095649 | 309 |
| 582 | iso_pu_bacteria | 2937098957 | 2937104158 | 309 |
| 583 | iso_pu_bacteria | 2937106411 | 2937112135 | 309 |
| 584 | iso_pu_bacteria | 2937113482 | 2937118043 | 309 |
| 585 | iso_pu_bacteria | 2937119839 | 2937124788 | 309 |
| 586 | iso_pu_bacteria | 2937126314 | 2937128990 | 309 |
| 587 | iso_pu_bacteria | 2937843397 | 2937846788 | 309 |
| 588 | iso_pu_bacteria | 2937861824 | 2937862751 | 309 |
| 589 | iso_pu_bacteria | 2937868953 | 2937876957 | 309 |
| 590 | iso_pu_bacteria | 2937877337 | 2937882838 | 309 |
| 591 | iso_pu_bacteria | 2937972304 | 2937973189 | 309 |
| 592 | iso_pu_bacteria | 2941499720 | 2941500205 | 309 |
| 593 | iso_pu_bacteria | 2954011201 | 2954015144 | 309 |
| 594 | iso_pu_bacteria | 2957375807 | 2957379973 | 309 |
| 595 | iso_pu_bacteria | 2957382221 | 2957385786 | 309 |
| 596 | iso_pu_bacteria | 2957388812 | 2957389072 | 309 |
| 597 | iso_pu_bacteria | 2957395598 | 2957400297 | 309 |
| 598 | iso_pu_bacteria | 2957402308 | 2957406538 | 309 |
| 599 | iso_pu_bacteria | 2957408893 | 2957411656 | 309 |
| 600 | iso_pu_bacteria | 2957415311 | 2957421785 | 309 |
| 601 | iso_pu_bacteria | 2957422303 | 2957423858 | 309 |
| 602 | iso_pu_bacteria | 2957430029 | 2957436111 | 309 |
| 603 | iso_pu_bacteria | 2957437181 | 2957439206 | 309 |
| 604 | iso_pu_bacteria | 2957443900 | 2957446480 | 309 |
| 605 | iso_pu_bacteria | 2957450854 | 2957456396 | 309 |
| 606 | iso_pu_bacteria | 2957457609 | 2957463693 | 309 |
| 607 | iso_pu_bacteria | 2957464669 | 2957469819 | 309 |
| 608 | iso_pu_bacteria | 2957471148 | 2957476711 | 309 |
| 609 | iso_pu_bacteria | 2957478035 | 2957479960 | 309 |
| 610 | iso_pu_bacteria | 2957484790 | 2957490286 | 309 |
| 611 | iso_pu_bacteria | 2957491536 | 2957498145 | 309 |
| 612 | iso_pu_bacteria | 2957498199 | 2957504168 | 309 |
| 613 | iso_pu_bacteria | 2957505466 | 2957511638 | 309 |
| 614 | iso_pu_bacteria | 2958034702 | 2958037562 | 309 |
| 615 | iso_pu_bacteria | 2958041894 | 2958047273 | 309 |
| 616 | iso_pu_bacteria | 2958064165 | 2958065940 | 309 |
| 617 | iso_pu_bacteria | 2958084443 | 2958089963 | 309 |
| 618 | iso_pu_bacteria | 2958108152 | 2958112822 | 309 |
| 619 | iso_pu_bacteria | 2958122699 | 2958126415 | 309 |
| 620 | iso_pu_bacteria | 2958137437 | 2958137645 | 309 |
| 621 | iso_pu_bacteria | 2958144490 | 2958150463 | 309 |
| 622 | iso_pu_bacteria | 2960584000 | 2960589564 | 309 |
| 623 | iso_pu_bacteria | 2960591022 | 2960595625 | 309 |
| 624 | iso_pu_bacteria | 2960597568 | 2960601801 | 309 |
| 625 | iso_pu_bacteria | 2960603979 | 2960609957 | 309 |
| 626 | iso_pu_bacteria | 2960610863 | 2960615893 | 309 |
| 627 | iso_pu_bacteria | 2960617483 | 2960617760 | 309 |
| 628 | iso_pu_bacteria | 2960624210 | 2960631053 | 309 |
| 629 | iso_pu_bacteria | 2960631154 | 2960633174 | 309 |
| 630 | iso_pu_bacteria | 2960637947 | 2960644189 | 309 |
| 631 | iso_pu_bacteria | 2960645483 | 2960651892 | 309 |
| 632 | iso_pu_bacteria | 2960652885 | 2960658586 | 309 |
| 633 | iso_pu_bacteria | 2960660292 | 2960666464 | 309 |
| 634 | iso_pu_bacteria | 2960667422 | 2960673432 | 309 |
| 635 | iso_pu_bacteria | 2960674078 | 2960676910 | 309 |
| 636 | iso_pu_bacteria | 2960680706 | 2960684214 | 309 |
| 637 | iso_pu_bacteria | 2960687367 | 2960692580 | 309 |
| 638 | iso_pu_bacteria | 2960693952 | 2960696742 | 309 |
| 639 | iso_pu_bacteria | 2961183825 | 2961185796 | 309 |
| 640 | iso_pu_bacteria | 2964607997 | 2964613876 | 309 |
| 641 | iso_pu_bacteria | 2964615318 | 2964619944 | 309 |
| 642 | iso_pu_bacteria | 2964621998 | 2964627832 | 309 |
| 643 | iso_pu_bacteria | 2964628898 | 2964634766 | 309 |
| 644 | iso_pu_bacteria | 2964636051 | 2964642983 | 309 |
| 645 | iso_pu_bacteria | 2964643177 | 2964648326 | 309 |
| 646 | iso_pu_bacteria | 2964649959 | 2964653163 | 309 |
| 647 | iso_pu_bacteria | 2964656573 | 2964659238 | 309 |
| 648 | iso_pu_bacteria | 2964663802 | 2964665915 | 309 |
| 649 | iso_pu_bacteria | 2964670856 | 2964674025 | 309 |
| 650 | iso_pu_bacteria | 2964678106 | 2964683620 | 309 |
| 651 | iso_pu_bacteria | 2964685014 | 2964690427 | 309 |
| 652 | iso_pu_bacteria | 2964691889 | 2964692347 | 309 |
| 653 | iso_pu_bacteria | 2964698721 | 2964702229 | 309 |
| 654 | iso_pu_bacteria | 2964705432 | 2964708036 | 309 |
| 655 | iso_pu_bacteria | 2964712639 | 2964718170 | 309 |
| 656 | iso_pu_bacteria | 2964719344 | 2964726639 | 309 |
| 657 | iso_pu_bacteria | 2965025482 | 2965030666 | 309 |
| 658 | iso_pu_bacteria | 2965032056 | 2965032872 | 309 |
| 659 | iso_pu_bacteria | 2965047637 | 2965050816 | 309 |
| 660 | iso_pu_bacteria | 2965102966 | 2965109525 | 309 |
| 661 | iso_pu_bacteria | 2967664464 | 2967669655 | 309 |
| 662 | iso_pu_bacteria | 2967671571 | 2967678519 | 309 |
| 663 | iso_pu_bacteria | 2967678726 | 2967681103 | 309 |
| 664 | iso_pu_bacteria | 2967686174 | 2967687086 | 309 |
| 665 | iso_pu_bacteria | 2967693043 | 2967693305 | 309 |
| 666 | iso_pu_bacteria | 2967699805 | 2967706876 | 309 |
| 667 | iso_pu_bacteria | 2967714385 | 2967716469 | 309 |
| 668 | iso_pu_bacteria | 2967721400 | 2967728119 | 309 |
| 669 | iso_pu_bacteria | 2967728569 | 2967734682 | 309 |
| 670 | iso_pu_bacteria | 2967735183 | 2967737519 | 309 |
| 671 | iso_pu_bacteria | 2967742019 | 2967742226 | 309 |
| 672 | iso_pu_bacteria | 2967748971 | 2967752047 | 309 |
| 673 | iso_pu_bacteria | 2967755722 | 2967760434 | 309 |
| 674 | iso_pu_bacteria | 2967762386 | 2967764491 | 309 |
| 675 | iso_pu_bacteria | 2967769361 | 2967770850 | 309 |
| 676 | iso_pu_bacteria | 2967775926 | 2967776189 | 309 |
| 677 | iso_pu_bacteria | 2968016561 | 2968019604 | 309 |
| 678 | iso_pu_bacteria | 2968138860 | 2968138939 | 309 |
| 679 | iso_pu_bacteria | 2970019648 | 2970026245 | 309 |
| 680 | iso_pu_bacteria | 2970026789 | 2970029152 | 309 |
| 681 | iso_pu_bacteria | 2970033650 | 2970038780 | 309 |
| 682 | iso_pu_bacteria | 2970040964 | 2970044599 | 309 |
| 683 | iso_pu_bacteria | 2970047711 | 2970054051 | 309 |
| 684 | iso_pu_bacteria | 2970054988 | 2970059549 | 309 |
| 685 | iso_pu_bacteria | 2970061556 | 2970068659 | 309 |
| 686 | iso_pu_bacteria | 2970068827 | 2970073919 | 309 |
| 687 | iso_pu_bacteria | 2970076120 | 2970081417 | 309 |
| 688 | iso_pu_bacteria | 2970082768 | 2970085334 | 309 |
| 689 | iso_pu_bacteria | 2970088815 | 2970094517 | 309 |
| 690 | iso_pu_bacteria | 2970095765 | 2970102249 | 309 |
| 691 | iso_pu_bacteria | 2970102677 | 2970107193 | 309 |
| 692 | iso_pu_bacteria | 2970109326 | 2970115165 | 309 |
| 693 | iso_pu_bacteria | 2970116247 | 2970117909 | 309 |
| 694 | iso_pu_bacteria | 2970122695 | 2970124406 | 309 |
| 695 | iso_pu_bacteria | 2970129317 | 2970129577 | 309 |
| 696 | iso_pu_bacteria | 2970136068 | 2970142572 | 309 |
| 697 | iso_pu_bacteria | 2970143518 | 2970144425 | 309 |
| 698 | iso_pu_bacteria | 2970149975 | 2970155573 | 309 |
| 699 | iso_pu_bacteria | 2970156795 | 2970163926 | 309 |
| 700 | iso_pu_bacteria | 2970164137 | 2970170000 | 309 |
| 701 | iso_pu_bacteria | 2970170962 | 2970171852 | 309 |
| 702 | iso_pu_bacteria | 2970177841 | 2970182277 | 309 |
| 703 | iso_pu_bacteria | 2970184632 | 2970188315 | 309 |
| 704 | iso_pu_bacteria | 2970191845 | 2970197686 | 309 |
| 705 | iso_pu_bacteria | 2970469710 | 2970472925 | 309 |
| 706 | iso_pu_bacteria | 2970489779 | 2970493544 | 309 |
| 707 | iso_pu_bacteria | 2970510686 | 2970512506 | 309 |
| 708 | iso_pu_bacteria | 2970547951 | 2970554715 | 309 |
| 709 | iso_pu_bacteria | 2970593180 | 2970596204 | 309 |
| 710 | iso_pu_bacteria | 2970619444 | 2970620373 | 309 |
| 711 | iso_pu_bacteria | 2977516862 | 2977522902 | 309 |
| 712 | iso_pu_bacteria | 2977523885 | 2977529983 | 309 |
| 713 | iso_pu_bacteria | 2977530762 | 2977531951 | 309 |
| 714 | iso_pu_bacteria | 2977537788 | 2977538046 | 309 |
| 715 | iso_pu_bacteria | 2977544691 | 2977546041 | 309 |
| 716 | iso_pu_bacteria | 2977551784 | 2977552047 | 309 |
| 717 | iso_pu_bacteria | 2977558990 | 2977564547 | 309 |
| 718 | iso_pu_bacteria | 2977565890 | 2977572013 | 309 |
| 719 | iso_pu_bacteria | 2977572785 | 2977578319 | 309 |
| 720 | iso_pu_bacteria | 2977579622 | 2977581435 | 309 |
| 721 | iso_pu_bacteria | 2977851361 | 2977857117 | 309 |
| 722 | iso_pu_bacteria | 2977872689 | 2977873162 | 309 |
| 723 | iso_pu_bacteria | 2977907340 | 2977912693 | 309 |
| 724 | iso_pu_bacteria | 2977915119 | 2977918714 | 309 |
| 725 | iso_pu_bacteria | 2977935797 | 2977936999 | 309 |
| 726 | iso_pu_bacteria | 2977950692 | 2977954384 | 309 |
| 727 | iso_pu_bacteria | 2977957713 | 2977962752 | 309 |
| 728 | iso_pu_bacteria | 2979089926 | 2979093727 | 309 |
| 729 | iso_pu_bacteria | 2979095461 | 2979098889 | 309 |
| 730 | iso_pu_bacteria | 2979100975 | 2979105703 | 309 |
| 731 | iso_pu_bacteria | 2979764755 | 2979770600 | 309 |
| 732 | iso_pu_bacteria | 2979772303 | 2979774953 | 309 |
| 733 | iso_pu_bacteria | 2979793036 | 2979794263 | 309 |
| 734 | iso_pu_bacteria | 2984509177 | 2984512450 | 309 |
| 735 | iso_pu_bacteria | 2984518228 | 2984521189 | 309 |
| 736 | iso_pu_bacteria | 2984537506 | 2984540483 | 309 |
| 737 | iso_pu_bacteria | 2984601300 | 2984602680 | 309 |
| 738 | iso_pu_bacteria | 2987645492 | 2987646146 | 309 |
| 739 | iso_pu_bacteria | 2987673487 | 2987674023 | 309 |
| 740 | iso_pu_bacteria | 2989349275 | 2989354160 | 309 |
| 741 | iso_pu_bacteria | 2989771324 | 2989772067 | 309 |
| 742 | iso_pu_bacteria | 2989776772 | 2989778186 | 309 |
| 743 | iso_pu_bacteria | 2995392953 | 2995393796 | 309 |
| 744 | iso_pu_bacteria | 2996310559 | 2996313315 | 309 |
| 745 | iso_pu_bacteria | 2996348954 | 2996351955 | 309 |
| 746 | iso_pu_bacteria | 2996386984 | 2996392352 | 309 |
| 747 | iso_pu_bacteria | 2996887358 | 2996890798 | 309 |
| 748 | iso_pu_bacteria | 2996893221 | 2996895081 | 309 |
| 749 | iso_pu_bacteria | 3002141150 | 3002143345 | 309 |
| 750 | iso_pu_bacteria | 3003930520 | 3003932678 | 309 |
| 751 | iso_pu_bacteria | 3004167301 | 3004170908 | 309 |
| 752 | iso_pu_bacteria | 3004239961 | 3004247750 | 309 |
| 753 | iso_pu_bacteria | 3004248173 | 3004252088 | 309 |
| 754 | iso_pu_bacteria | 3004268573 | 3004273140 | 309 |
| 755 | iso_pu_bacteria | 3004275668 | 3004278653 | 309 |
| 756 | iso_pu_bacteria | 3005409236 | 3005412452 | 309 |
| 757 | iso_pu_bacteria | 3005416602 | 3005417144 | 309 |
| 758 | iso_pu_bacteria | 3005445848 | 3005446763 | 309 |
| 759 | iso_pu_bacteria | 3005452660 | 3005453452 | 309 |
| 760 | iso_pu_bacteria | 639633055 | 639647434 | 309 |
| 761 | iso_pu_bacteria | 643692032 | 643825095 | 309 |
| 762 | iso_pu_bacteria | 648276728 | 648736424 | 309 |
| 763 | iso_pu_bacteria | 649633066 | 649874616 | 309 |
| 764 | iso_pu_bacteria | 650716007 | 650739538 | 309 |
| 765 | iso_pu_bacteria | 8003570095 | 8003570583 | 309 |
| 766 | iso_pu_bacteria | 8003992118 | 8003993004 | 309 |
| 767 | iso_pu_bacteria | 8003999396 | 8004000235 | 309 |
| 768 | iso_pu_bacteria | 8004300914 | 8004301775 | 309 |
| 769 | iso_pu_bacteria | 8004312739 | 8004317607 | 309 |
| 770 | iso_pu_bacteria | 8004361976 | 8004365572 | 309 |
| 771 | iso_pu_bacteria | 8004695233 | 8004700148 | 309 |
| 772 | iso_pu_bacteria | 8004727605 | 8004729934 | 309 |
| 773 | iso_pu_bacteria | 8005246636 | 8005251313 | 309 |
| 774 | iso_pu_bacteria | 8005258706 | 8005261813 | 309 |
| 775 | iso_pu_bacteria | 8005275841 | 8005279583 | 309 |
| 776 | iso_pu_bacteria | 8005282627 | 8005284781 | 309 |
| 777 | iso_pu_bacteria | 8005289223 | 8005292793 | 309 |
| 778 | iso_pu_bacteria | 8005301065 | 8005304599 | 309 |
| 779 | iso_pu_bacteria | 8005307578 | 8005311089 | 309 |
| 780 | iso_pu_bacteria | 8005314921 | 8005315205 | 309 |
| 781 | iso_pu_bacteria | 8005321885 | 8005325325 | 309 |
| 782 | iso_pu_bacteria | 8005376324 | 8005376607 | 309 |
| 783 | iso_pu_bacteria | 8005382845 | 8005385996 | 309 |
| 784 | iso_pu_bacteria | 8005395548 | 8005400221 | 309 |
| 785 | iso_pu_bacteria | 8005430974 | 8005432270 | 309 |
| 786 | iso_pu_bacteria | 8005460587 | 8005461930 | 309 |
| 787 | iso_pu_bacteria | 8005484373 | 8005485625 | 309 |
| 788 | iso_pu_bacteria | 8005497431 | 8005499332 | 309 |
| 789 | iso_pu_bacteria | 8005542996 | 8005544359 | 309 |
| 790 | iso_pu_bacteria | 8005570704 | 8005572685 | 309 |
| 791 | iso_pu_bacteria | 8005619151 | 8005620527 | 309 |
| 792 | iso_pu_bacteria | 8005626139 | 8005627507 | 309 |
| 793 | iso_pu_bacteria | 8005645114 | 8005648358 | 309 |
| 794 | iso_pu_bacteria | 8005658619 | 8005659968 | 309 |
| 795 | iso_pu_bacteria | 8005668836 | 8005670748 | 309 |
| 796 | iso_pu_bacteria | 8005682033 | 8005684566 | 309 |
| 797 | iso_pu_bacteria | 8005688590 | 8005691022 | 309 |
| 798 | iso_pu_bacteria | 8005695170 | 8005698788 | 309 |
| 799 | iso_pu_bacteria | 8018127388 | 8018131334 | 309 |
| 800 | iso_pu_bacteria | 8018150411 | 8018152550 | 309 |
| 801 | iso_pu_bacteria | 8018163183 | 8018169159 | 309 |
| 802 | iso_pu_bacteria | 8018176218 | 8018177242 | 309 |
| 803 | iso_pu_bacteria | 8023680758 | 8023686956 | 309 |
| 804 | iso_pu_bacteria | 8024479707 | 8024481103 | 309 |
| 805 | iso_pu_bacteria | 8024486573 | 8024489751 | 309 |
| 806 | iso_pu_bacteria | 8024501048 | 8024503250 | 309 |
| 807 | iso_pu_bacteria | 8046767195 | 8046767682 | 309 |
| 808 | iso_pu_bacteria | 8049293176 | 8049293934 | 309 |
| 809 | iso_pu_bacteria | 8054558443 | 8054562966 | 309 |
| 810 | iso_pu_bacteria | 8055431914 | 8055434197 | 309 |
| 811 | iso_pu_bacteria | 8056375014 | 8056380732 | 309 |
| 812 | iso_pu_bacteria | 8056382006 | 8056384751 | 309 |
| 813 | iso_pu_bacteria | 8056875544 | 8056876573 | 309 |
| 814 | iso_pu_bacteria | 8057575449 | 8057582196 | 309 |
| 815 | iso_pu_bacteria | 8057874678 | 8057879588 | 309 |
| 816 | iso_pu_bacteria | 2510917026 | 2511174601 | 310 |
| 817 | iso_pu_bacteria | 2585427633 | 2585995119 | 310 |
| 818 | iso_pu_bacteria | 2585427634 | 2585999666 | 310 |
| 819 | iso_pu_bacteria | 2919171160 | 2919171417 | 310 |
| 820 | 3300009545 | Ga0105237_10302382 | Ga0105237_103023822 | 311 |
| 821 | iso_pu_bacteria | 2724679232 | 2725948489 | 311 |
| 822 | iso_pu_bacteria | 2765235942 | 2766067602 | 311 |
| 823 | iso_pu_bacteria | 2791355263 | 2793339795 | 311 |
| 824 | iso_pu_bacteria | 2791355266 | 2793358921 | 311 |
| 825 | iso_pu_bacteria | 2933586486 | 2933591376 | 311 |
| 826 | iso_pu_bacteria | 2935894831 | 2935895145 | 311 |
| 827 | iso_pu_bacteria | 2936381700 | 2936387380 | 311 |
| 828 | iso_pu_bacteria | 8005556819 | 8005558925 | 311 |
| 829 | iso_pu_bacteria | 8005563573 | 8005570437 | 311 |
| 830 | 3300006051 | Ga0075364_10003962 | Ga0075364_100039628 | 312 |
| 831 | 3300049572 | Ga0501036_0354583 | Ga0501036_0354583_44_1009 | 312 |
| 832 | 3300049576 | Ga0501040_0099885 | Ga0501040_0099885_637_1602 | 312 |
| 833 | 3300049580 | Ga0501046_0215598 | Ga0501046_0215598_246_1211 | 312 |
| 834 | 3300049582 | Ga0501048_0197354 | Ga0501048_0197354_101_1066 | 312 |
| 835 | 3300049590 | Ga0501074_0118258 | Ga0501074_0118258_296_1261 | 312 |
| 836 | 3300049592 | Ga0501076_0111306 | Ga0501076_0111306_33_998 | 312 |
| 837 | 3300049741 | Ga0501079_0128745 | Ga0501079_0128745_346_1311 | 312 |
| 838 | 3300050491 | nmdc:mga00v17_3380_c1 | nmdc:mga00v17_3380_c1_2430_3413 | 312 |
| 839 | 3300054114 | Ga0501084_0162387 | Ga0501084_0162387_56_1021 | 312 |
| 840 | 3300001989 | JGI24739J22299_10007068 | JGI24739J22299_100070682 | 313 |
| 841 | 3300002737 | JGI25162J39368_1004608 | JGI25162J39368_10046082 | 313 |
| 842 | 3300002739 | JGI25158J39367_1000407 | JGI25158J39367_10004079 | 313 |
| 843 | 3300002773 | JGI25152J39213_1005768 | JGI25152J39213_10057683 | 313 |
| 844 | 3300002773 | JGI25152J39213_1006937 | JGI25152J39213_10069372 | 313 |
| 845 | 3300002774 | JGI25150J39212_1001462 | JGI25150J39212_10014625 | 313 |
| 846 | 3300002987 | JGI25159J45721_1000002 | JGI25159J45721_1000002221 | 313 |
| 847 | 3300002987 | JGI25159J45721_1000299 | JGI25159J45721_10002994 | 313 |
| 848 | 3300002987 | JGI25159J45721_1001244 | JGI25159J45721_10012442 | 313 |
| 849 | 3300003187 | JGI25151J46595_10015298 | JGI25151J46595_100152982 | 313 |
| 850 | 3300003214 | JGI25165J46597_1005540 | JGI25165J46597_10055402 | 313 |
| 851 | 3300003215 | JGI25153J46596_10009883 | JGI25153J46596_100098832 | 313 |
| 852 | 3300003215 | JGI25153J46596_10010716 | JGI25153J46596_100107164 | 313 |
| 853 | 3300003354 | JGI25160J50197_1000008 | JGI25160J50197_1000008221 | 313 |
| 854 | 3300003354 | JGI25160J50197_1000015 | JGI25160J50197_10000157 | 313 |
| 855 | 3300003374 | JGI25161J50226_1000005 | JGI25161J50226_1000005234 | 313 |
| 856 | 3300003374 | JGI25161J50226_1001391 | JGI25161J50226_10013918 | 313 |
| 857 | 3300003374 | JGI25161J50226_1001583 | JGI25161J50226_10015832 | 313 |
| 858 | 3300003771 | Ga0055526_1004652 | Ga0055526_10046528 | 313 |
| 859 | 3300003771 | Ga0055526_1009202 | Ga0055526_10092025 | 313 |
| 860 | 3300003775 | Ga0055524_1003638 | Ga0055524_10036386 | 313 |
| 861 | 3300003781 | Ga0055536_1015294 | Ga0055536_10152941 | 313 |
| 862 | 3300003790 | Ga0055528_1007761 | Ga0055528_10077614 | 313 |
| 863 | 3300003790 | Ga0055528_1012526 | Ga0055528_10125262 | 313 |
| 864 | 3300003791 | Ga0055530_10005675 | Ga0055530_100056753 | 313 |
| 865 | 3300003792 | Ga0055540_1002625 | Ga0055540_10026252 | 313 |
| 866 | 3300003794 | Ga0055531_10002261 | Ga0055531_1000226110 | 313 |
| 867 | 3300003794 | Ga0055531_10007612 | Ga0055531_100076128 | 313 |
| 868 | 3300003856 | Ga0058692_1002692 | Ga0058692_10026923 | 313 |
| 869 | 3300004625 | Ga0055543_1000012 | Ga0055543_10000128 | 313 |
| 870 | 3300004625 | Ga0055543_1000040 | Ga0055543_100004081 | 313 |
| 871 | 3300004625 | Ga0055543_1001946 | Ga0055543_10019468 | 313 |
| 872 | 3300005262 | Ga0065165_1000015 | Ga0065165_1000015222 | 313 |
| 873 | 3300005262 | Ga0065165_1002531 | Ga0065165_10025316 | 313 |
| 874 | 3300005262 | Ga0065165_1003987 | Ga0065165_10039878 | 313 |
| 875 | 3300005262 | Ga0065165_1007707 | Ga0065165_10077072 | 313 |
| 876 | 3300005262 | Ga0065165_1011545 | Ga0065165_10115452 | 313 |
| 877 | 3300005331 | Ga0070670_100009711 | Ga0070670_1000097113 | 313 |
| 878 | 3300005344 | Ga0070661_100002760 | Ga0070661_1000027602 | 313 |
| 879 | 3300005344 | Ga0070661_100006288 | Ga0070661_1000062884 | 313 |
| 880 | 3300005344 | Ga0070661_100312143 | Ga0070661_1003121431 | 313 |
| 881 | 3300005539 | Ga0068853_100004761 | Ga0068853_10000476113 | 313 |
| 882 | 3300005539 | Ga0068853_100078999 | Ga0068853_1000789993 | 313 |
| 883 | 3300005548 | Ga0070665_100100746 | Ga0070665_1001007462 | 313 |
| 884 | 3300005578 | Ga0068854_100034747 | Ga0068854_1000347476 | 313 |
| 885 | 3300005834 | Ga0068851_10005798 | Ga0068851_100057982 | 313 |
| 886 | 3300006038 | Ga0075365_10003852 | Ga0075365_100038522 | 313 |
| 887 | 3300006038 | Ga0075365_10077370 | Ga0075365_100773702 | 313 |
| 888 | 3300006038 | Ga0075365_10232344 | Ga0075365_102323442 | 313 |
| 889 | 3300006048 | Ga0075363_100256935 | Ga0075363_1002569351 | 313 |
| 890 | 3300006051 | Ga0075364_10069082 | Ga0075364_100690822 | 313 |
| 891 | 3300006186 | Ga0075369_10034254 | Ga0075369_100342542 | 313 |
| 892 | 3300006946 | Ga0079104_1000032 | Ga0079104_100003286 | 313 |
| 893 | 3300010375 | Ga0105239_10015417 | Ga0105239_100154173 | 313 |
| 894 | 3300013100 | Ga0157373_10066043 | Ga0157373_100660432 | 313 |
| 895 | 3300013102 | Ga0157371_10014140 | Ga0157371_100141405 | 313 |
| 896 | 3300013105 | Ga0157369_10196501 | Ga0157369_101965011 | 313 |
| 897 | 3300013249 | Ga0171463_1001 | Ga0171463_1001212 | 313 |
| 898 | 3300015690 | Ga0183363_1451 | Ga0183363_14512 | 313 |
| 899 | 3300021320 | Ga0214544_1000017 | Ga0214544_1000017176 | 313 |
| 900 | 3300021321 | Ga0214542_1000006 | Ga0214542_100000654 | 313 |
| 901 | 3300021327 | Ga0214543_1000003 | Ga0214543_1000003488 | 313 |
| 902 | 3300021327 | Ga0214543_1000014 | Ga0214543_1000014269 | 313 |
| 903 | 3300025208 | Ga0209436_100315 | Ga0209436_1003158 | 313 |
| 904 | 3300025208 | Ga0209436_101147 | Ga0209436_1011475 | 313 |
| 905 | 3300025233 | Ga0209437_100033 | Ga0209437_100033282 | 313 |
| 906 | 3300025256 | Ga0209759_1013620 | Ga0209759_10136202 | 313 |
| 907 | 3300025258 | Ga0209129_1000420 | Ga0209129_100042021 | 313 |
| 908 | 3300025258 | Ga0209129_1003477 | Ga0209129_10034774 | 313 |
| 909 | 3300025258 | Ga0209129_1008011 | Ga0209129_10080112 | 313 |
| 910 | 3300025261 | Ga0209233_1000064 | Ga0209233_1000064140 | 313 |
| 911 | 3300025273 | Ga0209673_1000041 | Ga0209673_100004172 | 313 |
| 912 | 3300025273 | Ga0209673_1000603 | Ga0209673_10006035 | 313 |
| 913 | 3300025273 | Ga0209673_1037998 | Ga0209673_10379982 | 313 |
| 914 | 3300025284 | Ga0209130_1000006 | Ga0209130_1000006530 | 313 |
| 915 | 3300025284 | Ga0209130_1000007 | Ga0209130_100000781 | 313 |
| 916 | 3300025284 | Ga0209130_1000018 | Ga0209130_1000018263 | 313 |
| 917 | 3300025284 | Ga0209130_1013814 | Ga0209130_10138141 | 313 |
| 918 | 3300025292 | Ga0209676_1003497 | Ga0209676_10034978 | 313 |
| 919 | 3300025292 | Ga0209676_1016484 | Ga0209676_10164842 | 313 |
| 920 | 3300025294 | Ga0209025_1000074 | Ga0209025_1000074260 | 313 |
| 921 | 3300025294 | Ga0209025_1000080 | Ga0209025_100008033 | 313 |
| 922 | 3300025294 | Ga0209025_1000100 | Ga0209025_1000100226 | 313 |
| 923 | 3300025294 | Ga0209025_1008335 | Ga0209025_10083357 | 313 |
| 924 | 3300025294 | Ga0209025_1013593 | Ga0209025_10135933 | 313 |
| 925 | 3300025294 | Ga0209025_1024975 | Ga0209025_10249752 | 313 |
| 926 | 3300025295 | Ga0209564_1000425 | Ga0209564_100042551 | 313 |
| 927 | 3300025295 | Ga0209564_1000439 | Ga0209564_100043912 | 313 |
| 928 | 3300025295 | Ga0209564_1011003 | Ga0209564_10110035 | 313 |
| 929 | 3300025295 | Ga0209564_1027287 | Ga0209564_10272872 | 313 |
| 930 | 3300025297 | Ga0209758_1000554 | Ga0209758_100055442 | 313 |
| 931 | 3300025297 | Ga0209758_1002005 | Ga0209758_10020052 | 313 |
| 932 | 3300025297 | Ga0209758_1017001 | Ga0209758_10170012 | 313 |
| 933 | 3300025297 | Ga0209758_1017730 | Ga0209758_10177302 | 313 |
| 934 | 3300025297 | Ga0209758_1021436 | Ga0209758_10214362 | 313 |
| 935 | 3300025297 | Ga0209758_1029384 | Ga0209758_10293842 | 313 |
| 936 | 3300025298 | Ga0209050_1016786 | Ga0209050_10167862 | 313 |
| 937 | 3300025299 | Ga0209256_1002348 | Ga0209256_10023486 | 313 |
| 938 | 3300025299 | Ga0209256_1002894 | Ga0209256_10028942 | 313 |
| 939 | 3300025299 | Ga0209256_1011586 | Ga0209256_10115863 | 313 |
| 940 | 3300025299 | Ga0209256_1022664 | Ga0209256_10226641 | 313 |
| 941 | 3300025302 | Ga0207426_1000044 | Ga0207426_1000044126 | 313 |
| 942 | 3300025302 | Ga0207426_1000064 | Ga0207426_100006481 | 313 |
| 943 | 3300025302 | Ga0207426_1000106 | Ga0207426_1000106107 | 313 |
| 944 | 3300025303 | Ga0209051_1000459 | Ga0209051_100045934 | 313 |
| 945 | 3300025303 | Ga0209051_1001705 | Ga0209051_10017053 | 313 |
| 946 | 3300025303 | Ga0209051_1002690 | Ga0209051_100269014 | 313 |
| 947 | 3300025304 | Ga0209257_1002541 | Ga0209257_10025412 | 313 |
| 948 | 3300025321 | Ga0207656_10003313 | Ga0207656_100033132 | 313 |
| 949 | 3300025919 | Ga0207657_10019763 | Ga0207657_100197632 | 313 |
| 950 | 3300025919 | Ga0207657_10154095 | Ga0207657_101540952 | 313 |
| 951 | 3300025925 | Ga0207650_10001915 | Ga0207650_1000191513 | 313 |
| 952 | 3300025949 | Ga0207667_10020644 | Ga0207667_100206441 | 313 |
| 953 | 3300026041 | Ga0207639_10010406 | Ga0207639_100104063 | 313 |
| 954 | 3300026142 | Ga0207698_10013180 | Ga0207698_100131804 | 313 |
| 955 | 3300027111 | Ga0209281_1000053 | Ga0209281_1000053195 | 313 |
| 956 | 3300027312 | Ga0209371_1000021 | Ga0209371_1000021478 | 313 |
| 957 | 3300028379 | Ga0268266_10377822 | Ga0268266_103778222 | 313 |
| 958 | 3300028794 | Ga0307515_10000070 | Ga0307515_10000070176 | 313 |
| 959 | 3300028794 | Ga0307515_10003572 | Ga0307515_100035723 | 313 |
| 960 | 3300028794 | Ga0307515_10010166 | Ga0307515_1001016613 | 313 |
| 961 | 3300028794 | Ga0307515_10231489 | Ga0307515_102314891 | 313 |
| 962 | 3300030500 | Ga0268256_1000020 | Ga0268256_1000020484 | 313 |
| 963 | 3300031456 | Ga0307513_10008740 | Ga0307513_100087402 | 313 |
| 964 | 3300031548 | Ga0307408_100149344 | Ga0307408_1001493441 | 313 |
| 965 | 3300031730 | Ga0307516_10042951 | Ga0307516_100429512 | 313 |
| 966 | 3300032004 | Ga0307414_10016210 | Ga0307414_100162105 | 313 |
| 967 | 3300035171 | Ga0373946_0022994 | Ga0373946_0022994_70_1014 | 313 |
| 968 | 3300035695 | Ga0373927_0000925 | Ga0373927_0000925_10940_11884 | 313 |
| 969 | 3300037068 | Ga0373925_0003381 | Ga0373925_0003381_8787_9731 | 313 |
| 970 | 3300037418 | Ga0395900_0094881 | Ga0395900_0094881_467_1411 | 313 |
| 971 | 3300037471 | Ga0395905_0017948 | Ga0395905_0017948_3625_4569 | 313 |
| 972 | 3300038443 | Ga0395901_0404396 | Ga0395901_0404396_208_1149 | 313 |
| 973 | 3300041404 | Ga0439436_0025006 | Ga0439436_0025006_598_1575 | 313 |
| 974 | 3300041406 | Ga0439439_0036435 | Ga0439439_0036435_271_1248 | 313 |
| 975 | 3300041407 | Ga0439447_019582 | Ga0439447_019582_582_1559 | 313 |
| 976 | 3300041413 | Ga0439465_0062662 | Ga0439465_0062662_85_1074 | 313 |
| 977 | 3300041997 | Ga0439431_0023859 | Ga0439431_0023859_336_1313 | 313 |
| 978 | 3300042006 | Ga0439432_062411 | Ga0439432_062411_50_994 | 313 |
| 979 | 3300046453 | Ga0495627_028880 | Ga0495627_028880_366_1361 | 313 |
| 980 | 3300046454 | Ga0495592_0050385 | Ga0495592_0050385_1681_2625 | 313 |
| 981 | 3300046460 | Ga0495638_0020463 | Ga0495638_0020463_2528_3478 | 313 |
| 982 | 3300046460 | Ga0495638_0024146 | Ga0495638_0024146_2481_3425 | 313 |
| 983 | 3300046462 | Ga0495651_0101369 | Ga0495651_0101369_790_1734 | 313 |
| 984 | 3300046501 | Ga0495607_0036799 | Ga0495607_0036799_1568_2518 | 313 |
| 985 | 3300046501 | Ga0495607_0107832 | Ga0495607_0107832_117_1061 | 313 |
| 986 | 3300046506 | Ga0495583_0028074 | Ga0495583_0028074_253_1197 | 313 |
| 987 | 3300046507 | Ga0495606_0015352 | Ga0495606_0015352_1379_2329 | 313 |
| 988 | 3300046507 | Ga0495606_0017659 | Ga0495606_0017659_1635_2579 | 313 |
| 989 | 3300046507 | Ga0495606_0170967 | Ga0495606_0170967_234_1178 | 313 |
| 990 | 3300046512 | Ga0495610_0023089 | Ga0495610_0023089_222_1172 | 313 |
| 991 | 3300046512 | Ga0495610_0049229 | Ga0495610_0049229_367_1311 | 313 |
| 992 | 3300046515 | Ga0495620_0012599 | Ga0495620_0012599_1942_2892 | 313 |
| 993 | 3300046515 | Ga0495620_0092744 | Ga0495620_0092744_101_1045 | 313 |
| 994 | 3300046519 | Ga0495632_0059265 | Ga0495632_0059265_558_1508 | 313 |
| 995 | 3300046522 | Ga0495643_0002659 | Ga0495643_0002659_11661_12605 | 313 |
| 996 | 3300046530 | Ga0495654_0000092 | Ga0495654_0000092_81584_82528 | 313 |
| 997 | 3300046542 | Ga0495597_0005990 | Ga0495597_0005990_1180_2130 | 313 |
| 998 | 3300046616 | Ga0495668_0051012 | Ga0495668_0051012_144_1094 | 313 |
| 999 | 3300046660 | Ga0495625_0012288 | Ga0495625_0012288_5170_6120 | 313 |
| 1000 | 3300046809 | Ga0495600_0009138 | Ga0495600_0009138_1186_2130 | 313 |
| 1001 | 3300046810 | Ga0495660_0001564 | Ga0495660_0001564_5282_6232 | 313 |
| 1002 | 3300047317 | Ga0495604_0032390 | Ga0495604_0032390_60_1004 | 313 |
| 1003 | 3300047470 | Ga0495681_0010747 | Ga0495681_0010747_3033_4028 | 313 |
| 1004 | 3300047472 | Ga0495686_0008600 | Ga0495686_0008600_1559_2509 | 313 |
| 1005 | 3300047472 | Ga0495686_0027080 | Ga0495686_0027080_2092_3036 | 313 |
| 1006 | 3300047472 | Ga0495686_0146621 | Ga0495686_0146621_430_1371 | 313 |
| 1007 | 3300048909 | Ga0496106_0003362 | Ga0496106_0003362_9895_10839 | 313 |
| 1008 | 3300048909 | Ga0496106_0089404 | Ga0496106_0089404_761_1705 | 313 |
| 1009 | 3300048909 | Ga0496106_0299690 | Ga0496106_0299690_256_1200 | 313 |
| 1010 | 3300048913 | Ga0496110_0239681 | Ga0496110_0239681_408_1352 | 313 |
| 1011 | 3300048914 | Ga0496111_0000236 | Ga0496111_0000236_17055_17999 | 313 |
| 1012 | 3300048919 | Ga0496116_0000036 | Ga0496116_0000036_280396_281388 | 313 |
| 1013 | 3300048920 | Ga0496117_0103427 | Ga0496117_0103427_15_959 | 313 |
| 1014 | 3300048921 | Ga0496118_0055489 | Ga0496118_0055489_1077_2021 | 313 |
| 1015 | 3300048923 | Ga0496120_0011845 | Ga0496120_0011845_3071_4111 | 313 |
| 1016 | 3300048923 | Ga0496120_0075534 | Ga0496120_0075534_298_1293 | 313 |
| 1017 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_893450_894490 | 313 |
| 1018 | 3300048924 | Ga0496121_0001948 | Ga0496121_0001948_4877_5869 | 313 |
| 1019 | 3300048924 | Ga0496121_0023150 | Ga0496121_0023150_1109_2053 | 313 |
| 1020 | 3300048924 | Ga0496121_0034281 | Ga0496121_0034281_3071_4015 | 313 |
| 1021 | 3300048924 | Ga0496121_0051611 | Ga0496121_0051611_2076_3026 | 313 |
| 1022 | 3300048924 | Ga0496121_0252673 | Ga0496121_0252673_213_1157 | 313 |
| 1023 | 3300048925 | Ga0496122_0000160 | Ga0496122_0000160_110944_111888 | 313 |
| 1024 | 3300048925 | Ga0496122_0061635 | Ga0496122_0061635_107_1147 | 313 |
| 1025 | 3300048925 | Ga0496122_0094524 | Ga0496122_0094524_329_1321 | 313 |
| 1026 | 3300048925 | Ga0496122_0128832 | Ga0496122_0128832_358_1302 | 313 |
| 1027 | 3300048926 | Ga0496123_0000034 | Ga0496123_0000034_140622_141566 | 313 |
| 1028 | 3300048926 | Ga0496123_0022771 | Ga0496123_0022771_3700_4740 | 313 |
| 1029 | 3300048926 | Ga0496123_0059455 | Ga0496123_0059455_806_1813 | 313 |
| 1030 | 3300048927 | Ga0496124_0000349 | Ga0496124_0000349_43629_44612 | 313 |
| 1031 | 3300048927 | Ga0496124_0030968 | Ga0496124_0030968_266_1210 | 313 |
| 1032 | 3300048927 | Ga0496124_0060590 | Ga0496124_0060590_329_1318 | 313 |
| 1033 | 3300048927 | Ga0496124_0078365 | Ga0496124_0078365_39_983 | 313 |
| 1034 | 3300048927 | Ga0496124_0131015 | Ga0496124_0131015_70_1014 | 313 |
| 1035 | 3300048927 | Ga0496124_0152290 | Ga0496124_0152290_452_1432 | 313 |
| 1036 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_1007335_1008375 | 313 |
| 1037 | 3300048928 | Ga0496125_0008785 | Ga0496125_0008785_6479_7423 | 313 |
| 1038 | 3300048928 | Ga0496125_0053355 | Ga0496125_0053355_1827_2771 | 313 |
| 1039 | 3300048929 | Ga0496126_0000156 | Ga0496126_0000156_95063_96070 | 313 |
| 1040 | 3300048929 | Ga0496126_0001886 | Ga0496126_0001886_7577_8518 | 313 |
| 1041 | 3300048929 | Ga0496126_0077009 | Ga0496126_0077009_1819_2763 | 313 |
| 1042 | 3300049568 | Ga0501031_0000060 | Ga0501031_0000060_48979_49920 | 313 |
| 1043 | 3300049568 | Ga0501031_0002553 | Ga0501031_0002553_2176_3117 | 313 |
| 1044 | 3300049569 | Ga0501032_0000015 | Ga0501032_0000015_135995_136936 | 313 |
| 1045 | 3300049569 | Ga0501032_0000025 | Ga0501032_0000025_74383_75324 | 313 |
| 1046 | 3300049569 | Ga0501032_0053548 | Ga0501032_0053548_355_1299 | 313 |
| 1047 | 3300049570 | Ga0501033_0000023 | Ga0501033_0000023_135995_136936 | 313 |
| 1048 | 3300049570 | Ga0501033_0000229 | Ga0501033_0000229_23823_24764 | 313 |
| 1049 | 3300049570 | Ga0501033_0000742 | Ga0501033_0000742_13806_14789 | 313 |
| 1050 | 3300049570 | Ga0501033_0086334 | Ga0501033_0086334_165_1106 | 313 |
| 1051 | 3300049571 | Ga0501034_0000073 | Ga0501034_0000073_39802_40743 | 313 |
| 1052 | 3300049571 | Ga0501034_0001654 | Ga0501034_0001654_13659_14600 | 313 |
| 1053 | 3300049571 | Ga0501034_0020740 | Ga0501034_0020740_1023_1964 | 313 |
| 1054 | 3300049571 | Ga0501034_0086434 | Ga0501034_0086434_1077_2018 | 313 |
| 1055 | 3300049571 | Ga0501034_0175292 | Ga0501034_0175292_270_1211 | 313 |
| 1056 | 3300049571 | Ga0501034_0211689 | Ga0501034_0211689_698_1687 | 313 |
| 1057 | 3300049572 | Ga0501036_0000002 | Ga0501036_0000002_135995_136936 | 313 |
| 1058 | 3300049572 | Ga0501036_0000151 | Ga0501036_0000151_5350_6291 | 313 |
| 1059 | 3300049573 | Ga0501037_0000048 | Ga0501037_0000048_39820_40761 | 313 |
| 1060 | 3300049573 | Ga0501037_0000176 | Ga0501037_0000176_24049_24990 | 313 |
| 1061 | 3300049574 | Ga0501038_0000002 | Ga0501038_0000002_129533_130474 | 313 |
| 1062 | 3300049574 | Ga0501038_0000046 | Ga0501038_0000046_100288_101229 | 313 |
| 1063 | 3300049575 | Ga0501039_0000002 | Ga0501039_0000002_218039_218980 | 313 |
| 1064 | 3300049575 | Ga0501039_0000003 | Ga0501039_0000003_90798_91739 | 313 |
| 1065 | 3300049576 | Ga0501040_0002028 | Ga0501040_0002028_8773_9714 | 313 |
| 1066 | 3300049579 | Ga0501043_0000029 | Ga0501043_0000029_13697_14638 | 313 |
| 1067 | 3300049579 | Ga0501043_0000051 | Ga0501043_0000051_23821_24762 | 313 |
| 1068 | 3300049579 | Ga0501043_0001754 | Ga0501043_0001754_16742_17683 | 313 |
| 1069 | 3300049581 | Ga0501047_0000801 | Ga0501047_0000801_28455_29396 | 313 |
| 1070 | 3300049581 | Ga0501047_0060138 | Ga0501047_0060138_1744_2685 | 313 |
| 1071 | 3300049581 | Ga0501047_0268666 | Ga0501047_0268666_129_1070 | 313 |
| 1072 | 3300049585 | Ga0501069_0000031 | Ga0501069_0000031_13716_14657 | 313 |
| 1073 | 3300049585 | Ga0501069_0143906 | Ga0501069_0143906_162_1103 | 313 |
| 1074 | 3300049586 | Ga0501070_0000045 | Ga0501070_0000045_13716_14657 | 313 |
| 1075 | 3300049586 | Ga0501070_0075850 | Ga0501070_0075850_880_1821 | 313 |
| 1076 | 3300049587 | Ga0501071_0002491 | Ga0501071_0002491_34_975 | 313 |
| 1077 | 3300049589 | Ga0501073_0318334 | Ga0501073_0318334_98_1039 | 313 |
| 1078 | 3300049590 | Ga0501074_0000012 | Ga0501074_0000012_79799_80740 | 313 |
| 1079 | 3300049742 | Ga0501080_0004574 | Ga0501080_0004574_7409_8350 | 313 |
| 1080 | 3300049742 | Ga0501080_0159814 | Ga0501080_0159814_615_1556 | 313 |
| 1081 | 3300049744 | Ga0501083_0000078 | Ga0501083_0000078_25063_26004 | 313 |
| 1082 | 3300049744 | Ga0501083_0060708 | Ga0501083_0060708_1468_2412 | 313 |
| 1083 | 3300049822 | Ga0501035_0000022 | Ga0501035_0000022_48925_49866 | 313 |
| 1084 | 3300049822 | Ga0501035_0000102 | Ga0501035_0000102_82194_83135 | 313 |
| 1085 | 3300049822 | Ga0501035_0000950 | Ga0501035_0000950_24983_25966 | 313 |
| 1086 | 3300049822 | Ga0501035_0003111 | Ga0501035_0003111_1057_1998 | 313 |
| 1087 | 3300049822 | Ga0501035_0093191 | Ga0501035_0093191_1640_2581 | 313 |
| 1088 | 3300049822 | Ga0501035_0148745 | Ga0501035_0148745_307_1248 | 313 |
| 1089 | 3300049823 | Ga0501044_0000002 | Ga0501044_0000002_156173_157114 | 313 |
| 1090 | 3300049823 | Ga0501044_0000113 | Ga0501044_0000113_13716_14657 | 313 |
| 1091 | 3300049823 | Ga0501044_0057809 | Ga0501044_0057809_1808_2749 | 313 |
| 1092 | 3300049823 | Ga0501044_0065523 | Ga0501044_0065523_38_979 | 313 |
| 1093 | 3300049823 | Ga0501044_0079931 | Ga0501044_0079931_165_1106 | 313 |
| 1094 | 3300049823 | Ga0501044_0189940 | Ga0501044_0189940_802_1743 | 313 |
| 1095 | 3300049824 | Ga0501045_0138904 | Ga0501045_0138904_710_1651 | 313 |
| 1096 | 3300049824 | Ga0501045_0318137 | Ga0501045_0318137_76_1017 | 313 |
| 1097 | 3300050492 | nmdc:mga0yw44_13656_c1 | nmdc:mga0yw44_13656_c1_432_1388 | 313 |
| 1098 | 3300050492 | nmdc:mga0yw44_19308_c1 | nmdc:mga0yw44_19308_c1_1342_2283 | 313 |
| 1099 | 3300050492 | nmdc:mga0yw44_41468_c1 | nmdc:mga0yw44_41468_c1_430_1371 | 313 |
| 1100 | 3300053096 | Ga0500641_0048969 | Ga0500641_0048969_52_999 | 313 |
| 1101 | 3300053107 | Ga0500560_002179 | Ga0500560_002179_1323_2267 | 313 |
| 1102 | 3300053109 | Ga0500569_048241 | Ga0500569_048241_308_1252 | 313 |
| 1103 | 3300053111 | Ga0500572_009295 | Ga0500572_009295_765_1709 | 313 |
| 1104 | 3300053122 | Ga0500608_042476 | Ga0500608_042476_124_1182 | 313 |
| 1105 | 3300053125 | Ga0500618_000227 | Ga0500618_000227_39369_40316 | 313 |
| 1106 | 3300053125 | Ga0500618_005699 | Ga0500618_005699_362_1306 | 313 |
| 1107 | 3300053134 | Ga0500658_0032453 | Ga0500658_0032453_758_1726 | 313 |
| 1108 | 3300053139 | Ga0500568_0012950 | Ga0500568_0012950_1128_2096 | 313 |
| 1109 | 3300053153 | Ga0500616_0003869 | Ga0500616_0003869_2151_3098 | 313 |
| 1110 | 3300053153 | Ga0500616_0055492 | Ga0500616_0055492_25_966 | 313 |
| 1111 | 3300053156 | Ga0500622_0004006 | Ga0500622_0004006_1606_2550 | 313 |
| 1112 | 3300053156 | Ga0500622_0033890 | Ga0500622_0033890_1594_2550 | 313 |
| 1113 | 3300053157 | Ga0500624_003548 | Ga0500624_003548_769_1713 | 313 |
| 1114 | 3300053177 | Ga0500636_0031858 | Ga0500636_0031858_490_1434 | 313 |
| 1115 | iso_pu_bacteria | 2512047086 | 2512532438 | 313 |
| 1116 | iso_pu_bacteria | 2513237159 | 2514001893 | 313 |
| 1117 | iso_pu_bacteria | 2582581304 | 2585256608 | 313 |
| 1118 | iso_pu_bacteria | 2599185236 | 2599723053 | 313 |
| 1119 | iso_pu_bacteria | 2600254933 | 2600375272 | 313 |
| 1120 | iso_pu_bacteria | 2718218009 | 2719731044 | 313 |
| 1121 | iso_pu_bacteria | 2718218363 | 2721146389 | 313 |
| 1122 | iso_pu_bacteria | 2718218366 | 2721163268 | 313 |
| 1123 | iso_pu_bacteria | 2721755514 | 2722839438 | 313 |
| 1124 | iso_pu_bacteria | 2721755810 | 2724043800 | 313 |
| 1125 | iso_pu_bacteria | 2728369365 | 2730163532 | 313 |
| 1126 | iso_pu_bacteria | 2728369397 | 2730297543 | 313 |
| 1127 | iso_pu_bacteria | 2791355094 | 2792638332 | 313 |
| 1128 | iso_pu_bacteria | 2791355260 | 2793321095 | 313 |
| 1129 | iso_pu_bacteria | 2978969890 | 2978973802 | 313 |
| 1130 | iso_pu_bacteria | 2984587000 | 2984589151 | 313 |
| 1131 | iso_pu_bacteria | 8054460903 | 8054461904 | 313 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qat-assembly1.cif.gz_A | crystal structure of acyl-carrier-protein-s-malonyltransferase from bartonella henselae | 0.9874 | 1 | 312 |
| 3qat-assembly1.cif.gz_A | crystal structure of acyl-carrier-protein-s-malonyltransferase from bartonella henselae | 0.9842 | 1 | 312 |
| 2g2y-assembly1.cif.gz_A | structure of e.coli fabd complexed with malonate | 0.9795 | 3 | 307 |
| 3hjv-assembly1.cif.gz_B | 1.7 angstrom resolution crystal structure of an acyl carrier protein s-malonyltransferase from vibrio cholerae o1 biovar eltor str. n16961 | 0.9767 | 1 | 306 |
| 3h0p-assembly1.cif.gz_A | 2.0 angstrom crystal structure of an acyl carrier protein s-malonyltransferase from salmonella typhimurium. | 0.9739 | 1 | 308 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tqeA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding | 0.986 | 127 | 198 | 3.30.70.250 |
| 3qatA01 | Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 | 0.9847 | 1 | 312 | 3.40.366.10 |
| af_P0AAI9_6_286_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9804 | 5 | 286 | 3.20.10.10 |
| 3qatA01 | Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 | 0.9767 | 1 | 312 | 3.40.366.10 |
| af_P0AAI9_6_286_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9735 | 5 | 286 | 3.20.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1PFN9-F1-model_v4 | [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) | 0.9971 | 85 | 312 |
GO:0004314
GO:0005829 GO:0006633 |
| AF-A0A512IKK0-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9911 | 1 | 306 |
GO:0004314
GO:0005829 GO:0006633 |
| AF-X5MGQ1-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9905 | 1 | 312 |
GO:0004314
GO:0005829 GO:0006633 |
| AF-X5MGQ1-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9874 | 1 | 312 |
GO:0004314
GO:0005829 GO:0006633 |
| AF-A0A2S6R8W3-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9871 | 17 | 311 |
GO:0004314
GO:0005829 GO:0006633 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar