F490544

General Info

Members Datasets Scaffolds Average Seq Length
1131 912 440 310

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10002216|Ga0157373_100022166
Length 324
Sequence MEVEKNKGKARQEGPHPMGIAFTFPGQGSQAIGMGKELADTYPEARAVFQEVDDALGQKLSDIMWNGPEETLTLTANAQPALMAVSMAVMRVLEARGLKLSDAVSYVAGHSLGEYSALCAAGTFSIADTARLLRIRGNAMQAAVPVGEGAMAAIIGLEHDAVSAICEEASILGVCQIANDNGGXXLVIEKAAAIASEKGAKRAIMLPVSAPFHSALMAPAAEAMREALAAVEKNNPVVPVIANVRAAPVSDANEIAALLVEQVTGQVRWRETVEWFAANNVTQLYEIGSGKVLTGLARRIDKTVNGVAVNGAADIDQLLATLIG

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
10 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
11 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
12 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
13 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
14 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
15 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
16 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
17 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
18 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
19 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
20 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
21 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
22 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
23 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
24 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
25 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
26 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
27 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
28 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
29 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
30 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
31 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
32 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
33 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
34 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
35 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
36 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
37 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
38 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
39 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
40 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
41 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
42 2516143018 Ensifer sp. BR816 Isolate Nodule
43 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
44 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
45 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
46 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
47 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
48 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
49 2519899620 Rhizobium sp. Pop5 Isolate Nodule
50 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
51 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
52 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
53 2534681786 Brucella suis 92/29 Isolate Unclassified
54 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
55 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
56 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
57 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
58 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
59 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
60 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
61 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
62 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
63 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
64 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
65 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
66 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
67 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
68 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
69 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
70 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
71 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
72 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
73 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
74 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
75 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
76 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
77 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
78 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
79 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
80 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
81 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
82 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
83 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
84 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
85 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
86 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
87 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
88 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
89 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
90 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
91 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
92 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
93 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
94 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
95 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
96 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
97 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
98 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
99 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
100 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
101 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
102 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
103 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
104 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
105 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
106 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
107 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
108 2643221557 Ensifer sp. Root558 Isolate Unclassified
109 2643221558 Rhizobium sp. Root149 Isolate Unclassified
110 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
111 2643221568 Rhizobium sp. Root564 Isolate Unclassified
112 2643221582 Rhizobium sp. Root651 Isolate Unclassified
113 2643221599 Rhizobium sp. Root708 Isolate Unclassified
114 2643221607 Rhizobium sp. Root73 Isolate Unclassified
115 2643221610 Ensifer sp. Root74 Isolate Unclassified
116 2643221618 Ensifer sp. Root231 Isolate Unclassified
117 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
118 2643221626 Ensifer sp. Root31 Isolate Unclassified
119 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
120 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
121 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
122 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
123 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
124 2643221655 Ensifer sp. Root1252 Isolate Unclassified
125 2643221659 Ensifer sp. Root127 Isolate Unclassified
126 2643221668 Ensifer sp. Root423 Isolate Unclassified
127 2643221675 Ensifer sp. Root1298 Isolate Unclassified
128 2643221680 Ensifer sp. Root1312 Isolate Unclassified
129 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
130 2643221688 Rhizobium sp. Root482 Isolate Unclassified
131 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
132 2643221693 Rhizobium sp. Root491 Isolate Unclassified
133 2643221698 Ensifer sp. Root142 Isolate Unclassified
134 2643221712 Ensifer sp. Root258 Isolate Unclassified
135 2643221718 Rhizobium sp. Root268 Isolate Unclassified
136 2643221719 Rhizobium sp. Root274 Isolate Unclassified
137 2643221723 Ensifer sp. Root278 Isolate Unclassified
138 2643221726 Ensifer sp. Root954 Isolate Unclassified
139 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
140 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
141 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
142 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
143 2718217927 Rhizobium sp. N324 Isolate Nodule
144 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
145 2718218009 Rhizobium sp. N561 Isolate Nodule
146 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
147 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
148 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
149 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
150 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
151 2718218363 Rhizobium sp. N113 Isolate Nodule
152 2718218366 Rhizobium sp. N621 Isolate Nodule
153 2718218423 Rhizobium sp. N941 Isolate Nodule
154 2721755514 Rhizobium sp. N6212 Isolate Nodule
155 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
156 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
157 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
158 2721755809 Rhizobium sp. N541 Isolate Nodule
159 2721755810 Rhizobium sp. N871 Isolate Nodule
160 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
161 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
162 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
163 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
164 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
165 2728369365 Rhizobium sp. N1341 Isolate Nodule
166 2728369397 Rhizobium sp. N1314 Isolate Nodule
167 2738541293 Rhizobium sp. GV031 Isolate Unclassified
168 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
169 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
170 2751185800 Brucella pituitosa AA2 Isolate Unclassified
171 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
172 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
173 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
174 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
175 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
176 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
177 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
178 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
179 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
180 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
181 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
182 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
183 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
184 2791355256 Rhizobium sp. M10 Isolate Nodule
185 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
186 2791355260 Rhizobium sp. L9 Isolate Nodule
187 2791355261 Rhizobium sp. J15 Isolate Nodule
188 2791355262 Rhizobium sp. M1 Isolate Nodule
189 2791355263 Rhizobium chutanense C5 Isolate Nodule
190 2791355264 Rhizobium sp. S9 Isolate Nodule
191 2791355265 Rhizobium sp. H4 Isolate Nodule
192 2791355266 Rhizobium sp. L43 Isolate Nodule
193 2791355267 Rhizobium sp. L18 Isolate Nodule
194 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
195 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
196 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
197 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
198 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
199 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
200 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
201 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
202 2802429633 Rhizobium anhuiense J3 Isolate Nodule
203 2802429634 Rhizobium anhuiense S10 Isolate Nodule
204 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
205 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
206 2802429637 Rhizobium anhuiense C15 Isolate Nodule
207 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
208 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
209 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
210 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
211 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
212 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
213 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
214 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
215 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
216 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
217 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
218 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
219 2838048938 Rhizobium pisi 27/80 Isolate Nodule
220 2838061910 Rhizobium phaseoli L15 Isolate Nodule
221 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
222 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
223 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
224 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
225 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
226 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
227 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
228 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
229 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
230 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
231 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
232 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
233 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
234 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
235 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
236 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
237 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
238 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
239 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
240 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
241 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
242 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
243 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
244 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
245 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
246 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
247 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
248 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
249 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
250 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
251 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
252 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
253 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
254 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
255 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
256 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
257 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
258 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
259 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
260 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
261 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
262 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
263 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
264 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
265 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
266 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
267 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
268 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
269 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
270 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
271 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
272 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
273 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
274 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
275 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
276 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
277 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
278 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
279 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
280 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
281 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
282 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
283 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
284 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
285 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
286 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
287 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
288 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
289 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
290 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
291 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
292 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
293 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
294 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
295 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
296 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
297 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
298 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
299 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
300 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
301 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
302 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
303 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
304 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
305 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
306 2844163670 Ensifer sp. 1H6 Isolate Unclassified
307 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
308 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
309 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
310 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
311 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
312 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
313 2854911287 Brucella lupini LUP21 Isolate Unclassified
314 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
315 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
316 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
317 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
318 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
319 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
320 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
321 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
322 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
323 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
324 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
325 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
326 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
327 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
328 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
329 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
330 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
331 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
332 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
333 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
334 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
335 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
336 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
337 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
338 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
339 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
340 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
341 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
342 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
343 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
344 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
345 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
346 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
347 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
348 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
349 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
350 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
351 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
352 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
353 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
354 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
355 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
356 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
357 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
358 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
359 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
360 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
361 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
362 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
363 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
364 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
365 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
366 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
367 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
368 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
369 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
370 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
371 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
372 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
373 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
374 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
375 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
376 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
377 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
378 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
379 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
380 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
381 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
382 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
383 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
384 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
385 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
386 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
387 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
388 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
389 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
390 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
391 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
392 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
393 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
394 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
395 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
396 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
397 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
398 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
399 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
400 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
401 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
402 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
403 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
404 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
405 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
406 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
407 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
408 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
409 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
410 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
411 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
412 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
413 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
414 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
415 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
416 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
417 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
418 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
419 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
420 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
421 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
422 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
423 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
424 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
425 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
426 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
427 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
428 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
429 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
430 2933599457 Rhizobium phaseoli M3 Isolate Nodule
431 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
432 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
433 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
434 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
435 2936381700 Rhizobium chutanense C16 Isolate Unclassified
436 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
437 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
438 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
439 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
440 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
441 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
442 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
443 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
444 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
445 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
446 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
447 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
448 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
449 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
450 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
451 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
452 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
453 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
454 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
455 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
456 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
457 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
458 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
459 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
460 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
461 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
462 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
463 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
464 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
465 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
466 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
467 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
468 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
469 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
470 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
471 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
472 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
473 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
474 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
475 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
476 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
477 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
478 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
479 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
480 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
481 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
482 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
483 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
484 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
485 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
486 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
487 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
488 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
489 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
490 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
491 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
492 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
493 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
494 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
495 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
496 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
497 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
498 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
499 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
500 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
501 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
502 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
503 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
504 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
505 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
506 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
507 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
508 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
509 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
510 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
511 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
512 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
513 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
514 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
515 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
516 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
517 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
518 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
519 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
520 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
521 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
522 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
523 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
524 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
525 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
526 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
527 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
528 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
529 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
530 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
531 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
532 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
533 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
534 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
535 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
536 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
537 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
538 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
539 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
540 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
541 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
542 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
543 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
544 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
545 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
546 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
547 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
548 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
549 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
550 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
551 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
552 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
553 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
554 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
555 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
556 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
557 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
558 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
559 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
560 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
561 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
562 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
563 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
564 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
565 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
566 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
567 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
568 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
569 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
570 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
571 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
572 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
573 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
574 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
575 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
576 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
577 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
578 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
579 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
580 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
581 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
582 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
583 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
584 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
585 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
586 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
587 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
588 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
589 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
590 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
591 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
592 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
593 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
594 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
595 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
596 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
597 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
598 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
599 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
600 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
601 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
602 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
603 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
604 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
605 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
606 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
607 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
608 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
609 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
610 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
611 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
612 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
613 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
614 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
615 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
616 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
617 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
618 2996887358 Rhizobium sp. R711 Isolate Nodule
619 2996893221 Rhizobium sp. R635 Isolate Nodule
620 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
621 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
622 3004167301 Mesorhizobium loti 582 Isolate Unclassified
623 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
624 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
625 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
626 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
627 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
628 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
629 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
630 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
631 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
632 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
633 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
634 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
635 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
636 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
637 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
638 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
639 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
640 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
641 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
642 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
643 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
644 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
645 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
646 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
647 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
648 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
649 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
650 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
651 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
652 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
653 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
654 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
655 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
656 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
657 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
658 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
659 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
660 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
661 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
662 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
663 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
664 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
665 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
666 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
667 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
668 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
669 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
670 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
671 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
672 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
673 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
674 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
675 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
676 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
677 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
678 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
679 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
680 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
681 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
682 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
683 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
684 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
685 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
686 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
687 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
688 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
689 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
690 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
691 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
692 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
693 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
694 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
695 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
696 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
697 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
698 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
699 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
700 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
701 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
702 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
703 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
704 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
705 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
706 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
707 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
708 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
709 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
710 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
711 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
712 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
713 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
714 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
715 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
716 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
717 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
718 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
719 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
720 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
721 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
722 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
723 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
724 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
725 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
726 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
727 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
728 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
729 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
730 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
731 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
732 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
733 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
734 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
735 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
736 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
737 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
738 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
739 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
740 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
741 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
742 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
743 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
744 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
745 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
746 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
747 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
748 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
749 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
750 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
751 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
752 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
753 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
754 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
755 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
756 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
757 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
758 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
759 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
760 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
761 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
762 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
763 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
764 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
765 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
766 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
767 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
768 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
769 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
770 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
771 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
772 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
773 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
774 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
775 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
776 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
777 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
778 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
779 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
780 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
781 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
782 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
783 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
784 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
785 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
786 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
787 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
788 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
789 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
790 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
791 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
792 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
793 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
794 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
795 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
796 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
797 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
798 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
799 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
800 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
801 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
802 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
803 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
804 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
805 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
806 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
807 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
808 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
809 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
810 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
811 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
812 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
813 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
814 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
815 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
816 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
817 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
818 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
819 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
820 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
821 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
822 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
823 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
824 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
825 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
826 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
827 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
828 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
829 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
830 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
831 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
832 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
833 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
834 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
835 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
836 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
837 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
838 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
839 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
840 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
841 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
842 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
843 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
844 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
845 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
846 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
847 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
848 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
849 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
850 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
851 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
852 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
853 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
854 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
855 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
856 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
857 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
858 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
859 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
860 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
861 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
862 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
863 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
864 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
865 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
866 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
867 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
868 8005258706 Rhizobium sp. R693 Isolate Nodule
869 8005275841 Rhizobium sp. N4311 Isolate Nodule
870 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
871 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
872 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
873 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
874 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
875 8005321885 Rhizobium sp. R72 Isolate Nodule
876 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
877 8005382845 Rhizobium sp. R634 Isolate Nodule
878 8005395548 Rhizobium sp. R339 Isolate Nodule
879 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
880 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
881 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
882 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
883 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
884 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
885 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
886 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
887 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
888 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
889 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
890 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
891 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
892 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
893 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
894 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
895 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
896 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
897 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
898 8018176218 Rhizobium sp. N122 Isolate Nodule
899 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
900 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
901 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
902 8024501048 Rhizobium sp. H4 Isolate Nodule
903 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
904 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
905 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
906 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
907 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
908 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
909 8056382006 Rhizobium croatiense 13T Isolate Nodule
910 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
911 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
912 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 38.9
Metatranscriptomes 0
Isolates 61.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 13.44
Nodule 46.24
Rhizoplane 2.48
Rhizosphere 22.02
Stem 0
Stem Tuber 0
Unclassified 15.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10007068 3300001989 Bacteria 4225
2 JGI25162J39368_1004608 3300002737 Bacteria 3114
3 JGI25158J39367_1000407 3300002739 Bacteria 8986
4 JGI25152J39213_1005768 3300002773 Bacteria 3526
5 JGI25152J39213_1006937 3300002773 Bacteria 2993
6 JGI25150J39212_1001462 3300002774 Bacteria 6581
7 JGI25159J45721_1000002 3300002987 Bacteria 289163
8 JGI25159J45721_1000299 3300002987 Bacteria 23242
9 JGI25159J45721_1001244 3300002987 Bacteria 10748
10 JGI25151J46595_10015298 3300003187 Bacteria 3386
11 JGI25165J46597_1005540 3300003214 Bacteria 2412
12 JGI25165J46597_1008647 3300003214 Bacteria 1583
13 JGI25153J46596_10009883 3300003215 Bacteria 4375
14 JGI25153J46596_10010716 3300003215 Bacteria 4121
15 JGI25160J50197_1000008 3300003354 Bacteria 289163
16 JGI25160J50197_1000015 3300003354 Bacteria 250902
17 JGI25161J50226_1000005 3300003374 Bacteria 292548
18 JGI25161J50226_1001391 3300003374 Bacteria 7366
19 JGI25161J50226_1001583 3300003374 Bacteria 6654
20 Ga0055526_1004652 3300003771 Bacteria 8162
21 Ga0055526_1009202 3300003771 Bacteria 4794
22 Ga0055526_1010667 3300003771 Bacteria 4244
23 Ga0055524_1003638 3300003775 Bacteria 7408
24 Ga0055524_1006936 3300003775 Bacteria 4870
25 Ga0055524_1009966 3300003775 Bacteria 3818
26 Ga0055536_1015294 3300003781 Bacteria 2636
27 Ga0055528_1005083 3300003790 Bacteria 6203
28 Ga0055528_1007761 3300003790 Bacteria 4695
29 Ga0055528_1012526 3300003790 Bacteria 3283
30 Ga0055528_1023932 3300003790 Bacteria 1847
31 Ga0055530_10005675 3300003791 Bacteria 5836
32 Ga0055540_1002625 3300003792 Bacteria 9328
33 Ga0055540_1008490 3300003792 Bacteria 3692
34 Ga0055531_10002261 3300003794 Bacteria 13034
35 Ga0055531_10007612 3300003794 Bacteria 5869
36 Ga0058692_1002692 3300003856 Bacteria 5849
37 Ga0058692_1011160 3300003856 Bacteria 2187
38 Ga0055543_1000012 3300004625 Bacteria 186581
39 Ga0055543_1000040 3300004625 Bacteria 122485
40 Ga0055543_1001946 3300004625 Bacteria 7366
41 Ga0065165_1000015 3300005262 Bacteria 289201
42 Ga0065165_1002531 3300005262 Bacteria 15197
43 Ga0065165_1003987 3300005262 Bacteria 9651
44 Ga0065165_1007707 3300005262 Bacteria 5214
45 Ga0065165_1011545 3300005262 Bacteria 3669
46 Ga0070670_100009711 3300005331 Bacteria 8216
47 Ga0070661_100002760 3300005344 Bacteria 12042
48 Ga0070661_100006288 3300005344 Bacteria 8194
49 Ga0070661_100312143 3300005344 Bacteria 1226
50 Ga0070671_100009450 3300005355 Bacteria 7827
51 Ga0070667_100335353 3300005367 Bacteria 1367
52 Ga0068853_100004761 3300005539 Bacteria 10552
53 Ga0068853_100078999 3300005539 Bacteria 2876
54 Ga0070665_100100746 3300005548 Bacteria 2893
55 Ga0070665_100192330 3300005548 Bacteria 2041
56 Ga0068854_100034747 3300005578 Bacteria 3523
57 Ga0068851_10005798 3300005834 Bacteria 5627
58 Ga0075365_10001318 3300006038 Bacteria 11080
59 Ga0075365_10003852 3300006038 Bacteria 7835
60 Ga0075365_10077370 3300006038 Bacteria 2248
61 Ga0075365_10232344 3300006038 Bacteria 1295
62 Ga0075368_10004614 3300006042 Bacteria 4684
63 Ga0075363_100256935 3300006048 Bacteria 1007
64 Ga0075364_10003962 3300006051 Bacteria 8500
65 Ga0075364_10069082 3300006051 Bacteria 2324
66 Ga0075367_10012849 3300006178 Bacteria 4483
67 Ga0075367_10115807 3300006178 Bacteria 1648
68 Ga0075369_10019091 3300006186 Bacteria 2796
69 Ga0075369_10034254 3300006186 Bacteria 2155
70 Ga0075366_10176209 3300006195 Bacteria 1298
71 Ga0075370_10204801 3300006353 Bacteria 1164
72 Ga0079104_1000032 3300006946 Bacteria 203094
73 Ga0099826_10078772 3300006948 Bacteria 2062
74 Ga0099826_10079873 3300006948 Bacteria 2042
75 Ga0105240_10000032 3300009093 Bacteria 283907
76 Ga0105248_10093909 3300009177 Bacteria 3378
77 Ga0105237_10000754 3300009545 Bacteria 44371
78 Ga0105237_10302382 3300009545 Bacteria 1603
79 Ga0123342_1031086 3300009766 Bacteria 2617
80 Ga0105239_10003143 3300010375 Bacteria 20495
81 Ga0105239_10015417 3300010375 Bacteria 8467
82 Ga0157373_10002216 3300013100 Bacteria 14709
83 Ga0157373_10066043 3300013100 Bacteria 2560
84 Ga0157371_10000073 3300013102 Bacteria 163215
85 Ga0157371_10014140 3300013102 Bacteria 6034
86 Ga0157370_10000972 3300013104 Bacteria 36292
87 Ga0157369_10063657 3300013105 Bacteria 3973
88 Ga0157369_10196501 3300013105 Bacteria 2118
89 Ga0171463_1001 3300013249 Bacteria 1406070
90 Ga0182007_10005040 3300015262 Bacteria 5865
91 Ga0182005_1012560 3300015265 Bacteria 2390
92 Ga0183363_1451 3300015690 Bacteria 2565
93 Ga0214544_1000017 3300021320 Bacteria 193638
94 Ga0214542_1000006 3300021321 Bacteria 345164
95 Ga0214543_1000003 3300021327 Bacteria 692327
96 Ga0214543_1000014 3300021327 Bacteria 324986
97 Ga0228711_1000001 3300022739 Bacteria 357377
98 Ga0228710_1000001 3300022740 Bacteria 314328
99 Ga0209436_100315 3300025208 Bacteria 22202
100 Ga0209436_101147 3300025208 Bacteria 9795
101 Ga0209437_100033 3300025233 Bacteria 512520
102 Ga0209677_101323 3300025253 Bacteria 10926
103 Ga0209759_1013620 3300025256 Bacteria 2191
104 Ga0209129_1000420 3300025258 Bacteria 32649
105 Ga0209129_1003371 3300025258 Bacteria 7023
106 Ga0209129_1003477 3300025258 Bacteria 6822
107 Ga0209129_1008011 3300025258 Bacteria 3012
108 Ga0209233_1000064 3300025261 Bacteria 392156
109 Ga0209233_1000209 3300025261 Bacteria 115124
110 Ga0209673_1000041 3300025273 Bacteria 307397
111 Ga0209673_1000319 3300025273 Bacteria 88129
112 Ga0209673_1000603 3300025273 Bacteria 55646
113 Ga0209673_1009838 3300025273 Bacteria 4094
114 Ga0209673_1011121 3300025273 Bacteria 3734
115 Ga0209673_1037998 3300025273 Bacteria 1407
116 Ga0209130_1000006 3300025284 Bacteria 596528
117 Ga0209130_1000007 3300025284 Bacteria 591584
118 Ga0209130_1000018 3300025284 Bacteria 388301
119 Ga0209130_1011895 3300025284 Bacteria 2307
120 Ga0209130_1013814 3300025284 Bacteria 2053
121 Ga0209676_1003497 3300025292 Bacteria 9618
122 Ga0209676_1016484 3300025292 Bacteria 2664
123 Ga0209676_1022064 3300025292 Bacteria 2118
124 Ga0209025_1000074 3300025294 Bacteria 277445
125 Ga0209025_1000080 3300025294 Bacteria 267244
126 Ga0209025_1000100 3300025294 Bacteria 229182
127 Ga0209025_1001440 3300025294 Bacteria 31293
128 Ga0209025_1008335 3300025294 Bacteria 7472
129 Ga0209025_1013593 3300025294 Bacteria 5098
130 Ga0209025_1024975 3300025294 Bacteria 3061
131 Ga0209564_1000425 3300025295 Bacteria 74279
132 Ga0209564_1000439 3300025295 Bacteria 71637
133 Ga0209564_1004856 3300025295 Bacteria 7991
134 Ga0209564_1011003 3300025295 Bacteria 4099
135 Ga0209564_1027287 3300025295 Bacteria 1858
136 Ga0209758_1000554 3300025297 Bacteria 59218
137 Ga0209758_1002005 3300025297 Bacteria 21904
138 Ga0209758_1017001 3300025297 Bacteria 3653
139 Ga0209758_1017730 3300025297 Bacteria 3525
140 Ga0209758_1021436 3300025297 Bacteria 3012
141 Ga0209758_1029384 3300025297 Bacteria 2300
142 Ga0209050_1006521 3300025298 Bacteria 6879
143 Ga0209050_1016786 3300025298 Bacteria 2968
144 Ga0209256_1000994 3300025299 Bacteria 33764
145 Ga0209256_1002348 3300025299 Bacteria 15760
146 Ga0209256_1002894 3300025299 Bacteria 13006
147 Ga0209256_1005095 3300025299 Bacteria 7802
148 Ga0209256_1011458 3300025299 Bacteria 3541
149 Ga0209256_1011586 3300025299 Bacteria 3505
150 Ga0209256_1022664 3300025299 Bacteria 1894
151 Ga0207426_1000044 3300025302 Bacteria 428043
152 Ga0207426_1000064 3300025302 Bacteria 358276
153 Ga0207426_1000106 3300025302 Bacteria 244368
154 Ga0209051_1000459 3300025303 Bacteria 53735
155 Ga0209051_1000514 3300025303 Bacteria 48877
156 Ga0209051_1001705 3300025303 Bacteria 17601
157 Ga0209051_1002690 3300025303 Bacteria 12386
158 Ga0209257_1002541 3300025304 Bacteria 17865
159 Ga0209257_1007417 3300025304 Bacteria 6627
160 Ga0207656_10003313 3300025321 Bacteria 5518
161 Ga0207695_10000024 3300025913 Bacteria 632311
162 Ga0207671_10003700 3300025914 Bacteria 15077
163 Ga0207657_10019763 3300025919 Bacteria 6385
164 Ga0207657_10154095 3300025919 Bacteria 1870
165 Ga0207650_10001915 3300025925 Bacteria 14658
166 Ga0207644_10067027 3300025931 Bacteria 2615
167 Ga0207711_10181472 3300025941 Bacteria 1914
168 Ga0207667_10020644 3300025949 Bacteria 7321
169 Ga0207668_10155547 3300025972 Bacteria 1776
170 Ga0207658_10310535 3300025986 Bacteria 1362
171 Ga0207639_10010406 3300026041 Bacteria 6441
172 Ga0207678_10023512 3300026067 Bacteria 5389
173 Ga0207678_10161027 3300026067 Bacteria 1917
174 Ga0207698_10013180 3300026142 Bacteria 5443
175 Ga0209281_1000053 3300027111 Bacteria 309587
176 Ga0209281_1000266 3300027111 Bacteria 100574
177 Ga0209371_1000021 3300027312 Bacteria 555864
178 Ga0209282_1000007 3300027666 Bacteria 254917
179 Ga0209282_1000102 3300027666 Bacteria 57412
180 Ga0268266_10377822 3300028379 Bacteria 1336
181 Ga0307515_10000070 3300028794 Bacteria 239322
182 Ga0307515_10003572 3300028794 Bacteria 32658
183 Ga0307515_10010166 3300028794 Bacteria 18072
184 Ga0307515_10231489 3300028794 Bacteria 1639
185 Ga0268256_1000020 3300030500 Bacteria 557873
186 Ga0316181_1097764 3300030744 Bacteria 4086
187 Ga0307513_10008740 3300031456 Bacteria 12903
188 Ga0307408_100149344 3300031548 Bacteria 1843
189 Ga0307516_10042951 3300031730 Bacteria 4482
190 Ga0315914_1000006 3300031967 Bacteria 239817
191 Ga0307414_10016210 3300032004 Bacteria 4523
192 Ga0315913_1000002 3300033430 Bacteria 241452
193 Ga0315915_1000001 3300033464 Bacteria 481518
194 Ga0373946_0022994 3300035171 Bacteria 2432
195 Ga0373927_0000925 3300035695 Bacteria 22236
196 Ga0316582_0089496 3300036647 Bacteria 2024
197 Ga0373925_0003381 3300037068 Bacteria 12371
198 Ga0395899_0000213 3300037312 Bacteria 83403
199 Ga0395900_0000121 3300037418 Bacteria 135026
200 Ga0395900_0094881 3300037418 Bacteria 3065
201 Ga0395898_0000247 3300037466 Bacteria 135026
202 Ga0395905_0000112 3300037471 Bacteria 135010
203 Ga0395905_0017948 3300037471 Bacteria 6719
204 Ga0395901_0000078 3300038443 Bacteria 135026
205 Ga0395901_0404396 3300038443 Bacteria 1402
206 Ga0439436_0025006 3300041404 Bacteria 1758
207 Ga0439439_0036435 3300041406 Bacteria 1266
208 Ga0439447_019582 3300041407 Bacteria 1803
209 Ga0439465_0015848 3300041413 Bacteria 2351
210 Ga0439465_0062662 3300041413 Bacteria 1234
211 Ga0439431_0023859 3300041997 Bacteria 1484
212 Ga0439432_062411 3300042006 Bacteria 1147
213 Ga0439449_0001282 3300042007 Bacteria 9833
214 Ga0450910_008733 3300042147 Bacteria 1428
215 Ga0495627_028880 3300046453 Bacteria 1769
216 Ga0495592_0050385 3300046454 Bacteria 3093
217 Ga0495638_0020463 3300046460 Bacteria 4372
218 Ga0495638_0024146 3300046460 Bacteria 3967
219 Ga0495651_0101369 3300046462 Bacteria 2143
220 Ga0495605_0052384 3300046474 Bacteria 1983
221 Ga0495662_0006888 3300046476 Bacteria 5647
222 Ga0495664_0257039 3300046477 Bacteria 1056
223 Ga0495607_0036799 3300046501 Bacteria 2946
224 Ga0495607_0107832 3300046501 Bacteria 1481
225 Ga0495583_0028074 3300046506 Bacteria 2771
226 Ga0495606_0015352 3300046507 Bacteria 5907
227 Ga0495606_0017659 3300046507 Bacteria 5384
228 Ga0495606_0081796 3300046507 Bacteria 2007
229 Ga0495606_0170967 3300046507 Bacteria 1260
230 Ga0495610_0023089 3300046512 Bacteria 3389
231 Ga0495610_0049229 3300046512 Bacteria 2064
232 Ga0495610_0158542 3300046512 Bacteria 959
233 Ga0495620_0012599 3300046515 Bacteria 4358
234 Ga0495620_0092744 3300046515 Bacteria 1210
235 Ga0495632_0059265 3300046519 Bacteria 1863
236 Ga0495643_0002659 3300046522 Bacteria 13838
237 Ga0495642_0167483 3300046528 Bacteria 954
238 Ga0495654_0000092 3300046530 Bacteria 101504
239 Ga0495597_0005990 3300046542 Bacteria 6341
240 Ga0495668_0051012 3300046616 Bacteria 2291
241 Ga0495625_0012288 3300046660 Bacteria 6944
242 Ga0495625_0073006 3300046660 Bacteria 2406
243 Ga0495661_0087487 3300046665 Bacteria 1781
244 Ga0495588_0037721 3300046674 Bacteria 2456
245 Ga0495657_0143833 3300046675 Bacteria 1485
246 Ga0495658_0076066 3300046683 Bacteria 1961
247 Ga0495600_0009138 3300046809 Bacteria 6113
248 Ga0495660_0001564 3300046810 Bacteria 15371
249 Ga0495604_0032390 3300047317 Bacteria 4143
250 Ga0495681_0010747 3300047470 Bacteria 5516
251 Ga0495686_0008600 3300047472 Bacteria 7470
252 Ga0495686_0027080 3300047472 Bacteria 3746
253 Ga0495686_0146621 3300047472 Bacteria 1388
254 Ga0496100_0230528 3300048903 Bacteria 1362
255 Ga0496102_0015568 3300048905 Bacteria 6625
256 Ga0496104_0360796 3300048907 Bacteria 1365
257 Ga0496105_0055157 3300048908 Bacteria 3281
258 Ga0496106_0003362 3300048909 Bacteria 11925
259 Ga0496106_0023088 3300048909 Bacteria 4620
260 Ga0496106_0089404 3300048909 Bacteria 2375
261 Ga0496106_0299690 3300048909 Bacteria 1289
262 Ga0496108_0178435 3300048911 Bacteria 1839
263 Ga0496109_0299691 3300048912 Bacteria 1516
264 Ga0496110_0138134 3300048913 Bacteria 2203
265 Ga0496110_0239681 3300048913 Bacteria 1650
266 Ga0496111_0000236 3300048914 Bacteria 26454
267 Ga0496111_0146862 3300048914 Bacteria 1748
268 Ga0496112_0190380 3300048915 Bacteria 2014
269 Ga0496112_0360785 3300048915 Bacteria 1395
270 Ga0496113_0198265 3300048916 Bacteria 1595
271 Ga0496114_0257392 3300048917 Bacteria 1536
272 Ga0496116_0000036 3300048919 Bacteria 388508
273 Ga0496116_0017649 3300048919 Bacteria 5530
274 Ga0496116_0026294 3300048919 Bacteria 4260
275 Ga0496117_0000002 3300048920 Bacteria 2483758
276 Ga0496117_0025724 3300048920 Bacteria 4620
277 Ga0496117_0047076 3300048920 Bacteria 3096
278 Ga0496117_0074025 3300048920 Bacteria 2270
279 Ga0496117_0103427 3300048920 Bacteria 1795
280 Ga0496118_0000214 3300048921 Bacteria 100898
281 Ga0496118_0002790 3300048921 Bacteria 22870
282 Ga0496118_0003651 3300048921 Bacteria 19121
283 Ga0496118_0054586 3300048921 Bacteria 3025
284 Ga0496118_0055489 3300048921 Bacteria 2989
285 Ga0496119_0013733 3300048922 Bacteria 6418
286 Ga0496119_0016653 3300048922 Bacteria 5578
287 Ga0496119_0018153 3300048922 Bacteria 5253
288 Ga0496120_0000125 3300048923 Bacteria 128983
289 Ga0496120_0011845 3300048923 Bacteria 5967
290 Ga0496120_0075534 3300048923 Bacteria 1839
291 Ga0496121_0000001 3300048924 Bacteria 1830318
292 Ga0496121_0001948 3300048924 Bacteria 32895
293 Ga0496121_0005233 3300048924 Bacteria 16787
294 Ga0496121_0023150 3300048924 Bacteria 5996
295 Ga0496121_0024937 3300048924 Bacteria 5699
296 Ga0496121_0034281 3300048924 Bacteria 4571
297 Ga0496121_0051611 3300048924 Bacteria 3462
298 Ga0496121_0252673 3300048924 Bacteria 1221
299 Ga0496122_0000001 3300048925 Bacteria 1827766
300 Ga0496122_0000160 3300048925 Bacteria 159236
301 Ga0496122_0024031 3300048925 Bacteria 5346
302 Ga0496122_0061635 3300048925 Bacteria 2751
303 Ga0496122_0089662 3300048925 Bacteria 2101
304 Ga0496122_0094524 3300048925 Bacteria 2023
305 Ga0496122_0128832 3300048925 Bacteria 1613
306 Ga0496123_0000001 3300048926 Bacteria 1831497
307 Ga0496123_0000034 3300048926 Bacteria 274836
308 Ga0496123_0022771 3300048926 Bacteria 4816
309 Ga0496123_0059455 3300048926 Bacteria 2471
310 Ga0496123_0085878 3300048926 Bacteria 1890
311 Ga0496123_0112713 3300048926 Bacteria 1550
312 Ga0496124_0000349 3300048927 Bacteria 84498
313 Ga0496124_0008594 3300048927 Bacteria 10654
314 Ga0496124_0030968 3300048927 Bacteria 4739
315 Ga0496124_0032626 3300048927 Bacteria 4594
316 Ga0496124_0060590 3300048927 Bacteria 3174
317 Ga0496124_0078365 3300048927 Bacteria 2723
318 Ga0496124_0131015 3300048927 Bacteria 1992
319 Ga0496124_0152290 3300048927 Bacteria 1812
320 Ga0496125_0000001 3300048928 Bacteria 1766138
321 Ga0496125_0008785 3300048928 Bacteria 10509
322 Ga0496125_0053355 3300048928 Bacteria 3314
323 Ga0496126_0000156 3300048929 Bacteria 158537
324 Ga0496126_0001886 3300048929 Bacteria 30413
325 Ga0496126_0077009 3300048929 Bacteria 2958
326 Ga0496126_0154530 3300048929 Bacteria 1964
327 Ga0496126_0210657 3300048929 Bacteria 1636
328 Ga0501031_0000060 3300049568 Bacteria 58759
329 Ga0501031_0002553 3300049568 Bacteria 11599
330 Ga0501031_0065131 3300049568 Bacteria 2374
331 Ga0501032_0000015 3300049569 Bacteria 176755
332 Ga0501032_0000025 3300049569 Bacteria 138521
333 Ga0501032_0030787 3300049569 Bacteria 3681
334 Ga0501032_0053548 3300049569 Bacteria 2717
335 Ga0501033_0000023 3300049570 Bacteria 176725
336 Ga0501033_0000229 3300049570 Bacteria 54036
337 Ga0501033_0000742 3300049570 Bacteria 29975
338 Ga0501033_0086334 3300049570 Bacteria 2297
339 Ga0501034_0000073 3300049571 Bacteria 176737
340 Ga0501034_0001654 3300049571 Bacteria 28764
341 Ga0501034_0020740 3300049571 Bacteria 6709
342 Ga0501034_0086434 3300049571 Bacteria 3136
343 Ga0501034_0175292 3300049571 Bacteria 2110
344 Ga0501034_0211689 3300049571 Bacteria 1894
345 Ga0501036_0000002 3300049572 Bacteria 293106
346 Ga0501036_0000151 3300049572 Bacteria 45499
347 Ga0501036_0354583 3300049572 Bacteria 1225
348 Ga0501037_0000048 3300049573 Bacteria 113375
349 Ga0501037_0000176 3300049573 Bacteria 60011
350 Ga0501038_0000002 3300049574 Bacteria 330446
351 Ga0501038_0000046 3300049574 Bacteria 106465
352 Ga0501039_0000002 3300049575 Bacteria 375152
353 Ga0501039_0000003 3300049575 Bacteria 357424
354 Ga0501040_0002028 3300049576 Bacteria 13049
355 Ga0501040_0099885 3300049576 Bacteria 2023
356 Ga0501043_0000029 3300049579 Bacteria 143328
357 Ga0501043_0000051 3300049579 Bacteria 106957
358 Ga0501043_0001754 3300049579 Bacteria 18691
359 Ga0501043_0072000 3300049579 Bacteria 2715
360 Ga0501046_0164079 3300049580 Bacteria 1669
361 Ga0501046_0215598 3300049580 Bacteria 1423
362 Ga0501047_0000801 3300049581 Bacteria 32872
363 Ga0501047_0052981 3300049581 Bacteria 3922
364 Ga0501047_0060138 3300049581 Bacteria 3667
365 Ga0501047_0268666 3300049581 Bacteria 1552
366 Ga0501048_0197354 3300049582 Bacteria 1426
367 Ga0501069_0000031 3300049585 Bacteria 97968
368 Ga0501069_0143906 3300049585 Bacteria 1368
369 Ga0501070_0000045 3300049586 Bacteria 107880
370 Ga0501070_0011905 3300049586 Bacteria 7346
371 Ga0501070_0075850 3300049586 Bacteria 2783
372 Ga0501071_0002491 3300049587 Bacteria 11196
373 Ga0501073_0046869 3300049589 Bacteria 3039
374 Ga0501073_0318334 3300049589 Bacteria 1073
375 Ga0501074_0000012 3300049590 Bacteria 83803
376 Ga0501074_0032004 3300049590 Bacteria 3812
377 Ga0501074_0118258 3300049590 Bacteria 1896
378 Ga0501076_0111306 3300049592 Bacteria 2213
379 Ga0501079_0128745 3300049741 Bacteria 1970
380 Ga0501080_0004574 3300049742 Bacteria 12329
381 Ga0501080_0008984 3300049742 Bacteria 9093
382 Ga0501080_0159814 3300049742 Bacteria 2081
383 Ga0501083_0000078 3300049744 Bacteria 65280
384 Ga0501083_0060708 3300049744 Bacteria 2525
385 Ga0501083_0216665 3300049744 Bacteria 1248
386 Ga0501280_011254 3300049776 Bacteria 1250
387 Ga0501035_0000022 3300049822 Bacteria 208622
388 Ga0501035_0000102 3300049822 Bacteria 106915
389 Ga0501035_0000950 3300049822 Bacteria 30620
390 Ga0501035_0003111 3300049822 Bacteria 15940
391 Ga0501035_0005408 3300049822 Bacteria 12072
392 Ga0501035_0093191 3300049822 Bacteria 2650
393 Ga0501035_0148745 3300049822 Bacteria 2033
394 Ga0501044_0000002 3300049823 Bacteria 375152
395 Ga0501044_0000113 3300049823 Bacteria 97940
396 Ga0501044_0057809 3300049823 Bacteria 3979
397 Ga0501044_0065523 3300049823 Bacteria 3705
398 Ga0501044_0071517 3300049823 Bacteria 3527
399 Ga0501044_0079931 3300049823 Bacteria 3312
400 Ga0501044_0189940 3300049823 Bacteria 2017
401 Ga0501045_0138904 3300049824 Bacteria 1807
402 Ga0501045_0318137 3300049824 Bacteria 1158
403 nmdc:mga03683_47427_c1 3300050489 Bacteria 1783
404 nmdc:mga03n38_228760_c1 3300050490 Bacteria 974
405 nmdc:mga00v17_3380_c1 3300050491 Bacteria 8235
406 nmdc:mga00v17_591_c1 3300050491 Bacteria 20204
407 nmdc:mga0yw44_13656_c1 3300050492 Bacteria 4283
408 nmdc:mga0yw44_19308_c1 3300050492 Bacteria 3756
409 nmdc:mga0yw44_41468_c1 3300050492 Bacteria 2364
410 nmdc:mga0yw44_756_c1 3300050492 Bacteria 11985
411 nmdc:mga0k408_14695_c1 3300050493 Bacteria 4319
412 nmdc:mga06z11_11622_c1 3300050494 Bacteria 3804
413 nmdc:mga0sz30_299_c1 3300050516 Bacteria 19018
414 Ga0495601_0226625 3300053077 Bacteria 1221
415 Ga0500641_0048969 3300053096 Bacteria 1732
416 Ga0500560_002179 3300053107 Bacteria 3672
417 Ga0500569_048241 3300053109 Bacteria 1275
418 Ga0500572_009295 3300053111 Bacteria 2321
419 Ga0500593_002181 3300053117 Bacteria 7128
420 Ga0500607_132347 3300053121 Bacteria 1187
421 Ga0500608_042476 3300053122 Bacteria 2182
422 Ga0500618_000227 3300053125 Bacteria 44231
423 Ga0500618_005699 3300053125 Bacteria 3755
424 Ga0500618_024443 3300053125 Bacteria 1455
425 Ga0500658_0032453 3300053134 Bacteria 2048
426 Ga0500561_0000742 3300053137 Bacteria 5173
427 Ga0500568_0000001 3300053139 Bacteria 988705
428 Ga0500568_0000143 3300053139 Bacteria 63442
429 Ga0500568_0012950 3300053139 Bacteria 3817
430 Ga0500590_001584 3300053148 Bacteria 9477
431 Ga0500616_0003869 3300053153 Bacteria 11034
432 Ga0500616_0055492 3300053153 Bacteria 2072
433 Ga0500616_0144953 3300053153 Bacteria 1106
434 Ga0500622_0004006 3300053156 Bacteria 9491
435 Ga0500622_0033890 3300053156 Bacteria 2678
436 Ga0500624_003548 3300053157 Bacteria 2045
437 Ga0500634_0000112 3300053161 Bacteria 30260
438 Ga0500636_0000070 3300053177 Bacteria 50168
439 Ga0500636_0031858 3300053177 Bacteria 3119
440 Ga0501084_0162387 3300054114 Bacteria 1885

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0054586 Ga0496118_0054586_1304_2311 275
2 3300050489 nmdc:mga03683_47427_c1 nmdc:mga03683_47427_c1_34_888 276
3 3300003790 Ga0055528_1005083 Ga0055528_10050838 278
4 3300053139 Ga0500568_0000143 Ga0500568_0000143_4434_5453 279
5 iso_pu_bacteria 3004289098 3004291408 281
6 3300053077 Ga0495601_0226625 Ga0495601_0226625_53_997 283
7 3300053148 Ga0500590_001584 Ga0500590_001584_1078_2022 283
8 3300006178 Ga0075367_10012849 Ga0075367_100128495 284
9 3300046476 Ga0495662_0006888 Ga0495662_0006888_3000_3944 286
10 3300046477 Ga0495664_0257039 Ga0495664_0257039_98_1042 286
11 3300046674 Ga0495588_0037721 Ga0495588_0037721_905_1849 286
12 3300046683 Ga0495658_0076066 Ga0495658_0076066_879_1823 286
13 3300049744 Ga0501083_0216665 Ga0501083_0216665_313_1209 286
14 3300053121 Ga0500607_132347 Ga0500607_132347_207_1151 286
15 3300046474 Ga0495605_0052384 Ga0495605_0052384_230_1174 288
16 3300046665 Ga0495661_0087487 Ga0495661_0087487_704_1648 288
17 3300053161 Ga0500634_0000112 Ga0500634_0000112_11100_12044 288
18 3300053177 Ga0500636_0000070 Ga0500636_0000070_6566_7510 289
19 3300041413 Ga0439465_0015848 Ga0439465_0015848_643_1587 291
20 iso_pu_bacteria 3004232784 3004237744 292
21 iso_pu_bacteria 2690316117 2692316815 293
22 3300003792 Ga0055540_1008490 Ga0055540_10084903 294
23 3300025273 Ga0209673_1011121 Ga0209673_10111212 294
24 3300025292 Ga0209676_1022064 Ga0209676_10220642 294
25 3300025298 Ga0209050_1006521 Ga0209050_10065217 294
26 3300025303 Ga0209051_1000514 Ga0209051_10005143 294
27 3300025304 Ga0209257_1007417 Ga0209257_10074177 294
28 3300003214 JGI25165J46597_1008647 JGI25165J46597_10086472 295
29 3300005548 Ga0070665_100192330 Ga0070665_1001923302 295
30 3300009093 Ga0105240_10000032 Ga0105240_10000032212 295
31 3300009545 Ga0105237_10000754 Ga0105237_1000075423 295
32 3300010375 Ga0105239_10003143 Ga0105239_1000314315 295
33 3300013104 Ga0157370_10000972 Ga0157370_1000097220 295
34 3300015262 Ga0182007_10005040 Ga0182007_100050403 295
35 3300015265 Ga0182005_1012560 Ga0182005_10125602 295
36 3300022739 Ga0228711_1000001 Ga0228711_100000162 295
37 3300022740 Ga0228710_1000001 Ga0228710_1000001263 295
38 3300025253 Ga0209677_101323 Ga0209677_1013234 295
39 3300025261 Ga0209233_1000209 Ga0209233_100020967 295
40 3300025913 Ga0207695_10000024 Ga0207695_10000024213 295
41 3300025914 Ga0207671_10003700 Ga0207671_1000370013 295
42 3300027111 Ga0209281_1000266 Ga0209281_100026635 295
43 3300027666 Ga0209282_1000007 Ga0209282_1000007190 295
44 3300031967 Ga0315914_1000006 Ga0315914_100000653 295
45 3300033430 Ga0315913_1000002 Ga0315913_1000002190 295
46 3300033464 Ga0315915_1000001 Ga0315915_1000001297 295
47 3300048919 Ga0496116_0026294 Ga0496116_0026294_2203_3147 295
48 3300048920 Ga0496117_0025724 Ga0496117_0025724_663_1607 295
49 3300048921 Ga0496118_0002790 Ga0496118_0002790_21267_22211 295
50 3300048922 Ga0496119_0018153 Ga0496119_0018153_1571_2515 295
51 3300048924 Ga0496121_0005233 Ga0496121_0005233_15764_16708 295
52 3300048925 Ga0496122_0089662 Ga0496122_0089662_677_1621 295
53 3300048926 Ga0496123_0085878 Ga0496123_0085878_366_1310 295
54 3300048927 Ga0496124_0008594 Ga0496124_0008594_2306_3250 295
55 3300048929 Ga0496126_0210657 Ga0496126_0210657_71_1015 295
56 3300025273 Ga0209673_1000319 Ga0209673_10003198 296
57 3300025295 Ga0209564_1004856 Ga0209564_10048563 296
58 3300025299 Ga0209256_1005095 Ga0209256_10050952 296
59 3300046507 Ga0495606_0081796 Ga0495606_0081796_707_1651 296
60 3300048920 Ga0496117_0074025 Ga0496117_0074025_976_1920 296
61 3300048921 Ga0496118_0003651 Ga0496118_0003651_12300_13244 296
62 3300013105 Ga0157369_10063657 Ga0157369_100636571 297
63 3300037312 Ga0395899_0000213 Ga0395899_0000213_58761_59654 297
64 3300037418 Ga0395900_0000121 Ga0395900_0000121_110384_111277 297
65 3300037466 Ga0395898_0000247 Ga0395898_0000247_23750_24643 297
66 3300037471 Ga0395905_0000112 Ga0395905_0000112_23734_24627 297
67 3300038443 Ga0395901_0000078 Ga0395901_0000078_110384_111277 297
68 3300042147 Ga0450910_008733 Ga0450910_008733_520_1416 297
69 3300046512 Ga0495610_0158542 Ga0495610_0158542_36_932 297
70 3300046528 Ga0495642_0167483 Ga0495642_0167483_20_916 297
71 3300046660 Ga0495625_0073006 Ga0495625_0073006_844_1740 297
72 3300046675 Ga0495657_0143833 Ga0495657_0143833_17_913 297
73 3300049568 Ga0501031_0065131 Ga0501031_0065131_37_930 297
74 3300049569 Ga0501032_0030787 Ga0501032_0030787_1931_2824 297
75 3300049580 Ga0501046_0164079 Ga0501046_0164079_738_1631 297
76 3300050490 nmdc:mga03n38_228760_c1 nmdc:mga03n38_228760_c1_52_945 297
77 3300053125 Ga0500618_024443 Ga0500618_024443_530_1426 297
78 3300053153 Ga0500616_0144953 Ga0500616_0144953_43_939 297
79 3300042007 Ga0439449_0001282 Ga0439449_0001282_4035_4997 299
80 iso_pu_bacteria 2924214083 2924218742 299
81 3300026067 Ga0207678_10023512 Ga0207678_100235125 300
82 3300049776 Ga0501280_011254 Ga0501280_011254_58_1002 300
83 3300006038 Ga0075365_10001318 Ga0075365_1000131810 301
84 3300009766 Ga0123342_1031086 Ga0123342_10310862 301
85 3300003771 Ga0055526_1010667 Ga0055526_10106671 302
86 3300003775 Ga0055524_1009966 Ga0055524_10099664 302
87 3300003790 Ga0055528_1023932 Ga0055528_10239322 302
88 3300003856 Ga0058692_1011160 Ga0058692_10111601 302
89 3300005355 Ga0070671_100009450 Ga0070671_1000094504 302
90 3300005367 Ga0070667_100335353 Ga0070667_1003353532 302
91 3300006042 Ga0075368_10004614 Ga0075368_100046142 302
92 3300006178 Ga0075367_10115807 Ga0075367_101158072 302
93 3300006186 Ga0075369_10019091 Ga0075369_100190912 302
94 3300006195 Ga0075366_10176209 Ga0075366_101762092 302
95 3300006353 Ga0075370_10204801 Ga0075370_102048011 302
96 3300006948 Ga0099826_10078772 Ga0099826_100787723 302
97 3300006948 Ga0099826_10079873 Ga0099826_100798733 302
98 3300009177 Ga0105248_10093909 Ga0105248_100939092 302
99 3300013102 Ga0157371_10000073 Ga0157371_100000733 302
100 3300025258 Ga0209129_1003371 Ga0209129_10033713 302
101 3300025273 Ga0209673_1009838 Ga0209673_10098383 302
102 3300025294 Ga0209025_1001440 Ga0209025_100144032 302
103 3300025299 Ga0209256_1011458 Ga0209256_10114583 302
104 3300025931 Ga0207644_10067027 Ga0207644_100670272 302
105 3300025941 Ga0207711_10181472 Ga0207711_101814722 302
106 3300025972 Ga0207668_10155547 Ga0207668_101555472 302
107 3300025986 Ga0207658_10310535 Ga0207658_103105351 302
108 3300026067 Ga0207678_10161027 Ga0207678_101610272 302
109 3300027666 Ga0209282_1000102 Ga0209282_100010231 302
110 3300030744 Ga0316181_1097764 Ga0316181_10977643 302
111 3300036647 Ga0316582_0089496 Ga0316582_0089496_452_1399 302
112 3300048903 Ga0496100_0230528 Ga0496100_0230528_169_1113 302
113 3300048905 Ga0496102_0015568 Ga0496102_0015568_629_1573 302
114 3300048907 Ga0496104_0360796 Ga0496104_0360796_252_1196 302
115 3300048908 Ga0496105_0055157 Ga0496105_0055157_903_1847 302
116 3300048909 Ga0496106_0023088 Ga0496106_0023088_127_1071 302
117 3300048911 Ga0496108_0178435 Ga0496108_0178435_508_1452 302
118 3300048912 Ga0496109_0299691 Ga0496109_0299691_299_1243 302
119 3300048913 Ga0496110_0138134 Ga0496110_0138134_1116_2060 302
120 3300048914 Ga0496111_0146862 Ga0496111_0146862_22_966 302
121 3300048915 Ga0496112_0190380 Ga0496112_0190380_687_1631 302
122 3300048915 Ga0496112_0360785 Ga0496112_0360785_402_1346 302
123 3300048916 Ga0496113_0198265 Ga0496113_0198265_428_1372 302
124 3300048917 Ga0496114_0257392 Ga0496114_0257392_157_1101 302
125 3300048919 Ga0496116_0017649 Ga0496116_0017649_3554_4498 302
126 3300048920 Ga0496117_0000002 Ga0496117_0000002_1487402_1488346 302
127 3300048921 Ga0496118_0000214 Ga0496118_0000214_60644_61588 302
128 3300048922 Ga0496119_0013733 Ga0496119_0013733_1100_2044 302
129 3300048922 Ga0496119_0016653 Ga0496119_0016653_772_1767 302
130 3300048923 Ga0496120_0000125 Ga0496120_0000125_56049_56993 302
131 3300048924 Ga0496121_0024937 Ga0496121_0024937_3526_4470 302
132 3300048925 Ga0496122_0000001 Ga0496122_0000001_858191_859135 302
133 3300048925 Ga0496122_0024031 Ga0496122_0024031_863_1807 302
134 3300048926 Ga0496123_0000001 Ga0496123_0000001_861922_862866 302
135 3300048926 Ga0496123_0112713 Ga0496123_0112713_456_1400 302
136 3300048929 Ga0496126_0154530 Ga0496126_0154530_877_1821 302
137 3300050493 nmdc:mga0k408_14695_c1 nmdc:mga0k408_14695_c1_3131_4126 302
138 3300050494 nmdc:mga06z11_11622_c1 nmdc:mga06z11_11622_c1_1896_2891 302
139 3300025284 Ga0209130_1011895 Ga0209130_10118951 303
140 3300048920 Ga0496117_0047076 Ga0496117_0047076_1736_2725 303
141 3300003775 Ga0055524_1006936 Ga0055524_10069364 306
142 3300013100 Ga0157373_10002216 Ga0157373_100022166 306
143 3300025299 Ga0209256_1000994 Ga0209256_100099412 306
144 3300048927 Ga0496124_0032626 Ga0496124_0032626_2899_3843 306
145 3300050491 nmdc:mga00v17_591_c1 nmdc:mga00v17_591_c1_7181_8125 306
146 3300050492 nmdc:mga0yw44_756_c1 nmdc:mga0yw44_756_c1_2317_3261 306
147 3300050516 nmdc:mga0sz30_299_c1 nmdc:mga0sz30_299_c1_11104_12048 306
148 3300053137 Ga0500561_0000742 Ga0500561_0000742_514_1509 306
149 3300049579 Ga0501043_0072000 Ga0501043_0072000_1618_2559 307
150 3300049581 Ga0501047_0052981 Ga0501047_0052981_1095_2036 307
151 3300049586 Ga0501070_0011905 Ga0501070_0011905_5312_6253 307
152 3300049589 Ga0501073_0046869 Ga0501073_0046869_1004_1945 307
153 3300049590 Ga0501074_0032004 Ga0501074_0032004_2050_2991 307
154 3300049742 Ga0501080_0008984 Ga0501080_0008984_6985_7926 307
155 3300049822 Ga0501035_0005408 Ga0501035_0005408_1111_2052 307
156 3300049823 Ga0501044_0071517 Ga0501044_0071517_1702_2643 307
157 iso_pu_bacteria 2757320392 2757570806 308
158 3300053117 Ga0500593_002181 Ga0500593_002181_1442_2374 309
159 3300053139 Ga0500568_0000001 Ga0500568_0000001_323750_324682 309
160 iso_pu_bacteria 2508501122 2509108528 309
161 iso_pu_bacteria 2509276018 2509371839 309
162 iso_pu_bacteria 2509276019 2509374446 309
163 iso_pu_bacteria 2509276021 2509387712 309
164 iso_pu_bacteria 2509276033 2509443071 309
165 iso_pu_bacteria 2510065019 2510132301 309
166 iso_pu_bacteria 2510065057 2510307236 309
167 iso_pu_bacteria 2510065059 2510318988 309
168 iso_pu_bacteria 2510461069 2510839685 309
169 iso_pu_bacteria 2510461076 2510898640 309
170 iso_pu_bacteria 2510917022 2511137034 309
171 iso_pu_bacteria 2510917028 2511186366 309
172 iso_pu_bacteria 2510917030 2511197191 309
173 iso_pu_bacteria 2511231027 2511392637 309
174 iso_pu_bacteria 2511231052 2511501028 309
175 iso_pu_bacteria 2512875026 2512972233 309
176 iso_pu_bacteria 2513237084 2513569139 309
177 iso_pu_bacteria 2513237085 2513578809 309
178 iso_pu_bacteria 2513237086 2513586964 309
179 iso_pu_bacteria 2513237088 2513596256 309
180 iso_pu_bacteria 2513237089 2513603312 309
181 iso_pu_bacteria 2513237091 2513618959 309
182 iso_pu_bacteria 2513237093 2513632753 309
183 iso_pu_bacteria 2513237103 2513709204 309
184 iso_pu_bacteria 2513237138 2513868776 309
185 iso_pu_bacteria 2513237140 2513881083 309
186 iso_pu_bacteria 2513237143 2513902319 309
187 iso_pu_bacteria 2513237144 2513907518 309
188 iso_pu_bacteria 2513237146 2513925710 309
189 iso_pu_bacteria 2513237156 2513983918 309
190 iso_pu_bacteria 2513237160 2514004767 309
191 iso_pu_bacteria 2513237162 2514020749 309
192 iso_pu_bacteria 2515075009 2515111286 309
193 iso_pu_bacteria 2515154107 2515608140 309
194 iso_pu_bacteria 2515154113 2515637834 309
195 iso_pu_bacteria 2515154114 2515642580 309
196 iso_pu_bacteria 2515154116 2515659189 309
197 iso_pu_bacteria 2515154134 2515740466 309
198 iso_pu_bacteria 2516143018 2516208891 309
199 iso_pu_bacteria 2516653046 2516892310 309
200 iso_pu_bacteria 2516653077 2517039926 309
201 iso_pu_bacteria 2516653085 2517075471 309
202 iso_pu_bacteria 2517093000 2517094058 309
203 iso_pu_bacteria 2517287029 2517405878 309
204 iso_pu_bacteria 2517487022 2517569101 309
205 iso_pu_bacteria 2519899620 2520375271 309
206 iso_pu_bacteria 2524023207 2524451122 309
207 iso_pu_bacteria 2524023209 2524460643 309
208 iso_pu_bacteria 2529292951 2530643889 309
209 iso_pu_bacteria 2534681786 2535484219 309
210 iso_pu_bacteria 2534681796 2535515725 309
211 iso_pu_bacteria 2537561587 2537874085 309
212 iso_pu_bacteria 2551306084 2551680900 309
213 iso_pu_bacteria 2551306085 2551684082 309
214 iso_pu_bacteria 2551306086 2551695739 309
215 iso_pu_bacteria 2551306087 2551702991 309
216 iso_pu_bacteria 2551306089 2551708474 309
217 iso_pu_bacteria 2551306090 2551724087 309
218 iso_pu_bacteria 2551306091 2551729769 309
219 iso_pu_bacteria 2551306092 2551739216 309
220 iso_pu_bacteria 2551306093 2551742896 309
221 iso_pu_bacteria 2554235003 2554247118 309
222 iso_pu_bacteria 2558860100 2558863474 309
223 iso_pu_bacteria 2558860242 2559294342 309
224 iso_pu_bacteria 2558860983 2561466064 309
225 iso_pu_bacteria 2582581283 2585165562 309
226 iso_pu_bacteria 2582581294 2585203085 309
227 iso_pu_bacteria 2582581298 2585220998 309
228 iso_pu_bacteria 2582581299 2585231488 309
229 iso_pu_bacteria 2582581306 2585266157 309
230 iso_pu_bacteria 2582581307 2585273256 309
231 iso_pu_bacteria 2582581308 2585278910 309
232 iso_pu_bacteria 2582581315 2585325476 309
233 iso_pu_bacteria 2582581316 2585329633 309
234 iso_pu_bacteria 2582581865 2585387159 309
235 iso_pu_bacteria 2582581866 2585392726 309
236 iso_pu_bacteria 2582581867 2585400117 309
237 iso_pu_bacteria 2585427526 2585527967 309
238 iso_pu_bacteria 2585427527 2585530707 309
239 iso_pu_bacteria 2585427529 2585549902 309
240 iso_pu_bacteria 2585427530 2585554887 309
241 iso_pu_bacteria 2585427531 2585559444 309
242 iso_pu_bacteria 2585427590 2585822676 309
243 iso_pu_bacteria 2585427594 2585847211 309
244 iso_pu_bacteria 2585427608 2585902115 309
245 iso_pu_bacteria 2585427609 2585905180 309
246 iso_pu_bacteria 2585428125 2587979705 309
247 iso_pu_bacteria 2599185156 2599333761 309
248 iso_pu_bacteria 2599185170 2599418587 309
249 iso_pu_bacteria 2599185210 2599602593 309
250 iso_pu_bacteria 2599185301 2599940415 309
251 iso_pu_bacteria 2599185352 2600191944 309
252 iso_pu_bacteria 2600255279 2601608673 309
253 iso_pu_bacteria 2600255308 2601745447 309
254 iso_pu_bacteria 2615840624 2616296209 309
255 iso_pu_bacteria 2615840626 2616305817 309
256 iso_pu_bacteria 2615840698 2616553941 309
257 iso_pu_bacteria 2617270742 2617383865 309
258 iso_pu_bacteria 2643221550 2643773611 309
259 iso_pu_bacteria 2643221557 2643807191 309
260 iso_pu_bacteria 2643221558 2643810001 309
261 iso_pu_bacteria 2643221564 2643837786 309
262 iso_pu_bacteria 2643221568 2643855863 309
263 iso_pu_bacteria 2643221582 2643918716 309
264 iso_pu_bacteria 2643221599 2644007932 309
265 iso_pu_bacteria 2643221607 2644046563 309
266 iso_pu_bacteria 2643221610 2644069543 309
267 iso_pu_bacteria 2643221618 2644108981 309
268 iso_pu_bacteria 2643221623 2644132921 309
269 iso_pu_bacteria 2643221626 2644151503 309
270 iso_pu_bacteria 2643221634 2644196521 309
271 iso_pu_bacteria 2643221636 2644202269 309
272 iso_pu_bacteria 2643221637 2644206191 309
273 iso_pu_bacteria 2643221643 2644242889 309
274 iso_pu_bacteria 2643221653 2644296826 309
275 iso_pu_bacteria 2643221655 2644311637 309
276 iso_pu_bacteria 2643221659 2644329895 309
277 iso_pu_bacteria 2643221668 2644380573 309
278 iso_pu_bacteria 2643221675 2644420697 309
279 iso_pu_bacteria 2643221680 2644454222 309
280 iso_pu_bacteria 2643221686 2644479353 309
281 iso_pu_bacteria 2643221688 2644493386 309
282 iso_pu_bacteria 2643221689 2644502396 309
283 iso_pu_bacteria 2643221693 2644518740 309
284 iso_pu_bacteria 2643221698 2644546569 309
285 iso_pu_bacteria 2643221712 2644617436 309
286 iso_pu_bacteria 2643221718 2644649838 309
287 iso_pu_bacteria 2643221719 2644655080 309
288 iso_pu_bacteria 2643221723 2644675639 309
289 iso_pu_bacteria 2643221726 2644689559 309
290 iso_pu_bacteria 2657244999 2657683251 309
291 iso_pu_bacteria 2667528174 2671115304 309
292 iso_pu_bacteria 2687453392 2688600139 309
293 iso_pu_bacteria 2718217927 2719384863 309
294 iso_pu_bacteria 2718217997 2719664618 309
295 iso_pu_bacteria 2718218199 2720491038 309
296 iso_pu_bacteria 2718218232 2720612400 309
297 iso_pu_bacteria 2718218233 2720619239 309
298 iso_pu_bacteria 2718218235 2720630639 309
299 iso_pu_bacteria 2718218269 2720774332 309
300 iso_pu_bacteria 2718218423 2721398583 309
301 iso_pu_bacteria 2721755556 2723026059 309
302 iso_pu_bacteria 2721755684 2723559604 309
303 iso_pu_bacteria 2721755685 2723566220 309
304 iso_pu_bacteria 2721755809 2724037396 309
305 iso_pu_bacteria 2721755819 2724088939 309
306 iso_pu_bacteria 2721755822 2724103485 309
307 iso_pu_bacteria 2721755823 2724109331 309
308 iso_pu_bacteria 2728369352 2730106995 309
309 iso_pu_bacteria 2738541293 2738802168 309
310 iso_pu_bacteria 2738541317 2738946538 309
311 iso_pu_bacteria 2738541333 2739035899 309
312 iso_pu_bacteria 2751185800 2753358810 309
313 iso_pu_bacteria 2751185821 2753460819 309
314 iso_pu_bacteria 2758568016 2758641044 309
315 iso_pu_bacteria 2775506902 2776271942 309
316 iso_pu_bacteria 2775506904 2776279541 309
317 iso_pu_bacteria 2775507049 2776912780 309
318 iso_pu_bacteria 2775507266 2778177491 309
319 iso_pu_bacteria 2791355082 2792584176 309
320 iso_pu_bacteria 2791355091 2792622673 309
321 iso_pu_bacteria 2791355092 2792628406 309
322 iso_pu_bacteria 2791355253 2793282315 309
323 iso_pu_bacteria 2791355256 2793296201 309
324 iso_pu_bacteria 2791355259 2793317527 309
325 iso_pu_bacteria 2791355261 2793327127 309
326 iso_pu_bacteria 2791355262 2793333616 309
327 iso_pu_bacteria 2791355264 2793347937 309
328 iso_pu_bacteria 2791355265 2793353575 309
329 iso_pu_bacteria 2791355267 2793367852 309
330 iso_pu_bacteria 2802428858 2802717745 309
331 iso_pu_bacteria 2802428859 2802723327 309
332 iso_pu_bacteria 2802428860 2802733189 309
333 iso_pu_bacteria 2802428861 2802736229 309
334 iso_pu_bacteria 2802428862 2802743561 309
335 iso_pu_bacteria 2802428863 2802750726 309
336 iso_pu_bacteria 2802429268 2804751360 309
337 iso_pu_bacteria 2802429605 2805926576 309
338 iso_pu_bacteria 2802429633 2806046922 309
339 iso_pu_bacteria 2802429634 2806052505 309
340 iso_pu_bacteria 2802429635 2806058724 309
341 iso_pu_bacteria 2802429636 2806067508 309
342 iso_pu_bacteria 2802429637 2806073987 309
343 iso_pu_bacteria 2808606387 2808985885 309
344 iso_pu_bacteria 2818991272 2819242538 309
345 iso_pu_bacteria 2818991439 2819556004 309
346 iso_pu_bacteria 2818991448 2819612205 309
347 iso_pu_bacteria 2818991453 2819639246 309
348 iso_pu_bacteria 2818991461 2819684111 309
349 iso_pu_bacteria 2821123053 2821124283 309
350 iso_pu_bacteria 2838016132 2838017288 309
351 iso_pu_bacteria 2838022645 2838023156 309
352 iso_pu_bacteria 2838029111 2838031429 309
353 iso_pu_bacteria 2838035591 2838037718 309
354 iso_pu_bacteria 2838042994 2838047982 309
355 iso_pu_bacteria 2838048938 2838049228 309
356 iso_pu_bacteria 2838061910 2838063326 309
357 iso_pu_bacteria 2838068647 2838074152 309
358 iso_pu_bacteria 2838074704 2838076453 309
359 iso_pu_bacteria 2838661181 2838662730 309
360 iso_pu_bacteria 2838668709 2838670848 309
361 iso_pu_bacteria 2838675328 2838676730 309
362 iso_pu_bacteria 2838680041 2838681342 309
363 iso_pu_bacteria 2838686498 2838688613 309
364 iso_pu_bacteria 2838694306 2838694623 309
365 iso_pu_bacteria 2838701080 2838703219 309
366 iso_pu_bacteria 2838707686 2838708001 309
367 iso_pu_bacteria 2838714209 2838715614 309
368 iso_pu_bacteria 2838719591 2838720586 309
369 iso_pu_bacteria 2838724970 2838726370 309
370 iso_pu_bacteria 2838729681 2838730908 309
371 iso_pu_bacteria 2838736955 2838741224 309
372 iso_pu_bacteria 2838742623 2838744198 309
373 iso_pu_bacteria 2839993093 2839995891 309
374 iso_pu_bacteria 2840764183 2840769677 309
375 iso_pu_bacteria 2841840854 2841844879 309
376 iso_pu_bacteria 2841846520 2841847521 309
377 iso_pu_bacteria 2841851746 2841856879 309
378 iso_pu_bacteria 2841859092 2841859943 309
379 iso_pu_bacteria 2841864319 2841865472 309
380 iso_pu_bacteria 2842077413 2842080768 309
381 iso_pu_bacteria 2842110456 2842114977 309
382 iso_pu_bacteria 2842118031 2842121387 309
383 iso_pu_bacteria 2842124991 2842126449 309
384 iso_pu_bacteria 2842130223 2842131623 309
385 iso_pu_bacteria 2842140634 2842144601 309
386 iso_pu_bacteria 2842146304 2842147557 309
387 iso_pu_bacteria 2842152218 2842153208 309
388 iso_pu_bacteria 2842156927 2842160049 309
389 iso_pu_bacteria 2842163707 2842168292 309
390 iso_pu_bacteria 2842170452 2842171857 309
391 iso_pu_bacteria 2842175837 2842176827 309
392 iso_pu_bacteria 2842180545 2842183334 309
393 iso_pu_bacteria 2842187318 2842188722 309
394 iso_pu_bacteria 2842192696 2842197951 309
395 iso_pu_bacteria 2842198810 2842199584 309
396 iso_pu_bacteria 2842205361 2842207696 309
397 iso_pu_bacteria 2842211629 2842213033 309
398 iso_pu_bacteria 2842217011 2842221204 309
399 iso_pu_bacteria 2842224351 2842225348 309
400 iso_pu_bacteria 2842229732 2842235065 309
401 iso_pu_bacteria 2842237096 2842237412 309
402 iso_pu_bacteria 2842243621 2842245662 309
403 iso_pu_bacteria 2842250916 2842252623 309
404 iso_pu_bacteria 2842257432 2842259688 309
405 iso_pu_bacteria 2842264693 2842266927 309
406 iso_pu_bacteria 2842271015 2842274527 309
407 iso_pu_bacteria 2842278818 2842281509 309
408 iso_pu_bacteria 2842285085 2842287116 309
409 iso_pu_bacteria 2842291075 2842294424 309
410 iso_pu_bacteria 2842298080 2842302447 309
411 iso_pu_bacteria 2842304105 2842306771 309
412 iso_pu_bacteria 2842311132 2842314747 309
413 iso_pu_bacteria 2842317721 2842318650 309
414 iso_pu_bacteria 2842341865 2842343591 309
415 iso_pu_bacteria 2842357229 2842360820 309
416 iso_pu_bacteria 2842363717 2842365252 309
417 iso_pu_bacteria 2842370503 2842371805 309
418 iso_pu_bacteria 2842377471 2842380822 309
419 iso_pu_bacteria 2842384541 2842387893 309
420 iso_pu_bacteria 2842395702 2842398264 309
421 iso_pu_bacteria 2842402390 2842404384 309
422 iso_pu_bacteria 2842409023 2842410931 309
423 iso_pu_bacteria 2842415677 2842417613 309
424 iso_pu_bacteria 2842422224 2842427357 309
425 iso_pu_bacteria 2842428310 2842431058 309
426 iso_pu_bacteria 2842434925 2842436944 309
427 iso_pu_bacteria 2842441272 2842443022 309
428 iso_pu_bacteria 2842447887 2842453244 309
429 iso_pu_bacteria 2842462802 2842465033 309
430 iso_pu_bacteria 2842469257 2842471741 309
431 iso_pu_bacteria 2842475841 2842477976 309
432 iso_pu_bacteria 2842482326 2842482856 309
433 iso_pu_bacteria 2842489311 2842493758 309
434 iso_pu_bacteria 2842495871 2842497285 309
435 iso_pu_bacteria 2842502639 2842504785 309
436 iso_pu_bacteria 2842509118 2842509731 309
437 iso_pu_bacteria 2842515876 2842516728 309
438 iso_pu_bacteria 2842521101 2842526337 309
439 iso_pu_bacteria 2842871566 2842874501 309
440 iso_pu_bacteria 2842922631 2842924801 309
441 iso_pu_bacteria 2844009547 2844015452 309
442 iso_pu_bacteria 2844163670 2844168506 309
443 iso_pu_bacteria 2844454524 2844455129 309
444 iso_pu_bacteria 2847417321 2847418120 309
445 iso_pu_bacteria 2848992105 2848993095 309
446 iso_pu_bacteria 2850079185 2850080488 309
447 iso_pu_bacteria 2852387548 2852389077 309
448 iso_pu_bacteria 2854896431 2854897184 309
449 iso_pu_bacteria 2854911287 2854914386 309
450 iso_pu_bacteria 2854916844 2854918195 309
451 iso_pu_bacteria 2855825444 2855831380 309
452 iso_pu_bacteria 2855839649 2855840506 309
453 iso_pu_bacteria 2855872281 2855876374 309
454 iso_pu_bacteria 2856320880 2856324401 309
455 iso_pu_bacteria 2856328259 2856333394 309
456 iso_pu_bacteria 2856334872 2856335704 309
457 iso_pu_bacteria 2857367948 2857375525 309
458 iso_pu_bacteria 2857516855 2857520291 309
459 iso_pu_bacteria 2857531043 2857531863 309
460 iso_pu_bacteria 2858800743 2858801034 309
461 iso_pu_bacteria 2869169390 2869171478 309
462 iso_pu_bacteria 2869242130 2869245745 309
463 iso_pu_bacteria 2869249662 2869256476 309
464 iso_pu_bacteria 2869256925 2869260177 309
465 iso_pu_bacteria 2869264136 2869264442 309
466 iso_pu_bacteria 2869271264 2869276520 309
467 iso_pu_bacteria 2869278585 2869281601 309
468 iso_pu_bacteria 2871435913 2871440443 309
469 iso_pu_bacteria 2871451962 2871458377 309
470 iso_pu_bacteria 2871459585 2871462204 309
471 iso_pu_bacteria 2874116593 2874121573 309
472 iso_pu_bacteria 2874131515 2874132706 309
473 iso_pu_bacteria 2874139085 2874140735 309
474 iso_pu_bacteria 2874162495 2874163476 309
475 iso_pu_bacteria 2876386047 2876389061 309
476 iso_pu_bacteria 2876399893 2876406252 309
477 iso_pu_bacteria 2876406927 2876411925 309
478 iso_pu_bacteria 2876420981 2876425170 309
479 iso_pu_bacteria 2878738818 2878742516 309
480 iso_pu_bacteria 2878774303 2878775924 309
481 iso_pu_bacteria 2878781027 2878783501 309
482 iso_pu_bacteria 2888337043 2888341315 309
483 iso_pu_bacteria 2889790730 2889794254 309
484 iso_pu_bacteria 2889914905 2889916789 309
485 iso_pu_bacteria 2891048133 2891051631 309
486 iso_pu_bacteria 2891373044 2891374681 309
487 iso_pu_bacteria 2894652903 2894654872 309
488 iso_pu_bacteria 2896384573 2896386652 309
489 iso_pu_bacteria 2899792073 2899796610 309
490 iso_pu_bacteria 2899803654 2899803781 309
491 iso_pu_bacteria 2899845264 2899847129 309
492 iso_pu_bacteria 2903513507 2903514434 309
493 iso_pu_bacteria 2904578770 2904581374 309
494 iso_pu_bacteria 2906363423 2906365542 309
495 iso_pu_bacteria 2906370794 2906374091 309
496 iso_pu_bacteria 2906386501 2906389493 309
497 iso_pu_bacteria 2906393657 2906394262 309
498 iso_pu_bacteria 2906401398 2906407898 309
499 iso_pu_bacteria 2906408224 2906411693 309
500 iso_pu_bacteria 2913295892 2913297432 309
501 iso_pu_bacteria 2913308742 2913310955 309
502 iso_pu_bacteria 2915650412 2915651269 309
503 iso_pu_bacteria 2915980308 2915986225 309
504 iso_pu_bacteria 2915986958 2915991194 309
505 iso_pu_bacteria 2915993759 2915996201 309
506 iso_pu_bacteria 2916000859 2916001226 309
507 iso_pu_bacteria 2916007675 2916013281 309
508 iso_pu_bacteria 2916014648 2916020474 309
509 iso_pu_bacteria 2916021584 2916027229 309
510 iso_pu_bacteria 2916028427 2916033801 309
511 iso_pu_bacteria 2916035215 2916040301 309
512 iso_pu_bacteria 2916041962 2916047659 309
513 iso_pu_bacteria 2916048683 2916052523 309
514 iso_pu_bacteria 2916055098 2916055300 309
515 iso_pu_bacteria 2916061851 2916062875 309
516 iso_pu_bacteria 2916068649 2916069406 309
517 iso_pu_bacteria 2916076590 2916077517 309
518 iso_pu_bacteria 2919100787 2919103835 309
519 iso_pu_bacteria 2919114240 2919115816 309
520 iso_pu_bacteria 2919119836 2919122610 309
521 iso_pu_bacteria 2919166419 2919167371 309
522 iso_pu_bacteria 2919408235 2919409311 309
523 iso_pu_bacteria 2920760137 2920762863 309
524 iso_pu_bacteria 2920822456 2920823854 309
525 iso_pu_bacteria 2921201388 2921202234 309
526 iso_pu_bacteria 2921208531 2921214014 309
527 iso_pu_bacteria 2921237296 2921240088 309
528 iso_pu_bacteria 2921244191 2921248355 309
529 iso_pu_bacteria 2921250672 2921251006 309
530 iso_pu_bacteria 2921257292 2921262508 309
531 iso_pu_bacteria 2921263974 2921264177 309
532 iso_pu_bacteria 2921282425 2921288128 309
533 iso_pu_bacteria 2921289301 2921295444 309
534 iso_pu_bacteria 2922151315 2922154117 309
535 iso_pu_bacteria 2922172374 2922176881 309
536 iso_pu_bacteria 2922178524 2922184635 309
537 iso_pu_bacteria 2923556063 2923557564 309
538 iso_pu_bacteria 2924144063 2924145541 309
539 iso_pu_bacteria 2924150972 2924156944 309
540 iso_pu_bacteria 2924158325 2924160633 309
541 iso_pu_bacteria 2924165586 2924171566 309
542 iso_pu_bacteria 2924172951 2924177566 309
543 iso_pu_bacteria 2924179722 2924180705 309
544 iso_pu_bacteria 2924186466 2924192133 309
545 iso_pu_bacteria 2924193448 2924199721 309
546 iso_pu_bacteria 2924200457 2924205443 309
547 iso_pu_bacteria 2924207177 2924212321 309
548 iso_pu_bacteria 2924221636 2924222367 309
549 iso_pu_bacteria 2924228884 2924234212 309
550 iso_pu_bacteria 2924718760 2924723270 309
551 iso_pu_bacteria 2924733363 2924735393 309
552 iso_pu_bacteria 2924748358 2924751704 309
553 iso_pu_bacteria 2924776078 2924780316 309
554 iso_pu_bacteria 2926754445 2926756757 309
555 iso_pu_bacteria 2926760298 2926760996 309
556 iso_pu_bacteria 2928521798 2928524664 309
557 iso_pu_bacteria 2929138655 2929139527 309
558 iso_pu_bacteria 2933006813 2933007851 309
559 iso_pu_bacteria 2933011516 2933012630 309
560 iso_pu_bacteria 2933016740 2933016844 309
561 iso_pu_bacteria 2933570622 2933573115 309
562 iso_pu_bacteria 2933594066 2933595070 309
563 iso_pu_bacteria 2933599457 2933604606 309
564 iso_pu_bacteria 2935901341 2935904135 309
565 iso_pu_bacteria 2936367885 2936368121 309
566 iso_pu_bacteria 2936375103 2936381486 309
567 iso_pu_bacteria 2936996657 2937001042 309
568 iso_pu_bacteria 2937002841 2937008715 309
569 iso_pu_bacteria 2937009748 2937015074 309
570 iso_pu_bacteria 2937016420 2937018926 309
571 iso_pu_bacteria 2937023124 2937028460 309
572 iso_pu_bacteria 2937029754 2937029814 309
573 iso_pu_bacteria 2937036028 2937036840 309
574 iso_pu_bacteria 2937042894 2937043439 309
575 iso_pu_bacteria 2937049772 2937056225 309
576 iso_pu_bacteria 2937056579 2937062309 309
577 iso_pu_bacteria 2937063883 2937069237 309
578 iso_pu_bacteria 2937071275 2937077457 309
579 iso_pu_bacteria 2937078374 2937082921 309
580 iso_pu_bacteria 2937084907 2937091199 309
581 iso_pu_bacteria 2937091812 2937095649 309
582 iso_pu_bacteria 2937098957 2937104158 309
583 iso_pu_bacteria 2937106411 2937112135 309
584 iso_pu_bacteria 2937113482 2937118043 309
585 iso_pu_bacteria 2937119839 2937124788 309
586 iso_pu_bacteria 2937126314 2937128990 309
587 iso_pu_bacteria 2937843397 2937846788 309
588 iso_pu_bacteria 2937861824 2937862751 309
589 iso_pu_bacteria 2937868953 2937876957 309
590 iso_pu_bacteria 2937877337 2937882838 309
591 iso_pu_bacteria 2937972304 2937973189 309
592 iso_pu_bacteria 2941499720 2941500205 309
593 iso_pu_bacteria 2954011201 2954015144 309
594 iso_pu_bacteria 2957375807 2957379973 309
595 iso_pu_bacteria 2957382221 2957385786 309
596 iso_pu_bacteria 2957388812 2957389072 309
597 iso_pu_bacteria 2957395598 2957400297 309
598 iso_pu_bacteria 2957402308 2957406538 309
599 iso_pu_bacteria 2957408893 2957411656 309
600 iso_pu_bacteria 2957415311 2957421785 309
601 iso_pu_bacteria 2957422303 2957423858 309
602 iso_pu_bacteria 2957430029 2957436111 309
603 iso_pu_bacteria 2957437181 2957439206 309
604 iso_pu_bacteria 2957443900 2957446480 309
605 iso_pu_bacteria 2957450854 2957456396 309
606 iso_pu_bacteria 2957457609 2957463693 309
607 iso_pu_bacteria 2957464669 2957469819 309
608 iso_pu_bacteria 2957471148 2957476711 309
609 iso_pu_bacteria 2957478035 2957479960 309
610 iso_pu_bacteria 2957484790 2957490286 309
611 iso_pu_bacteria 2957491536 2957498145 309
612 iso_pu_bacteria 2957498199 2957504168 309
613 iso_pu_bacteria 2957505466 2957511638 309
614 iso_pu_bacteria 2958034702 2958037562 309
615 iso_pu_bacteria 2958041894 2958047273 309
616 iso_pu_bacteria 2958064165 2958065940 309
617 iso_pu_bacteria 2958084443 2958089963 309
618 iso_pu_bacteria 2958108152 2958112822 309
619 iso_pu_bacteria 2958122699 2958126415 309
620 iso_pu_bacteria 2958137437 2958137645 309
621 iso_pu_bacteria 2958144490 2958150463 309
622 iso_pu_bacteria 2960584000 2960589564 309
623 iso_pu_bacteria 2960591022 2960595625 309
624 iso_pu_bacteria 2960597568 2960601801 309
625 iso_pu_bacteria 2960603979 2960609957 309
626 iso_pu_bacteria 2960610863 2960615893 309
627 iso_pu_bacteria 2960617483 2960617760 309
628 iso_pu_bacteria 2960624210 2960631053 309
629 iso_pu_bacteria 2960631154 2960633174 309
630 iso_pu_bacteria 2960637947 2960644189 309
631 iso_pu_bacteria 2960645483 2960651892 309
632 iso_pu_bacteria 2960652885 2960658586 309
633 iso_pu_bacteria 2960660292 2960666464 309
634 iso_pu_bacteria 2960667422 2960673432 309
635 iso_pu_bacteria 2960674078 2960676910 309
636 iso_pu_bacteria 2960680706 2960684214 309
637 iso_pu_bacteria 2960687367 2960692580 309
638 iso_pu_bacteria 2960693952 2960696742 309
639 iso_pu_bacteria 2961183825 2961185796 309
640 iso_pu_bacteria 2964607997 2964613876 309
641 iso_pu_bacteria 2964615318 2964619944 309
642 iso_pu_bacteria 2964621998 2964627832 309
643 iso_pu_bacteria 2964628898 2964634766 309
644 iso_pu_bacteria 2964636051 2964642983 309
645 iso_pu_bacteria 2964643177 2964648326 309
646 iso_pu_bacteria 2964649959 2964653163 309
647 iso_pu_bacteria 2964656573 2964659238 309
648 iso_pu_bacteria 2964663802 2964665915 309
649 iso_pu_bacteria 2964670856 2964674025 309
650 iso_pu_bacteria 2964678106 2964683620 309
651 iso_pu_bacteria 2964685014 2964690427 309
652 iso_pu_bacteria 2964691889 2964692347 309
653 iso_pu_bacteria 2964698721 2964702229 309
654 iso_pu_bacteria 2964705432 2964708036 309
655 iso_pu_bacteria 2964712639 2964718170 309
656 iso_pu_bacteria 2964719344 2964726639 309
657 iso_pu_bacteria 2965025482 2965030666 309
658 iso_pu_bacteria 2965032056 2965032872 309
659 iso_pu_bacteria 2965047637 2965050816 309
660 iso_pu_bacteria 2965102966 2965109525 309
661 iso_pu_bacteria 2967664464 2967669655 309
662 iso_pu_bacteria 2967671571 2967678519 309
663 iso_pu_bacteria 2967678726 2967681103 309
664 iso_pu_bacteria 2967686174 2967687086 309
665 iso_pu_bacteria 2967693043 2967693305 309
666 iso_pu_bacteria 2967699805 2967706876 309
667 iso_pu_bacteria 2967714385 2967716469 309
668 iso_pu_bacteria 2967721400 2967728119 309
669 iso_pu_bacteria 2967728569 2967734682 309
670 iso_pu_bacteria 2967735183 2967737519 309
671 iso_pu_bacteria 2967742019 2967742226 309
672 iso_pu_bacteria 2967748971 2967752047 309
673 iso_pu_bacteria 2967755722 2967760434 309
674 iso_pu_bacteria 2967762386 2967764491 309
675 iso_pu_bacteria 2967769361 2967770850 309
676 iso_pu_bacteria 2967775926 2967776189 309
677 iso_pu_bacteria 2968016561 2968019604 309
678 iso_pu_bacteria 2968138860 2968138939 309
679 iso_pu_bacteria 2970019648 2970026245 309
680 iso_pu_bacteria 2970026789 2970029152 309
681 iso_pu_bacteria 2970033650 2970038780 309
682 iso_pu_bacteria 2970040964 2970044599 309
683 iso_pu_bacteria 2970047711 2970054051 309
684 iso_pu_bacteria 2970054988 2970059549 309
685 iso_pu_bacteria 2970061556 2970068659 309
686 iso_pu_bacteria 2970068827 2970073919 309
687 iso_pu_bacteria 2970076120 2970081417 309
688 iso_pu_bacteria 2970082768 2970085334 309
689 iso_pu_bacteria 2970088815 2970094517 309
690 iso_pu_bacteria 2970095765 2970102249 309
691 iso_pu_bacteria 2970102677 2970107193 309
692 iso_pu_bacteria 2970109326 2970115165 309
693 iso_pu_bacteria 2970116247 2970117909 309
694 iso_pu_bacteria 2970122695 2970124406 309
695 iso_pu_bacteria 2970129317 2970129577 309
696 iso_pu_bacteria 2970136068 2970142572 309
697 iso_pu_bacteria 2970143518 2970144425 309
698 iso_pu_bacteria 2970149975 2970155573 309
699 iso_pu_bacteria 2970156795 2970163926 309
700 iso_pu_bacteria 2970164137 2970170000 309
701 iso_pu_bacteria 2970170962 2970171852 309
702 iso_pu_bacteria 2970177841 2970182277 309
703 iso_pu_bacteria 2970184632 2970188315 309
704 iso_pu_bacteria 2970191845 2970197686 309
705 iso_pu_bacteria 2970469710 2970472925 309
706 iso_pu_bacteria 2970489779 2970493544 309
707 iso_pu_bacteria 2970510686 2970512506 309
708 iso_pu_bacteria 2970547951 2970554715 309
709 iso_pu_bacteria 2970593180 2970596204 309
710 iso_pu_bacteria 2970619444 2970620373 309
711 iso_pu_bacteria 2977516862 2977522902 309
712 iso_pu_bacteria 2977523885 2977529983 309
713 iso_pu_bacteria 2977530762 2977531951 309
714 iso_pu_bacteria 2977537788 2977538046 309
715 iso_pu_bacteria 2977544691 2977546041 309
716 iso_pu_bacteria 2977551784 2977552047 309
717 iso_pu_bacteria 2977558990 2977564547 309
718 iso_pu_bacteria 2977565890 2977572013 309
719 iso_pu_bacteria 2977572785 2977578319 309
720 iso_pu_bacteria 2977579622 2977581435 309
721 iso_pu_bacteria 2977851361 2977857117 309
722 iso_pu_bacteria 2977872689 2977873162 309
723 iso_pu_bacteria 2977907340 2977912693 309
724 iso_pu_bacteria 2977915119 2977918714 309
725 iso_pu_bacteria 2977935797 2977936999 309
726 iso_pu_bacteria 2977950692 2977954384 309
727 iso_pu_bacteria 2977957713 2977962752 309
728 iso_pu_bacteria 2979089926 2979093727 309
729 iso_pu_bacteria 2979095461 2979098889 309
730 iso_pu_bacteria 2979100975 2979105703 309
731 iso_pu_bacteria 2979764755 2979770600 309
732 iso_pu_bacteria 2979772303 2979774953 309
733 iso_pu_bacteria 2979793036 2979794263 309
734 iso_pu_bacteria 2984509177 2984512450 309
735 iso_pu_bacteria 2984518228 2984521189 309
736 iso_pu_bacteria 2984537506 2984540483 309
737 iso_pu_bacteria 2984601300 2984602680 309
738 iso_pu_bacteria 2987645492 2987646146 309
739 iso_pu_bacteria 2987673487 2987674023 309
740 iso_pu_bacteria 2989349275 2989354160 309
741 iso_pu_bacteria 2989771324 2989772067 309
742 iso_pu_bacteria 2989776772 2989778186 309
743 iso_pu_bacteria 2995392953 2995393796 309
744 iso_pu_bacteria 2996310559 2996313315 309
745 iso_pu_bacteria 2996348954 2996351955 309
746 iso_pu_bacteria 2996386984 2996392352 309
747 iso_pu_bacteria 2996887358 2996890798 309
748 iso_pu_bacteria 2996893221 2996895081 309
749 iso_pu_bacteria 3002141150 3002143345 309
750 iso_pu_bacteria 3003930520 3003932678 309
751 iso_pu_bacteria 3004167301 3004170908 309
752 iso_pu_bacteria 3004239961 3004247750 309
753 iso_pu_bacteria 3004248173 3004252088 309
754 iso_pu_bacteria 3004268573 3004273140 309
755 iso_pu_bacteria 3004275668 3004278653 309
756 iso_pu_bacteria 3005409236 3005412452 309
757 iso_pu_bacteria 3005416602 3005417144 309
758 iso_pu_bacteria 3005445848 3005446763 309
759 iso_pu_bacteria 3005452660 3005453452 309
760 iso_pu_bacteria 639633055 639647434 309
761 iso_pu_bacteria 643692032 643825095 309
762 iso_pu_bacteria 648276728 648736424 309
763 iso_pu_bacteria 649633066 649874616 309
764 iso_pu_bacteria 650716007 650739538 309
765 iso_pu_bacteria 8003570095 8003570583 309
766 iso_pu_bacteria 8003992118 8003993004 309
767 iso_pu_bacteria 8003999396 8004000235 309
768 iso_pu_bacteria 8004300914 8004301775 309
769 iso_pu_bacteria 8004312739 8004317607 309
770 iso_pu_bacteria 8004361976 8004365572 309
771 iso_pu_bacteria 8004695233 8004700148 309
772 iso_pu_bacteria 8004727605 8004729934 309
773 iso_pu_bacteria 8005246636 8005251313 309
774 iso_pu_bacteria 8005258706 8005261813 309
775 iso_pu_bacteria 8005275841 8005279583 309
776 iso_pu_bacteria 8005282627 8005284781 309
777 iso_pu_bacteria 8005289223 8005292793 309
778 iso_pu_bacteria 8005301065 8005304599 309
779 iso_pu_bacteria 8005307578 8005311089 309
780 iso_pu_bacteria 8005314921 8005315205 309
781 iso_pu_bacteria 8005321885 8005325325 309
782 iso_pu_bacteria 8005376324 8005376607 309
783 iso_pu_bacteria 8005382845 8005385996 309
784 iso_pu_bacteria 8005395548 8005400221 309
785 iso_pu_bacteria 8005430974 8005432270 309
786 iso_pu_bacteria 8005460587 8005461930 309
787 iso_pu_bacteria 8005484373 8005485625 309
788 iso_pu_bacteria 8005497431 8005499332 309
789 iso_pu_bacteria 8005542996 8005544359 309
790 iso_pu_bacteria 8005570704 8005572685 309
791 iso_pu_bacteria 8005619151 8005620527 309
792 iso_pu_bacteria 8005626139 8005627507 309
793 iso_pu_bacteria 8005645114 8005648358 309
794 iso_pu_bacteria 8005658619 8005659968 309
795 iso_pu_bacteria 8005668836 8005670748 309
796 iso_pu_bacteria 8005682033 8005684566 309
797 iso_pu_bacteria 8005688590 8005691022 309
798 iso_pu_bacteria 8005695170 8005698788 309
799 iso_pu_bacteria 8018127388 8018131334 309
800 iso_pu_bacteria 8018150411 8018152550 309
801 iso_pu_bacteria 8018163183 8018169159 309
802 iso_pu_bacteria 8018176218 8018177242 309
803 iso_pu_bacteria 8023680758 8023686956 309
804 iso_pu_bacteria 8024479707 8024481103 309
805 iso_pu_bacteria 8024486573 8024489751 309
806 iso_pu_bacteria 8024501048 8024503250 309
807 iso_pu_bacteria 8046767195 8046767682 309
808 iso_pu_bacteria 8049293176 8049293934 309
809 iso_pu_bacteria 8054558443 8054562966 309
810 iso_pu_bacteria 8055431914 8055434197 309
811 iso_pu_bacteria 8056375014 8056380732 309
812 iso_pu_bacteria 8056382006 8056384751 309
813 iso_pu_bacteria 8056875544 8056876573 309
814 iso_pu_bacteria 8057575449 8057582196 309
815 iso_pu_bacteria 8057874678 8057879588 309
816 iso_pu_bacteria 2510917026 2511174601 310
817 iso_pu_bacteria 2585427633 2585995119 310
818 iso_pu_bacteria 2585427634 2585999666 310
819 iso_pu_bacteria 2919171160 2919171417 310
820 3300009545 Ga0105237_10302382 Ga0105237_103023822 311
821 iso_pu_bacteria 2724679232 2725948489 311
822 iso_pu_bacteria 2765235942 2766067602 311
823 iso_pu_bacteria 2791355263 2793339795 311
824 iso_pu_bacteria 2791355266 2793358921 311
825 iso_pu_bacteria 2933586486 2933591376 311
826 iso_pu_bacteria 2935894831 2935895145 311
827 iso_pu_bacteria 2936381700 2936387380 311
828 iso_pu_bacteria 8005556819 8005558925 311
829 iso_pu_bacteria 8005563573 8005570437 311
830 3300006051 Ga0075364_10003962 Ga0075364_100039628 312
831 3300049572 Ga0501036_0354583 Ga0501036_0354583_44_1009 312
832 3300049576 Ga0501040_0099885 Ga0501040_0099885_637_1602 312
833 3300049580 Ga0501046_0215598 Ga0501046_0215598_246_1211 312
834 3300049582 Ga0501048_0197354 Ga0501048_0197354_101_1066 312
835 3300049590 Ga0501074_0118258 Ga0501074_0118258_296_1261 312
836 3300049592 Ga0501076_0111306 Ga0501076_0111306_33_998 312
837 3300049741 Ga0501079_0128745 Ga0501079_0128745_346_1311 312
838 3300050491 nmdc:mga00v17_3380_c1 nmdc:mga00v17_3380_c1_2430_3413 312
839 3300054114 Ga0501084_0162387 Ga0501084_0162387_56_1021 312
840 3300001989 JGI24739J22299_10007068 JGI24739J22299_100070682 313
841 3300002737 JGI25162J39368_1004608 JGI25162J39368_10046082 313
842 3300002739 JGI25158J39367_1000407 JGI25158J39367_10004079 313
843 3300002773 JGI25152J39213_1005768 JGI25152J39213_10057683 313
844 3300002773 JGI25152J39213_1006937 JGI25152J39213_10069372 313
845 3300002774 JGI25150J39212_1001462 JGI25150J39212_10014625 313
846 3300002987 JGI25159J45721_1000002 JGI25159J45721_1000002221 313
847 3300002987 JGI25159J45721_1000299 JGI25159J45721_10002994 313
848 3300002987 JGI25159J45721_1001244 JGI25159J45721_10012442 313
849 3300003187 JGI25151J46595_10015298 JGI25151J46595_100152982 313
850 3300003214 JGI25165J46597_1005540 JGI25165J46597_10055402 313
851 3300003215 JGI25153J46596_10009883 JGI25153J46596_100098832 313
852 3300003215 JGI25153J46596_10010716 JGI25153J46596_100107164 313
853 3300003354 JGI25160J50197_1000008 JGI25160J50197_1000008221 313
854 3300003354 JGI25160J50197_1000015 JGI25160J50197_10000157 313
855 3300003374 JGI25161J50226_1000005 JGI25161J50226_1000005234 313
856 3300003374 JGI25161J50226_1001391 JGI25161J50226_10013918 313
857 3300003374 JGI25161J50226_1001583 JGI25161J50226_10015832 313
858 3300003771 Ga0055526_1004652 Ga0055526_10046528 313
859 3300003771 Ga0055526_1009202 Ga0055526_10092025 313
860 3300003775 Ga0055524_1003638 Ga0055524_10036386 313
861 3300003781 Ga0055536_1015294 Ga0055536_10152941 313
862 3300003790 Ga0055528_1007761 Ga0055528_10077614 313
863 3300003790 Ga0055528_1012526 Ga0055528_10125262 313
864 3300003791 Ga0055530_10005675 Ga0055530_100056753 313
865 3300003792 Ga0055540_1002625 Ga0055540_10026252 313
866 3300003794 Ga0055531_10002261 Ga0055531_1000226110 313
867 3300003794 Ga0055531_10007612 Ga0055531_100076128 313
868 3300003856 Ga0058692_1002692 Ga0058692_10026923 313
869 3300004625 Ga0055543_1000012 Ga0055543_10000128 313
870 3300004625 Ga0055543_1000040 Ga0055543_100004081 313
871 3300004625 Ga0055543_1001946 Ga0055543_10019468 313
872 3300005262 Ga0065165_1000015 Ga0065165_1000015222 313
873 3300005262 Ga0065165_1002531 Ga0065165_10025316 313
874 3300005262 Ga0065165_1003987 Ga0065165_10039878 313
875 3300005262 Ga0065165_1007707 Ga0065165_10077072 313
876 3300005262 Ga0065165_1011545 Ga0065165_10115452 313
877 3300005331 Ga0070670_100009711 Ga0070670_1000097113 313
878 3300005344 Ga0070661_100002760 Ga0070661_1000027602 313
879 3300005344 Ga0070661_100006288 Ga0070661_1000062884 313
880 3300005344 Ga0070661_100312143 Ga0070661_1003121431 313
881 3300005539 Ga0068853_100004761 Ga0068853_10000476113 313
882 3300005539 Ga0068853_100078999 Ga0068853_1000789993 313
883 3300005548 Ga0070665_100100746 Ga0070665_1001007462 313
884 3300005578 Ga0068854_100034747 Ga0068854_1000347476 313
885 3300005834 Ga0068851_10005798 Ga0068851_100057982 313
886 3300006038 Ga0075365_10003852 Ga0075365_100038522 313
887 3300006038 Ga0075365_10077370 Ga0075365_100773702 313
888 3300006038 Ga0075365_10232344 Ga0075365_102323442 313
889 3300006048 Ga0075363_100256935 Ga0075363_1002569351 313
890 3300006051 Ga0075364_10069082 Ga0075364_100690822 313
891 3300006186 Ga0075369_10034254 Ga0075369_100342542 313
892 3300006946 Ga0079104_1000032 Ga0079104_100003286 313
893 3300010375 Ga0105239_10015417 Ga0105239_100154173 313
894 3300013100 Ga0157373_10066043 Ga0157373_100660432 313
895 3300013102 Ga0157371_10014140 Ga0157371_100141405 313
896 3300013105 Ga0157369_10196501 Ga0157369_101965011 313
897 3300013249 Ga0171463_1001 Ga0171463_1001212 313
898 3300015690 Ga0183363_1451 Ga0183363_14512 313
899 3300021320 Ga0214544_1000017 Ga0214544_1000017176 313
900 3300021321 Ga0214542_1000006 Ga0214542_100000654 313
901 3300021327 Ga0214543_1000003 Ga0214543_1000003488 313
902 3300021327 Ga0214543_1000014 Ga0214543_1000014269 313
903 3300025208 Ga0209436_100315 Ga0209436_1003158 313
904 3300025208 Ga0209436_101147 Ga0209436_1011475 313
905 3300025233 Ga0209437_100033 Ga0209437_100033282 313
906 3300025256 Ga0209759_1013620 Ga0209759_10136202 313
907 3300025258 Ga0209129_1000420 Ga0209129_100042021 313
908 3300025258 Ga0209129_1003477 Ga0209129_10034774 313
909 3300025258 Ga0209129_1008011 Ga0209129_10080112 313
910 3300025261 Ga0209233_1000064 Ga0209233_1000064140 313
911 3300025273 Ga0209673_1000041 Ga0209673_100004172 313
912 3300025273 Ga0209673_1000603 Ga0209673_10006035 313
913 3300025273 Ga0209673_1037998 Ga0209673_10379982 313
914 3300025284 Ga0209130_1000006 Ga0209130_1000006530 313
915 3300025284 Ga0209130_1000007 Ga0209130_100000781 313
916 3300025284 Ga0209130_1000018 Ga0209130_1000018263 313
917 3300025284 Ga0209130_1013814 Ga0209130_10138141 313
918 3300025292 Ga0209676_1003497 Ga0209676_10034978 313
919 3300025292 Ga0209676_1016484 Ga0209676_10164842 313
920 3300025294 Ga0209025_1000074 Ga0209025_1000074260 313
921 3300025294 Ga0209025_1000080 Ga0209025_100008033 313
922 3300025294 Ga0209025_1000100 Ga0209025_1000100226 313
923 3300025294 Ga0209025_1008335 Ga0209025_10083357 313
924 3300025294 Ga0209025_1013593 Ga0209025_10135933 313
925 3300025294 Ga0209025_1024975 Ga0209025_10249752 313
926 3300025295 Ga0209564_1000425 Ga0209564_100042551 313
927 3300025295 Ga0209564_1000439 Ga0209564_100043912 313
928 3300025295 Ga0209564_1011003 Ga0209564_10110035 313
929 3300025295 Ga0209564_1027287 Ga0209564_10272872 313
930 3300025297 Ga0209758_1000554 Ga0209758_100055442 313
931 3300025297 Ga0209758_1002005 Ga0209758_10020052 313
932 3300025297 Ga0209758_1017001 Ga0209758_10170012 313
933 3300025297 Ga0209758_1017730 Ga0209758_10177302 313
934 3300025297 Ga0209758_1021436 Ga0209758_10214362 313
935 3300025297 Ga0209758_1029384 Ga0209758_10293842 313
936 3300025298 Ga0209050_1016786 Ga0209050_10167862 313
937 3300025299 Ga0209256_1002348 Ga0209256_10023486 313
938 3300025299 Ga0209256_1002894 Ga0209256_10028942 313
939 3300025299 Ga0209256_1011586 Ga0209256_10115863 313
940 3300025299 Ga0209256_1022664 Ga0209256_10226641 313
941 3300025302 Ga0207426_1000044 Ga0207426_1000044126 313
942 3300025302 Ga0207426_1000064 Ga0207426_100006481 313
943 3300025302 Ga0207426_1000106 Ga0207426_1000106107 313
944 3300025303 Ga0209051_1000459 Ga0209051_100045934 313
945 3300025303 Ga0209051_1001705 Ga0209051_10017053 313
946 3300025303 Ga0209051_1002690 Ga0209051_100269014 313
947 3300025304 Ga0209257_1002541 Ga0209257_10025412 313
948 3300025321 Ga0207656_10003313 Ga0207656_100033132 313
949 3300025919 Ga0207657_10019763 Ga0207657_100197632 313
950 3300025919 Ga0207657_10154095 Ga0207657_101540952 313
951 3300025925 Ga0207650_10001915 Ga0207650_1000191513 313
952 3300025949 Ga0207667_10020644 Ga0207667_100206441 313
953 3300026041 Ga0207639_10010406 Ga0207639_100104063 313
954 3300026142 Ga0207698_10013180 Ga0207698_100131804 313
955 3300027111 Ga0209281_1000053 Ga0209281_1000053195 313
956 3300027312 Ga0209371_1000021 Ga0209371_1000021478 313
957 3300028379 Ga0268266_10377822 Ga0268266_103778222 313
958 3300028794 Ga0307515_10000070 Ga0307515_10000070176 313
959 3300028794 Ga0307515_10003572 Ga0307515_100035723 313
960 3300028794 Ga0307515_10010166 Ga0307515_1001016613 313
961 3300028794 Ga0307515_10231489 Ga0307515_102314891 313
962 3300030500 Ga0268256_1000020 Ga0268256_1000020484 313
963 3300031456 Ga0307513_10008740 Ga0307513_100087402 313
964 3300031548 Ga0307408_100149344 Ga0307408_1001493441 313
965 3300031730 Ga0307516_10042951 Ga0307516_100429512 313
966 3300032004 Ga0307414_10016210 Ga0307414_100162105 313
967 3300035171 Ga0373946_0022994 Ga0373946_0022994_70_1014 313
968 3300035695 Ga0373927_0000925 Ga0373927_0000925_10940_11884 313
969 3300037068 Ga0373925_0003381 Ga0373925_0003381_8787_9731 313
970 3300037418 Ga0395900_0094881 Ga0395900_0094881_467_1411 313
971 3300037471 Ga0395905_0017948 Ga0395905_0017948_3625_4569 313
972 3300038443 Ga0395901_0404396 Ga0395901_0404396_208_1149 313
973 3300041404 Ga0439436_0025006 Ga0439436_0025006_598_1575 313
974 3300041406 Ga0439439_0036435 Ga0439439_0036435_271_1248 313
975 3300041407 Ga0439447_019582 Ga0439447_019582_582_1559 313
976 3300041413 Ga0439465_0062662 Ga0439465_0062662_85_1074 313
977 3300041997 Ga0439431_0023859 Ga0439431_0023859_336_1313 313
978 3300042006 Ga0439432_062411 Ga0439432_062411_50_994 313
979 3300046453 Ga0495627_028880 Ga0495627_028880_366_1361 313
980 3300046454 Ga0495592_0050385 Ga0495592_0050385_1681_2625 313
981 3300046460 Ga0495638_0020463 Ga0495638_0020463_2528_3478 313
982 3300046460 Ga0495638_0024146 Ga0495638_0024146_2481_3425 313
983 3300046462 Ga0495651_0101369 Ga0495651_0101369_790_1734 313
984 3300046501 Ga0495607_0036799 Ga0495607_0036799_1568_2518 313
985 3300046501 Ga0495607_0107832 Ga0495607_0107832_117_1061 313
986 3300046506 Ga0495583_0028074 Ga0495583_0028074_253_1197 313
987 3300046507 Ga0495606_0015352 Ga0495606_0015352_1379_2329 313
988 3300046507 Ga0495606_0017659 Ga0495606_0017659_1635_2579 313
989 3300046507 Ga0495606_0170967 Ga0495606_0170967_234_1178 313
990 3300046512 Ga0495610_0023089 Ga0495610_0023089_222_1172 313
991 3300046512 Ga0495610_0049229 Ga0495610_0049229_367_1311 313
992 3300046515 Ga0495620_0012599 Ga0495620_0012599_1942_2892 313
993 3300046515 Ga0495620_0092744 Ga0495620_0092744_101_1045 313
994 3300046519 Ga0495632_0059265 Ga0495632_0059265_558_1508 313
995 3300046522 Ga0495643_0002659 Ga0495643_0002659_11661_12605 313
996 3300046530 Ga0495654_0000092 Ga0495654_0000092_81584_82528 313
997 3300046542 Ga0495597_0005990 Ga0495597_0005990_1180_2130 313
998 3300046616 Ga0495668_0051012 Ga0495668_0051012_144_1094 313
999 3300046660 Ga0495625_0012288 Ga0495625_0012288_5170_6120 313
1000 3300046809 Ga0495600_0009138 Ga0495600_0009138_1186_2130 313
1001 3300046810 Ga0495660_0001564 Ga0495660_0001564_5282_6232 313
1002 3300047317 Ga0495604_0032390 Ga0495604_0032390_60_1004 313
1003 3300047470 Ga0495681_0010747 Ga0495681_0010747_3033_4028 313
1004 3300047472 Ga0495686_0008600 Ga0495686_0008600_1559_2509 313
1005 3300047472 Ga0495686_0027080 Ga0495686_0027080_2092_3036 313
1006 3300047472 Ga0495686_0146621 Ga0495686_0146621_430_1371 313
1007 3300048909 Ga0496106_0003362 Ga0496106_0003362_9895_10839 313
1008 3300048909 Ga0496106_0089404 Ga0496106_0089404_761_1705 313
1009 3300048909 Ga0496106_0299690 Ga0496106_0299690_256_1200 313
1010 3300048913 Ga0496110_0239681 Ga0496110_0239681_408_1352 313
1011 3300048914 Ga0496111_0000236 Ga0496111_0000236_17055_17999 313
1012 3300048919 Ga0496116_0000036 Ga0496116_0000036_280396_281388 313
1013 3300048920 Ga0496117_0103427 Ga0496117_0103427_15_959 313
1014 3300048921 Ga0496118_0055489 Ga0496118_0055489_1077_2021 313
1015 3300048923 Ga0496120_0011845 Ga0496120_0011845_3071_4111 313
1016 3300048923 Ga0496120_0075534 Ga0496120_0075534_298_1293 313
1017 3300048924 Ga0496121_0000001 Ga0496121_0000001_893450_894490 313
1018 3300048924 Ga0496121_0001948 Ga0496121_0001948_4877_5869 313
1019 3300048924 Ga0496121_0023150 Ga0496121_0023150_1109_2053 313
1020 3300048924 Ga0496121_0034281 Ga0496121_0034281_3071_4015 313
1021 3300048924 Ga0496121_0051611 Ga0496121_0051611_2076_3026 313
1022 3300048924 Ga0496121_0252673 Ga0496121_0252673_213_1157 313
1023 3300048925 Ga0496122_0000160 Ga0496122_0000160_110944_111888 313
1024 3300048925 Ga0496122_0061635 Ga0496122_0061635_107_1147 313
1025 3300048925 Ga0496122_0094524 Ga0496122_0094524_329_1321 313
1026 3300048925 Ga0496122_0128832 Ga0496122_0128832_358_1302 313
1027 3300048926 Ga0496123_0000034 Ga0496123_0000034_140622_141566 313
1028 3300048926 Ga0496123_0022771 Ga0496123_0022771_3700_4740 313
1029 3300048926 Ga0496123_0059455 Ga0496123_0059455_806_1813 313
1030 3300048927 Ga0496124_0000349 Ga0496124_0000349_43629_44612 313
1031 3300048927 Ga0496124_0030968 Ga0496124_0030968_266_1210 313
1032 3300048927 Ga0496124_0060590 Ga0496124_0060590_329_1318 313
1033 3300048927 Ga0496124_0078365 Ga0496124_0078365_39_983 313
1034 3300048927 Ga0496124_0131015 Ga0496124_0131015_70_1014 313
1035 3300048927 Ga0496124_0152290 Ga0496124_0152290_452_1432 313
1036 3300048928 Ga0496125_0000001 Ga0496125_0000001_1007335_1008375 313
1037 3300048928 Ga0496125_0008785 Ga0496125_0008785_6479_7423 313
1038 3300048928 Ga0496125_0053355 Ga0496125_0053355_1827_2771 313
1039 3300048929 Ga0496126_0000156 Ga0496126_0000156_95063_96070 313
1040 3300048929 Ga0496126_0001886 Ga0496126_0001886_7577_8518 313
1041 3300048929 Ga0496126_0077009 Ga0496126_0077009_1819_2763 313
1042 3300049568 Ga0501031_0000060 Ga0501031_0000060_48979_49920 313
1043 3300049568 Ga0501031_0002553 Ga0501031_0002553_2176_3117 313
1044 3300049569 Ga0501032_0000015 Ga0501032_0000015_135995_136936 313
1045 3300049569 Ga0501032_0000025 Ga0501032_0000025_74383_75324 313
1046 3300049569 Ga0501032_0053548 Ga0501032_0053548_355_1299 313
1047 3300049570 Ga0501033_0000023 Ga0501033_0000023_135995_136936 313
1048 3300049570 Ga0501033_0000229 Ga0501033_0000229_23823_24764 313
1049 3300049570 Ga0501033_0000742 Ga0501033_0000742_13806_14789 313
1050 3300049570 Ga0501033_0086334 Ga0501033_0086334_165_1106 313
1051 3300049571 Ga0501034_0000073 Ga0501034_0000073_39802_40743 313
1052 3300049571 Ga0501034_0001654 Ga0501034_0001654_13659_14600 313
1053 3300049571 Ga0501034_0020740 Ga0501034_0020740_1023_1964 313
1054 3300049571 Ga0501034_0086434 Ga0501034_0086434_1077_2018 313
1055 3300049571 Ga0501034_0175292 Ga0501034_0175292_270_1211 313
1056 3300049571 Ga0501034_0211689 Ga0501034_0211689_698_1687 313
1057 3300049572 Ga0501036_0000002 Ga0501036_0000002_135995_136936 313
1058 3300049572 Ga0501036_0000151 Ga0501036_0000151_5350_6291 313
1059 3300049573 Ga0501037_0000048 Ga0501037_0000048_39820_40761 313
1060 3300049573 Ga0501037_0000176 Ga0501037_0000176_24049_24990 313
1061 3300049574 Ga0501038_0000002 Ga0501038_0000002_129533_130474 313
1062 3300049574 Ga0501038_0000046 Ga0501038_0000046_100288_101229 313
1063 3300049575 Ga0501039_0000002 Ga0501039_0000002_218039_218980 313
1064 3300049575 Ga0501039_0000003 Ga0501039_0000003_90798_91739 313
1065 3300049576 Ga0501040_0002028 Ga0501040_0002028_8773_9714 313
1066 3300049579 Ga0501043_0000029 Ga0501043_0000029_13697_14638 313
1067 3300049579 Ga0501043_0000051 Ga0501043_0000051_23821_24762 313
1068 3300049579 Ga0501043_0001754 Ga0501043_0001754_16742_17683 313
1069 3300049581 Ga0501047_0000801 Ga0501047_0000801_28455_29396 313
1070 3300049581 Ga0501047_0060138 Ga0501047_0060138_1744_2685 313
1071 3300049581 Ga0501047_0268666 Ga0501047_0268666_129_1070 313
1072 3300049585 Ga0501069_0000031 Ga0501069_0000031_13716_14657 313
1073 3300049585 Ga0501069_0143906 Ga0501069_0143906_162_1103 313
1074 3300049586 Ga0501070_0000045 Ga0501070_0000045_13716_14657 313
1075 3300049586 Ga0501070_0075850 Ga0501070_0075850_880_1821 313
1076 3300049587 Ga0501071_0002491 Ga0501071_0002491_34_975 313
1077 3300049589 Ga0501073_0318334 Ga0501073_0318334_98_1039 313
1078 3300049590 Ga0501074_0000012 Ga0501074_0000012_79799_80740 313
1079 3300049742 Ga0501080_0004574 Ga0501080_0004574_7409_8350 313
1080 3300049742 Ga0501080_0159814 Ga0501080_0159814_615_1556 313
1081 3300049744 Ga0501083_0000078 Ga0501083_0000078_25063_26004 313
1082 3300049744 Ga0501083_0060708 Ga0501083_0060708_1468_2412 313
1083 3300049822 Ga0501035_0000022 Ga0501035_0000022_48925_49866 313
1084 3300049822 Ga0501035_0000102 Ga0501035_0000102_82194_83135 313
1085 3300049822 Ga0501035_0000950 Ga0501035_0000950_24983_25966 313
1086 3300049822 Ga0501035_0003111 Ga0501035_0003111_1057_1998 313
1087 3300049822 Ga0501035_0093191 Ga0501035_0093191_1640_2581 313
1088 3300049822 Ga0501035_0148745 Ga0501035_0148745_307_1248 313
1089 3300049823 Ga0501044_0000002 Ga0501044_0000002_156173_157114 313
1090 3300049823 Ga0501044_0000113 Ga0501044_0000113_13716_14657 313
1091 3300049823 Ga0501044_0057809 Ga0501044_0057809_1808_2749 313
1092 3300049823 Ga0501044_0065523 Ga0501044_0065523_38_979 313
1093 3300049823 Ga0501044_0079931 Ga0501044_0079931_165_1106 313
1094 3300049823 Ga0501044_0189940 Ga0501044_0189940_802_1743 313
1095 3300049824 Ga0501045_0138904 Ga0501045_0138904_710_1651 313
1096 3300049824 Ga0501045_0318137 Ga0501045_0318137_76_1017 313
1097 3300050492 nmdc:mga0yw44_13656_c1 nmdc:mga0yw44_13656_c1_432_1388 313
1098 3300050492 nmdc:mga0yw44_19308_c1 nmdc:mga0yw44_19308_c1_1342_2283 313
1099 3300050492 nmdc:mga0yw44_41468_c1 nmdc:mga0yw44_41468_c1_430_1371 313
1100 3300053096 Ga0500641_0048969 Ga0500641_0048969_52_999 313
1101 3300053107 Ga0500560_002179 Ga0500560_002179_1323_2267 313
1102 3300053109 Ga0500569_048241 Ga0500569_048241_308_1252 313
1103 3300053111 Ga0500572_009295 Ga0500572_009295_765_1709 313
1104 3300053122 Ga0500608_042476 Ga0500608_042476_124_1182 313
1105 3300053125 Ga0500618_000227 Ga0500618_000227_39369_40316 313
1106 3300053125 Ga0500618_005699 Ga0500618_005699_362_1306 313
1107 3300053134 Ga0500658_0032453 Ga0500658_0032453_758_1726 313
1108 3300053139 Ga0500568_0012950 Ga0500568_0012950_1128_2096 313
1109 3300053153 Ga0500616_0003869 Ga0500616_0003869_2151_3098 313
1110 3300053153 Ga0500616_0055492 Ga0500616_0055492_25_966 313
1111 3300053156 Ga0500622_0004006 Ga0500622_0004006_1606_2550 313
1112 3300053156 Ga0500622_0033890 Ga0500622_0033890_1594_2550 313
1113 3300053157 Ga0500624_003548 Ga0500624_003548_769_1713 313
1114 3300053177 Ga0500636_0031858 Ga0500636_0031858_490_1434 313
1115 iso_pu_bacteria 2512047086 2512532438 313
1116 iso_pu_bacteria 2513237159 2514001893 313
1117 iso_pu_bacteria 2582581304 2585256608 313
1118 iso_pu_bacteria 2599185236 2599723053 313
1119 iso_pu_bacteria 2600254933 2600375272 313
1120 iso_pu_bacteria 2718218009 2719731044 313
1121 iso_pu_bacteria 2718218363 2721146389 313
1122 iso_pu_bacteria 2718218366 2721163268 313
1123 iso_pu_bacteria 2721755514 2722839438 313
1124 iso_pu_bacteria 2721755810 2724043800 313
1125 iso_pu_bacteria 2728369365 2730163532 313
1126 iso_pu_bacteria 2728369397 2730297543 313
1127 iso_pu_bacteria 2791355094 2792638332 313
1128 iso_pu_bacteria 2791355260 2793321095 313
1129 iso_pu_bacteria 2978969890 2978973802 313
1130 iso_pu_bacteria 2984587000 2984589151 313
1131 iso_pu_bacteria 8054460903 8054461904 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00698

Acyl_transf_1

Acyl transferase domain

21

308

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qat-assembly1.cif.gz_A crystal structure of acyl-carrier-protein-s-malonyltransferase from bartonella henselae 0.9874 1 312
3qat-assembly1.cif.gz_A crystal structure of acyl-carrier-protein-s-malonyltransferase from bartonella henselae 0.9842 1 312
2g2y-assembly1.cif.gz_A structure of e.coli fabd complexed with malonate 0.9795 3 307
3hjv-assembly1.cif.gz_B 1.7 angstrom resolution crystal structure of an acyl carrier protein s-malonyltransferase from vibrio cholerae o1 biovar eltor str. n16961 0.9767 1 306
3h0p-assembly1.cif.gz_A 2.0 angstrom crystal structure of an acyl carrier protein s-malonyltransferase from salmonella typhimurium. 0.9739 1 308
ID Description Score Start End Superfamily
3tqeA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding 0.986 127 198 3.30.70.250
3qatA01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9847 1 312 3.40.366.10
af_P0AAI9_6_286_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9804 5 286 3.20.10.10
3qatA01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9767 1 312 3.40.366.10
af_P0AAI9_6_286_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9735 5 286 3.20.10.10
ID Description Score Start End GO Terms
AF-A0A3S1PFN9-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9971 85 312 GO:0004314
GO:0005829
GO:0006633
AF-A0A512IKK0-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9911 1 306 GO:0004314
GO:0005829
GO:0006633
AF-X5MGQ1-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9905 1 312 GO:0004314
GO:0005829
GO:0006633
AF-X5MGQ1-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9874 1 312 GO:0004314
GO:0005829
GO:0006633
AF-A0A2S6R8W3-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9871 17 311 GO:0004314
GO:0005829
GO:0006633

Feature Viewer

pLDDT pTM Quality
95.6 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map