F490537

General Info

Members Datasets Scaffolds Average Seq Length
1130 761 679 225

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0002017|Ga0495610_0002017_11796_12617
Length 273
Sequence MVFSRSRSAGASLPGFGRAEVSQHLPSAAIALSEVSFVELFGIAWRCRPLEPTMSLTLYYHPLASFCHKVLIALYENGVDFDKRIINLGEESDRAELEAIWPLCKFPVLRDQERRRDVPETSVIIEYLDRYFPGAQPMLPADWDAALDVRLWDRFFDNYVQEPMQTIVSAHLTGMQCDQTKERTKLKTAYKMIEKRMATRAWMCGEAFSMADCAAAPALFYAATLLPFPEEYHHLQSYFERLVARPSVKRVLDESKPYFPMYPFVNDIPERFL

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
10 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
11 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
12 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
13 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
14 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
15 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
16 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
17 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
18 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
19 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
20 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
21 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
22 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
23 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
24 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
25 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
26 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
27 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
28 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
29 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
30 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
31 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
32 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
33 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
34 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
35 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
36 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
37 2519899620 Rhizobium sp. Pop5 Isolate Nodule
38 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
39 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
40 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
41 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
42 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
43 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
44 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
45 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
46 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
47 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
48 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
49 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
50 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
51 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
52 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
53 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
54 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
55 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
56 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
57 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
58 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
59 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
60 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
61 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
62 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
63 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
64 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
65 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
66 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
67 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
68 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
69 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
70 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
71 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
72 2643221557 Ensifer sp. Root558 Isolate Unclassified
73 2643221568 Rhizobium sp. Root564 Isolate Unclassified
74 2643221583 Caulobacter sp. Root655 Isolate Unclassified
75 2643221593 Lysobacter sp. Root690 Isolate Unclassified
76 2643221599 Rhizobium sp. Root708 Isolate Unclassified
77 2643221610 Ensifer sp. Root74 Isolate Unclassified
78 2643221618 Ensifer sp. Root231 Isolate Unclassified
79 2643221626 Ensifer sp. Root31 Isolate Unclassified
80 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
81 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
82 2643221655 Ensifer sp. Root1252 Isolate Unclassified
83 2643221659 Ensifer sp. Root127 Isolate Unclassified
84 2643221668 Ensifer sp. Root423 Isolate Unclassified
85 2643221675 Ensifer sp. Root1298 Isolate Unclassified
86 2643221680 Ensifer sp. Root1312 Isolate Unclassified
87 2643221698 Ensifer sp. Root142 Isolate Unclassified
88 2643221712 Ensifer sp. Root258 Isolate Unclassified
89 2643221723 Ensifer sp. Root278 Isolate Unclassified
90 2643221726 Ensifer sp. Root954 Isolate Unclassified
91 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
92 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
93 2718217882 Rhizobium sp. N741 Isolate Nodule
94 2718217927 Rhizobium sp. N324 Isolate Nodule
95 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
96 2718218009 Rhizobium sp. N561 Isolate Nodule
97 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
98 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
99 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
100 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
101 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
102 2718218363 Rhizobium sp. N113 Isolate Nodule
103 2718218365 Rhizobium sp. N731 Isolate Nodule
104 2718218366 Rhizobium sp. N621 Isolate Nodule
105 2718218423 Rhizobium sp. N941 Isolate Nodule
106 2721755514 Rhizobium sp. N6212 Isolate Nodule
107 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
108 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
109 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
110 2721755809 Rhizobium sp. N541 Isolate Nodule
111 2721755810 Rhizobium sp. N871 Isolate Nodule
112 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
113 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
114 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
115 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
116 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
117 2728369365 Rhizobium sp. N1341 Isolate Nodule
118 2728369397 Rhizobium sp. N1314 Isolate Nodule
119 2738541293 Rhizobium sp. GV031 Isolate Unclassified
120 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
121 2738543024 Aminobacter sp. AP02 Isolate Unclassified
122 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
123 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
124 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
125 2791355256 Rhizobium sp. M10 Isolate Nodule
126 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
127 2791355260 Rhizobium sp. L9 Isolate Nodule
128 2791355262 Rhizobium sp. M1 Isolate Nodule
129 2791355263 Rhizobium chutanense C5 Isolate Nodule
130 2791355264 Rhizobium sp. S9 Isolate Nodule
131 2791355265 Rhizobium sp. H4 Isolate Nodule
132 2791355266 Rhizobium sp. L43 Isolate Nodule
133 2791355267 Rhizobium sp. L18 Isolate Nodule
134 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
135 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
136 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
137 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
138 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
139 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
140 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
141 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
142 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
143 2802429633 Rhizobium anhuiense J3 Isolate Nodule
144 2802429634 Rhizobium anhuiense S10 Isolate Nodule
145 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
146 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
147 2802429637 Rhizobium anhuiense C15 Isolate Nodule
148 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
149 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
150 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
151 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
152 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
153 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
154 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
155 2838048938 Rhizobium pisi 27/80 Isolate Nodule
156 2838061910 Rhizobium phaseoli L15 Isolate Nodule
157 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
158 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
159 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
160 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
161 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
162 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
163 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
164 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
165 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
166 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
167 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
168 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
169 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
170 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
171 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
172 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
173 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
174 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
175 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
176 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
177 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
178 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
179 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
180 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
181 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
182 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
183 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
184 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
185 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
186 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
187 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
188 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
189 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
190 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
191 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
192 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
193 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
194 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
195 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
196 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
197 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
198 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
199 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
200 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
201 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
202 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
203 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
204 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
205 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
206 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
207 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
208 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
209 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
210 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
211 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
212 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
213 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
214 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
215 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
216 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
217 2844163670 Ensifer sp. 1H6 Isolate Unclassified
218 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
219 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
220 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
221 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
222 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
223 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
224 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
225 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
226 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
227 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
228 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
229 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
230 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
231 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
232 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
233 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
234 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
235 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
236 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
237 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
238 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
239 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
240 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
241 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
242 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
243 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
244 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
245 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
246 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
247 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
248 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
249 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
250 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
251 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
252 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
253 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
254 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
255 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
256 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
257 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
258 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
259 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
260 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
261 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
262 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
263 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
264 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
265 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
266 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
267 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
268 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
269 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
270 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
271 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
272 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
273 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
274 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
275 2933599457 Rhizobium phaseoli M3 Isolate Nodule
276 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
277 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
278 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
279 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
280 2936381700 Rhizobium chutanense C16 Isolate Unclassified
281 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
282 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
283 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
284 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
285 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
286 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
287 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
288 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
289 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
290 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
291 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
292 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
293 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
294 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
295 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
296 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
297 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
298 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
299 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
300 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
301 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
302 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
303 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
304 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
305 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
306 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
307 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
308 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
309 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
310 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
311 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
312 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
313 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
314 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
315 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
316 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
317 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
318 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
319 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
320 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
321 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
322 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
323 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
324 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
325 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
326 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
327 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
328 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
329 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
330 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
331 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
332 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
333 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
334 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
335 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
336 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
337 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
338 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
339 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
340 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
341 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
342 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
343 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
344 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
345 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
346 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
347 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
348 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
349 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
350 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
351 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
352 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
353 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
354 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
355 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
356 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
357 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
358 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
359 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
360 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
361 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
362 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
363 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
364 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
365 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
366 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
367 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
368 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
369 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
370 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
371 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
372 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
373 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
374 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
375 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
376 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
377 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
378 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
379 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
380 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
381 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
382 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
383 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
384 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
385 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
386 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
387 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
388 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
389 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
390 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
391 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
392 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
393 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
394 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
395 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
396 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
397 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
398 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
399 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
400 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
401 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
402 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
403 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
404 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
405 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
406 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
407 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
408 2996893221 Rhizobium sp. R635 Isolate Nodule
409 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
410 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
411 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
412 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
413 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
414 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
415 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
416 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
417 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
418 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
419 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
420 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
421 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
422 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
423 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
424 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
425 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
426 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
427 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
428 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
429 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
430 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
431 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
432 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
433 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
434 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
435 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
436 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
437 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
438 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
439 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
440 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
441 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
442 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
443 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
444 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
445 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
446 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
447 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
448 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
449 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
450 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
451 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
452 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
453 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
454 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
455 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
456 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
457 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
458 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
459 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
460 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
461 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
462 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
463 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
464 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
465 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
466 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
467 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
468 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
469 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
470 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
471 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
472 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
473 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
474 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
475 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
476 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
477 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
478 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
479 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
480 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
481 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
482 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
483 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
484 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
485 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
486 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
487 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
488 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
489 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
490 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
491 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
492 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
493 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
494 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
495 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
496 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
497 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
498 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
499 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
500 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
501 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
502 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
503 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
504 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
505 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
506 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
507 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
508 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
509 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
510 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
511 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
512 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
513 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
514 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
515 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
516 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
517 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
518 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
519 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
520 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
521 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
522 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
523 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
524 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
525 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
526 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
527 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
528 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
529 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
530 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
531 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
532 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
533 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
534 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
535 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
536 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
537 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
538 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
539 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
540 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
541 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
542 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
543 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
544 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
545 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
546 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
547 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
548 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
549 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
550 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
551 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
552 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
553 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
554 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
555 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
556 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
557 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
558 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
559 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
560 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
561 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
562 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
563 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
564 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
565 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
566 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
567 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
568 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
569 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
570 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
571 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
572 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
573 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
574 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
575 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
576 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
577 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
578 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
579 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
580 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
581 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
582 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
583 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
584 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
585 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
586 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
587 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
588 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
589 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
590 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
591 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
592 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
593 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
594 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
595 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
596 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
597 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
598 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
599 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
600 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
601 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
602 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
603 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
604 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
605 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
606 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
607 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
608 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
609 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
610 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
611 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
612 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
613 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
614 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
615 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
616 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
617 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
618 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
619 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
620 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
621 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
622 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
623 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
624 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
625 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
626 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
627 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
628 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
629 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
630 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
631 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
632 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
633 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
634 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
635 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
636 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
637 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
638 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
639 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
640 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
641 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
642 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
643 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
644 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
645 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
646 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
647 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
648 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
649 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
650 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
651 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
652 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
653 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
654 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
655 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
656 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
657 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
658 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
659 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
660 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
661 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
662 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
663 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
664 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
665 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
666 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
667 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
668 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
669 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
670 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
671 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
672 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
673 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
674 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
675 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
676 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
677 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
678 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
679 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
680 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
681 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
682 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
683 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
684 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
685 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
686 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
687 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
688 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
689 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
690 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
691 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
692 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
693 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
694 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
695 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
696 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
697 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
698 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
699 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
700 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
701 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
702 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
703 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
704 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
705 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
706 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
707 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
708 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
709 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
710 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
711 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
712 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
713 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
714 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
715 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
716 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
717 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
718 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
719 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
720 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
721 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
722 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
723 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
724 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
725 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
726 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
727 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
728 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
729 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
730 8005275841 Rhizobium sp. N4311 Isolate Nodule
731 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
732 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
733 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
734 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
735 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
736 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
737 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
738 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
739 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
740 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
741 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
742 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
743 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
744 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
745 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
746 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
747 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
748 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
749 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
750 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
751 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
752 8018176218 Rhizobium sp. N122 Isolate Nodule
753 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
754 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
755 8024501048 Rhizobium sp. H4 Isolate Nodule
756 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
757 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
758 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
759 8056382006 Rhizobium croatiense 13T Isolate Nodule
760 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
761 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.91
Metatranscriptomes 0.09
Isolates 40

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.79
Nodule 33.81
Rhizoplane 1.33
Rhizosphere 29.82
Stem 0
Stem Tuber 0
Unclassified 17.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000001 3300002704 Bacteria 354543
2 JGI25156J39149_1000001 3300002705 Bacteria 354557
3 JGI25162J39368_1000209 3300002737 Bacteria 61889
4 JGI25154J39366_1000011 3300002738 Bacteria 296007
5 JGI25158J39367_1000088 3300002739 Bacteria 21274
6 JGI25157J39369_1000030 3300002741 Bacteria 146112
7 JGI25152J39213_1001161 3300002773 Bacteria 12171
8 JGI25152J39213_1003989 3300002773 Bacteria 4817
9 JGI25152J39213_1004094 3300002773 Bacteria 4724
10 JGI25152J39213_1004694 3300002773 Plasmid 4227
11 JGI25150J39212_1000160 3300002774 Bacteria 38064
12 JGI25150J39212_1017535 3300002774 Bacteria 1154
13 JGI25159J45721_1000028 3300002987 Bacteria 111628
14 JGI25159J45721_1000850 3300002987 Bacteria 13326
15 JGI25151J46595_10000083 3300003187 Bacteria 130658
16 JGI25151J46595_10009987 3300003187 Bacteria 4451
17 JGI25151J46595_10010555 3300003187 Bacteria 4281
18 JGI25165J46597_1000302 3300003214 Bacteria 61889
19 JGI25165J46597_1005338 3300003214 Bacteria 2502
20 JGI25153J46596_10000965 3300003215 Bacteria 17426
21 JGI25153J46596_10005132 3300003215 Bacteria 6902
22 JGI25153J46596_10008229 3300003215 Bacteria 5013
23 rootH1_10056988 3300003316 Bacteria 2343
24 rootH2_10012649 3300003320 Bacteria 8778
25 rootH1_10000039 3300003316 Bacteria 23242
26 rootH1_10000039 3300003323 Bacteria 6950
27 rootH1_10014639 3300003323 Bacteria 3755
28 JGI25160J50197_1000024 3300003354 Bacteria 189526
29 JGI25160J50197_1003560 3300003354 Bacteria 6932
30 JGI25160J50197_1008974 3300003354 Bacteria 3753
31 JGI25161J50226_1000414 3300003374 Bacteria 20639
32 JGI25161J50226_1000876 3300003374 Bacteria 11022
33 JGI25161J50226_1005973 3300003374 Bacteria 2268
34 Ga0055529_1000125 3300003763 Bacteria 110810
35 Ga0055526_1000005 3300003771 Bacteria 344542
36 Ga0055526_1000016 3300003771 Bacteria 213710
37 Ga0055526_1000118 3300003771 Bacteria 69508
38 Ga0055526_1000323 3300003771 Bacteria 39660
39 Ga0055526_1000490 3300003771 Bacteria 31450
40 Ga0055526_1003421 3300003771 Bacteria 10078
41 Ga0055526_1003494 3300003771 Bacteria 9959
42 Ga0055526_1004931 3300003771 Bacteria 7844
43 Ga0055526_1020423 3300003771 Bacteria 2357
44 Ga0055537_1000042 3300003773 Bacteria 91406
45 Ga0055524_1000005 3300003775 Bacteria 344542
46 Ga0055524_1000129 3300003775 Bacteria 88836
47 Ga0055524_1001133 3300003775 Bacteria 16031
48 Ga0055524_1001266 3300003775 Bacteria 14812
49 Ga0055524_1002043 3300003775 Bacteria 10732
50 Ga0055524_1005296 3300003775 Bacteria 5790
51 Ga0055524_1011991 3300003775 Bacteria 3352
52 Ga0055524_1025150 3300003775 Bacteria 1871
53 Ga0055536_1007822 3300003781 Bacteria 4714
54 Ga0055534_1000002 3300003784 Bacteria 390762
55 Ga0055528_1000002 3300003790 Bacteria 368879
56 Ga0055528_1000057 3300003790 Bacteria 89062
57 Ga0055528_1000284 3300003790 Bacteria 43328
58 Ga0055528_1001616 3300003790 Bacteria 13306
59 Ga0055528_1005134 3300003790 Bacteria 6160
60 Ga0055528_1016447 3300003790 Bacteria 2615
61 Ga0055528_1018737 3300003790 Bacteria 2333
62 Ga0055540_1000510 3300003792 Bacteria 29334
63 Ga0055540_1003979 3300003792 Bacteria 6882
64 Ga0055540_1028168 3300003792 Bacteria 1332
65 JGI25405J52794_10000556 3300003911 Bacteria 5451
66 Ga0055543_1000013 3300004625 Bacteria 179052
67 Ga0055543_1000536 3300004625 Bacteria 21378
68 Ga0055543_1000668 3300004625 Bacteria 18040
69 Ga0065165_1000098 3300005262 Bacteria 144210
70 Ga0065165_1022746 3300005262 Bacteria 2141
71 Ga0065165_1037690 3300005262 Bacteria 1463
72 Ga0065714_10010827 3300005288 Bacteria 3051
73 Ga0065715_10249483 3300005293 Bacteria 1172
74 Ga0070658_10049799 3300005327 Bacteria 3395
75 Ga0070668_100333367 3300005347 Bacteria 1280
76 Ga0070667_100673145 3300005367 Bacteria 956
77 Ga0070686_100045263 3300005544 Bacteria 2771
78 Ga0070665_100073173 3300005548 Bacteria 3434
79 Ga0070665_100101125 3300005548 Bacteria 2887
80 Ga0070665_100359817 3300005548 Bacteria 1461
81 Ga0068855_100111994 3300005563 Bacteria 3132
82 Ga0068856_100087574 3300005614 Bacteria 3096
83 Ga0068856_100563960 3300005614 Bacteria 1160
84 Ga0068859_100304614 3300005617 Bacteria 1687
85 Ga0068859_101326588 3300005617 Bacteria 793
86 Ga0068861_100862695 3300005719 Bacteria 854
87 Ga0068862_100147974 3300005844 Bacteria 2089
88 Ga0081455_10005282 3300005937 Bacteria 14190
89 Ga0081455_10195894 3300005937 Bacteria 1517
90 Ga0081455_10339856 3300005937 Bacteria 1063
91 Ga0081455_10348069 3300005937 Bacteria 1046
92 Ga0075365_10001032 3300006038 Bacteria 11976
93 Ga0075368_10036201 3300006042 Bacteria 1928
94 Ga0075363_100064567 3300006048 Bacteria 1978
95 Ga0075363_100127293 3300006048 Bacteria 1427
96 Ga0075432_10000194 3300006058 Bacteria 15798
97 Ga0075362_10000141 3300006177 Bacteria 19610
98 Ga0075362_10123514 3300006177 Bacteria 1227
99 Ga0075367_10002608 3300006178 Bacteria 8282
100 Ga0075369_10001683 3300006186 Bacteria 7632
101 Ga0075369_10101479 3300006186 Bacteria 1291
102 Ga0075366_10005088 3300006195 Bacteria 7112
103 Ga0075370_10002484 3300006353 Bacteria 8551
104 Ga0075370_10309879 3300006353 Bacteria 939
105 Ga0075428_100009454 3300006844 Bacteria 10823
106 Ga0075430_100000129 3300006846 Bacteria 47714
107 Ga0075430_100101154 3300006846 Bacteria 2407
108 Ga0075431_100000948 3300006847 Bacteria 25623
109 Ga0075431_100002790 3300006847 Bacteria 16922
110 Ga0075431_100058389 3300006847 Bacteria 3982
111 Ga0075433_10000100 3300006852 Bacteria 41448
112 Ga0075434_100001229 3300006871 Bacteria 21306
113 Ga0075429_100000278 3300006880 Bacteria 36057
114 Ga0075429_100049145 3300006880 Bacteria 3668
115 Ga0075429_100077198 3300006880 Bacteria 2902
116 Ga0097620_100304599 3300006931 Bacteria 1687
117 Ga0097620_101326316 3300006931 Bacteria 793
118 Ga0079104_1019394 3300006946 Bacteria 1901
119 Ga0099826_10000001 3300006948 Bacteria 1155201
120 Ga0075435_100009615 3300007076 Bacteria 7018
121 Ga0105244_10034297 3300009036 Bacteria 2673
122 Ga0105250_10000022 3300009092 Bacteria 231610
123 Ga0105240_10000005 3300009093 Bacteria 702630
124 Ga0111539_10001748 3300009094 Bacteria 28854
125 Ga0114129_10002143 3300009147 Bacteria 27207
126 Ga0114129_10080591 3300009147 Bacteria 4525
127 Ga0105242_10721601 3300009176 Bacteria 978
128 Ga0105237_10003410 3300009545 Bacteria 18891
129 Ga0123341_1000037 3300009765 Bacteria 60834
130 Ga0123342_1010819 3300009766 Bacteria 10273
131 Ga0105239_10010354 3300010375 Bacteria 10440
132 Ga0157373_10071569 3300013100 Bacteria 2449
133 Ga0157371_10009535 3300013102 Bacteria 7635
134 Ga0157370_10000046 3300013104 Bacteria 125612
135 Ga0157369_10040067 3300013105 Bacteria 5117
136 Ga0157369_10151748 3300013105 Bacteria 2449
137 Ga0157369_10860805 3300013105 Bacteria 930
138 Ga0171463_1003 3300013249 Bacteria 695693
139 Ga0163162_10459840 3300013306 Bacteria 1404
140 Ga0182008_10038739 3300014497 Bacteria 2383
141 Ga0157379_10000176 3300014968 Bacteria 48211
142 Ga0182007_10001276 3300015262 Bacteria 13646
143 Ga0182005_1000769 3300015265 Bacteria 14613
144 Ga0183360_10002 3300015689 Bacteria 953821
145 Ga0183363_1059 3300015690 Bacteria 33798
146 Ga0214544_1000169 3300021320 Bacteria 101212
147 Ga0214542_1000131 3300021321 Bacteria 107074
148 Ga0214543_1000028 3300021327 Bacteria 214029
149 Ga0213872_10001117 3300021361 Bacteria 18361
150 Ga0213872_10024542 3300021361 Bacteria 2773
151 Ga0213872_10150457 3300021361 Bacteria 1017
152 Ga0228711_1006836 3300022739 Bacteria 16770
153 Ga0228710_1006916 3300022740 Bacteria 16965
154 Ga0209435_100012 3300025206 Bacteria 401621
155 Ga0209436_100020 3300025208 Bacteria 104602
156 Ga0209436_100385 3300025208 Bacteria 19927
157 Ga0209672_102907 3300025228 Bacteria 3826
158 Ga0209437_100047 3300025233 Bacteria 405163
159 Ga0207425_1000024 3300025245 Bacteria 328978
160 Ga0207425_1002801 3300025245 Bacteria 5902
161 Ga0207425_1007877 3300025245 Bacteria 2774
162 Ga0207425_1025167 3300025245 Bacteria 1230
163 Ga0209646_1000026 3300025246 Bacteria 401621
164 Ga0209646_1004877 3300025246 Bacteria 2402
165 Ga0209026_1000014 3300025250 Bacteria 401621
166 Ga0209026_1001794 3300025250 Bacteria 8878
167 Ga0209677_100511 3300025253 Bacteria 21677
168 Ga0209759_1000012 3300025256 Bacteria 401621
169 Ga0209129_1000069 3300025258 Bacteria 212790
170 Ga0209129_1000184 3300025258 Bacteria 87102
171 Ga0209129_1000376 3300025258 Bacteria 36225
172 Ga0209129_1001228 3300025258 Bacteria 14696
173 Ga0209129_1003874 3300025258 Bacteria 6231
174 Ga0209233_1000048 3300025261 Bacteria 453669
175 Ga0209233_1000195 3300025261 Bacteria 125863
176 Ga0209565_1000001 3300025263 Bacteria 2950419
177 Ga0209565_1008639 3300025263 Bacteria 2642
178 Ga0209455_1000044 3300025272 Bacteria 410787
179 Ga0209455_1016427 3300025272 Bacteria 1590
180 Ga0209673_1000001 3300025273 Bacteria 3176258
181 Ga0209673_1000013 3300025273 Bacteria 571633
182 Ga0209673_1000048 3300025273 Bacteria 287976
183 Ga0209673_1000296 3300025273 Bacteria 92350
184 Ga0209673_1001255 3300025273 Bacteria 26234
185 Ga0209673_1001781 3300025273 Bacteria 17854
186 Ga0209673_1003140 3300025273 Bacteria 10087
187 Ga0209673_1007806 3300025273 Bacteria 4856
188 Ga0209673_1020119 3300025273 Bacteria 2372
189 Ga0209130_1000004 3300025284 Bacteria 633436
190 Ga0209130_1000026 3300025284 Bacteria 334058
191 Ga0209675_1000001 3300025291 Bacteria 2950293
192 Ga0209675_1010434 3300025291 Bacteria 3170
193 Ga0209025_1000050 3300025294 Bacteria 331531
194 Ga0209025_1000166 3300025294 Bacteria 164692
195 Ga0209025_1000216 3300025294 Bacteria 138307
196 Ga0209025_1001567 3300025294 Bacteria 28985
197 Ga0209025_1006945 3300025294 Bacteria 8607
198 Ga0209025_1027996 3300025294 Bacteria 2775
199 Ga0209564_1000001 3300025295 Bacteria 3176258
200 Ga0209564_1000002 3300025295 Bacteria 1636803
201 Ga0209564_1000007 3300025295 Bacteria 1028582
202 Ga0209564_1000013 3300025295 Bacteria 775755
203 Ga0209564_1000273 3300025295 Bacteria 108165
204 Ga0209564_1000362 3300025295 Bacteria 84376
205 Ga0209564_1000584 3300025295 Bacteria 57729
206 Ga0209564_1004952 3300025295 Bacteria 7866
207 Ga0209564_1008716 3300025295 Bacteria 4951
208 Ga0209758_1000083 3300025297 Bacteria 257283
209 Ga0209758_1000218 3300025297 Bacteria 124300
210 Ga0209758_1000228 3300025297 Bacteria 119948
211 Ga0209758_1000540 3300025297 Bacteria 60103
212 Ga0209758_1000564 3300025297 Bacteria 58328
213 Ga0209758_1011418 3300025297 Bacteria 5149
214 Ga0209758_1026498 3300025297 Bacteria 2506
215 Ga0209050_1007767 3300025298 Bacteria 5912
216 Ga0209050_1014269 3300025298 Bacteria 3439
217 Ga0209256_1000006 3300025299 Bacteria 1250310
218 Ga0209256_1000042 3300025299 Bacteria 341821
219 Ga0209256_1000686 3300025299 Bacteria 45451
220 Ga0209256_1000701 3300025299 Bacteria 44561
221 Ga0209256_1000745 3300025299 Bacteria 42627
222 Ga0209256_1002196 3300025299 Bacteria 16720
223 Ga0209256_1005098 3300025299 Bacteria 7798
224 Ga0209256_1052731 3300025299 Bacteria 976
225 Ga0207426_1000003 3300025302 Bacteria 1063212
226 Ga0207426_1000006 3300025302 Bacteria 1025969
227 Ga0207426_1000039 3300025302 Bacteria 439937
228 Ga0207426_1057449 3300025302 Bacteria 1132
229 Ga0209051_1000142 3300025303 Bacteria 135337
230 Ga0209051_1002479 3300025303 Bacteria 13179
231 Ga0209051_1006908 3300025303 Bacteria 6304
232 Ga0209051_1014583 3300025303 Bacteria 3657
233 Ga0209051_1023516 3300025303 Bacteria 2558
234 Ga0209257_1000331 3300025304 Bacteria 98650
235 Ga0209257_1003749 3300025304 Bacteria 12578
236 Ga0209257_1004924 3300025304 Bacteria 9816
237 Ga0209257_1005349 3300025304 Bacteria 9080
238 Ga0207696_1000450 3300025711 Bacteria 36003
239 Ga0207695_10000011 3300025913 Bacteria 910221
240 Ga0207671_10000241 3300025914 Bacteria 81847
241 Ga0207667_10060118 3300025949 Bacteria 3978
242 Ga0207668_10219762 3300025972 Bacteria 1525
243 Ga0207668_10668388 3300025972 Bacteria 911
244 Ga0207668_10797430 3300025972 Bacteria 836
245 Ga0207658_10100950 3300025986 Bacteria 2260
246 Ga0207702_10510431 3300026078 Bacteria 1173
247 Ga0209281_1000106 3300027111 Bacteria 219666
248 Ga0209281_1000426 3300027111 Bacteria 62651
249 Ga0209371_1012308 3300027312 Bacteria 2486
250 Ga0209282_1000083 3300027666 Bacteria 70247
251 Ga0209813_10034606 3300027866 Bacteria 1509
252 Ga0207428_10000146 3300027907 Bacteria 95417
253 Ga0268266_10168384 3300028379 Bacteria 1987
254 Ga0268266_10381098 3300028379 Bacteria 1330
255 Ga0268265_10186649 3300028380 Bacteria 1787
256 Ga0307515_10014912 3300028794 Bacteria 14364
257 Ga0307515_10030708 3300028794 Bacteria 9004
258 Ga0307515_10067856 3300028794 Bacteria 4911
259 Ga0307515_10078172 3300028794 Bacteria 4356
260 Ga0307515_10253687 3300028794 Bacteria 1507
261 Ga0268256_1009224 3300030500 Bacteria 3304
262 Ga0307513_10114544 3300031456 Bacteria 2681
263 Ga0307509_10000026 3300031507 Bacteria 231153
264 Ga0307408_100451126 3300031548 Bacteria 1115
265 Ga0307408_100955862 3300031548 Bacteria 787
266 Ga0307406_10082201 3300031901 Bacteria 2144
267 Ga0307406_10685158 3300031901 Unclassified 854
268 Ga0307412_10001552 3300031911 Bacteria 12679
269 Ga0315914_1002550 3300031967 Bacteria 27863
270 Ga0307416_101301473 3300032002 Bacteria 833
271 Ga0307414_10045272 3300032004 Bacteria 3012
272 Ga0307415_100985938 3300032126 Bacteria 782
273 Ga0307507_10049419 3300033179 Bacteria 4075
274 Ga0315913_1001274 3300033430 Bacteria 27225
275 Ga0315915_1000010 3300033464 Bacteria 240214
276 Ga0373935_0049529 3300035692 Bacteria 2663
277 Ga0373927_0001054 3300035695 Bacteria 21024
278 Ga0373937_0356972 3300036401 Bacteria 1385
279 Ga0373925_0000823 3300037068 Bacteria 28567
280 Ga0436361_0152213 3300039447 Bacteria 18297
281 Ga0436361_0195272 3300039447 Bacteria 7850
282 Ga0436361_0746508 3300039447 Bacteria 1358
283 Ga0439436_0043129 3300041404 Bacteria 1288
284 Ga0439436_0057683 3300041404 Bacteria 1089
285 Ga0439438_049945 3300041405 Bacteria 1066
286 Ga0439438_052693 3300041405 Bacteria 1031
287 Ga0439465_0001615 3300041413 Bacteria 7336
288 Ga0439465_0024328 3300041413 Bacteria 1908
289 Ga0439465_0029955 3300041413 Bacteria 1730
290 Ga0451791_1127090 3300041451 Bacteria 769
291 Ga0451793_0049932 3300041452 Bacteria 1316
292 Ga0451798_1116211 3300041458 Bacteria 1426
293 Ga0451833_0040918 3300041491 Bacteria 3606
294 Ga0451833_0231172 3300041491 Bacteria 1836
295 Ga0451833_0457014 3300041491 Bacteria 6972
296 Ga0451835_0119890 3300041492 Bacteria 1365
297 Ga0451835_0865008 3300041492 Bacteria 3131
298 Ga0451837_0390347 3300041494 Bacteria 1669
299 Ga0451837_0483527 3300041494 Bacteria 2913
300 Ga0451839_0867715 3300041496 Bacteria 1891
301 Ga0451839_0898432 3300041496 Bacteria 3250
302 Ga0451841_0758593 3300041498 Bacteria 1343
303 Ga0451841_1079509 3300041498 Bacteria 1810
304 Ga0451845_0143472 3300041501 Bacteria 1931
305 Ga0451845_0748312 3300041501 Bacteria 913
306 Ga0451845_0915619 3300041501 Bacteria 1382
307 Ga0451847_0282006 3300041503 Bacteria 2607
308 Ga0451847_0588818 3300041503 Bacteria 1772
309 Ga0451847_0809477 3300041503 Bacteria 1883
310 Ga0451849_0040628 3300041505 Bacteria 1724
311 Ga0451849_0529772 3300041505 Bacteria 1410
312 Ga0451849_1057240 3300041505 Bacteria 2646
313 Ga0451851_0521423 3300041507 Bacteria 3683
314 Ga0451843_0294807 3300041509 Bacteria 2349
315 Ga0451843_0295029 3300041509 Bacteria 1207
316 Ga0451855_1834447 3300041511 Bacteria 1305
317 Ga0451855_1835784 3300041511 Bacteria 1368
318 Ga0451853_1433263 3300041512 Bacteria 1402
319 Ga0451853_1987462 3300041512 Bacteria 3076
320 Ga0451853_2367428 3300041512 Bacteria 1124
321 Ga0451853_2840807 3300041512 Bacteria 1800
322 Ga0451853_3769747 3300041512 Bacteria 3981
323 Ga0439431_0046127 3300041997 Bacteria 1120
324 Ga0439449_0036105 3300042007 Bacteria 1838
325 Ga0439434_0038628 3300042435 Bacteria 1464
326 Ga0466966_0084707 3300044684 Bacteria 1971
327 Ga0466963_0089855 3300044694 Bacteria 2090
328 Ga0466970_0007785 3300044765 Bacteria 5374
329 Ga0466957_0123559 3300044842 Bacteria 1652
330 Ga0466958_0081532 3300045836 Bacteria 1991
331 Ga0466967_0482885 3300045976 Bacteria 1214
332 Ga0466967_0755453 3300045976 Bacteria 964
333 Ga0495617_000808 3300046452 Bacteria 15140
334 Ga0495627_002053 3300046453 Bacteria 10280
335 Ga0495627_042027 3300046453 Bacteria 1402
336 Ga0495590_0039225 3300046457 Bacteria 1652
337 Ga0495638_0000453 3300046460 Bacteria 49159
338 Ga0495653_0000118 3300046463 Bacteria 65731
339 Ga0495650_0001656 3300046471 Bacteria 20602
340 Ga0495650_0069850 3300046471 Bacteria 1381
341 Ga0495650_0133718 3300046471 Bacteria 903
342 Ga0495580_0006213 3300046472 Bacteria 9759
343 Ga0495605_0000022 3300046474 Bacteria 248321
344 Ga0495585_0013763 3300046492 Bacteria 4728
345 Ga0495585_0013953 3300046492 Bacteria 4693
346 Ga0495585_0051988 3300046492 Bacteria 2269
347 Ga0495594_0187058 3300046499 Unclassified 1179
348 Ga0495596_0024692 3300046500 Bacteria 2433
349 Ga0495607_0021900 3300046501 Bacteria 4020
350 Ga0495607_0091848 3300046501 Bacteria 1643
351 Ga0495583_0005835 3300046506 Bacteria 8221
352 Ga0495583_0014100 3300046506 Bacteria 4423
353 Ga0495583_0095273 3300046506 Unclassified 1277
354 Ga0495606_0000014 3300046507 Bacteria 289347
355 Ga0495606_0000569 3300046507 Bacteria 58510
356 Ga0495606_0000841 3300046507 Bacteria 46218
357 Ga0495606_0000896 3300046507 Bacteria 44373
358 Ga0495606_0001060 3300046507 Bacteria 39739
359 Ga0495606_0016764 3300046507 Bacteria 5570
360 Ga0495606_0024202 3300046507 Bacteria 4382
361 Ga0495610_0002017 3300046512 Bacteria 17371
362 Ga0495610_0002342 3300046512 Bacteria 16022
363 Ga0495610_0004134 3300046512 Bacteria 10859
364 Ga0495610_0030235 3300046512 Bacteria 2841
365 Ga0495610_0062272 3300046512 Bacteria 1770
366 Ga0495610_0129879 3300046512 Bacteria 1095
367 Ga0495610_0173281 3300046512 Bacteria 903
368 Ga0495616_0002859 3300046513 Bacteria 11259
369 Ga0495616_0077003 3300046513 Bacteria 1602
370 Ga0495620_0018038 3300046515 Bacteria 3503
371 Ga0495620_0025347 3300046515 Bacteria 2807
372 Ga0495631_0001721 3300046518 Bacteria 12994
373 Ga0495631_0198279 3300046518 Bacteria 858
374 Ga0495632_0001097 3300046519 Bacteria 23175
375 Ga0495632_0014423 3300046519 Bacteria 4471
376 Ga0495632_0044435 3300046519 Bacteria 2217
377 Ga0495637_0005182 3300046520 Bacteria 6677
378 Ga0495637_0013316 3300046520 Bacteria 3904
379 Ga0495637_0073832 3300046520 Bacteria 1371
380 Ga0495643_0000591 3300046522 Bacteria 44066
381 Ga0495643_0011123 3300046522 Bacteria 5500
382 Ga0495643_0022984 3300046522 Bacteria 3549
383 Ga0495643_0033748 3300046522 Bacteria 2828
384 Ga0495643_0054014 3300046522 Bacteria 2152
385 Ga0495648_0010128 3300046524 Bacteria 7219
386 Ga0495648_0016509 3300046524 Bacteria 5320
387 Ga0495648_0016542 3300046524 Bacteria 5315
388 Ga0495663_0008013 3300046525 Bacteria 2922
389 Ga0495666_0000072 3300046526 Bacteria 39769
390 Ga0495666_0011171 3300046526 Bacteria 4481
391 Ga0495642_0000003 3300046528 Bacteria 185425
392 Ga0495654_0054148 3300046530 Bacteria 1947
393 Ga0495654_0058278 3300046530 Bacteria 1864
394 Ga0495609_0028390 3300046538 Bacteria 2553
395 Ga0495609_0069556 3300046538 Bacteria 1547
396 Ga0495597_0000456 3300046542 Bacteria 34898
397 Ga0495597_0017092 3300046542 Bacteria 3418
398 Ga0495597_0131779 3300046542 Bacteria 1036
399 Ga0495622_0110049 3300046557 Bacteria 1261
400 Ga0495633_0004276 3300046558 Bacteria 9126
401 Ga0495633_0029489 3300046558 Bacteria 2669
402 Ga0495633_0038204 3300046558 Bacteria 2294
403 Ga0495633_0042683 3300046558 Bacteria 2153
404 Ga0495633_0134223 3300046558 Bacteria 1145
405 Ga0495668_0000038 3300046616 Bacteria 232122
406 Ga0495668_0005544 3300046616 Bacteria 8504
407 Ga0495668_0082861 3300046616 Bacteria 1759
408 Ga0495611_0023006 3300046648 Bacteria 2700
409 Ga0495625_0002121 3300046660 Bacteria 22129
410 Ga0495625_0003247 3300046660 Bacteria 16451
411 Ga0495625_0003775 3300046660 Bacteria 14711
412 Ga0495625_0006277 3300046660 Bacteria 10631
413 Ga0495625_0128848 3300046660 Bacteria 1715
414 Ga0495625_0139049 3300046660 Bacteria 1639
415 Ga0495659_0000186 3300046664 Bacteria 26967
416 Ga0495661_0028839 3300046665 Bacteria 3547
417 Ga0495661_0085813 3300046665 Bacteria 1803
418 Ga0495661_0094538 3300046665 Bacteria 1694
419 Ga0495588_0154440 3300046674 Bacteria 1213
420 Ga0495657_0034509 3300046675 Bacteria 3513
421 Ga0495623_0000821 3300046679 Bacteria 20962
422 Ga0495624_0105267 3300046690 Bacteria 1736
423 Ga0495670_0011533 3300046691 Bacteria 4347
424 Ga0495671_0026707 3300046692 Bacteria 2990
425 Ga0495671_0043620 3300046692 Bacteria 2251
426 Ga0495671_0050700 3300046692 Bacteria 2066
427 Ga0495649_0011038 3300046694 Bacteria 5322
428 Ga0495649_0072560 3300046694 Bacteria 1845
429 Ga0495600_0103381 3300046809 Bacteria 1856
430 Ga0495600_0176026 3300046809 Bacteria 1379
431 Ga0495660_0010233 3300046810 Bacteria 5452
432 Ga0495660_0024379 3300046810 Bacteria 3447
433 Ga0495660_0049320 3300046810 Bacteria 2299
434 Ga0495660_0079662 3300046810 Bacteria 1720
435 Ga0495604_0005804 3300047317 Bacteria 9794
436 Ga0495604_0009642 3300047317 Bacteria 7635
437 Ga0495636_0022196 3300047318 Bacteria 2565
438 Ga0495672_0000241 3300047320 Bacteria 77378
439 Ga0495680_0026198 3300047322 Bacteria 4811
440 Ga0495680_0139116 3300047322 Bacteria 1777
441 Ga0495683_0081209 3300047323 Bacteria 1581
442 Ga0495683_0098136 3300047323 Bacteria 1412
443 Ga0495687_032686 3300047443 Bacteria 2371
444 Ga0495687_064456 3300047443 Bacteria 1495
445 Ga0495677_0015503 3300047445 Bacteria 2769
446 Ga0495679_001059 3300047446 Bacteria 16719
447 Ga0495685_151437 3300047447 Bacteria 753
448 Ga0495673_0000028 3300047469 Bacteria 473418
449 Ga0495681_0096001 3300047470 Bacteria 1302
450 Ga0495684_0016273 3300047471 Bacteria 5726
451 Ga0495686_0001704 3300047472 Bacteria 22714
452 Ga0495686_0007125 3300047472 Bacteria 8421
453 Ga0495686_0007998 3300047472 Bacteria 7841
454 Ga0495686_0071298 3300047472 Bacteria 2139
455 Ga0495686_0165959 3300047472 Bacteria 1287
456 Ga0495686_0223614 3300047472 Bacteria 1069
457 Ga0495593_0000026 3300047673 Bacteria 62356
458 Ga0495602_0084283 3300048088 Bacteria 2660
459 Ga0496100_0033923 3300048903 Bacteria 3197
460 Ga0496101_0058014 3300048904 Bacteria 2802
461 Ga0496101_0126153 3300048904 Bacteria 1939
462 Ga0496102_0013120 3300048905 Bacteria 7168
463 Ga0496103_0006159 3300048906 Bacteria 7167
464 Ga0496106_0000050 3300048909 Bacteria 96126
465 Ga0496106_0173311 3300048909 Bacteria 1711
466 Ga0496111_0022824 3300048914 Bacteria 4385
467 Ga0496113_0288842 3300048916 Bacteria 1312
468 Ga0496113_0398151 3300048916 Bacteria 1105
469 Ga0496116_0000036 3300048919 Bacteria 388508
470 Ga0496116_0001253 3300048919 Bacteria 29488
471 Ga0496116_0006467 3300048919 Bacteria 10615
472 Ga0496116_0013559 3300048919 Bacteria 6558
473 Ga0496116_0027606 3300048919 Bacteria 4130
474 Ga0496116_0030386 3300048919 Bacteria 3882
475 Ga0496116_0034489 3300048919 Bacteria 3569
476 Ga0496116_0035703 3300048919 Bacteria 3488
477 Ga0496116_0085930 3300048919 Bacteria 1931
478 Ga0496116_0111655 3300048919 Bacteria 1605
479 Ga0496117_0000353 3300048920 Bacteria 81061
480 Ga0496117_0006763 3300048920 Bacteria 11452
481 Ga0496117_0008869 3300048920 Bacteria 9487
482 Ga0496117_0010840 3300048920 Bacteria 8224
483 Ga0496118_0000204 3300048921 Bacteria 104260
484 Ga0496118_0008696 3300048921 Bacteria 10434
485 Ga0496118_0009778 3300048921 Bacteria 9615
486 Ga0496118_0032421 3300048921 Bacteria 4304
487 Ga0496118_0058672 3300048921 Bacteria 2873
488 Ga0496118_0074280 3300048921 Bacteria 2431
489 Ga0496119_0001824 3300048922 Bacteria 24672
490 Ga0496119_0028814 3300048922 Bacteria 3780
491 Ga0496119_0063407 3300048922 Bacteria 2198
492 Ga0496119_0217289 3300048922 Bacteria 980
493 Ga0496120_0014057 3300048923 Bacteria 5351
494 Ga0496120_0062989 3300048923 Bacteria 2065
495 Ga0496120_0070435 3300048923 Bacteria 1923
496 Ga0496121_0000001 3300048924 Bacteria 1830318
497 Ga0496121_0000378 3300048924 Bacteria 91381
498 Ga0496121_0006268 3300048924 Bacteria 14880
499 Ga0496121_0010411 3300048924 Bacteria 10496
500 Ga0496121_0013627 3300048924 Bacteria 8717
501 Ga0496121_0015485 3300048924 Bacteria 7986
502 Ga0496121_0016204 3300048924 Bacteria 7713
503 Ga0496121_0045893 3300048924 Bacteria 3748
504 Ga0496121_0061858 3300048924 Bacteria 3069
505 Ga0496121_0103074 3300048924 Bacteria 2196
506 Ga0496121_0190691 3300048924 Bacteria 1470
507 Ga0496121_0469111 3300048924 Bacteria 807
508 Ga0496121_0628049 3300048924 Bacteria 658
509 Ga0496122_0005725 3300048925 Bacteria 14650
510 Ga0496122_0012966 3300048925 Bacteria 8224
511 Ga0496122_0015716 3300048925 Bacteria 7217
512 Ga0496122_0017662 3300048925 Bacteria 6652
513 Ga0496122_0031826 3300048925 Bacteria 4377
514 Ga0496122_0033970 3300048925 Bacteria 4184
515 Ga0496122_0048658 3300048925 Bacteria 3256
516 Ga0496122_0228168 3300048925 Bacteria 1061
517 Ga0496122_0392296 3300048925 Bacteria 708
518 Ga0496123_0006698 3300048926 Bacteria 11098
519 Ga0496123_0007026 3300048926 Bacteria 10729
520 Ga0496123_0012909 3300048926 Bacteria 7068
521 Ga0496123_0013633 3300048926 Bacteria 6800
522 Ga0496123_0019298 3300048926 Bacteria 5381
523 Ga0496123_0044909 3300048926 Bacteria 3016
524 Ga0496123_0072470 3300048926 Bacteria 2143
525 Ga0496123_0087694 3300048926 Bacteria 1860
526 Ga0496123_0284404 3300048926 Bacteria 797
527 Ga0496124_0003917 3300048927 Bacteria 17784
528 Ga0496124_0008097 3300048927 Bacteria 11046
529 Ga0496124_0010539 3300048927 Bacteria 9344
530 Ga0496124_0024270 3300048927 Bacteria 5518
531 Ga0496124_0028228 3300048927 Bacteria 5022
532 Ga0496124_0046495 3300048927 Bacteria 3716
533 Ga0496124_0090410 3300048927 Bacteria 2497
534 Ga0496124_0114819 3300048927 Bacteria 2162
535 Ga0496124_0246208 3300048927 Bacteria 1326
536 Ga0496125_0000001 3300048928 Bacteria 1766138
537 Ga0496125_0000585 3300048928 Bacteria 62191
538 Ga0496125_0009291 3300048928 Bacteria 10140
539 Ga0496125_0034704 3300048928 Bacteria 4440
540 Ga0496125_0035935 3300048928 Bacteria 4335
541 Ga0496125_0051744 3300048928 Bacteria 3384
542 Ga0496125_0065545 3300048928 Bacteria 2876
543 Ga0496125_0160064 3300048928 Bacteria 1531
544 Ga0496125_0218896 3300048928 Bacteria 1229
545 Ga0496125_0435107 3300048928 Bacteria 756
546 Ga0496126_0000156 3300048929 Bacteria 158537
547 Ga0496126_0044809 3300048929 Bacteria 4070
548 Ga0496126_0090330 3300048929 Bacteria 2695
549 Ga0496126_0161339 3300048929 Bacteria 1915
550 Ga0496126_0304499 3300048929 Bacteria 1313
551 Ga0496126_0304516 3300048929 Bacteria 1313
552 Ga0496126_0695390 3300048929 Bacteria 791
553 Ga0495678_000442 3300049459 Bacteria 41328
554 Ga0495678_021556 3300049459 Bacteria 2835
555 Ga0495678_112099 3300049459 Bacteria 928
556 Ga0501031_0000064 3300049568 Bacteria 56925
557 Ga0501032_0000006 3300049569 Bacteria 261727
558 Ga0501032_0000019 3300049569 Bacteria 155168
559 Ga0501033_0000053 3300049570 Bacteria 109042
560 Ga0501033_0000582 3300049570 Bacteria 33881
561 Ga0501033_0557173 3300049570 Bacteria 789
562 Ga0501034_0000030 3300049571 Bacteria 248180
563 Ga0501034_0000130 3300049571 Bacteria 139568
564 Ga0501034_0014618 3300049571 Bacteria 8083
565 Ga0501034_0053807 3300049571 Bacteria 4052
566 Ga0501034_0191606 3300049571 Bacteria 2006
567 Ga0501034_0290310 3300049571 Bacteria 1574
568 Ga0501034_0330160 3300049571 Bacteria 1457
569 Ga0501034_0352605 3300049571 Bacteria 1399
570 Ga0501036_0000003 3300049572 Bacteria 261545
571 Ga0501036_0000218 3300049572 Bacteria 38481
572 Ga0501036_0598588 3300049572 Bacteria 914
573 Ga0501036_0751147 3300049572 Bacteria 805
574 Ga0501037_0000003 3300049573 Bacteria 261548
575 Ga0501037_0000218 3300049573 Bacteria 50780
576 Ga0501037_0057296 3300049573 Bacteria 2845
577 Ga0501038_0000004 3300049574 Bacteria 261289
578 Ga0501038_0002051 3300049574 Bacteria 18639
579 Ga0501038_0216622 3300049574 Bacteria 1529
580 Ga0501039_0000008 3300049575 Bacteria 274778
581 Ga0501039_0000028 3300049575 Bacteria 139568
582 Ga0501040_0001890 3300049576 Bacteria 13451
583 Ga0501040_0005395 3300049576 Bacteria 8273
584 Ga0501042_0337052 3300049578 Bacteria 1090
585 Ga0501043_0000113 3300049579 Bacteria 76112
586 Ga0501043_0000365 3300049579 Bacteria 40969
587 Ga0501043_0103335 3300049579 Bacteria 2239
588 Ga0501043_0372565 3300049579 Bacteria 1082
589 Ga0501046_0038762 3300049580 Bacteria 3822
590 Ga0501046_0061751 3300049580 Bacteria 2928
591 Ga0501047_0001197 3300049581 Bacteria 25699
592 Ga0501047_0137941 3300049581 Bacteria 2319
593 Ga0501047_0241699 3300049581 Bacteria 1656
594 Ga0501048_0167520 3300049582 Bacteria 1556
595 Ga0501068_0046420 3300049584 Bacteria 2620
596 Ga0501070_0009239 3300049586 Bacteria 8337
597 Ga0501070_0523573 3300049586 Bacteria 951
598 Ga0501073_0217714 3300049589 Bacteria 1319
599 Ga0501079_0083699 3300049741 Unclassified 2468
600 Ga0501083_0011497 3300049744 Bacteria 6210
601 Ga0501083_0042070 3300049744 Bacteria 3098
602 Ga0501083_0164076 3300049744 Bacteria 1452
603 Ga0501035_0000031 3300049822 Bacteria 175591
604 Ga0501035_0000201 3300049822 Bacteria 72627
605 Ga0501035_0179978 3300049822 Bacteria 1822
606 Ga0501035_0481740 3300049822 Bacteria 1023
607 Ga0501044_0000008 3300049823 Bacteria 274778
608 Ga0501044_0053234 3300049823 Bacteria 4165
609 Ga0501044_0160690 3300049823 Bacteria 2224
610 Ga0501044_0282696 3300049823 Bacteria 1592
611 Ga0501045_0078990 3300049824 Bacteria 2426
612 Ga0501045_0534505 3300049824 Bacteria 870
613 nmdc:mga03683_118059_c1 3300050489 Bacteria 1177
614 nmdc:mga03683_436_c1 3300050489 Bacteria 12047
615 nmdc:mga03n38_167361_c1 3300050490 Bacteria 1117
616 nmdc:mga03n38_17393_c1 3300050490 Bacteria 2815
617 nmdc:mga03n38_28864_c1 3300050490 Bacteria 2316
618 nmdc:mga00v17_88166_c1 3300050491 Bacteria 1945
619 nmdc:mga0yw44_1206_c1 3300050492 Bacteria 10117
620 nmdc:mga0k408_241303_c1 3300050493 Bacteria 1079
621 nmdc:mga0k408_604_c1 3300050493 Bacteria 19838
622 nmdc:mga06z11_224743_c1 3300050494 Bacteria 1098
623 nmdc:mga06z11_6405_c1 3300050494 Bacteria 4788
624 nmdc:mga07m45_5653_c1 3300050496 Bacteria 6250
625 nmdc:mga05p37_111_c2 3300050507 Bacteria 41438
626 nmdc:mga05p37_331671_c1 3300050507 Bacteria 1797
627 nmdc:mga09592_130829_c1 3300050508 Bacteria 2159
628 nmdc:mga09592_137_c1 3300050508 Bacteria 48140
629 nmdc:mga09592_43190_c1 3300050508 Bacteria 3793
630 nmdc:mga0qj67_1612_c1 3300050509 Bacteria 15868
631 nmdc:mga0qj67_78025_c1 3300050509 Bacteria 2650
632 nmdc:mga06r32_10264_c1 3300050510 Bacteria 8449
633 nmdc:mga06r32_108937_c1 3300050510 Bacteria 2724
634 nmdc:mga06r32_526_c1 3300050510 Bacteria 33031
635 nmdc:mga08y16_1030_c1 3300050511 Bacteria 27341
636 nmdc:mga0n895_331_c1 3300050512 Bacteria 31576
637 nmdc:mga0rr50_5720_c1 3300050513 Bacteria 7453
638 nmdc:mga0a205_50_c1 3300050515 Bacteria 64126
639 nmdc:mga0sz30_178935_c1 3300050516 Bacteria 941
640 nmdc:mga0sz30_3381_c1 3300050516 Bacteria 5738
641 Ga0500610_0082906 3300053079 Bacteria 1670
642 Ga0500578_0061123 3300053086 Bacteria 2405
643 Ga0500643_064452 3300053087 Bacteria 1024
644 Ga0500644_0263757 3300053088 Bacteria 729
645 Ga0500651_0092816 3300053093 Bacteria 1857
646 Ga0500651_0125774 3300053093 Bacteria 1553
647 Ga0500641_0150204 3300053096 Unclassified 1006
648 Ga0500556_0167757 3300053104 Bacteria 867
649 Ga0500557_004267 3300053105 Bacteria 2972
650 Ga0500569_009164 3300053109 Bacteria 2292
651 Ga0500593_000058 3300053117 Bacteria 41070
652 Ga0500594_0002903 3300053118 Bacteria 3740
653 Ga0500594_0009369 3300053118 Bacteria 2253
654 Ga0500594_0071960 3300053118 Bacteria 1018
655 Ga0500618_003612 3300053125 Bacteria 5244
656 Ga0500618_016671 3300053125 Bacteria 1835
657 Ga0500618_037788 3300053125 Bacteria 1115
658 Ga0500658_0000167 3300053134 Bacteria 31776
659 Ga0500568_0001502 3300053139 Bacteria 14909
660 Ga0500568_0004659 3300053139 Bacteria 7291
661 Ga0500568_0107831 3300053139 Bacteria 1042
662 Ga0500573_0236031 3300053140 Bacteria 951
663 Ga0500586_000063 3300053145 Bacteria 18908
664 Ga0500616_0006022 3300053153 Bacteria 8065
665 Ga0500616_0078835 3300053153 Bacteria 1660
666 Ga0500616_0109858 3300053153 Bacteria 1333
667 Ga0500622_0000618 3300053156 Bacteria 32174
668 Ga0500622_0001581 3300053156 Bacteria 17919
669 Ga0500622_0076331 3300053156 Bacteria 1685
670 Ga0500627_0025221 3300053158 Bacteria 2441
671 Ga0500633_0000903 3300053160 Bacteria 5182
672 Ga0500634_0138940 3300053161 Bacteria 1154
673 Ga0500636_0105451 3300053177 Bacteria 1598
674 Ga0500645_004831 3300053730 Bacteria 5085
675 Ga0500645_032366 3300053730 Bacteria 1568
676 Ga0587088_041183 3300059508 Bacteria 870
677 Ga0501082_0024147 3300060353 Bacteria 5244
678 Ga0501082_0431782 3300060353 Bacteria 1150
679 Ga0530510_0006359 3300061734 Bacteria 8219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0628049 Ga0496121_0628049_47_643 198
2 3300046522 Ga0495643_0054014 Ga0495643_0054014_950_1735 206
3 3300046665 Ga0495661_0028839 Ga0495661_0028839_1352_2137 206
4 3300048925 Ga0496122_0392296 Ga0496122_0392296_29_661 210
5 3300042435 Ga0439434_0038628 Ga0439434_0038628_24_659 211
6 iso_pu_bacteria 2643221583 2643926704 211
7 iso_pu_bacteria 2738543024 2739308528 211
8 3300041512 Ga0451853_2367428 Ga0451853_2367428_31_669 212
9 3300048916 Ga0496113_0398151 Ga0496113_0398151_50_688 212
10 3300053093 Ga0500651_0092816 Ga0500651_0092816_1197_1835 212
11 3300005548 Ga0070665_100359817 Ga0070665_1003598172 215
12 3300028379 Ga0268266_10381098 Ga0268266_103810982 215
13 3300031507 Ga0307509_10000026 Ga0307509_10000026115 215
14 3300041451 Ga0451791_1127090 Ga0451791_1127090_71_718 215
15 3300046453 Ga0495627_002053 Ga0495627_002053_5723_6370 215
16 3300049823 Ga0501044_0282696 Ga0501044_0282696_415_1062 215
17 3300028794 Ga0307515_10078172 Ga0307515_100781722 216
18 3300003775 Ga0055524_1000129 Ga0055524_100012940 218
19 3300006948 Ga0099826_10000001 Ga0099826_10000001267 218
20 3300049569 Ga0501032_0000019 Ga0501032_0000019_35559_36215 218
21 3300049570 Ga0501033_0000582 Ga0501033_0000582_32138_32794 218
22 3300049571 Ga0501034_0000130 Ga0501034_0000130_19959_20615 218
23 3300049572 Ga0501036_0000218 Ga0501036_0000218_32172_32828 218
24 3300049573 Ga0501037_0000218 Ga0501037_0000218_17930_18586 218
25 3300049574 Ga0501038_0002051 Ga0501038_0002051_16768_17424 218
26 3300049575 Ga0501039_0000028 Ga0501039_0000028_118954_119610 218
27 3300049579 Ga0501043_0000113 Ga0501043_0000113_39821_40477 218
28 3300049580 Ga0501046_0038762 Ga0501046_0038762_2208_2864 218
29 3300049822 Ga0501035_0000201 Ga0501035_0000201_39819_40475 218
30 3300049823 Ga0501044_0053234 Ga0501044_0053234_228_884 218
31 3300049824 Ga0501045_0534505 Ga0501045_0534505_67_723 218
32 3300003763 Ga0055529_1000125 Ga0055529_100012554 220
33 3300003771 Ga0055526_1000016 Ga0055526_1000016164 220
34 3300003771 Ga0055526_1000118 Ga0055526_100011818 220
35 3300003771 Ga0055526_1000323 Ga0055526_10003235 220
36 3300009036 Ga0105244_10034297 Ga0105244_100342973 220
37 3300009092 Ga0105250_10000022 Ga0105250_10000022154 220
38 3300014968 Ga0157379_10000176 Ga0157379_1000017629 220
39 3300021361 Ga0213872_10001117 Ga0213872_100011177 220
40 3300021361 Ga0213872_10024542 Ga0213872_100245422 220
41 3300025272 Ga0209455_1000044 Ga0209455_1000044259 220
42 3300025294 Ga0209025_1006945 Ga0209025_10069452 220
43 3300025295 Ga0209564_1000002 Ga0209564_10000021244 220
44 3300025295 Ga0209564_1000007 Ga0209564_1000007650 220
45 3300025297 Ga0209758_1000228 Ga0209758_100022839 220
46 3300025711 Ga0207696_1000450 Ga0207696_100045014 220
47 3300033179 Ga0307507_10049419 Ga0307507_100494192 220
48 3300039447 Ga0436361_0152213 Ga0436361_0152213_14227_14901 220
49 3300039447 Ga0436361_0195272 Ga0436361_0195272_3567_4229 220
50 3300041501 Ga0451845_0748312 Ga0451845_0748312_30_692 220
51 3300041512 Ga0451853_1987462 Ga0451853_1987462_1659_2321 220
52 3300046452 Ga0495617_000808 Ga0495617_000808_8422_9084 220
53 3300046463 Ga0495653_0000118 Ga0495653_0000118_38116_38778 220
54 3300046471 Ga0495650_0001656 Ga0495650_0001656_9989_10651 220
55 3300046474 Ga0495605_0000022 Ga0495605_0000022_39523_40185 220
56 3300046507 Ga0495606_0000014 Ga0495606_0000014_134635_135420 220
57 3300046507 Ga0495606_0000569 Ga0495606_0000569_25315_25977 220
58 3300046507 Ga0495606_0000841 Ga0495606_0000841_60_743 220
59 3300046507 Ga0495606_0001060 Ga0495606_0001060_28262_28939 220
60 3300046512 Ga0495610_0002017 Ga0495610_0002017_11796_12617 220
61 3300046512 Ga0495610_0004134 Ga0495610_0004134_5036_5698 220
62 3300046512 Ga0495610_0129879 Ga0495610_0129879_164_826 220
63 3300046520 Ga0495637_0005182 Ga0495637_0005182_1763_2446 220
64 3300046520 Ga0495637_0013316 Ga0495637_0013316_296_958 220
65 3300046522 Ga0495643_0000591 Ga0495643_0000591_12035_12856 220
66 3300046524 Ga0495648_0016509 Ga0495648_0016509_1320_2141 220
67 3300046524 Ga0495648_0016542 Ga0495648_0016542_1314_2135 220
68 3300046526 Ga0495666_0000072 Ga0495666_0000072_585_1247 220
69 3300046542 Ga0495597_0000456 Ga0495597_0000456_23562_24224 220
70 3300046558 Ga0495633_0004276 Ga0495633_0004276_105_767 220
71 3300046558 Ga0495633_0029489 Ga0495633_0029489_1905_2567 220
72 3300046616 Ga0495668_0000038 Ga0495668_0000038_12146_12808 220
73 3300046660 Ga0495625_0002121 Ga0495625_0002121_17705_18367 220
74 3300046660 Ga0495625_0003775 Ga0495625_0003775_4166_4828 220
75 3300046675 Ga0495657_0034509 Ga0495657_0034509_2250_2912 220
76 3300046679 Ga0495623_0000821 Ga0495623_0000821_18629_19291 220
77 3300046692 Ga0495671_0043620 Ga0495671_0043620_1361_2182 220
78 3300046694 Ga0495649_0011038 Ga0495649_0011038_1800_2462 220
79 3300046809 Ga0495600_0103381 Ga0495600_0103381_833_1495 220
80 3300046809 Ga0495600_0176026 Ga0495600_0176026_507_1169 220
81 3300046810 Ga0495660_0024379 Ga0495660_0024379_2688_3350 220
82 3300047317 Ga0495604_0009642 Ga0495604_0009642_568_1230 220
83 3300047320 Ga0495672_0000241 Ga0495672_0000241_43663_44484 220
84 3300047322 Ga0495680_0026198 Ga0495680_0026198_1539_2201 220
85 3300047322 Ga0495680_0139116 Ga0495680_0139116_25_687 220
86 3300047445 Ga0495677_0015503 Ga0495677_0015503_788_1609 220
87 3300047446 Ga0495679_001059 Ga0495679_001059_13977_14639 220
88 3300047469 Ga0495673_0000028 Ga0495673_0000028_85165_85827 220
89 3300047471 Ga0495684_0016273 Ga0495684_0016273_2766_3428 220
90 3300047673 Ga0495593_0000026 Ga0495593_0000026_9400_10062 220
91 3300048919 Ga0496116_0030386 Ga0496116_0030386_500_1162 220
92 3300048923 Ga0496120_0062989 Ga0496120_0062989_1044_1706 220
93 3300048926 Ga0496123_0006698 Ga0496123_0006698_9317_9979 220
94 3300048927 Ga0496124_0046495 Ga0496124_0046495_1670_2437 220
95 3300048928 Ga0496125_0035935 Ga0496125_0035935_1707_2369 220
96 3300049459 Ga0495678_000442 Ga0495678_000442_9837_10658 220
97 3300053118 Ga0500594_0009369 Ga0500594_0009369_1577_2239 220
98 3300053145 Ga0500586_000063 Ga0500586_000063_8998_9660 220
99 iso_pu_bacteria 2508501122 2509110951 220
100 iso_pu_bacteria 2510065057 2510304344 220
101 iso_pu_bacteria 2511231052 2511502115 220
102 iso_pu_bacteria 2512047086 2512533490 220
103 iso_pu_bacteria 2512875026 2512970834 220
104 iso_pu_bacteria 2513237086 2513582491 220
105 iso_pu_bacteria 2513237089 2513604127 220
106 iso_pu_bacteria 2513237091 2513618038 220
107 iso_pu_bacteria 2513237140 2513885451 220
108 iso_pu_bacteria 2513237143 2513903227 220
109 iso_pu_bacteria 2513237156 2513987548 220
110 iso_pu_bacteria 2513237160 2514006524 220
111 iso_pu_bacteria 2515154107 2515608896 220
112 iso_pu_bacteria 2516653046 2516893493 220
113 iso_pu_bacteria 2517487022 2517570199 220
114 iso_pu_bacteria 2524023207 2524448678 220
115 iso_pu_bacteria 2551306084 2551680099 220
116 iso_pu_bacteria 2551306085 2551684442 220
117 iso_pu_bacteria 2551306086 2551690211 220
118 iso_pu_bacteria 2551306087 2551704293 220
119 iso_pu_bacteria 2551306089 2551713945 220
120 iso_pu_bacteria 2551306090 2551722631 220
121 iso_pu_bacteria 2551306091 2551725858 220
122 iso_pu_bacteria 2551306092 2551732767 220
123 iso_pu_bacteria 2551306093 2551741453 220
124 iso_pu_bacteria 2657244999 2657681399 220
125 iso_pu_bacteria 2791355094 2792639195 220
126 iso_pu_bacteria 2802428858 2802719892 220
127 iso_pu_bacteria 2802428859 2802727174 220
128 iso_pu_bacteria 2802428860 2802731826 220
129 iso_pu_bacteria 2802428861 2802739156 220
130 iso_pu_bacteria 2802428862 2802745866 220
131 iso_pu_bacteria 2802428863 2802752466 220
132 iso_pu_bacteria 2802429268 2804752594 220
133 iso_pu_bacteria 2838074704 2838077020 220
134 iso_pu_bacteria 2847417321 2847419276 220
135 iso_pu_bacteria 2848992105 2848994299 220
136 iso_pu_bacteria 2855825444 2855826216 220
137 iso_pu_bacteria 2855839649 2855841561 220
138 iso_pu_bacteria 2858800743 2858801669 220
139 iso_pu_bacteria 2896384573 2896389126 220
140 iso_pu_bacteria 2913295892 2913299466 220
141 iso_pu_bacteria 2915980308 2915984228 220
142 iso_pu_bacteria 2915986958 2915987403 220
143 iso_pu_bacteria 2915993759 2915996070 220
144 iso_pu_bacteria 2916000859 2916002659 220
145 iso_pu_bacteria 2916007675 2916009991 220
146 iso_pu_bacteria 2916014648 2916020149 220
147 iso_pu_bacteria 2916021584 2916027852 220
148 iso_pu_bacteria 2916028427 2916029176 220
149 iso_pu_bacteria 2916035215 2916039491 220
150 iso_pu_bacteria 2916041962 2916043782 220
151 iso_pu_bacteria 2916048683 2916052435 220
152 iso_pu_bacteria 2916055098 2916055832 220
153 iso_pu_bacteria 2916061851 2916066309 220
154 iso_pu_bacteria 2916068649 2916073495 220
155 iso_pu_bacteria 2916076590 2916080741 220
156 iso_pu_bacteria 2920760137 2920761757 220
157 iso_pu_bacteria 2921201388 2921205517 220
158 iso_pu_bacteria 2921208531 2921210830 220
159 iso_pu_bacteria 2921237296 2921240868 220
160 iso_pu_bacteria 2921244191 2921244796 220
161 iso_pu_bacteria 2921250672 2921255560 220
162 iso_pu_bacteria 2921257292 2921260576 220
163 iso_pu_bacteria 2921263974 2921267697 220
164 iso_pu_bacteria 2921282425 2921287909 220
165 iso_pu_bacteria 2921289301 2921289502 220
166 iso_pu_bacteria 2921296804 2921300530 220
167 iso_pu_bacteria 2924144063 2924148676 220
168 iso_pu_bacteria 2924150972 2924151395 220
169 iso_pu_bacteria 2924158325 2924162057 220
170 iso_pu_bacteria 2924165586 2924166950 220
171 iso_pu_bacteria 2924172951 2924176146 220
172 iso_pu_bacteria 2924179722 2924180117 220
173 iso_pu_bacteria 2924186466 2924188319 220
174 iso_pu_bacteria 2924193448 2924199707 220
175 iso_pu_bacteria 2924200457 2924203588 220
176 iso_pu_bacteria 2924207177 2924208088 220
177 iso_pu_bacteria 2924214083 2924219600 220
178 iso_pu_bacteria 2924221636 2924223737 220
179 iso_pu_bacteria 2924228884 2924232199 220
180 iso_pu_bacteria 2936996657 2937001872 220
181 iso_pu_bacteria 2937002841 2937008367 220
182 iso_pu_bacteria 2937009748 2937014751 220
183 iso_pu_bacteria 2937016420 2937022493 220
184 iso_pu_bacteria 2937023124 2937027052 220
185 iso_pu_bacteria 2937029754 2937034256 220
186 iso_pu_bacteria 2937042894 2937046057 220
187 iso_pu_bacteria 2937049772 2937051323 220
188 iso_pu_bacteria 2937056579 2937062449 220
189 iso_pu_bacteria 2937063883 2937069171 220
190 iso_pu_bacteria 2937071275 2937072878 220
191 iso_pu_bacteria 2937078374 2937082329 220
192 iso_pu_bacteria 2937091812 2937093854 220
193 iso_pu_bacteria 2937098957 2937100274 220
194 iso_pu_bacteria 2937106411 2937110655 220
195 iso_pu_bacteria 2937113482 2937117041 220
196 iso_pu_bacteria 2937119839 2937124612 220
197 iso_pu_bacteria 2937126314 2937132656 220
198 iso_pu_bacteria 2957375807 2957380285 220
199 iso_pu_bacteria 2957382221 2957388204 220
200 iso_pu_bacteria 2957388812 2957392996 220
201 iso_pu_bacteria 2957395598 2957398896 220
202 iso_pu_bacteria 2957402308 2957408117 220
203 iso_pu_bacteria 2957408893 2957410816 220
204 iso_pu_bacteria 2957415311 2957415943 220
205 iso_pu_bacteria 2957422303 2957427838 220
206 iso_pu_bacteria 2957430029 2957430459 220
207 iso_pu_bacteria 2957437181 2957440746 220
208 iso_pu_bacteria 2957443900 2957450105 220
209 iso_pu_bacteria 2957450854 2957456111 220
210 iso_pu_bacteria 2957457609 2957460833 220
211 iso_pu_bacteria 2957464669 2957468691 220
212 iso_pu_bacteria 2957471148 2957475679 220
213 iso_pu_bacteria 2957478035 2957481540 220
214 iso_pu_bacteria 2957484790 2957485686 220
215 iso_pu_bacteria 2957491536 2957492346 220
216 iso_pu_bacteria 2957498199 2957502356 220
217 iso_pu_bacteria 2957505466 2957507376 220
218 iso_pu_bacteria 2960584000 2960587137 220
219 iso_pu_bacteria 2960591022 2960595760 220
220 iso_pu_bacteria 2960597568 2960602540 220
221 iso_pu_bacteria 2960603979 2960609115 220
222 iso_pu_bacteria 2960610863 2960611576 220
223 iso_pu_bacteria 2960617483 2960623227 220
224 iso_pu_bacteria 2960624210 2960625211 220
225 iso_pu_bacteria 2960631154 2960635989 220
226 iso_pu_bacteria 2960637947 2960639376 220
227 iso_pu_bacteria 2960645483 2960650187 220
228 iso_pu_bacteria 2960652885 2960653202 220
229 iso_pu_bacteria 2960660292 2960667113 220
230 iso_pu_bacteria 2960667422 2960670030 220
231 iso_pu_bacteria 2960674078 2960676866 220
232 iso_pu_bacteria 2960680706 2960683461 220
233 iso_pu_bacteria 2960687367 2960690555 220
234 iso_pu_bacteria 2960693952 2960699330 220
235 iso_pu_bacteria 2964607997 2964609950 220
236 iso_pu_bacteria 2964615318 2964615743 220
237 iso_pu_bacteria 2964621998 2964623070 220
238 iso_pu_bacteria 2964628898 2964633962 220
239 iso_pu_bacteria 2964636051 2964637865 220
240 iso_pu_bacteria 2964643177 2964648024 220
241 iso_pu_bacteria 2964649959 2964653385 220
242 iso_pu_bacteria 2964656573 2964662701 220
243 iso_pu_bacteria 2964663802 2964667539 220
244 iso_pu_bacteria 2964670856 2964675430 220
245 iso_pu_bacteria 2964678106 2964680987 220
246 iso_pu_bacteria 2964685014 2964686032 220
247 iso_pu_bacteria 2964691889 2964693683 220
248 iso_pu_bacteria 2964698721 2964703696 220
249 iso_pu_bacteria 2964705432 2964711986 220
250 iso_pu_bacteria 2964712639 2964713958 220
251 iso_pu_bacteria 2964719344 2964720798 220
252 iso_pu_bacteria 2967664464 2967669843 220
253 iso_pu_bacteria 2967671571 2967673819 220
254 iso_pu_bacteria 2967678726 2967679839 220
255 iso_pu_bacteria 2967686174 2967690547 220
256 iso_pu_bacteria 2967693043 2967696426 220
257 iso_pu_bacteria 2967699805 2967704005 220
258 iso_pu_bacteria 2967706974 2967709109 220
259 iso_pu_bacteria 2967714385 2967721038 220
260 iso_pu_bacteria 2967721400 2967722100 220
261 iso_pu_bacteria 2967728569 2967733405 220
262 iso_pu_bacteria 2967735183 2967741520 220
263 iso_pu_bacteria 2967742019 2967745897 220
264 iso_pu_bacteria 2967748971 2967754189 220
265 iso_pu_bacteria 2967755722 2967759756 220
266 iso_pu_bacteria 2967762386 2967763085 220
267 iso_pu_bacteria 2967769361 2967773371 220
268 iso_pu_bacteria 2967775926 2967779302 220
269 iso_pu_bacteria 2970019648 2970021481 220
270 iso_pu_bacteria 2970026789 2970027203 220
271 iso_pu_bacteria 2970033650 2970039916 220
272 iso_pu_bacteria 2970040964 2970041362 220
273 iso_pu_bacteria 2970047711 2970048494 220
274 iso_pu_bacteria 2970054988 2970061134 220
275 iso_pu_bacteria 2970061556 2970066500 220
276 iso_pu_bacteria 2970068827 2970074193 220
277 iso_pu_bacteria 2970076120 2970080919 220
278 iso_pu_bacteria 2970082768 2970087393 220
279 iso_pu_bacteria 2970088815 2970089972 220
280 iso_pu_bacteria 2970095765 2970101599 220
281 iso_pu_bacteria 2970102677 2970108680 220
282 iso_pu_bacteria 2970109326 2970114753 220
283 iso_pu_bacteria 2970116247 2970121043 220
284 iso_pu_bacteria 2970122695 2970127452 220
285 iso_pu_bacteria 2970129317 2970132447 220
286 iso_pu_bacteria 2970136068 2970139189 220
287 iso_pu_bacteria 2970143518 2970148720 220
288 iso_pu_bacteria 2970149975 2970150621 220
289 iso_pu_bacteria 2970156795 2970158135 220
290 iso_pu_bacteria 2970164137 2970168805 220
291 iso_pu_bacteria 2970170962 2970173915 220
292 iso_pu_bacteria 2970177841 2970179749 220
293 iso_pu_bacteria 2970184632 2970187042 220
294 iso_pu_bacteria 2970191845 2970196454 220
295 iso_pu_bacteria 2977516862 2977522598 220
296 iso_pu_bacteria 2977523885 2977530667 220
297 iso_pu_bacteria 2977530762 2977535275 220
298 iso_pu_bacteria 2977537788 2977543931 220
299 iso_pu_bacteria 2977551784 2977555333 220
300 iso_pu_bacteria 2977558990 2977561745 220
301 iso_pu_bacteria 2977565890 2977572115 220
302 iso_pu_bacteria 2977572785 2977576184 220
303 iso_pu_bacteria 2977579622 2977584831 220
304 iso_pu_bacteria 648276728 648740831 220
305 iso_pu_bacteria 8003992118 8003994029 220
306 iso_pu_bacteria 8003999396 8004001657 220
307 3300042007 Ga0439449_0036105 Ga0439449_0036105_26_691 221
308 iso_pu_bacteria 2941489479 2941493207 221
309 3300005262 Ga0065165_1022746 Ga0065165_10227462 222
310 3300025972 Ga0207668_10797430 Ga0207668_107974301 222
311 3300049571 Ga0501034_0014618 Ga0501034_0014618_5102_5770 222
312 iso_pu_bacteria 2582581304 2585254807 222
313 iso_pu_bacteria 2599185352 2600195880 222
314 iso_pu_bacteria 2643221557 2643803341 222
315 iso_pu_bacteria 2643221568 2643855898 222
316 iso_pu_bacteria 2643221610 2644063708 222
317 iso_pu_bacteria 2643221668 2644374985 222
318 iso_pu_bacteria 2643221675 2644414471 222
319 iso_pu_bacteria 2643221680 2644447999 222
320 iso_pu_bacteria 2643221723 2644676313 222
321 iso_pu_bacteria 2643221726 2644690472 222
322 iso_pu_bacteria 2821443989 2821445499 222
323 iso_pu_bacteria 2919166419 2919167336 222
324 iso_pu_bacteria 2920822456 2920824978 222
325 iso_pu_bacteria 2929138655 2929139491 222
326 3300028794 Ga0307515_10253687 Ga0307515_102536872 223
327 3300053117 Ga0500593_000058 Ga0500593_000058_36656_37327 223
328 iso_pu_bacteria 2510917030 2511195398 223
329 iso_pu_bacteria 2513237088 2513594635 223
330 iso_pu_bacteria 2534681796 2535516549 223
331 iso_pu_bacteria 2582581298 2585224474 223
332 iso_pu_bacteria 2585427529 2585546595 223
333 iso_pu_bacteria 2643221618 2644107479 223
334 iso_pu_bacteria 2643221618 2644109698 223
335 iso_pu_bacteria 2643221626 2644146077 223
336 iso_pu_bacteria 2643221634 2644192724 223
337 iso_pu_bacteria 2643221655 2644308875 223
338 iso_pu_bacteria 2643221655 2644312576 223
339 iso_pu_bacteria 2643221659 2644332700 223
340 iso_pu_bacteria 2643221659 2644336870 223
341 iso_pu_bacteria 2643221698 2644540102 223
342 iso_pu_bacteria 2643221698 2644540891 223
343 iso_pu_bacteria 2643221712 2644614816 223
344 iso_pu_bacteria 2643221712 2644618307 223
345 iso_pu_bacteria 2844163670 2844168218 223
346 iso_pu_bacteria 2919100787 2919106759 223
347 iso_pu_bacteria 3005445848 3005447631 223
348 3300005327 Ga0070658_10049799 Ga0070658_100497992 224
349 3300005617 Ga0068859_100304614 Ga0068859_1003046142 224
350 3300005719 Ga0068861_100862695 Ga0068861_1008626951 224
351 3300005844 Ga0068862_100147974 Ga0068862_1001479742 224
352 3300006931 Ga0097620_100304599 Ga0097620_1003045992 224
353 3300006946 Ga0079104_1019394 Ga0079104_10193942 224
354 3300021320 Ga0214544_1000169 Ga0214544_100016911 224
355 3300021321 Ga0214542_1000131 Ga0214542_100013181 224
356 3300021327 Ga0214543_1000028 Ga0214543_100002811 224
357 3300021361 Ga0213872_10150457 Ga0213872_101504571 224
358 3300022739 Ga0228711_1006836 Ga0228711_100683614 224
359 3300022740 Ga0228710_1006916 Ga0228710_100691614 224
360 3300025250 Ga0209026_1001794 Ga0209026_10017942 224
361 3300027111 Ga0209281_1000106 Ga0209281_100010656 224
362 3300027111 Ga0209281_1000426 Ga0209281_100042610 224
363 3300027666 Ga0209282_1000083 Ga0209282_100008315 224
364 3300028380 Ga0268265_10186649 Ga0268265_101866493 224
365 3300028794 Ga0307515_10014912 Ga0307515_100149127 224
366 3300031548 Ga0307408_100955862 Ga0307408_1009558621 224
367 3300031967 Ga0315914_1002550 Ga0315914_100255015 224
368 3300033430 Ga0315913_1001274 Ga0315913_100127414 224
369 3300033464 Ga0315915_1000010 Ga0315915_100001089 224
370 3300036401 Ga0373937_0356972 Ga0373937_0356972_657_1331 224
371 3300039447 Ga0436361_0746508 Ga0436361_0746508_93_767 224
372 3300041404 Ga0439436_0043129 Ga0439436_0043129_430_1104 224
373 3300041405 Ga0439438_049945 Ga0439438_049945_218_892 224
374 3300046506 Ga0495583_0095273 Ga0495583_0095273_84_758 224
375 3300047472 Ga0495686_0007125 Ga0495686_0007125_4282_4956 224
376 3300053153 Ga0500616_0078835 Ga0500616_0078835_805_1479 224
377 iso_pu_bacteria 2509276021 2509392562 224
378 iso_pu_bacteria 2509276033 2509443359 224
379 iso_pu_bacteria 2510065019 2510133413 224
380 iso_pu_bacteria 2510461076 2510894799 224
381 iso_pu_bacteria 2513237084 2513572400 224
382 iso_pu_bacteria 2513237085 2513577385 224
383 iso_pu_bacteria 2513237093 2513629984 224
384 iso_pu_bacteria 2513237103 2513708624 224
385 iso_pu_bacteria 2513237162 2514021735 224
386 iso_pu_bacteria 2515075009 2515112377 224
387 iso_pu_bacteria 2515154113 2515632729 224
388 iso_pu_bacteria 2515154114 2515639877 224
389 iso_pu_bacteria 2515154116 2515661222 224
390 iso_pu_bacteria 2515154134 2515744232 224
391 iso_pu_bacteria 2516653077 2517036109 224
392 iso_pu_bacteria 2516653085 2517076499 224
393 iso_pu_bacteria 2517093000 2517095265 224
394 iso_pu_bacteria 2517287029 2517406873 224
395 iso_pu_bacteria 2519899620 2520379259 224
396 iso_pu_bacteria 2529292951 2530645623 224
397 iso_pu_bacteria 2582581299 2585229942 224
398 iso_pu_bacteria 2585427526 2585527739 224
399 iso_pu_bacteria 2585427528 2585537633 224
400 iso_pu_bacteria 2585427593 2585835583 224
401 iso_pu_bacteria 2585427594 2585846780 224
402 iso_pu_bacteria 2615840624 2616292371 224
403 iso_pu_bacteria 2643221593 2643973306 224
404 iso_pu_bacteria 2643221643 2644239618 224
405 iso_pu_bacteria 2718217882 2719181268 224
406 iso_pu_bacteria 2718217927 2719385880 224
407 iso_pu_bacteria 2718217997 2719665694 224
408 iso_pu_bacteria 2718218009 2719732017 224
409 iso_pu_bacteria 2718218199 2720492114 224
410 iso_pu_bacteria 2718218232 2720613379 224
411 iso_pu_bacteria 2718218233 2720620256 224
412 iso_pu_bacteria 2718218235 2720631681 224
413 iso_pu_bacteria 2718218269 2720775409 224
414 iso_pu_bacteria 2718218363 2721147362 224
415 iso_pu_bacteria 2718218365 2721158896 224
416 iso_pu_bacteria 2718218366 2721164280 224
417 iso_pu_bacteria 2718218423 2721399659 224
418 iso_pu_bacteria 2721755514 2722840450 224
419 iso_pu_bacteria 2721755556 2723027027 224
420 iso_pu_bacteria 2721755684 2723560639 224
421 iso_pu_bacteria 2721755685 2723567228 224
422 iso_pu_bacteria 2721755809 2724038472 224
423 iso_pu_bacteria 2721755810 2724044773 224
424 iso_pu_bacteria 2721755819 2724090016 224
425 iso_pu_bacteria 2721755822 2724104493 224
426 iso_pu_bacteria 2721755823 2724110287 224
427 iso_pu_bacteria 2724679232 2725948556 224
428 iso_pu_bacteria 2728369352 2730107963 224
429 iso_pu_bacteria 2728369365 2730164505 224
430 iso_pu_bacteria 2728369397 2730298528 224
431 iso_pu_bacteria 2738541333 2739036596 224
432 iso_pu_bacteria 2765235942 2766067455 224
433 iso_pu_bacteria 2791355256 2793294767 224
434 iso_pu_bacteria 2791355259 2793312349 224
435 iso_pu_bacteria 2791355260 2793324916 224
436 iso_pu_bacteria 2791355262 2793335967 224
437 iso_pu_bacteria 2791355263 2793341615 224
438 iso_pu_bacteria 2791355264 2793348983 224
439 iso_pu_bacteria 2791355265 2793352982 224
440 iso_pu_bacteria 2791355266 2793361076 224
441 iso_pu_bacteria 2791355267 2793369170 224
442 iso_pu_bacteria 2802429605 2805925792 224
443 iso_pu_bacteria 2802429606 2805933484 224
444 iso_pu_bacteria 2802429633 2806046146 224
445 iso_pu_bacteria 2802429634 2806054526 224
446 iso_pu_bacteria 2802429635 2806060530 224
447 iso_pu_bacteria 2802429636 2806065012 224
448 iso_pu_bacteria 2802429637 2806072272 224
449 iso_pu_bacteria 2838016132 2838021381 224
450 iso_pu_bacteria 2838022645 2838028057 224
451 iso_pu_bacteria 2838042994 2838043537 224
452 iso_pu_bacteria 2838048938 2838053448 224
453 iso_pu_bacteria 2838061910 2838065721 224
454 iso_pu_bacteria 2838068647 2838074559 224
455 iso_pu_bacteria 2838668709 2838671940 224
456 iso_pu_bacteria 2838680041 2838682121 224
457 iso_pu_bacteria 2838686498 2838691883 224
458 iso_pu_bacteria 2838694306 2838696693 224
459 iso_pu_bacteria 2838701080 2838704780 224
460 iso_pu_bacteria 2838707686 2838710068 224
461 iso_pu_bacteria 2838729681 2838732970 224
462 iso_pu_bacteria 2838742623 2838745848 224
463 iso_pu_bacteria 2841851746 2841855693 224
464 iso_pu_bacteria 2841864319 2841864441 224
465 iso_pu_bacteria 2842077413 2842078241 224
466 iso_pu_bacteria 2842110456 2842114308 224
467 iso_pu_bacteria 2842118031 2842119251 224
468 iso_pu_bacteria 2842146304 2842148480 224
469 iso_pu_bacteria 2842156927 2842157315 224
470 iso_pu_bacteria 2842163707 2842167974 224
471 iso_pu_bacteria 2842180545 2842181101 224
472 iso_pu_bacteria 2842192696 2842194424 224
473 iso_pu_bacteria 2842198810 2842204020 224
474 iso_pu_bacteria 2842205361 2842205949 224
475 iso_pu_bacteria 2842217011 2842217345 224
476 iso_pu_bacteria 2842229732 2842230841 224
477 iso_pu_bacteria 2842237096 2842239480 224
478 iso_pu_bacteria 2842243621 2842245053 224
479 iso_pu_bacteria 2842250916 2842254460 224
480 iso_pu_bacteria 2842257432 2842258866 224
481 iso_pu_bacteria 2842264693 2842265956 224
482 iso_pu_bacteria 2842271015 2842276464 224
483 iso_pu_bacteria 2842278818 2842279406 224
484 iso_pu_bacteria 2842285085 2842286055 224
485 iso_pu_bacteria 2842291075 2842291903 224
486 iso_pu_bacteria 2842304105 2842304396 224
487 iso_pu_bacteria 2842311132 2842314325 224
488 iso_pu_bacteria 2842317721 2842317820 224
489 iso_pu_bacteria 2842341865 2842345211 224
490 iso_pu_bacteria 2842363717 2842364655 224
491 iso_pu_bacteria 2842370503 2842372688 224
492 iso_pu_bacteria 2842377471 2842378299 224
493 iso_pu_bacteria 2842384541 2842385760 224
494 iso_pu_bacteria 2842395702 2842398775 224
495 iso_pu_bacteria 2842402390 2842403415 224
496 iso_pu_bacteria 2842409023 2842409212 224
497 iso_pu_bacteria 2842415677 2842415866 224
498 iso_pu_bacteria 2842422224 2842427450 224
499 iso_pu_bacteria 2842428310 2842429407 224
500 iso_pu_bacteria 2842434925 2842436020 224
501 iso_pu_bacteria 2842441272 2842442367 224
502 iso_pu_bacteria 2842447887 2842450658 224
503 iso_pu_bacteria 2842462802 2842463828 224
504 iso_pu_bacteria 2842469257 2842470349 224
505 iso_pu_bacteria 2842489311 2842490112 224
506 iso_pu_bacteria 2842495871 2842496090 224
507 iso_pu_bacteria 2844454524 2844459061 224
508 iso_pu_bacteria 2857516855 2857523657 224
509 iso_pu_bacteria 2933570622 2933571670 224
510 iso_pu_bacteria 2933586486 2933590403 224
511 iso_pu_bacteria 2933599457 2933605039 224
512 iso_pu_bacteria 2935894831 2935897452 224
513 iso_pu_bacteria 2935901341 2935905583 224
514 iso_pu_bacteria 2936367885 2936372597 224
515 iso_pu_bacteria 2936375103 2936376406 224
516 iso_pu_bacteria 2936381700 2936387116 224
517 iso_pu_bacteria 2937084907 2937087727 224
518 iso_pu_bacteria 2977544691 2977549726 224
519 iso_pu_bacteria 2996893221 2996894076 224
520 iso_pu_bacteria 639633055 639648636 224
521 iso_pu_bacteria 8002285264 8002290114 224
522 iso_pu_bacteria 8005275841 8005280661 224
523 iso_pu_bacteria 8005282627 8005287017 224
524 iso_pu_bacteria 8005289223 8005293181 224
525 iso_pu_bacteria 8005301065 8005302649 224
526 iso_pu_bacteria 8005307578 8005309824 224
527 iso_pu_bacteria 8005376324 8005379321 224
528 iso_pu_bacteria 8005430974 8005434547 224
529 iso_pu_bacteria 8005460587 8005463048 224
530 iso_pu_bacteria 8005497431 8005500422 224
531 iso_pu_bacteria 8005556819 8005557610 224
532 iso_pu_bacteria 8005563573 8005568783 224
533 iso_pu_bacteria 8005570704 8005574331 224
534 iso_pu_bacteria 8005619151 8005621797 224
535 iso_pu_bacteria 8005626139 8005626615 224
536 iso_pu_bacteria 8005668836 8005671840 224
537 iso_pu_bacteria 8005688590 8005694663 224
538 iso_pu_bacteria 8005695170 8005699918 224
539 iso_pu_bacteria 8018127388 8018130005 224
540 iso_pu_bacteria 8018163183 8018166699 224
541 iso_pu_bacteria 8018176218 8018179743 224
542 iso_pu_bacteria 8023680758 8023685284 224
543 iso_pu_bacteria 8024479707 8024483441 224
544 iso_pu_bacteria 8024501048 8024506508 224
545 iso_pu_bacteria 8056375014 8056376713 224
546 iso_pu_bacteria 8056382006 8056387918 224
547 iso_pu_bacteria 8057874678 8057874962 224
548 3300003771 Ga0055526_1000005 Ga0055526_1000005264 225
549 3300003773 Ga0055537_1000042 Ga0055537_100004266 225
550 3300003775 Ga0055524_1000005 Ga0055524_1000005265 225
551 3300003784 Ga0055534_1000002 Ga0055534_100000265 225
552 3300003790 Ga0055528_1000002 Ga0055528_100000265 225
553 3300015689 Ga0183360_10002 Ga0183360_10002834 225
554 3300025263 Ga0209565_1000001 Ga0209565_1000001521 225
555 3300025273 Ga0209673_1000001 Ga0209673_1000001521 225
556 3300025291 Ga0209675_1000001 Ga0209675_10000012011 225
557 3300025295 Ga0209564_1000001 Ga0209564_10000012173 225
558 3300025299 Ga0209256_1000006 Ga0209256_1000006609 225
559 3300046512 Ga0495610_0002342 Ga0495610_0002342_9229_9906 225
560 3300046515 Ga0495620_0018038 Ga0495620_0018038_449_1126 225
561 3300046519 Ga0495632_0044435 Ga0495632_0044435_559_1236 225
562 3300046522 Ga0495643_0022984 Ga0495643_0022984_801_1478 225
563 3300047472 Ga0495686_0007998 Ga0495686_0007998_3618_4295 225
564 3300048924 Ga0496121_0013627 Ga0496121_0013627_7125_7802 225
565 3300049571 Ga0501034_0330160 Ga0501034_0330160_640_1317 225
566 3300049576 Ga0501040_0001890 Ga0501040_0001890_782_1459 225
567 3300049578 Ga0501042_0337052 Ga0501042_0337052_383_1060 225
568 3300049741 Ga0501079_0083699 Ga0501079_0083699_71_748 225
569 3300049824 Ga0501045_0078990 Ga0501045_0078990_1313_1990 225
570 3300060353 Ga0501082_0024147 Ga0501082_0024147_3828_4505 225
571 3300061734 Ga0530510_0006359 Ga0530510_0006359_1874_2551 225
572 iso_pu_bacteria 2643221599 2644003813 225
573 3300002987 JGI25159J45721_1000028 JGI25159J45721_1000028104 226
574 3300003187 JGI25151J46595_10009987 JGI25151J46595_100099874 226
575 3300003354 JGI25160J50197_1000024 JGI25160J50197_1000024105 226
576 3300003374 JGI25161J50226_1000876 JGI25161J50226_10008761 226
577 3300003771 Ga0055526_1003494 Ga0055526_10034945 226
578 3300003775 Ga0055524_1001133 Ga0055524_10011337 226
579 3300003775 Ga0055524_1025150 Ga0055524_10251502 226
580 3300003781 Ga0055536_1007822 Ga0055536_10078221 226
581 3300004625 Ga0055543_1000013 Ga0055543_100001391 226
582 3300005262 Ga0065165_1000098 Ga0065165_1000098110 226
583 3300005288 Ga0065714_10010827 Ga0065714_100108273 226
584 3300005293 Ga0065715_10249483 Ga0065715_102494832 226
585 3300005347 Ga0070668_100333367 Ga0070668_1003333672 226
586 3300005367 Ga0070667_100673145 Ga0070667_1006731451 226
587 3300005617 Ga0068859_101326588 Ga0068859_1013265881 226
588 3300006847 Ga0075431_100058389 Ga0075431_1000583893 226
589 3300006880 Ga0075429_100049145 Ga0075429_1000491452 226
590 3300006931 Ga0097620_101326316 Ga0097620_1013263161 226
591 3300009147 Ga0114129_10080591 Ga0114129_100805915 226
592 3300013102 Ga0157371_10009535 Ga0157371_100095358 226
593 3300013105 Ga0157369_10040067 Ga0157369_100400675 226
594 3300013249 Ga0171463_1003 Ga0171463_1003382 226
595 3300015690 Ga0183363_1059 Ga0183363_10599 226
596 3300025208 Ga0209436_100385 Ga0209436_10038517 226
597 3300025245 Ga0207425_1025167 Ga0207425_10251671 226
598 3300025284 Ga0209130_1000026 Ga0209130_1000026105 226
599 3300025294 Ga0209025_1000216 Ga0209025_1000216133 226
600 3300025295 Ga0209564_1000013 Ga0209564_1000013397 226
601 3300025295 Ga0209564_1004952 Ga0209564_10049525 226
602 3300025298 Ga0209050_1007767 Ga0209050_10077674 226
603 3300025299 Ga0209256_1000042 Ga0209256_1000042288 226
604 3300025299 Ga0209256_1000745 Ga0209256_10007453 226
605 3300025302 Ga0207426_1000006 Ga0207426_1000006769 226
606 3300025303 Ga0209051_1006908 Ga0209051_10069084 226
607 3300025304 Ga0209257_1000331 Ga0209257_100033183 226
608 3300025304 Ga0209257_1003749 Ga0209257_10037497 226
609 3300025972 Ga0207668_10219762 Ga0207668_102197622 226
610 3300032126 Ga0307415_100985938 Ga0307415_1009859381 226
611 3300041405 Ga0439438_052693 Ga0439438_052693_134_814 226
612 3300046472 Ga0495580_0006213 Ga0495580_0006213_7342_8022 226
613 3300046499 Ga0495594_0187058 Ga0495594_0187058_116_796 226
614 3300046518 Ga0495631_0198279 Ga0495631_0198279_24_704 226
615 3300046526 Ga0495666_0011171 Ga0495666_0011171_1760_2440 226
616 3300046528 Ga0495642_0000003 Ga0495642_0000003_83218_83898 226
617 3300046664 Ga0495659_0000186 Ga0495659_0000186_253_933 226
618 3300046665 Ga0495661_0085813 Ga0495661_0085813_275_955 226
619 3300046690 Ga0495624_0105267 Ga0495624_0105267_685_1365 226
620 3300047317 Ga0495604_0005804 Ga0495604_0005804_7067_7747 226
621 3300047447 Ga0495685_151437 Ga0495685_151437_19_699 226
622 3300048088 Ga0495602_0084283 Ga0495602_0084283_1115_1795 226
623 3300048914 Ga0496111_0022824 Ga0496111_0022824_1239_1919 226
624 3300048919 Ga0496116_0000036 Ga0496116_0000036_245373_246053 226
625 3300048919 Ga0496116_0034489 Ga0496116_0034489_2688_3368 226
626 3300048920 Ga0496117_0008869 Ga0496117_0008869_7772_8452 226
627 3300048921 Ga0496118_0074280 Ga0496118_0074280_578_1258 226
628 3300048922 Ga0496119_0063407 Ga0496119_0063407_578_1258 226
629 3300048923 Ga0496120_0070435 Ga0496120_0070435_928_1608 226
630 3300048924 Ga0496121_0000001 Ga0496121_0000001_857391_858071 226
631 3300048926 Ga0496123_0044909 Ga0496123_0044909_254_934 226
632 3300048926 Ga0496123_0087694 Ga0496123_0087694_506_1186 226
633 3300048927 Ga0496124_0028228 Ga0496124_0028228_3764_4444 226
634 3300048928 Ga0496125_0000001 Ga0496125_0000001_971307_971987 226
635 3300048928 Ga0496125_0051744 Ga0496125_0051744_2178_2858 226
636 3300048929 Ga0496126_0000156 Ga0496126_0000156_128187_128867 226
637 3300048929 Ga0496126_0044809 Ga0496126_0044809_3304_3984 226
638 3300048929 Ga0496126_0161339 Ga0496126_0161339_413_1093 226
639 3300049459 Ga0495678_112099 Ga0495678_112099_202_882 226
640 3300049568 Ga0501031_0000064 Ga0501031_0000064_35102_35782 226
641 3300049569 Ga0501032_0000006 Ga0501032_0000006_22051_22731 226
642 3300049570 Ga0501033_0000053 Ga0501033_0000053_35102_35782 226
643 3300049570 Ga0501033_0557173 Ga0501033_0557173_20_700 226
644 3300049571 Ga0501034_0000030 Ga0501034_0000030_212399_213079 226
645 3300049571 Ga0501034_0191606 Ga0501034_0191606_1175_1855 226
646 3300049571 Ga0501034_0352605 Ga0501034_0352605_635_1315 226
647 3300049572 Ga0501036_0000003 Ga0501036_0000003_238997_239677 226
648 3300049572 Ga0501036_0751147 Ga0501036_0751147_113_793 226
649 3300049573 Ga0501037_0000003 Ga0501037_0000003_238997_239677 226
650 3300049574 Ga0501038_0000004 Ga0501038_0000004_238997_239677 226
651 3300049575 Ga0501039_0000008 Ga0501039_0000008_238997_239677 226
652 3300049576 Ga0501040_0005395 Ga0501040_0005395_1660_2340 226
653 3300049579 Ga0501043_0000365 Ga0501043_0000365_20884_21564 226
654 3300049580 Ga0501046_0061751 Ga0501046_0061751_1714_2394 226
655 3300049581 Ga0501047_0001197 Ga0501047_0001197_7825_8505 226
656 3300049581 Ga0501047_0241699 Ga0501047_0241699_908_1588 226
657 3300049582 Ga0501048_0167520 Ga0501048_0167520_481_1161 226
658 3300049586 Ga0501070_0009239 Ga0501070_0009239_4321_5001 226
659 3300049586 Ga0501070_0523573 Ga0501070_0523573_238_918 226
660 3300049822 Ga0501035_0000031 Ga0501035_0000031_139810_140490 226
661 3300049822 Ga0501035_0179978 Ga0501035_0179978_1073_1753 226
662 3300049823 Ga0501044_0000008 Ga0501044_0000008_238997_239677 226
663 3300050507 nmdc:mga05p37_331671_c1 nmdc:mga05p37_331671_c1_391_1071 226
664 3300050508 nmdc:mga09592_43190_c1 nmdc:mga09592_43190_c1_2841_3521 226
665 3300050510 nmdc:mga06r32_108937_c1 nmdc:mga06r32_108937_c1_1105_1785 226
666 3300053730 Ga0500645_004831 Ga0500645_004831_3568_4248 226
667 iso_pu_bacteria 2510917022 2511135178 226
668 iso_pu_bacteria 2524023209 2524460216 226
669 iso_pu_bacteria 2582581307 2585270919 226
670 iso_pu_bacteria 2582581308 2585277270 226
671 iso_pu_bacteria 2582581315 2585323722 226
672 iso_pu_bacteria 2582581316 2585331697 226
673 iso_pu_bacteria 2585427527 2585533996 226
674 iso_pu_bacteria 2585427530 2585552154 226
675 iso_pu_bacteria 2585427531 2585558643 226
676 iso_pu_bacteria 2585427608 2585898006 226
677 iso_pu_bacteria 2585427609 2585904387 226
678 iso_pu_bacteria 2585428125 2587980496 226
679 iso_pu_bacteria 2615840626 2616308647 226
680 iso_pu_bacteria 2667528174 2671111655 226
681 iso_pu_bacteria 2775507266 2778174081 226
682 iso_pu_bacteria 2818991448 2819608927 226
683 iso_pu_bacteria 2818991453 2819637842 226
684 iso_pu_bacteria 2838029111 2838030027 226
685 iso_pu_bacteria 2842298080 2842301977 226
686 iso_pu_bacteria 2842357229 2842357556 226
687 iso_pu_bacteria 2842475841 2842476688 226
688 iso_pu_bacteria 2842482326 2842484772 226
689 iso_pu_bacteria 2842502639 2842503555 226
690 iso_pu_bacteria 2842509118 2842511368 226
691 iso_pu_bacteria 2852387548 2852389965 226
692 iso_pu_bacteria 2919408235 2919411626 226
693 iso_pu_bacteria 2929199973 2929202227 226
694 iso_pu_bacteria 3005409236 3005415078 226
695 iso_pu_bacteria 8005484373 8005485212 226
696 iso_pu_bacteria 8005645114 8005649804 226
697 iso_pu_bacteria 8005682033 8005683123 226
698 iso_pu_bacteria 8046767195 8046773725 226
699 iso_pu_bacteria 8055909800 8055916642 226
700 iso_pu_bacteria 8057575449 8057575970 226
701 3300002739 JGI25158J39367_1000088 JGI25158J39367_10000888 227
702 3300002773 JGI25152J39213_1003989 JGI25152J39213_10039894 227
703 3300002774 JGI25150J39212_1017535 JGI25150J39212_10175351 227
704 3300003215 JGI25153J46596_10008229 JGI25153J46596_100082294 227
705 3300003354 JGI25160J50197_1008974 JGI25160J50197_10089745 227
706 3300003374 JGI25161J50226_1000414 JGI25161J50226_100041416 227
707 3300003771 Ga0055526_1003421 Ga0055526_10034218 227
708 3300003775 Ga0055524_1005296 Ga0055524_10052966 227
709 3300003790 Ga0055528_1005134 Ga0055528_10051346 227
710 3300003792 Ga0055540_1003979 Ga0055540_10039798 227
711 3300003911 JGI25405J52794_10000556 JGI25405J52794_100005563 227
712 3300004625 Ga0055543_1000536 Ga0055543_100053615 227
713 3300005262 Ga0065165_1037690 Ga0065165_10376903 227
714 3300005548 Ga0070665_100073173 Ga0070665_1000731732 227
715 3300005937 Ga0081455_10005282 Ga0081455_100052827 227
716 3300005937 Ga0081455_10195894 Ga0081455_101958942 227
717 3300005937 Ga0081455_10348069 Ga0081455_103480692 227
718 3300006058 Ga0075432_10000194 Ga0075432_1000019413 227
719 3300006186 Ga0075369_10101479 Ga0075369_101014792 227
720 3300006844 Ga0075428_100009454 Ga0075428_1000094548 227
721 3300006846 Ga0075430_100000129 Ga0075430_10000012929 227
722 3300006847 Ga0075431_100000948 Ga0075431_10000094818 227
723 3300006852 Ga0075433_10000100 Ga0075433_1000010011 227
724 3300006871 Ga0075434_100001229 Ga0075434_10000122912 227
725 3300006880 Ga0075429_100000278 Ga0075429_10000027818 227
726 3300007076 Ga0075435_100009615 Ga0075435_1000096156 227
727 3300009094 Ga0111539_10001748 Ga0111539_1000174811 227
728 3300009147 Ga0114129_10002143 Ga0114129_1000214312 227
729 3300025208 Ga0209436_100020 Ga0209436_10002077 227
730 3300025245 Ga0207425_1002801 Ga0207425_10028014 227
731 3300025258 Ga0209129_1001228 Ga0209129_10012289 227
732 3300025258 Ga0209129_1003874 Ga0209129_10038744 227
733 3300025273 Ga0209673_1003140 Ga0209673_10031405 227
734 3300025284 Ga0209130_1000004 Ga0209130_1000004322 227
735 3300025294 Ga0209025_1027996 Ga0209025_10279962 227
736 3300025295 Ga0209564_1000362 Ga0209564_100036297 227
737 3300025297 Ga0209758_1000540 Ga0209758_100054043 227
738 3300025297 Ga0209758_1000564 Ga0209758_100056422 227
739 3300025297 Ga0209758_1011418 Ga0209758_10114185 227
740 3300025299 Ga0209256_1002196 Ga0209256_100219610 227
741 3300025302 Ga0207426_1000003 Ga0207426_1000003405 227
742 3300025302 Ga0207426_1057449 Ga0207426_10574492 227
743 3300025303 Ga0209051_1014583 Ga0209051_10145834 227
744 3300025304 Ga0209257_1004924 Ga0209257_10049244 227
745 3300025986 Ga0207658_10100950 Ga0207658_101009502 227
746 3300027907 Ga0207428_10000146 Ga0207428_1000014631 227
747 3300028794 Ga0307515_10067856 Ga0307515_100678565 227
748 3300031456 Ga0307513_10114544 Ga0307513_101145443 227
749 3300031901 Ga0307406_10685158 Ga0307406_106851582 227
750 3300032002 Ga0307416_101301473 Ga0307416_1013014731 227
751 3300041413 Ga0439465_0024328 Ga0439465_0024328_1165_1848 227
752 3300041413 Ga0439465_0029955 Ga0439465_0029955_582_1265 227
753 3300046492 Ga0495585_0013953 Ga0495585_0013953_3094_3777 227
754 3300046506 Ga0495583_0014100 Ga0495583_0014100_546_1229 227
755 3300046507 Ga0495606_0016764 Ga0495606_0016764_4865_5548 227
756 3300046512 Ga0495610_0062272 Ga0495610_0062272_493_1176 227
757 3300046522 Ga0495643_0033748 Ga0495643_0033748_1600_2283 227
758 3300046558 Ga0495633_0042683 Ga0495633_0042683_731_1414 227
759 3300046616 Ga0495668_0082861 Ga0495668_0082861_543_1226 227
760 3300046694 Ga0495649_0072560 Ga0495649_0072560_216_899 227
761 3300048909 Ga0496106_0000050 Ga0496106_0000050_44057_44740 227
762 3300048919 Ga0496116_0111655 Ga0496116_0111655_705_1388 227
763 3300048921 Ga0496118_0008696 Ga0496118_0008696_7707_8390 227
764 3300048924 Ga0496121_0103074 Ga0496121_0103074_95_778 227
765 3300048924 Ga0496121_0190691 Ga0496121_0190691_546_1229 227
766 3300048924 Ga0496121_0469111 Ga0496121_0469111_69_752 227
767 3300048925 Ga0496122_0031826 Ga0496122_0031826_1954_2637 227
768 3300048926 Ga0496123_0007026 Ga0496123_0007026_10023_10706 227
769 3300048927 Ga0496124_0114819 Ga0496124_0114819_740_1423 227
770 3300048927 Ga0496124_0246208 Ga0496124_0246208_190_873 227
771 3300048928 Ga0496125_0000585 Ga0496125_0000585_18067_18750 227
772 3300048928 Ga0496125_0034704 Ga0496125_0034704_3434_4117 227
773 3300048928 Ga0496125_0160064 Ga0496125_0160064_672_1355 227
774 3300048929 Ga0496126_0695390 Ga0496126_0695390_55_738 227
775 3300049571 Ga0501034_0290310 Ga0501034_0290310_330_1013 227
776 3300049579 Ga0501043_0103335 Ga0501043_0103335_112_795 227
777 3300049584 Ga0501068_0046420 Ga0501068_0046420_292_975 227
778 3300049744 Ga0501083_0164076 Ga0501083_0164076_130_813 227
779 3300050507 nmdc:mga05p37_111_c2 nmdc:mga05p37_111_c2_9926_10618 227
780 3300050508 nmdc:mga09592_137_c1 nmdc:mga09592_137_c1_21391_22083 227
781 3300050509 nmdc:mga0qj67_1612_c1 nmdc:mga0qj67_1612_c1_1437_2129 227
782 3300050510 nmdc:mga06r32_526_c1 nmdc:mga06r32_526_c1_9806_10498 227
783 3300050511 nmdc:mga08y16_1030_c1 nmdc:mga08y16_1030_c1_9940_10632 227
784 3300050512 nmdc:mga0n895_331_c1 nmdc:mga0n895_331_c1_20952_21644 227
785 3300050513 nmdc:mga0rr50_5720_c1 nmdc:mga0rr50_5720_c1_6499_7191 227
786 3300050515 nmdc:mga0a205_50_c1 nmdc:mga0a205_50_c1_15193_15885 227
787 3300050516 nmdc:mga0sz30_178935_c1 nmdc:mga0sz30_178935_c1_22_705 227
788 3300053087 Ga0500643_064452 Ga0500643_064452_174_857 227
789 3300053088 Ga0500644_0263757 Ga0500644_0263757_23_706 227
790 3300053093 Ga0500651_0125774 Ga0500651_0125774_471_1154 227
791 3300053096 Ga0500641_0150204 Ga0500641_0150204_149_832 227
792 3300053139 Ga0500568_0001502 Ga0500568_0001502_442_1125 227
793 3300053139 Ga0500568_0107831 Ga0500568_0107831_296_979 227
794 3300053156 Ga0500622_0001581 Ga0500622_0001581_7418_8101 227
795 3300053160 Ga0500633_0000903 Ga0500633_0000903_1872_2555 227
796 3300002773 JGI25152J39213_1001161 JGI25152J39213_10011619 228
797 3300002774 JGI25150J39212_1000160 JGI25150J39212_100016035 228
798 3300003187 JGI25151J46595_10000083 JGI25151J46595_10000083126 228
799 3300003215 JGI25153J46596_10000965 JGI25153J46596_100009656 228
800 3300003215 JGI25153J46596_10005132 JGI25153J46596_100051327 228
801 3300003320 rootH2_10012649 rootH2_1001264911 228
802 3300003354 JGI25160J50197_1003560 JGI25160J50197_10035605 228
803 3300003374 JGI25161J50226_1005973 JGI25161J50226_10059732 228
804 3300003771 Ga0055526_1000490 Ga0055526_100049019 228
805 3300003771 Ga0055526_1004931 Ga0055526_10049318 228
806 3300003775 Ga0055524_1001266 Ga0055524_100126619 228
807 3300003775 Ga0055524_1011991 Ga0055524_10119911 228
808 3300003790 Ga0055528_1000284 Ga0055528_100028443 228
809 3300003790 Ga0055528_1001616 Ga0055528_100161618 228
810 3300003790 Ga0055528_1016447 Ga0055528_10164473 228
811 3300003790 Ga0055528_1018737 Ga0055528_10187372 228
812 3300003792 Ga0055540_1000510 Ga0055540_100051022 228
813 3300003792 Ga0055540_1028168 Ga0055540_10281682 228
814 3300004625 Ga0055543_1000668 Ga0055543_100066822 228
815 3300005544 Ga0070686_100045263 Ga0070686_1000452634 228
816 3300006038 Ga0075365_10001032 Ga0075365_100010329 228
817 3300006042 Ga0075368_10036201 Ga0075368_100362013 228
818 3300006048 Ga0075363_100064567 Ga0075363_1000645673 228
819 3300006048 Ga0075363_100127293 Ga0075363_1001272931 228
820 3300006177 Ga0075362_10000141 Ga0075362_100001416 228
821 3300006177 Ga0075362_10123514 Ga0075362_101235141 228
822 3300006178 Ga0075367_10002608 Ga0075367_1000260810 228
823 3300006186 Ga0075369_10001683 Ga0075369_100016838 228
824 3300006195 Ga0075366_10005088 Ga0075366_100050886 228
825 3300006353 Ga0075370_10002484 Ga0075370_100024844 228
826 3300006353 Ga0075370_10309879 Ga0075370_103098791 228
827 3300009765 Ga0123341_1000037 Ga0123341_100003742 228
828 3300009766 Ga0123342_1010819 Ga0123342_10108199 228
829 3300013306 Ga0163162_10459840 Ga0163162_104598402 228
830 3300025245 Ga0207425_1000024 Ga0207425_1000024124 228
831 3300025245 Ga0207425_1007877 Ga0207425_10078774 228
832 3300025258 Ga0209129_1000184 Ga0209129_100018412 228
833 3300025258 Ga0209129_1000376 Ga0209129_10003763 228
834 3300025263 Ga0209565_1008639 Ga0209565_10086393 228
835 3300025273 Ga0209673_1000013 Ga0209673_1000013349 228
836 3300025273 Ga0209673_1000296 Ga0209673_10002967 228
837 3300025273 Ga0209673_1001255 Ga0209673_100125521 228
838 3300025273 Ga0209673_1001781 Ga0209673_10017817 228
839 3300025273 Ga0209673_1007806 Ga0209673_10078064 228
840 3300025273 Ga0209673_1020119 Ga0209673_10201193 228
841 3300025291 Ga0209675_1010434 Ga0209675_10104343 228
842 3300025294 Ga0209025_1000050 Ga0209025_1000050203 228
843 3300025294 Ga0209025_1000166 Ga0209025_1000166110 228
844 3300025295 Ga0209564_1000273 Ga0209564_10002733 228
845 3300025295 Ga0209564_1000584 Ga0209564_100058415 228
846 3300025297 Ga0209758_1000083 Ga0209758_100008354 228
847 3300025297 Ga0209758_1000218 Ga0209758_1000218102 228
848 3300025297 Ga0209758_1026498 Ga0209758_10264984 228
849 3300025298 Ga0209050_1014269 Ga0209050_10142694 228
850 3300025299 Ga0209256_1000701 Ga0209256_100070122 228
851 3300025299 Ga0209256_1005098 Ga0209256_10050983 228
852 3300025299 Ga0209256_1052731 Ga0209256_10527312 228
853 3300025302 Ga0207426_1000039 Ga0207426_1000039200 228
854 3300025303 Ga0209051_1000142 Ga0209051_100014214 228
855 3300025303 Ga0209051_1002479 Ga0209051_10024793 228
856 3300025303 Ga0209051_1023516 Ga0209051_10235162 228
857 3300025304 Ga0209257_1005349 Ga0209257_100534914 228
858 3300027866 Ga0209813_10034606 Ga0209813_100346062 228
859 3300028794 Ga0307515_10030708 Ga0307515_100307082 228
860 3300031901 Ga0307406_10082201 Ga0307406_100822012 228
861 3300031911 Ga0307412_10001552 Ga0307412_100015529 228
862 3300032004 Ga0307414_10045272 Ga0307414_100452723 228
863 3300041404 Ga0439436_0057683 Ga0439436_0057683_144_830 228
864 3300041413 Ga0439465_0001615 Ga0439465_0001615_2735_3421 228
865 3300041452 Ga0451793_0049932 Ga0451793_0049932_249_935 228
866 3300041458 Ga0451798_1116211 Ga0451798_1116211_18_704 228
867 3300041491 Ga0451833_0040918 Ga0451833_0040918_321_1007 228
868 3300041491 Ga0451833_0231172 Ga0451833_0231172_952_1638 228
869 3300041491 Ga0451833_0457014 Ga0451833_0457014_289_975 228
870 3300041492 Ga0451835_0119890 Ga0451835_0119890_367_1053 228
871 3300041492 Ga0451835_0865008 Ga0451835_0865008_1071_1757 228
872 3300041494 Ga0451837_0390347 Ga0451837_0390347_218_904 228
873 3300041494 Ga0451837_0483527 Ga0451837_0483527_1805_2491 228
874 3300041496 Ga0451839_0867715 Ga0451839_0867715_186_872 228
875 3300041496 Ga0451839_0898432 Ga0451839_0898432_732_1418 228
876 3300041498 Ga0451841_0758593 Ga0451841_0758593_337_1023 228
877 3300041498 Ga0451841_1079509 Ga0451841_1079509_289_975 228
878 3300041501 Ga0451845_0143472 Ga0451845_0143472_923_1609 228
879 3300041501 Ga0451845_0915619 Ga0451845_0915619_466_1152 228
880 3300041503 Ga0451847_0282006 Ga0451847_0282006_1860_2546 228
881 3300041503 Ga0451847_0588818 Ga0451847_0588818_321_1007 228
882 3300041503 Ga0451847_0809477 Ga0451847_0809477_289_975 228
883 3300041505 Ga0451849_0040628 Ga0451849_0040628_328_1014 228
884 3300041505 Ga0451849_0529772 Ga0451849_0529772_365_1051 228
885 3300041505 Ga0451849_1057240 Ga0451849_1057240_1947_2633 228
886 3300041507 Ga0451851_0521423 Ga0451851_0521423_2670_3356 228
887 3300041509 Ga0451843_0294807 Ga0451843_0294807_289_975 228
888 3300041509 Ga0451843_0295029 Ga0451843_0295029_465_1151 228
889 3300041511 Ga0451855_1834447 Ga0451855_1834447_321_1007 228
890 3300041511 Ga0451855_1835784 Ga0451855_1835784_289_975 228
891 3300041512 Ga0451853_1433263 Ga0451853_1433263_355_1041 228
892 3300041512 Ga0451853_2840807 Ga0451853_2840807_257_943 228
893 3300041512 Ga0451853_3769747 Ga0451853_3769747_1509_2195 228
894 3300046471 Ga0495650_0069850 Ga0495650_0069850_680_1366 228
895 3300046471 Ga0495650_0133718 Ga0495650_0133718_29_715 228
896 3300046492 Ga0495585_0051988 Ga0495585_0051988_538_1224 228
897 3300046500 Ga0495596_0024692 Ga0495596_0024692_775_1461 228
898 3300046501 Ga0495607_0021900 Ga0495607_0021900_2970_3656 228
899 3300046506 Ga0495583_0005835 Ga0495583_0005835_801_1487 228
900 3300046507 Ga0495606_0024202 Ga0495606_0024202_3346_4032 228
901 3300046512 Ga0495610_0030235 Ga0495610_0030235_1774_2460 228
902 3300046513 Ga0495616_0077003 Ga0495616_0077003_576_1262 228
903 3300046519 Ga0495632_0001097 Ga0495632_0001097_3648_4355 228
904 3300046519 Ga0495632_0014423 Ga0495632_0014423_3633_4319 228
905 3300046522 Ga0495643_0011123 Ga0495643_0011123_4136_4822 228
906 3300046524 Ga0495648_0010128 Ga0495648_0010128_1476_2162 228
907 3300046525 Ga0495663_0008013 Ga0495663_0008013_1817_2503 228
908 3300046530 Ga0495654_0058278 Ga0495654_0058278_955_1641 228
909 3300046542 Ga0495597_0017092 Ga0495597_0017092_470_1156 228
910 3300046558 Ga0495633_0038204 Ga0495633_0038204_529_1215 228
911 3300046660 Ga0495625_0006277 Ga0495625_0006277_4763_5449 228
912 3300046660 Ga0495625_0139049 Ga0495625_0139049_443_1129 228
913 3300046665 Ga0495661_0094538 Ga0495661_0094538_105_791 228
914 3300046692 Ga0495671_0026707 Ga0495671_0026707_486_1172 228
915 3300046810 Ga0495660_0010233 Ga0495660_0010233_4156_4842 228
916 3300046810 Ga0495660_0079662 Ga0495660_0079662_254_940 228
917 3300047323 Ga0495683_0098136 Ga0495683_0098136_26_712 228
918 3300047443 Ga0495687_032686 Ga0495687_032686_486_1172 228
919 3300047472 Ga0495686_0165959 Ga0495686_0165959_286_972 228
920 3300047472 Ga0495686_0223614 Ga0495686_0223614_118_804 228
921 3300048904 Ga0496101_0058014 Ga0496101_0058014_908_1594 228
922 3300048904 Ga0496101_0126153 Ga0496101_0126153_1132_1818 228
923 3300048916 Ga0496113_0288842 Ga0496113_0288842_66_752 228
924 3300048919 Ga0496116_0001253 Ga0496116_0001253_4298_4984 228
925 3300048919 Ga0496116_0006467 Ga0496116_0006467_3766_4452 228
926 3300048919 Ga0496116_0027606 Ga0496116_0027606_446_1132 228
927 3300048919 Ga0496116_0035703 Ga0496116_0035703_1275_1961 228
928 3300048919 Ga0496116_0085930 Ga0496116_0085930_221_907 228
929 3300048920 Ga0496117_0006763 Ga0496117_0006763_1279_1965 228
930 3300048920 Ga0496117_0010840 Ga0496117_0010840_4721_5407 228
931 3300048921 Ga0496118_0009778 Ga0496118_0009778_161_847 228
932 3300048921 Ga0496118_0032421 Ga0496118_0032421_1221_1907 228
933 3300048921 Ga0496118_0058672 Ga0496118_0058672_1142_1828 228
934 3300048922 Ga0496119_0217289 Ga0496119_0217289_50_736 228
935 3300048924 Ga0496121_0015485 Ga0496121_0015485_4298_4984 228
936 3300048924 Ga0496121_0016204 Ga0496121_0016204_4025_4711 228
937 3300048924 Ga0496121_0045893 Ga0496121_0045893_1056_1784 228
938 3300048925 Ga0496122_0015716 Ga0496122_0015716_3112_3798 228
939 3300048925 Ga0496122_0033970 Ga0496122_0033970_387_1073 228
940 3300048925 Ga0496122_0048658 Ga0496122_0048658_1409_2095 228
941 3300048925 Ga0496122_0228168 Ga0496122_0228168_248_934 228
942 3300048926 Ga0496123_0013633 Ga0496123_0013633_3112_3798 228
943 3300048926 Ga0496123_0019298 Ga0496123_0019298_1693_2379 228
944 3300048926 Ga0496123_0072470 Ga0496123_0072470_434_1120 228
945 3300048927 Ga0496124_0003917 Ga0496124_0003917_14020_14706 228
946 3300048927 Ga0496124_0010539 Ga0496124_0010539_2342_3028 228
947 3300048927 Ga0496124_0090410 Ga0496124_0090410_1168_1854 228
948 3300048928 Ga0496125_0009291 Ga0496125_0009291_5157_5843 228
949 3300048928 Ga0496125_0435107 Ga0496125_0435107_31_717 228
950 3300048929 Ga0496126_0090330 Ga0496126_0090330_675_1361 228
951 3300049574 Ga0501038_0216622 Ga0501038_0216622_503_1189 228
952 3300049579 Ga0501043_0372565 Ga0501043_0372565_360_1046 228
953 3300049589 Ga0501073_0217714 Ga0501073_0217714_322_1008 228
954 3300049744 Ga0501083_0011497 Ga0501083_0011497_151_837 228
955 3300049744 Ga0501083_0042070 Ga0501083_0042070_943_1629 228
956 3300049822 Ga0501035_0481740 Ga0501035_0481740_29_715 228
957 3300050489 nmdc:mga03683_118059_c1 nmdc:mga03683_118059_c1_92_778 228
958 3300050489 nmdc:mga03683_436_c1 nmdc:mga03683_436_c1_6453_7139 228
959 3300050490 nmdc:mga03n38_167361_c1 nmdc:mga03n38_167361_c1_195_881 228
960 3300050490 nmdc:mga03n38_17393_c1 nmdc:mga03n38_17393_c1_1277_1963 228
961 3300050490 nmdc:mga03n38_28864_c1 nmdc:mga03n38_28864_c1_785_1471 228
962 3300050491 nmdc:mga00v17_88166_c1 nmdc:mga00v17_88166_c1_527_1213 228
963 3300050492 nmdc:mga0yw44_1206_c1 nmdc:mga0yw44_1206_c1_2827_3513 228
964 3300050493 nmdc:mga0k408_241303_c1 nmdc:mga0k408_241303_c1_82_768 228
965 3300050493 nmdc:mga0k408_604_c1 nmdc:mga0k408_604_c1_9146_9832 228
966 3300050494 nmdc:mga06z11_224743_c1 nmdc:mga06z11_224743_c1_19_705 228
967 3300050494 nmdc:mga06z11_6405_c1 nmdc:mga06z11_6405_c1_1312_1998 228
968 3300050496 nmdc:mga07m45_5653_c1 nmdc:mga07m45_5653_c1_1988_2674 228
969 3300050516 nmdc:mga0sz30_3381_c1 nmdc:mga0sz30_3381_c1_3616_4302 228
970 3300053086 Ga0500578_0061123 Ga0500578_0061123_640_1326 228
971 3300053118 Ga0500594_0071960 Ga0500594_0071960_293_979 228
972 3300053125 Ga0500618_016671 Ga0500618_016671_62_748 228
973 3300053134 Ga0500658_0000167 Ga0500658_0000167_23520_24206 228
974 3300053153 Ga0500616_0109858 Ga0500616_0109858_538_1224 228
975 3300053156 Ga0500622_0076331 Ga0500622_0076331_426_1112 228
976 3300059508 Ga0587088_041183 Ga0587088_041183_137_823 228
977 3300060353 Ga0501082_0431782 Ga0501082_0431782_147_833 228
978 iso_pu_bacteria 2738541293 2738804256 228
979 3300002773 JGI25152J39213_1004694 JGI25152J39213_10046944 229
980 3300025972 Ga0207668_10668388 Ga0207668_106683882 229
981 3300031548 Ga0307408_100451126 Ga0307408_1004511261 229
982 3300035692 Ga0373935_0049529 Ga0373935_0049529_759_1448 229
983 3300035695 Ga0373927_0001054 Ga0373927_0001054_10552_11241 229
984 3300037068 Ga0373925_0000823 Ga0373925_0000823_7978_8667 229
985 3300046457 Ga0495590_0039225 Ga0495590_0039225_582_1271 229
986 3300046507 Ga0495606_0000896 Ga0495606_0000896_14634_15323 229
987 3300046542 Ga0495597_0131779 Ga0495597_0131779_232_921 229
988 3300046692 Ga0495671_0050700 Ga0495671_0050700_487_1176 229
989 3300047472 Ga0495686_0071298 Ga0495686_0071298_1158_1847 229
990 3300048924 Ga0496121_0006268 Ga0496121_0006268_6325_7014 229
991 3300048924 Ga0496121_0010411 Ga0496121_0010411_5431_6120 229
992 3300048928 Ga0496125_0218896 Ga0496125_0218896_161_850 229
993 3300049823 Ga0501044_0160690 Ga0501044_0160690_848_1669 229
994 3300053156 Ga0500622_0000618 Ga0500622_0000618_21678_22367 229
995 3300002704 JGI25155J39150_1000001 JGI25155J39150_100000176 230
996 3300002705 JGI25156J39149_1000001 JGI25156J39149_1000001256 230
997 3300002737 JGI25162J39368_1000209 JGI25162J39368_100020952 230
998 3300002738 JGI25154J39366_1000011 JGI25154J39366_1000011127 230
999 3300002741 JGI25157J39369_1000030 JGI25157J39369_100003058 230
1000 3300002773 JGI25152J39213_1004094 JGI25152J39213_10040942 230
1001 3300002987 JGI25159J45721_1000850 JGI25159J45721_10008508 230
1002 3300003187 JGI25151J46595_10010555 JGI25151J46595_100105555 230
1003 3300003214 JGI25165J46597_1000302 JGI25165J46597_100030252 230
1004 3300003214 JGI25165J46597_1005338 JGI25165J46597_10053381 230
1005 3300003316 rootH1_10056988 rootH1_100569884 230
1006 3300003323 rootH1_10000039 rootH1_100000393 230
1007 3300003323 rootH1_10014639 rootH1_100146397 230
1008 3300003771 Ga0055526_1020423 Ga0055526_10204232 230
1009 3300003775 Ga0055524_1002043 Ga0055524_100204311 230
1010 3300003790 Ga0055528_1000057 Ga0055528_100005737 230
1011 3300005548 Ga0070665_100101125 Ga0070665_1001011252 230
1012 3300005563 Ga0068855_100111994 Ga0068855_1001119942 230
1013 3300005614 Ga0068856_100087574 Ga0068856_1000875745 230
1014 3300005614 Ga0068856_100563960 Ga0068856_1005639602 230
1015 3300005937 Ga0081455_10339856 Ga0081455_103398561 230
1016 3300006846 Ga0075430_100101154 Ga0075430_1001011542 230
1017 3300006847 Ga0075431_100002790 Ga0075431_10000279012 230
1018 3300006880 Ga0075429_100077198 Ga0075429_1000771982 230
1019 3300009093 Ga0105240_10000005 Ga0105240_10000005663 230
1020 3300009176 Ga0105242_10721601 Ga0105242_107216011 230
1021 3300009545 Ga0105237_10003410 Ga0105237_1000341012 230
1022 3300010375 Ga0105239_10010354 Ga0105239_100103546 230
1023 3300013100 Ga0157373_10071569 Ga0157373_100715694 230
1024 3300013104 Ga0157370_10000046 Ga0157370_10000046113 230
1025 3300013105 Ga0157369_10151748 Ga0157369_101517482 230
1026 3300013105 Ga0157369_10860805 Ga0157369_108608051 230
1027 3300014497 Ga0182008_10038739 Ga0182008_100387391 230
1028 3300015262 Ga0182007_10001276 Ga0182007_1000127610 230
1029 3300015265 Ga0182005_1000769 Ga0182005_10007695 230
1030 3300025206 Ga0209435_100012 Ga0209435_100012126 230
1031 3300025228 Ga0209672_102907 Ga0209672_1029074 230
1032 3300025233 Ga0209437_100047 Ga0209437_100047165 230
1033 3300025246 Ga0209646_1000026 Ga0209646_1000026126 230
1034 3300025246 Ga0209646_1004877 Ga0209646_10048772 230
1035 3300025250 Ga0209026_1000014 Ga0209026_1000014126 230
1036 3300025253 Ga0209677_100511 Ga0209677_10051119 230
1037 3300025256 Ga0209759_1000012 Ga0209759_1000012126 230
1038 3300025258 Ga0209129_1000069 Ga0209129_100006971 230
1039 3300025261 Ga0209233_1000048 Ga0209233_1000048237 230
1040 3300025261 Ga0209233_1000195 Ga0209233_100019581 230
1041 3300025272 Ga0209455_1016427 Ga0209455_10164273 230
1042 3300025273 Ga0209673_1000048 Ga0209673_1000048242 230
1043 3300025294 Ga0209025_1001567 Ga0209025_100156727 230
1044 3300025295 Ga0209564_1008716 Ga0209564_10087165 230
1045 3300025299 Ga0209256_1000686 Ga0209256_100068625 230
1046 3300025913 Ga0207695_10000011 Ga0207695_10000011254 230
1047 3300025914 Ga0207671_10000241 Ga0207671_1000024163 230
1048 3300025949 Ga0207667_10060118 Ga0207667_100601185 230
1049 3300026078 Ga0207702_10510431 Ga0207702_105104312 230
1050 3300027312 Ga0209371_1012308 Ga0209371_10123084 230
1051 3300028379 Ga0268266_10168384 Ga0268266_101683844 230
1052 3300030500 Ga0268256_1009224 Ga0268256_10092244 230
1053 3300041997 Ga0439431_0046127 Ga0439431_0046127_126_818 230
1054 3300044684 Ga0466966_0084707 Ga0466966_0084707_1152_1844 230
1055 3300044694 Ga0466963_0089855 Ga0466963_0089855_1060_1752 230
1056 3300044765 Ga0466970_0007785 Ga0466970_0007785_4343_5035 230
1057 3300044842 Ga0466957_0123559 Ga0466957_0123559_613_1305 230
1058 3300045836 Ga0466958_0081532 Ga0466958_0081532_955_1647 230
1059 3300045976 Ga0466967_0482885 Ga0466967_0482885_276_968 230
1060 3300045976 Ga0466967_0755453 Ga0466967_0755453_49_741 230
1061 3300046453 Ga0495627_042027 Ga0495627_042027_141_833 230
1062 3300046460 Ga0495638_0000453 Ga0495638_0000453_26765_27457 230
1063 3300046492 Ga0495585_0013763 Ga0495585_0013763_599_1291 230
1064 3300046501 Ga0495607_0091848 Ga0495607_0091848_407_1099 230
1065 3300046512 Ga0495610_0173281 Ga0495610_0173281_92_784 230
1066 3300046513 Ga0495616_0002859 Ga0495616_0002859_3594_4286 230
1067 3300046515 Ga0495620_0025347 Ga0495620_0025347_1780_2472 230
1068 3300046518 Ga0495631_0001721 Ga0495631_0001721_1784_2476 230
1069 3300046520 Ga0495637_0073832 Ga0495637_0073832_462_1154 230
1070 3300046530 Ga0495654_0054148 Ga0495654_0054148_50_742 230
1071 3300046538 Ga0495609_0028390 Ga0495609_0028390_99_791 230
1072 3300046538 Ga0495609_0069556 Ga0495609_0069556_314_1006 230
1073 3300046557 Ga0495622_0110049 Ga0495622_0110049_157_849 230
1074 3300046558 Ga0495633_0134223 Ga0495633_0134223_255_947 230
1075 3300046616 Ga0495668_0005544 Ga0495668_0005544_6420_7112 230
1076 3300046648 Ga0495611_0023006 Ga0495611_0023006_110_802 230
1077 3300046660 Ga0495625_0003247 Ga0495625_0003247_1496_2188 230
1078 3300046660 Ga0495625_0128848 Ga0495625_0128848_369_1061 230
1079 3300046674 Ga0495588_0154440 Ga0495588_0154440_225_917 230
1080 3300046691 Ga0495670_0011533 Ga0495670_0011533_3470_4162 230
1081 3300046810 Ga0495660_0049320 Ga0495660_0049320_1021_1713 230
1082 3300047318 Ga0495636_0022196 Ga0495636_0022196_494_1186 230
1083 3300047323 Ga0495683_0081209 Ga0495683_0081209_164_856 230
1084 3300047443 Ga0495687_064456 Ga0495687_064456_108_800 230
1085 3300047470 Ga0495681_0096001 Ga0495681_0096001_336_1028 230
1086 3300047472 Ga0495686_0001704 Ga0495686_0001704_3105_3803 230
1087 3300048903 Ga0496100_0033923 Ga0496100_0033923_1893_2585 230
1088 3300048905 Ga0496102_0013120 Ga0496102_0013120_2039_2731 230
1089 3300048906 Ga0496103_0006159 Ga0496103_0006159_2095_2787 230
1090 3300048909 Ga0496106_0173311 Ga0496106_0173311_72_764 230
1091 3300048919 Ga0496116_0013559 Ga0496116_0013559_639_1331 230
1092 3300048920 Ga0496117_0000353 Ga0496117_0000353_57459_58151 230
1093 3300048921 Ga0496118_0000204 Ga0496118_0000204_82811_83503 230
1094 3300048922 Ga0496119_0001824 Ga0496119_0001824_3845_4537 230
1095 3300048922 Ga0496119_0028814 Ga0496119_0028814_1960_2652 230
1096 3300048923 Ga0496120_0014057 Ga0496120_0014057_3845_4537 230
1097 3300048924 Ga0496121_0000378 Ga0496121_0000378_31799_32491 230
1098 3300048924 Ga0496121_0061858 Ga0496121_0061858_2281_2973 230
1099 3300048925 Ga0496122_0005725 Ga0496122_0005725_2377_3069 230
1100 3300048925 Ga0496122_0012966 Ga0496122_0012966_3763_4455 230
1101 3300048925 Ga0496122_0017662 Ga0496122_0017662_4717_5409 230
1102 3300048926 Ga0496123_0012909 Ga0496123_0012909_4402_5094 230
1103 3300048926 Ga0496123_0284404 Ga0496123_0284404_95_787 230
1104 3300048927 Ga0496124_0008097 Ga0496124_0008097_4451_5143 230
1105 3300048927 Ga0496124_0024270 Ga0496124_0024270_3092_3784 230
1106 3300048928 Ga0496125_0065545 Ga0496125_0065545_1825_2517 230
1107 3300048929 Ga0496126_0304499 Ga0496126_0304499_207_899 230
1108 3300048929 Ga0496126_0304516 Ga0496126_0304516_207_899 230
1109 3300049459 Ga0495678_021556 Ga0495678_021556_232_924 230
1110 3300049571 Ga0501034_0053807 Ga0501034_0053807_518_1210 230
1111 3300049572 Ga0501036_0598588 Ga0501036_0598588_44_736 230
1112 3300049573 Ga0501037_0057296 Ga0501037_0057296_398_1090 230
1113 3300049581 Ga0501047_0137941 Ga0501047_0137941_791_1483 230
1114 3300050508 nmdc:mga09592_130829_c1 nmdc:mga09592_130829_c1_240_935 230
1115 3300050509 nmdc:mga0qj67_78025_c1 nmdc:mga0qj67_78025_c1_1119_1814 230
1116 3300050510 nmdc:mga06r32_10264_c1 nmdc:mga06r32_10264_c1_6230_6925 230
1117 3300053079 Ga0500610_0082906 Ga0500610_0082906_396_1088 230
1118 3300053104 Ga0500556_0167757 Ga0500556_0167757_137_829 230
1119 3300053105 Ga0500557_004267 Ga0500557_004267_1801_2493 230
1120 3300053109 Ga0500569_009164 Ga0500569_009164_472_1164 230
1121 3300053118 Ga0500594_0002903 Ga0500594_0002903_142_834 230
1122 3300053125 Ga0500618_003612 Ga0500618_003612_2798_3490 230
1123 3300053125 Ga0500618_037788 Ga0500618_037788_176_868 230
1124 3300053139 Ga0500568_0004659 Ga0500568_0004659_3685_4377 230
1125 3300053140 Ga0500573_0236031 Ga0500573_0236031_166_858 230
1126 3300053153 Ga0500616_0006022 Ga0500616_0006022_5046_5738 230
1127 3300053158 Ga0500627_0025221 Ga0500627_0025221_1268_1960 230
1128 3300053161 Ga0500634_0138940 Ga0500634_0138940_347_1039 230
1129 3300053177 Ga0500636_0105451 Ga0500636_0105451_219_911 230
1130 3300053730 Ga0500645_032366 Ga0500645_032366_40_732 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

170

241

0.94

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

54

130

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

58

136

0.91

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

64

130

0.88

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

155

246

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4glt-assembly2.cif.gz_C crystal structure of glutathione s-transferase mfla_2116 (target efi-507160) from methylobacillus flagellatus kt with gsh bound 0.9237 3 202
3zmk-assembly1.cif.gz_A anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa 0.9145 3 202
3tou-assembly1.cif.gz_B crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound 0.9115 3 202
4ecj-assembly1.cif.gz_B crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione 0.9105 2 202
6v91-assembly1.cif.gz_B crystal structure of stringent starvation protein a (bth_i2974) from burkholderia thailandensis 0.9054 3 202
ID Description Score Start End Superfamily
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.943 3 87 3.40.30.10
af_A0A0R0GW40_137_220_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9353 1 79 3.40.30.10
af_Q9H4Y5_21_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9317 2 77 3.40.30.10
1v2aB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.931 4 79 3.40.30.10
3q19A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9232 2 85 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2E1EC21-F1-model_v4 Glutathione S-transferase 0.988 1 215 GO:0016740
AF-A0A852RSS1-F1-model_v4 deleted 0.9878 1 224
AF-A0A534YW12-F1-model_v4 Glutathione S-transferase family protein 0.9856 4 214 GO:0016740
AF-A0A249NU33-F1-model_v4 Putative glutathione S-transferase-like protein 0.9822 1 223 GO:0016740
AF-A0A530A173-F1-model_v4 deleted 0.982 1 108

Feature Viewer

pLDDT pTM Quality
95.41 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map