F490531

General Info

Members Datasets Scaffolds Average Seq Length
1130 419 2260 78

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100066880|Ga0070686_1000668804
Length 86
Sequence LRAPGAGCVSAYLDPCDKCEEVMQPYLDRALDEGERAEAEAHLADCGYCRKRYRFEESLRVFVRQVCAEEMPPELKQKLAALRTPL

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
195 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
196 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
197 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
198 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
199 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
202 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
207 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
208 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
227 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
228 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
229 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
230 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
233 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
234 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
235 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
244 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
262 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
263 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
264 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
265 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
266 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
267 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
268 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
269 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
270 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
271 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
272 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
273 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
274 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
275 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
276 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
277 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
278 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
279 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
280 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
283 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
284 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
285 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
288 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
289 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
290 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
291 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
296 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
297 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
301 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
302 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
303 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
304 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
305 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
306 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
307 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
308 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
309 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
310 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
311 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
312 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
315 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
316 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
317 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
321 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
322 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
323 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
324 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
325 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
326 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
327 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
328 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
329 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
330 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
331 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
332 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
333 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
334 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
335 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
339 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
340 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
341 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
347 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
348 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
349 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
350 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
351 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
352 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
353 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
356 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
357 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
358 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
359 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
360 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
361 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
362 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
363 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
364 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
365 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
366 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
367 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
368 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
382 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
383 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
384 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
385 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
386 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
387 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
388 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
389 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
390 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
391 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
392 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
393 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
394 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
395 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
396 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
397 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
398 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
399 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
400 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
401 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
402 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
403 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
404 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
405 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
406 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
407 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
408 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
409 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
410 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
411 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
412 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
413 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
414 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
415 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
418 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
419 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 2.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 11.06
Rhizosphere 88.5
Stem 0
Stem Tuber 0
Unclassified 13.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100066880 3300005544 Unclassified 2339
2 JGI25406J46586_10119438 3300003203 Bacteria 776
3 Ga0058861_12077871 3300004800 Bacteria 898
4 Ga0058862_10037025 3300004803 Bacteria 964
5 Ga0058862_12790353 3300004803 Bacteria 840
6 Ga0070658_10074452 3300005327 Bacteria 2785
7 Ga0070658_10319182 3300005327 Bacteria 1326
8 Ga0070658_11210014 3300005327 Bacteria 657
9 Ga0070683_100000868 3300005329 Bacteria 22387
10 Ga0070683_100040644 3300005329 Bacteria 4276
11 Ga0070683_100145369 3300005329 Bacteria 2247
12 Ga0070683_100246273 3300005329 Bacteria 1700
13 Ga0070683_100534364 3300005329 Bacteria 1121
14 Ga0070683_101090155 3300005329 Bacteria 767
15 Ga0070683_101300780 3300005329 Bacteria 699
16 Ga0070690_100313134 3300005330 Bacteria 1129
17 Ga0070690_100341220 3300005330 Unclassified 1085
18 Ga0070677_10288818 3300005333 Bacteria 829
19 Ga0068869_100719515 3300005334 Bacteria 853
20 Ga0068869_101594688 3300005334 Bacteria 581
21 Ga0070680_100028977 3300005336 Bacteria 4444
22 Ga0070680_100082461 3300005336 Bacteria 2654
23 Ga0070680_100102501 3300005336 Bacteria 2377
24 Ga0070680_100124163 3300005336 Bacteria 2156
25 Ga0070680_100962909 3300005336 Bacteria 737
26 Ga0070682_100015362 3300005337 Bacteria 4434
27 Ga0070682_100094764 3300005337 Bacteria 1959
28 Ga0070682_100516341 3300005337 Bacteria 928
29 Ga0068868_101353759 3300005338 Bacteria 663
30 Ga0068868_101591313 3300005338 Bacteria 614
31 Ga0070660_100003046 3300005339 Bacteria 11532
32 Ga0070660_100034719 3300005339 Unclassified 3812
33 Ga0070660_100040413 3300005339 Bacteria 3550
34 Ga0070660_100069382 3300005339 Bacteria 2749
35 Ga0070660_100122214 3300005339 Bacteria 2078
36 Ga0070660_100247724 3300005339 Bacteria 1452
37 Ga0070660_100311067 3300005339 Bacteria 1293
38 Ga0070660_100379554 3300005339 Bacteria 1167
39 Ga0070691_10023507 3300005341 Bacteria 2862
40 Ga0070691_10050196 3300005341 Bacteria 1990
41 Ga0070687_100876283 3300005343 Unclassified 642
42 Ga0070661_100026212 3300005344 Bacteria 4190
43 Ga0070661_100093483 3300005344 Bacteria 2228
44 Ga0070661_101115187 3300005344 Bacteria 658
45 Ga0070692_10095426 3300005345 Bacteria 1623
46 Ga0070692_10196104 3300005345 Bacteria 1180
47 Ga0070668_100429693 3300005347 Bacteria 1132
48 Ga0070668_100434705 3300005347 Bacteria 1126
49 Ga0070669_100525889 3300005353 Bacteria 984
50 Ga0070669_101574308 3300005353 Bacteria 572
51 Ga0070675_100126955 3300005354 Unclassified 2171
52 Ga0070675_100734991 3300005354 Bacteria 900
53 Ga0070675_100863166 3300005354 Bacteria 829
54 Ga0070671_100305329 3300005355 Bacteria 1355
55 Ga0070671_100675377 3300005355 Bacteria 895
56 Ga0070674_100040566 3300005356 Unclassified 3150
57 Ga0070674_100170077 3300005356 Bacteria 1661
58 Ga0070674_100175008 3300005356 Bacteria 1639
59 Ga0070674_100986046 3300005356 Bacteria 739
60 Ga0070673_100971050 3300005364 Bacteria 790
61 Ga0070688_100280113 3300005365 Bacteria 1198
62 Ga0070659_100190088 3300005366 Bacteria 1687
63 Ga0070659_100298135 3300005366 Bacteria 1344
64 Ga0070659_100335846 3300005366 Bacteria 1265
65 Ga0070659_101872474 3300005366 Bacteria 538
66 Ga0070667_101230052 3300005367 Bacteria 701
67 Ga0070667_101429923 3300005367 Bacteria 649
68 Ga0070703_10070046 3300005406 Unclassified 1169
69 Ga0070709_10042207 3300005434 Bacteria 2815
70 Ga0070709_10363015 3300005434 Bacteria 1073
71 Ga0070714_100034545 3300005435 Bacteria 4234
72 Ga0070714_100036286 3300005435 Bacteria 4133
73 Ga0070714_100038130 3300005435 Bacteria 4041
74 Ga0070714_100095306 3300005435 Bacteria 2613
75 Ga0070714_101004778 3300005435 Unclassified 812
76 Ga0070714_102100303 3300005435 Bacteria 550
77 Ga0070714_102142229 3300005435 Bacteria 545
78 Ga0070713_100013333 3300005436 Bacteria 6066
79 Ga0070713_100054867 3300005436 Bacteria 3308
80 Ga0070713_100072102 3300005436 Bacteria 2921
81 Ga0070713_101406229 3300005436 Bacteria 677
82 Ga0070713_102488164 3300005436 Unclassified 500
83 Ga0070710_10060396 3300005437 Unclassified 2156
84 Ga0070711_100031738 3300005439 Bacteria 3509
85 Ga0070711_100357894 3300005439 Bacteria 1175
86 Ga0070711_100918521 3300005439 Unclassified 748
87 Ga0070711_100966135 3300005439 Bacteria 730
88 Ga0070705_100443351 3300005440 Bacteria 972
89 Ga0070705_100824096 3300005440 Bacteria 740
90 Ga0070705_101874188 3300005440 Bacteria 510
91 Ga0070700_100937075 3300005441 Bacteria 708
92 Ga0070694_100087673 3300005444 Bacteria 2177
93 Ga0070694_100481040 3300005444 Unclassified 985
94 Ga0070694_100670821 3300005444 Bacteria 841
95 Ga0070694_100787655 3300005444 Bacteria 779
96 Ga0070663_101696985 3300005455 Bacteria 565
97 Ga0070678_100665538 3300005456 Bacteria 935
98 Ga0070678_101224066 3300005456 Unclassified 697
99 Ga0070678_101579151 3300005456 Bacteria 616
100 Ga0070678_101599106 3300005456 Bacteria 612
101 Ga0070678_102088662 3300005456 Bacteria 537
102 Ga0070662_100130770 3300005457 Bacteria 1935
103 Ga0070662_100329746 3300005457 Bacteria 1247
104 Ga0070662_100643623 3300005457 Bacteria 894
105 Ga0070681_10017975 3300005458 Bacteria 7066
106 Ga0070681_10032197 3300005458 Bacteria 5262
107 Ga0070681_10032468 3300005458 Bacteria 5240
108 Ga0070681_10158844 3300005458 Bacteria 2185
109 Ga0070681_10281407 3300005458 Bacteria 1574
110 Ga0070681_10325216 3300005458 Bacteria 1447
111 Ga0070681_11641366 3300005458 Bacteria 569
112 Ga0068867_100057577 3300005459 Bacteria 2878
113 Ga0068867_101172992 3300005459 Bacteria 704
114 Ga0068867_101480017 3300005459 Bacteria 632
115 Ga0070685_11267604 3300005466 Unclassified 562
116 Ga0070706_100323158 3300005467 Bacteria 1439
117 Ga0070706_100473032 3300005467 Bacteria 1166
118 Ga0070706_100653673 3300005467 Unclassified 976
119 Ga0070706_101421625 3300005467 Bacteria 635
120 Ga0070707_100065510 3300005468 Bacteria 3490
121 Ga0070707_100398184 3300005468 Bacteria 1337
122 Ga0070698_100155192 3300005471 Unclassified 2235
123 Ga0070698_100172441 3300005471 Unclassified 2104
124 Ga0070698_100459844 3300005471 Bacteria 1208
125 Ga0070699_100377454 3300005518 Archaea 1280
126 Ga0070699_100524773 3300005518 Bacteria 1077
127 Ga0070699_101264833 3300005518 Bacteria 677
128 Ga0070679_100016115 3300005530 Bacteria 7201
129 Ga0070679_100016881 3300005530 Bacteria 7057
130 Ga0070679_100025921 3300005530 Bacteria 5753
131 Ga0070679_100050560 3300005530 Bacteria 4140
132 Ga0070679_100230973 3300005530 Bacteria 1809
133 Ga0070679_100242485 3300005530 Bacteria 1760
134 Ga0070684_100000550 3300005535 Bacteria 25812
135 Ga0070684_100021823 3300005535 Bacteria 5333
136 Ga0070684_100071955 3300005535 Bacteria 3043
137 Ga0070684_100160404 3300005535 Bacteria 2040
138 Ga0070684_100370237 3300005535 Unclassified 1319
139 Ga0070684_100808053 3300005535 Bacteria 877
140 Ga0070684_101882211 3300005535 Bacteria 564
141 Ga0070697_101058008 3300005536 Bacteria 722
142 Ga0068853_100904503 3300005539 Bacteria 848
143 Ga0070672_100630200 3300005543 Bacteria 935
144 Ga0070672_101173047 3300005543 Bacteria 684
145 Ga0070672_101539039 3300005543 Bacteria 596
146 Ga0070686_100033576 3300005544 Bacteria 3154
147 Ga0070695_100321166 3300005545 Bacteria 1151
148 Ga0070695_100581297 3300005545 Bacteria 877
149 Ga0070695_101776680 3300005545 Bacteria 517
150 Ga0070695_101843496 3300005545 Bacteria 508
151 Ga0070695_101884812 3300005545 Unclassified 502
152 Ga0070696_100060907 3300005546 Bacteria 2640
153 Ga0070696_100161700 3300005546 Bacteria 1650
154 Ga0070696_100624874 3300005546 Bacteria 871
155 Ga0070693_100018552 3300005547 Unclassified 3637
156 Ga0070693_100121267 3300005547 Bacteria 1622
157 Ga0070693_100201288 3300005547 Bacteria 1293
158 Ga0070693_100823771 3300005547 Bacteria 690
159 Ga0070665_101571174 3300005548 Bacteria 666
160 Ga0070704_100117866 3300005549 Unclassified 2033
161 Ga0070704_101113387 3300005549 Bacteria 718
162 Ga0070704_101941298 3300005549 Bacteria 546
163 Ga0068855_100103666 3300005563 Bacteria 3272
164 Ga0068855_100161909 3300005563 Bacteria 2539
165 Ga0068855_100341242 3300005563 Bacteria 1652
166 Ga0068855_100541849 3300005563 Bacteria 1261
167 Ga0068855_100588683 3300005563 Bacteria 1201
168 Ga0070664_100111763 3300005564 Unclassified 2385
169 Ga0070664_102009280 3300005564 Bacteria 549
170 Ga0070664_102356546 3300005564 Bacteria 505
171 Ga0068857_100107948 3300005577 Bacteria 2500
172 Ga0068857_100752897 3300005577 Unclassified 928
173 Ga0068857_101874709 3300005577 Unclassified 587
174 Ga0068854_101695639 3300005578 Bacteria 578
175 Ga0068854_101867622 3300005578 Unclassified 552
176 Ga0068856_100081618 3300005614 Bacteria 3208
177 Ga0068856_100143874 3300005614 Unclassified 2392
178 Ga0068856_100200793 3300005614 Bacteria 2008
179 Ga0068856_100216040 3300005614 Bacteria 1933
180 Ga0068856_102652931 3300005614 Bacteria 507
181 Ga0070702_100327798 3300005615 Bacteria 1070
182 Ga0070702_101463242 3300005615 Bacteria 561
183 Ga0068852_100065799 3300005616 Bacteria 3164
184 Ga0068852_100137776 3300005616 Bacteria 2255
185 Ga0068852_100714557 3300005616 Bacteria 1013
186 Ga0068852_100795399 3300005616 Bacteria 960
187 Ga0068852_100801920 3300005616 Bacteria 956
188 Ga0068859_100933765 3300005617 Bacteria 951
189 Ga0068864_100896358 3300005618 Bacteria 876
190 Ga0068866_10032502 3300005718 Bacteria 2524
191 Ga0068861_100103693 3300005719 Bacteria 2267
192 Ga0068861_100689272 3300005719 Bacteria 948
193 Ga0068861_101768114 3300005719 Unclassified 613
194 Ga0068851_10799230 3300005834 Unclassified 586
195 Ga0068870_10113620 3300005840 Bacteria 1550
196 Ga0068863_101306895 3300005841 Unclassified 732
197 Ga0068863_102300870 3300005841 Bacteria 549
198 Ga0068858_100063104 3300005842 Bacteria 3428
199 Ga0068858_100621350 3300005842 Bacteria 1049
200 Ga0068858_101108551 3300005842 Bacteria 777
201 Ga0068860_100660251 3300005843 Bacteria 1054
202 Ga0068862_100168652 3300005844 Bacteria 1959
203 Ga0068862_100622462 3300005844 Bacteria 1038
204 Ga0068862_101363735 3300005844 Bacteria 712
205 Ga0081455_10017634 3300005937 Bacteria 6834
206 Ga0081455_10056348 3300005937 Bacteria 3338
207 Ga0081538_10021393 3300005981 Bacteria 4724
208 Ga0081539_10001603 3300005985 Bacteria 37270
209 Ga0070717_10008104 3300006028 Bacteria 7837
210 Ga0070717_10051688 3300006028 Bacteria 3383
211 Ga0070717_10517701 3300006028 Bacteria 1079
212 Ga0070715_10004504 3300006163 Bacteria 4579
213 Ga0070716_100055187 3300006173 Unclassified 2272
214 Ga0070716_100952352 3300006173 Bacteria 676
215 Ga0070716_100964920 3300006173 Bacteria 672
216 Ga0070712_100036396 3300006175 Bacteria 3349
217 Ga0070712_100273210 3300006175 Bacteria 1359
218 Ga0070712_100595100 3300006175 Unclassified 935
219 Ga0070712_101296426 3300006175 Bacteria 635
220 Ga0070712_101834525 3300006175 Unclassified 531
221 Ga0097621_101467439 3300006237 Bacteria 647
222 Ga0097621_102041837 3300006237 Bacteria 548
223 Ga0068871_100580293 3300006358 Bacteria 1018
224 Ga0068871_101722405 3300006358 Bacteria 594
225 Ga0075428_100521684 3300006844 Unclassified 1271
226 Ga0075433_10392320 3300006852 Bacteria 1225
227 Ga0075434_100542090 3300006871 Unclassified 1183
228 Ga0075434_101314783 3300006871 Bacteria 734
229 Ga0075434_101411972 3300006871 Bacteria 706
230 Ga0075434_101754384 3300006871 Bacteria 628
231 Ga0068865_100150173 3300006881 Bacteria 1767
232 Ga0068865_101030211 3300006881 Bacteria 722
233 Ga0068865_101502140 3300006881 Bacteria 604
234 Ga0075436_100134882 3300006914 Bacteria 1733
235 Ga0075436_100463576 3300006914 Bacteria 924
236 Ga0075436_100830702 3300006914 Unclassified 689
237 Ga0097620_100933814 3300006931 Bacteria 951
238 Ga0075435_100091233 3300007076 Bacteria 2514
239 Ga0075435_100629323 3300007076 Unclassified 931
240 Ga0105240_10217526 3300009093 Bacteria 2228
241 Ga0105240_10617069 3300009093 Bacteria 1192
242 Ga0111539_10652099 3300009094 Bacteria 1226
243 Ga0111539_11068787 3300009094 Bacteria 938
244 Ga0111539_11341228 3300009094 Unclassified 830
245 Ga0105245_10014664 3300009098 Bacteria 6824
246 Ga0105245_10021496 3300009098 Bacteria 5661
247 Ga0105245_10137528 3300009098 Bacteria 2297
248 Ga0105245_10194195 3300009098 Bacteria 1946
249 Ga0105245_10234205 3300009098 Unclassified 1777
250 Ga0105245_10262856 3300009098 Bacteria 1680
251 Ga0105245_10543179 3300009098 Bacteria 1183
252 Ga0105245_11922665 3300009098 Bacteria 645
253 Ga0105247_10124108 3300009101 Bacteria 1676
254 Ga0105247_10939931 3300009101 Bacteria 671
255 Ga0114129_10399143 3300009147 Unclassified 1812
256 Ga0114129_11021377 3300009147 Archaea 1040
257 Ga0114129_11840264 3300009147 Unclassified 735
258 Ga0114129_13116683 3300009147 Bacteria 542
259 Ga0105243_10055503 3300009148 Bacteria 3148
260 Ga0105243_10430756 3300009148 Bacteria 1233
261 Ga0105243_10668143 3300009148 Unclassified 1009
262 Ga0105243_11512132 3300009148 Bacteria 695
263 Ga0105241_10039640 3300009174 Bacteria 3554
264 Ga0105241_11871259 3300009174 Bacteria 587
265 Ga0105241_12604152 3300009174 Bacteria 508
266 Ga0105242_10070241 3300009176 Bacteria 2903
267 Ga0105242_10302770 3300009176 Bacteria 1460
268 Ga0105248_10025022 3300009177 Bacteria 6636
269 Ga0105248_10968780 3300009177 Bacteria 961
270 Ga0105237_10248490 3300009545 Bacteria 1781
271 Ga0105237_10667708 3300009545 Bacteria 1046
272 Ga0105237_11389726 3300009545 Bacteria 708
273 Ga0105237_11550514 3300009545 Bacteria 669
274 Ga0105237_12018137 3300009545 Bacteria 585
275 Ga0105238_10211062 3300009551 Bacteria 1917
276 Ga0105238_10977778 3300009551 Bacteria 867
277 Ga0105238_10980626 3300009551 Bacteria 866
278 Ga0105249_10105886 3300009553 Bacteria 2652
279 Ga0105249_10338557 3300009553 Bacteria 1520
280 Ga0105249_10440570 3300009553 Bacteria 1340
281 Ga0105249_10475406 3300009553 Bacteria 1292
282 Ga0105249_13553755 3300009553 Bacteria 502
283 Ga0105239_10757308 3300010375 Bacteria 1112
284 Ga0105239_11439471 3300010375 Bacteria 796
285 Ga0105239_11531413 3300010375 Bacteria 771
286 Ga0105239_11583995 3300010375 Bacteria 757
287 Ga0105239_12205523 3300010375 Bacteria 640
288 Ga0105246_10156111 3300011119 Bacteria 1733
289 Ga0105246_10188017 3300011119 Bacteria 1596
290 Ga0105246_11386229 3300011119 Unclassified 655
291 Ga0105246_12255889 3300011119 Archaea 531
292 Ga0157373_10125718 3300013100 Bacteria 1803
293 Ga0157373_10516387 3300013100 Bacteria 864
294 Ga0157373_10799889 3300013100 Bacteria 695
295 Ga0157371_10498479 3300013102 Bacteria 899
296 Ga0157371_10776204 3300013102 Bacteria 721
297 Ga0157371_11556247 3300013102 Archaea 517
298 Ga0157370_10050281 3300013104 Bacteria 3984
299 Ga0157370_10904137 3300013104 Bacteria 801
300 Ga0157370_11261183 3300013104 Bacteria 666
301 Ga0157369_10005853 3300013105 Bacteria 14285
302 Ga0157369_10452362 3300013105 Bacteria 1330
303 Ga0157369_10840443 3300013105 Bacteria 943
304 Ga0157369_11485240 3300013105 Unclassified 690
305 Ga0157369_12269038 3300013105 Bacteria 550
306 Ga0157374_10041104 3300013296 Bacteria 4259
307 Ga0157374_10587499 3300013296 Bacteria 1123
308 Ga0157374_10763524 3300013296 Bacteria 982
309 Ga0157374_12666162 3300013296 Bacteria 527
310 Ga0157378_10862901 3300013297 Bacteria 934
311 Ga0157378_11010031 3300013297 Archaea 866
312 Ga0157378_11653463 3300013297 Bacteria 687
313 Ga0163162_10191884 3300013306 Bacteria 2171
314 Ga0163162_12105617 3300013306 Bacteria 647
315 Ga0163162_12331794 3300013306 Bacteria 615
316 Ga0157372_10136121 3300013307 Bacteria 2829
317 Ga0157372_10291480 3300013307 Bacteria 1898
318 Ga0157372_10293503 3300013307 Bacteria 1891
319 Ga0157372_10956392 3300013307 Bacteria 993
320 Ga0157372_12231242 3300013307 Bacteria 629
321 Ga0157372_12458820 3300013307 Bacteria 598
322 Ga0157375_10233236 3300013308 Bacteria 1999
323 Ga0157375_10254470 3300013308 Bacteria 1917
324 Ga0157375_10618297 3300013308 Bacteria 1241
325 Ga0157375_11399629 3300013308 Bacteria 824
326 Ga0157375_13065829 3300013308 Bacteria 558
327 Ga0157375_13152194 3300013308 Bacteria 550
328 Ga0163163_10330626 3300014325 Bacteria 1578
329 Ga0163163_10352363 3300014325 Bacteria 1528
330 Ga0163163_10531821 3300014325 Bacteria 1238
331 Ga0163163_11007265 3300014325 Unclassified 896
332 Ga0163163_11268998 3300014325 Bacteria 799
333 Ga0163163_11822917 3300014325 Bacteria 669
334 Ga0157380_12097626 3300014326 Bacteria 628
335 Ga0157380_12271686 3300014326 Unclassified 607
336 Ga0157380_13094223 3300014326 Unclassified 530
337 Ga0157380_13198963 3300014326 Bacteria 523
338 Ga0157380_13264885 3300014326 Bacteria 518
339 Ga0182008_10041678 3300014497 Bacteria 2290
340 Ga0157377_10067767 3300014745 Bacteria 2055
341 Ga0157377_10098333 3300014745 Bacteria 1739
342 Ga0157377_10198018 3300014745 Bacteria 1274
343 Ga0157377_10330800 3300014745 Bacteria 1016
344 Ga0157377_10886026 3300014745 Unclassified 666
345 Ga0157379_10074183 3300014968 Bacteria 3046
346 Ga0157379_10741123 3300014968 Bacteria 924
347 Ga0157379_11013963 3300014968 Bacteria 792
348 Ga0157376_10262856 3300014969 Bacteria 1618
349 Ga0157376_11205881 3300014969 Bacteria 785
350 Ga0182006_1035178 3300015261 Bacteria 1999
351 Ga0182007_10133703 3300015262 Bacteria 836
352 Ga0163161_10468077 3300017792 Bacteria 1021
353 Ga0197907_11003049 3300020069 Bacteria 1061
354 Ga0197907_11235624 3300020069 Bacteria 1110
355 Ga0206356_10267656 3300020070 Bacteria 4257
356 Ga0206356_10577645 3300020070 Bacteria 572
357 Ga0206356_11557596 3300020070 Bacteria 2060
358 Ga0206356_11815991 3300020070 Bacteria 1308
359 Ga0206349_1860178 3300020075 Bacteria 1336
360 Ga0206355_1445200 3300020076 Bacteria 562
361 Ga0206355_1476787 3300020076 Bacteria 632
362 Ga0206350_10344085 3300020080 Unclassified 594
363 Ga0206354_10813093 3300020081 Bacteria 595
364 Ga0206354_11640104 3300020081 Bacteria 1562
365 Ga0206353_10584395 3300020082 Bacteria 1637
366 Ga0206353_10669531 3300020082 Unclassified 644
367 Ga0206353_11931564 3300020082 Bacteria 1434
368 Ga0154015_1469048 3300020610 Bacteria 786
369 Ga0154015_1585765 3300020610 Bacteria 586
370 Ga0213871_10002417 3300021441 Bacteria 3429
371 Ga0224712_10004092 3300022467 Bacteria 3893
372 Ga0224712_10016945 3300022467 Bacteria 2406
373 Ga0224712_10142166 3300022467 Unclassified 1057
374 Ga0207653_10335147 3300025885 Bacteria 590
375 Ga0207692_10029445 3300025898 Bacteria 2610
376 Ga0207692_10479299 3300025898 Unclassified 787
377 Ga0207692_10512250 3300025898 Unclassified 763
378 Ga0207642_10014509 3300025899 Bacteria 2909
379 Ga0207642_10722093 3300025899 Bacteria 629
380 Ga0207710_10064493 3300025900 Bacteria 1668
381 Ga0207688_10085578 3300025901 Bacteria 1805
382 Ga0207688_10465411 3300025901 Bacteria 789
383 Ga0207647_10125607 3300025904 Bacteria 1510
384 Ga0207685_10079708 3300025905 Unclassified 1352
385 Ga0207699_10007837 3300025906 Bacteria 5235
386 Ga0207699_10152906 3300025906 Unclassified 1529
387 Ga0207645_10247029 3300025907 Bacteria 1180
388 Ga0207643_10146690 3300025908 Bacteria 1412
389 Ga0207705_10009942 3300025909 Bacteria 6926
390 Ga0207705_10046097 3300025909 Bacteria 3132
391 Ga0207705_10186512 3300025909 Bacteria 1567
392 Ga0207705_10194289 3300025909 Bacteria 1536
393 Ga0207705_11464251 3300025909 Bacteria 518
394 Ga0207684_10051716 3300025910 Bacteria 3486
395 Ga0207684_10170037 3300025910 Bacteria 1879
396 Ga0207684_11451714 3300025910 Unclassified 560
397 Ga0207684_11456788 3300025910 Bacteria 559
398 Ga0207654_10216092 3300025911 Bacteria 1269
399 Ga0207654_10430014 3300025911 Bacteria 923
400 Ga0207707_10017739 3300025912 Bacteria 6209
401 Ga0207707_10040778 3300025912 Bacteria 4054
402 Ga0207707_10168432 3300025912 Bacteria 1914
403 Ga0207707_10255601 3300025912 Bacteria 1521
404 Ga0207707_10297668 3300025912 Bacteria 1395
405 Ga0207707_10486548 3300025912 Bacteria 1054
406 Ga0207707_11317681 3300025912 Bacteria 579
407 Ga0207707_11540361 3300025912 Unclassified 525
408 Ga0207695_10097570 3300025913 Bacteria 2940
409 Ga0207695_10651889 3300025913 Bacteria 934
410 Ga0207695_11233852 3300025913 Unclassified 628
411 Ga0207671_10804682 3300025914 Bacteria 745
412 Ga0207671_10804844 3300025914 Bacteria 745
413 Ga0207693_10045089 3300025915 Bacteria 3465
414 Ga0207693_10901245 3300025915 Bacteria 678
415 Ga0207693_11062808 3300025915 Bacteria 616
416 Ga0207663_10002700 3300025916 Bacteria 8557
417 Ga0207663_10404169 3300025916 Bacteria 1045
418 Ga0207660_10060438 3300025917 Bacteria 2724
419 Ga0207660_10077844 3300025917 Bacteria 2429
420 Ga0207660_10138895 3300025917 Bacteria 1856
421 Ga0207660_10368643 3300025917 Bacteria 1153
422 Ga0207660_10377260 3300025917 Bacteria 1139
423 Ga0207660_10716727 3300025917 Bacteria 816
424 Ga0207662_10021294 3300025918 Bacteria 3705
425 Ga0207657_10002847 3300025919 Bacteria 18595
426 Ga0207657_10006585 3300025919 Bacteria 12032
427 Ga0207657_10006650 3300025919 Bacteria 11964
428 Ga0207657_10067084 3300025919 Bacteria 3052
429 Ga0207657_10084751 3300025919 Bacteria 2655
430 Ga0207657_10207008 3300025919 Bacteria 1576
431 Ga0207657_10305683 3300025919 Bacteria 1259
432 Ga0207657_11216246 3300025919 Bacteria 572
433 Ga0207649_10243340 3300025920 Bacteria 1292
434 Ga0207649_10354871 3300025920 Bacteria 1086
435 Ga0207649_11023326 3300025920 Unclassified 650
436 Ga0207649_11558581 3300025920 Bacteria 523
437 Ga0207652_10027919 3300025921 Bacteria 4707
438 Ga0207652_10029233 3300025921 Bacteria 4605
439 Ga0207652_10034477 3300025921 Bacteria 4266
440 Ga0207652_10041618 3300025921 Bacteria 3907
441 Ga0207652_10189917 3300025921 Bacteria 1848
442 Ga0207652_10253357 3300025921 Bacteria 1587
443 Ga0207652_10832166 3300025921 Bacteria 818
444 Ga0207652_11072071 3300025921 Bacteria 706
445 Ga0207652_11261140 3300025921 Bacteria 641
446 Ga0207646_10054364 3300025922 Bacteria 3582
447 Ga0207646_10072696 3300025922 Bacteria 3072
448 Ga0207646_10455800 3300025922 Bacteria 1154
449 Ga0207646_10596095 3300025922 Bacteria 992
450 Ga0207681_10462177 3300025923 Bacteria 1034
451 Ga0207694_10144531 3300025924 Bacteria 1914
452 Ga0207694_10583569 3300025924 Bacteria 940
453 Ga0207650_11646138 3300025925 Bacteria 544
454 Ga0207659_10432310 3300025926 Bacteria 1106
455 Ga0207659_11005506 3300025926 Bacteria 717
456 Ga0207687_10012897 3300025927 Bacteria 5462
457 Ga0207687_10032610 3300025927 Bacteria 3528
458 Ga0207687_10154421 3300025927 Bacteria 1755
459 Ga0207687_10322853 3300025927 Bacteria 1250
460 Ga0207687_10435359 3300025927 Bacteria 1085
461 Ga0207687_10840248 3300025927 Bacteria 784
462 Ga0207687_10891578 3300025927 Unclassified 761
463 Ga0207700_10016444 3300025928 Bacteria 4915
464 Ga0207700_10304022 3300025928 Bacteria 1378
465 Ga0207700_10508834 3300025928 Unclassified 1066
466 Ga0207700_11116524 3300025928 Bacteria 705
467 Ga0207664_10017486 3300025929 Bacteria 5258
468 Ga0207664_10022929 3300025929 Bacteria 4670
469 Ga0207664_10033418 3300025929 Bacteria 3951
470 Ga0207664_10081648 3300025929 Bacteria 2631
471 Ga0207664_10128921 3300025929 Bacteria 2127
472 Ga0207664_10178797 3300025929 Unclassified 1820
473 Ga0207664_10820123 3300025929 Unclassified 837
474 Ga0207664_11678095 3300025929 Bacteria 558
475 Ga0207664_11806507 3300025929 Bacteria 534
476 Ga0207644_10138772 3300025931 Bacteria 1870
477 Ga0207644_10473147 3300025931 Bacteria 1031
478 Ga0207644_11005189 3300025931 Unclassified 700
479 Ga0207690_10465779 3300025932 Bacteria 1018
480 Ga0207690_10699821 3300025932 Bacteria 833
481 Ga0207690_11128864 3300025932 Unclassified 654
482 Ga0207690_11203703 3300025932 Bacteria 632
483 Ga0207690_11262684 3300025932 Unclassified 617
484 Ga0207706_10112274 3300025933 Bacteria 2398
485 Ga0207706_10490682 3300025933 Bacteria 1061
486 Ga0207706_10570963 3300025933 Bacteria 973
487 Ga0207706_11327520 3300025933 Bacteria 593
488 Ga0207686_10027322 3300025934 Bacteria 3341
489 Ga0207686_10185373 3300025934 Bacteria 1479
490 Ga0207709_10026392 3300025935 Bacteria 3336
491 Ga0207709_10609662 3300025935 Bacteria 865
492 Ga0207669_10144446 3300025937 Bacteria 1657
493 Ga0207669_10432598 3300025937 Unclassified 1038
494 Ga0207669_11099164 3300025937 Bacteria 671
495 Ga0207704_10259951 3300025938 Bacteria 1308
496 Ga0207665_10002480 3300025939 Bacteria 12442
497 Ga0207665_10040336 3300025939 Bacteria 3114
498 Ga0207691_11008129 3300025940 Bacteria 695
499 Ga0207691_11025530 3300025940 Bacteria 688
500 Ga0207711_10986529 3300025941 Unclassified 782
501 Ga0207711_11202080 3300025941 Bacteria 700
502 Ga0207689_10525776 3300025942 Bacteria 992
503 Ga0207689_10717858 3300025942 Bacteria 843
504 Ga0207661_10018170 3300025944 Bacteria 5224
505 Ga0207661_10049001 3300025944 Bacteria 3360
506 Ga0207661_10131724 3300025944 Bacteria 2142
507 Ga0207661_10228188 3300025944 Bacteria 1648
508 Ga0207661_10759907 3300025944 Unclassified 892
509 Ga0207661_11191541 3300025944 Unclassified 701
510 Ga0207661_11192909 3300025944 Bacteria 700
511 Ga0207679_10053927 3300025945 Bacteria 2957
512 Ga0207679_11481832 3300025945 Unclassified 622
513 Ga0207667_10743563 3300025949 Bacteria 980
514 Ga0207667_10909665 3300025949 Bacteria 871
515 Ga0207667_10958254 3300025949 Unclassified 845
516 Ga0207712_10063875 3300025961 Bacteria 2622
517 Ga0207712_10085150 3300025961 Bacteria 2312
518 Ga0207712_10090041 3300025961 Bacteria 2257
519 Ga0207712_10314741 3300025961 Bacteria 1289
520 Ga0207668_10418927 3300025972 Bacteria 1136
521 Ga0207668_11194671 3300025972 Bacteria 683
522 Ga0207640_10432491 3300025981 Bacteria 1080
523 Ga0207640_10746593 3300025981 Bacteria 843
524 Ga0207640_11899758 3300025981 Unclassified 539
525 Ga0207677_10116763 3300026023 Bacteria 1999
526 Ga0207677_10694747 3300026023 Bacteria 902
527 Ga0207677_11154253 3300026023 Bacteria 708
528 Ga0207703_10979135 3300026035 Unclassified 811
529 Ga0207678_10066743 3300026067 Unclassified 3088
530 Ga0207678_10163639 3300026067 Bacteria 1900
531 Ga0207678_10418463 3300026067 Bacteria 1162
532 Ga0207678_11644659 3300026067 Unclassified 565
533 Ga0207708_10004691 3300026075 Bacteria 10054
534 Ga0207708_11207279 3300026075 Bacteria 661
535 Ga0207708_11569577 3300026075 Bacteria 578
536 Ga0207702_10137672 3300026078 Unclassified 2205
537 Ga0207702_10526304 3300026078 Bacteria 1154
538 Ga0207702_10540184 3300026078 Bacteria 1139
539 Ga0207702_10890913 3300026078 Bacteria 881
540 Ga0207702_12209432 3300026078 Unclassified 539
541 Ga0207641_10737514 3300026088 Bacteria 972
542 Ga0207641_12219937 3300026088 Bacteria 549
543 Ga0207648_10020890 3300026089 Bacteria 5895
544 Ga0207648_10530173 3300026089 Bacteria 1080
545 Ga0207648_10885594 3300026089 Bacteria 833
546 Ga0207674_10063055 3300026116 Bacteria 3742
547 Ga0207674_12068328 3300026116 Unclassified 534
548 Ga0207674_12083305 3300026116 Bacteria 531
549 Ga0207675_100017398 3300026118 Bacteria 6710
550 Ga0207675_100293238 3300026118 Bacteria 1583
551 Ga0207675_100883619 3300026118 Bacteria 909
552 Ga0207675_101315903 3300026118 Bacteria 743
553 Ga0207683_10279417 3300026121 Bacteria 1526
554 Ga0207683_10447165 3300026121 Bacteria 1191
555 Ga0207683_10806431 3300026121 Bacteria 871
556 Ga0207698_10104318 3300026142 Unclassified 2358
557 Ga0207698_10126397 3300026142 Bacteria 2175
558 Ga0207698_10162402 3300026142 Bacteria 1956
559 Ga0207698_11754066 3300026142 Bacteria 636
560 Ga0207698_11770053 3300026142 Bacteria 633
561 Ga0207698_12166051 3300026142 Unclassified 569
562 Ga0209966_1040336 3300027695 Bacteria 971
563 Ga0268266_11514632 3300028379 Bacteria 646
564 Ga0268266_11975673 3300028379 Bacteria 557
565 Ga0268265_10107935 3300028380 Bacteria 2265
566 Ga0268265_10386150 3300028380 Bacteria 1290
567 Ga0268264_10504599 3300028381 Bacteria 1180
568 Ga0265337_1033629 3300028556 Bacteria 1512
569 Ga0265337_1114612 3300028556 Bacteria 731
570 Ga0265326_10045479 3300028558 Bacteria 1245
571 Ga0265319_1002177 3300028563 Bacteria 10916
572 Ga0265334_10039417 3300028573 Bacteria 1854
573 Ga0265318_10006074 3300028577 Bacteria 5597
574 Ga0265318_10130749 3300028577 Bacteria 923
575 Ga0265322_10012994 3300028654 Bacteria 2410
576 Ga0265322_10070747 3300028654 Bacteria 990
577 Ga0265338_10011194 3300028800 Bacteria 10397
578 Ga0265338_10082600 3300028800 Bacteria 2689
579 Ga0265324_10061275 3300029957 Bacteria 1286
580 Ga0265330_10143920 3300031235 Bacteria 1013
581 Ga0265328_10148088 3300031239 Bacteria 883
582 Ga0265328_10199204 3300031239 Bacteria 760
583 Ga0265320_10016472 3300031240 Bacteria 4140
584 Ga0265320_10250243 3300031240 Unclassified 786
585 Ga0265320_10472094 3300031240 Bacteria 554
586 Ga0265325_10105746 3300031241 Bacteria 1373
587 Ga0265325_10119360 3300031241 Bacteria 1273
588 Ga0265329_10023651 3300031242 Bacteria 2045
589 Ga0265340_10063196 3300031247 Bacteria 1767
590 Ga0265339_10028523 3300031249 Bacteria 3173
591 Ga0265331_10090744 3300031250 Bacteria 1412
592 Ga0265327_10011377 3300031251 Bacteria 6133
593 Ga0265327_10026939 3300031251 Bacteria 3318
594 Ga0265327_10123636 3300031251 Bacteria 1224
595 Ga0265316_10018516 3300031344 Bacteria 5980
596 Ga0265316_10045508 3300031344 Bacteria 3482
597 Ga0307408_100027257 3300031548 Bacteria 3935
598 Ga0307408_100937474 3300031548 Unclassified 794
599 Ga0265313_10054583 3300031595 Unclassified 1897
600 Ga0265313_10060798 3300031595 Bacteria 1770
601 Ga0265314_10009672 3300031711 Bacteria 8117
602 Ga0265314_10038259 3300031711 Bacteria 3468
603 Ga0265342_10009927 3300031712 Bacteria 6656
604 Ga0265342_10213930 3300031712 Bacteria 1041
605 Ga0265342_10383401 3300031712 Bacteria 728
606 Ga0307405_10101774 3300031731 Unclassified 1928
607 Ga0307405_10384877 3300031731 Unclassified 1093
608 Ga0307413_10390205 3300031824 Unclassified 1087
609 Ga0307410_10011770 3300031852 Bacteria 5022
610 Ga0307410_10528024 3300031852 Bacteria 975
611 Ga0307406_10060794 3300031901 Bacteria 2437
612 Ga0307407_10000662 3300031903 Bacteria 11078
613 Ga0307412_10247954 3300031911 Unclassified 1381
614 Ga0307412_11968602 3300031911 Bacteria 540
615 Ga0307409_100017482 3300031995 Bacteria 4782
616 Ga0307409_102090840 3300031995 Bacteria 596
617 Ga0307416_100002728 3300032002 Bacteria 10236
618 Ga0307414_10063369 3300032004 Bacteria 2627
619 Ga0307411_10055307 3300032005 Bacteria 2610
620 Ga0307415_100016833 3300032126 Bacteria 4369
621 Ga0307415_102047354 3300032126 Unclassified 558
622 Ga0373950_0052860 3300034818 Bacteria 801
623 Ga0373938_0126586 3300034957 Bacteria 663
624 Ga0373926_0005523 3300035083 Bacteria 4171
625 Ga0373928_0150219 3300035084 Bacteria 644
626 Ga0373934_0135754 3300035086 Bacteria 1005
627 Ga0373944_0027607 3300035089 Bacteria 1684
628 Ga0373949_0036587 3300035090 Bacteria 1191
629 Ga0373932_0222584 3300035112 Unclassified 679
630 Ga0373932_0459968 3300035112 Bacteria 501
631 Ga0373945_0022615 3300035116 Bacteria 2167
632 Ga0373953_0233253 3300035117 Unclassified 798
633 Ga0373954_0045163 3300035118 Bacteria 2058
634 Ga0373956_0170340 3300035119 Bacteria 1028
635 Ga0373960_0116091 3300035121 Unclassified 884
636 Ga0373960_0341926 3300035121 Bacteria 565
637 Ga0373960_0416142 3300035121 Unclassified 521
638 Ga0373943_0001283 3300035170 Bacteria 11248
639 Ga0373943_0657228 3300035170 Bacteria 620
640 Ga0373946_0046255 3300035171 Bacteria 1803
641 Ga0373955_0448203 3300035172 Unclassified 786
642 Ga0373955_1032370 3300035172 Bacteria 506
643 Ga0373942_0085251 3300035207 Bacteria 944
644 Ga0373962_0039778 3300035242 Unclassified 1321
645 Ga0373931_1063960 3300035691 Bacteria 550
646 Ga0373931_1106373 3300035691 Bacteria 540
647 Ga0373935_0020364 3300035692 Bacteria 4053
648 Ga0373935_0064209 3300035692 Bacteria 2354
649 Ga0373935_0943052 3300035692 Unclassified 640
650 Ga0373927_0259318 3300035695 Bacteria 1143
651 Ga0373933_0244472 3300035724 Bacteria 1155
652 Ga0373947_0002113 3300035725 Bacteria 12113
653 Ga0373937_0052542 3300036401 Bacteria 3736
654 Ga0373937_0129914 3300036401 Bacteria 2352
655 Ga0373925_0001501 3300037068 Bacteria 19995
656 Ga0373925_0232012 3300037068 Bacteria 1476
657 Ga0373925_1696008 3300037068 Bacteria 516
658 Ga0373925_1725107 3300037068 Unclassified 511
659 Ga0395899_0284953 3300037312 Bacteria 1123
660 Ga0395899_0478665 3300037312 Bacteria 811
661 Ga0395900_0093322 3300037418 Bacteria 3092
662 Ga0395900_0173074 3300037418 Bacteria 2197
663 Ga0395900_1741559 3300037418 Unclassified 534
664 Ga0395898_0027064 3300037466 Bacteria 5761
665 Ga0395898_0094323 3300037466 Bacteria 2876
666 Ga0395898_0337135 3300037466 Unclassified 1438
667 Ga0395905_0190867 3300037471 Bacteria 1922
668 Ga0395905_0196229 3300037471 Bacteria 1893
669 Ga0395905_0367710 3300037471 Bacteria 1331
670 Ga0395905_1297088 3300037471 Bacteria 632
671 Ga0395901_0130635 3300038443 Bacteria 2639
672 Ga0395901_0385734 3300038443 Bacteria 1441
673 Ga0395901_0756842 3300038443 Bacteria 964
674 Ga0395901_1548679 3300038443 Bacteria 618
675 Ga0395901_1587519 3300038443 Unclassified 608
676 Ga0436360_0548929 3300039438 Bacteria 1018
677 Ga0436360_0556691 3300039438 Bacteria 7187
678 Ga0436362_0539041 3300039453 Unclassified 745
679 Ga0439439_0019644 3300041406 Bacteria 1678
680 Ga0451853_1447046 3300041512 Bacteria 714
681 Ga0451853_2374780 3300041512 Bacteria 930
682 Ga0451853_2840255 3300041512 Bacteria 540
683 Ga0439431_0005605 3300041997 Bacteria 2769
684 Ga0439433_0001351 3300041999 Bacteria 5049
685 Ga0439437_044543 3300042000 Bacteria 580
686 Ga0439442_119542 3300042002 Bacteria 576
687 Ga0439449_0048052 3300042007 Bacteria 1580
688 Ga0439457_021945 3300042014 Bacteria 1414
689 Ga0439462_0098367 3300042015 Bacteria 805
690 Ga0450920_007751 3300042122 Bacteria 1949
691 Ga0450923_054944 3300042125 Unclassified 861
692 Ga0450923_106515 3300042125 Bacteria 651
693 Ga0450898_103249 3300042134 Bacteria 597
694 Ga0450910_026494 3300042147 Bacteria 896
695 Ga0439446_0006869 3300042156 Bacteria 2980
696 Ga0439458_0102954 3300042157 Bacteria 742
697 Ga0439434_0010766 3300042435 Bacteria 2698
698 Ga0439435_0284375 3300042436 Bacteria 563
699 Ga0450918_064626 3300042531 Bacteria 680
700 Ga0451577_0194803 3300042876 Bacteria 1829
701 Ga0466965_0297133 3300044683 Unclassified 875
702 Ga0466965_0327523 3300044683 Unclassified 835
703 Ga0466966_0209753 3300044684 Bacteria 1177
704 Ga0466961_0019364 3300044693 Bacteria 4377
705 Ga0466961_0382081 3300044693 Bacteria 855
706 Ga0466963_0001805 3300044694 Bacteria 11654
707 Ga0466963_0003165 3300044694 Bacteria 9347
708 Ga0466963_0021168 3300044694 Bacteria 4098
709 Ga0466963_0113320 3300044694 Bacteria 1862
710 Ga0466963_0129442 3300044694 Bacteria 1742
711 Ga0466964_0003980 3300044706 Bacteria 5433
712 Ga0466964_0006104 3300044706 Bacteria 4491
713 Ga0466964_0016278 3300044706 Bacteria 2837
714 Ga0466964_0018404 3300044706 Bacteria 2681
715 Ga0466964_0034357 3300044706 Bacteria 2023
716 Ga0466964_0661989 3300044706 Unclassified 578
717 Ga0466971_0028641 3300044719 Bacteria 2492
718 Ga0466971_0042813 3300044719 Bacteria 2035
719 Ga0466971_0082844 3300044719 Bacteria 1464
720 Ga0466971_0561136 3300044719 Bacteria 567
721 Ga0466968_0000933 3300044735 Bacteria 10298
722 Ga0466968_0006910 3300044735 Bacteria 4297
723 Ga0466968_0077786 3300044735 Bacteria 1453
724 Ga0466968_0098167 3300044735 Bacteria 1305
725 Ga0466968_0389868 3300044735 Bacteria 681
726 Ga0466970_0922567 3300044765 Bacteria 514
727 Ga0466957_0007794 3300044842 Bacteria 6064
728 Ga0466957_0114378 3300044842 Bacteria 1714
729 Ga0466957_0219670 3300044842 Bacteria 1254
730 Ga0466957_0676792 3300044842 Bacteria 727
731 Ga0466960_0038972 3300044901 Bacteria 2238
732 Ga0466960_0477670 3300044901 Unclassified 728
733 Ga0466960_0528884 3300044901 Bacteria 693
734 Ga0466959_0027231 3300045049 Bacteria 4239
735 Ga0466959_0125664 3300045049 Bacteria 1821
736 Ga0466959_0263408 3300045049 Bacteria 1186
737 Ga0466959_0371445 3300045049 Bacteria 974
738 Ga0451576_0979851 3300045051 Bacteria 886
739 Ga0466958_0001480 3300045836 Bacteria 11201
740 Ga0466958_0057280 3300045836 Bacteria 2368
741 Ga0466958_0081027 3300045836 Bacteria 1997
742 Ga0466958_0248521 3300045836 Bacteria 1137
743 Ga0466958_0683229 3300045836 Bacteria 668
744 Ga0466967_0005380 3300045976 Bacteria 8862
745 Ga0466967_0006129 3300045976 Bacteria 8460
746 Ga0466967_0006388 3300045976 Bacteria 8332
747 Ga0466967_0006609 3300045976 Bacteria 8238
748 Ga0466967_0008400 3300045976 Bacteria 7559
749 Ga0466967_0010274 3300045976 Bacteria 7007
750 Ga0466967_0012465 3300045976 Bacteria 6505
751 Ga0466967_0029028 3300045976 Bacteria 4624
752 Ga0466967_0084154 3300045976 Bacteria 2878
753 Ga0466967_0118967 3300045976 Bacteria 2437
754 Ga0466967_0135873 3300045976 Bacteria 2286
755 Ga0466967_0173397 3300045976 Bacteria 2030
756 Ga0466967_0182389 3300045976 Bacteria 1981
757 Ga0466967_0201238 3300045976 Bacteria 1886
758 Ga0466967_0317424 3300045976 Bacteria 1502
759 Ga0466967_0716619 3300045976 Bacteria 991
760 Ga0466967_0742559 3300045976 Bacteria 973
761 Ga0466967_1338725 3300045976 Bacteria 713
762 Ga0466967_1913969 3300045976 Bacteria 590
763 Ga0466967_2165880 3300045976 Bacteria 552
764 Ga0495592_0002297 3300046454 Bacteria 13484
765 Ga0495592_0051471 3300046454 Bacteria 3059
766 Ga0495592_0132620 3300046454 Bacteria 1741
767 Ga0495603_0008076 3300046455 Bacteria 6359
768 Ga0495629_0073277 3300046459 Bacteria 2391
769 Ga0495629_0156180 3300046459 Bacteria 1585
770 Ga0495629_0255970 3300046459 Unclassified 1204
771 Ga0495629_1108703 3300046459 Unclassified 511
772 Ga0495641_0005407 3300046461 Bacteria 8637
773 Ga0495641_0042686 3300046461 Bacteria 2100
774 Ga0495651_0129457 3300046462 Bacteria 1844
775 Ga0495651_0271899 3300046462 Bacteria 1148
776 Ga0495653_0025614 3300046463 Bacteria 4736
777 Ga0495653_0151727 3300046463 Bacteria 1618
778 Ga0495580_0033594 3300046472 Bacteria 3695
779 Ga0495582_0028215 3300046473 Bacteria 3080
780 Ga0495582_0046446 3300046473 Bacteria 2391
781 Ga0495582_0054842 3300046473 Bacteria 2197
782 Ga0495582_0385323 3300046473 Bacteria 808
783 Ga0495639_0000977 3300046475 Bacteria 12876
784 Ga0495662_0047065 3300046476 Bacteria 2082
785 Ga0495662_0520872 3300046476 Bacteria 583
786 Ga0495664_0014004 3300046477 Bacteria 4543
787 Ga0495664_0029420 3300046477 Bacteria 3213
788 Ga0495584_0264036 3300046491 Unclassified 875
789 Ga0495584_0265452 3300046491 Unclassified 873
790 Ga0495585_0218318 3300046492 Bacteria 963
791 Ga0495585_0340090 3300046492 Unclassified 731
792 Ga0495585_0445109 3300046492 Unclassified 620
793 Ga0495585_0575875 3300046492 Unclassified 531
794 Ga0495594_0123707 3300046499 Bacteria 1463
795 Ga0495594_0336804 3300046499 Bacteria 859
796 Ga0495596_0139657 3300046500 Unclassified 941
797 Ga0495608_0039334 3300046511 Bacteria 3170
798 Ga0495608_0220896 3300046511 Bacteria 1189
799 Ga0495608_0779540 3300046511 Unclassified 565
800 Ga0495618_0014789 3300046514 Bacteria 4760
801 Ga0495618_0028699 3300046514 Bacteria 3468
802 Ga0495628_0026160 3300046516 Bacteria 4763
803 Ga0495628_0129262 3300046516 Bacteria 1933
804 Ga0495628_0151690 3300046516 Unclassified 1765
805 Ga0495630_0598800 3300046517 Bacteria 845
806 Ga0495630_0766400 3300046517 Bacteria 737
807 Ga0495631_0177822 3300046518 Bacteria 912
808 Ga0495637_0253596 3300046520 Bacteria 633
809 Ga0495644_0147802 3300046523 Bacteria 899
810 Ga0495644_0294691 3300046523 Bacteria 634
811 Ga0495644_0378766 3300046523 Unclassified 559
812 Ga0495663_0063825 3300046525 Unclassified 1162
813 Ga0495666_0003161 3300046526 Bacteria 8288
814 Ga0495642_0151334 3300046528 Unclassified 1004
815 Ga0495652_0023704 3300046529 Bacteria 5439
816 Ga0495652_0045218 3300046529 Bacteria 3787
817 Ga0495652_0160562 3300046529 Bacteria 1746
818 Ga0495652_0635670 3300046529 Bacteria 724
819 Ga0495665_0003374 3300046531 Bacteria 8667
820 Ga0495640_0030108 3300046533 Bacteria 3889
821 Ga0495640_0620661 3300046533 Bacteria 652
822 Ga0495586_0004202 3300046535 Bacteria 7714
823 Ga0495586_0791265 3300046535 Unclassified 547
824 Ga0495587_0121823 3300046536 Bacteria 1494
825 Ga0495587_0207312 3300046536 Bacteria 1107
826 Ga0495645_0040289 3300046543 Bacteria 3408
827 Ga0495633_0407679 3300046558 Unclassified 615
828 Ga0495667_0028876 3300046559 Bacteria 3734
829 Ga0495656_0281531 3300046615 Unclassified 848
830 Ga0495656_0460219 3300046615 Bacteria 671
831 Ga0495656_0575761 3300046615 Unclassified 601
832 Ga0495668_0848606 3300046616 Unclassified 506
833 Ga0495634_0012359 3300046642 Bacteria 6183
834 Ga0495634_0319116 3300046642 Unclassified 936
835 Ga0495611_0119800 3300046648 Bacteria 1227
836 Ga0495635_0015964 3300046663 Bacteria 5245
837 Ga0495635_0018898 3300046663 Bacteria 4809
838 Ga0495635_0399806 3300046663 Bacteria 913
839 Ga0495635_0629829 3300046663 Bacteria 699
840 Ga0495588_0190208 3300046674 Archaea 1084
841 Ga0495657_0043885 3300046675 Bacteria 3045
842 Ga0495657_0351878 3300046675 Unclassified 872
843 Ga0495657_0546213 3300046675 Bacteria 673
844 Ga0495657_0686293 3300046675 Unclassified 589
845 Ga0495657_0863333 3300046675 Bacteria 515
846 Ga0495599_0040124 3300046678 Bacteria 2940
847 Ga0495599_0109794 3300046678 Bacteria 1718
848 Ga0495599_0717051 3300046678 Unclassified 576
849 Ga0495599_0844750 3300046678 Bacteria 521
850 Ga0495646_0083812 3300046680 Bacteria 1852
851 Ga0495646_0119813 3300046680 Bacteria 1490
852 Ga0495646_0225973 3300046680 Bacteria 1010
853 Ga0495647_0001014 3300046681 Bacteria 8554
854 Ga0495647_0034678 3300046681 Bacteria 1891
855 Ga0495647_0093667 3300046681 Bacteria 1235
856 Ga0495647_0472601 3300046681 Bacteria 582
857 Ga0495658_0003312 3300046683 Bacteria 7996
858 Ga0495658_0142464 3300046683 Bacteria 1467
859 Ga0495658_0313315 3300046683 Archaea 994
860 Ga0495658_0886443 3300046683 Bacteria 570
861 Ga0495613_0051740 3300046689 Bacteria 3026
862 Ga0495613_0091801 3300046689 Bacteria 2199
863 Ga0495613_0247899 3300046689 Bacteria 1244
864 Ga0495613_0254193 3300046689 Bacteria 1226
865 Ga0495624_0017657 3300046690 Bacteria 4784
866 Ga0495624_0684395 3300046690 Bacteria 609
867 Ga0495670_0193540 3300046691 Unclassified 1076
868 Ga0495670_0427378 3300046691 Bacteria 717
869 Ga0495589_0229086 3300046794 Bacteria 872
870 Ga0495600_0040286 3300046809 Bacteria 3042
871 Ga0495600_0190434 3300046809 Bacteria 1319
872 Ga0495581_0434870 3300047315 Bacteria 764
873 Ga0495581_0833567 3300047315 Bacteria 528
874 Ga0495674_0122532 3300047319 Bacteria 2196
875 Ga0495674_0208392 3300047319 Bacteria 1620
876 Ga0495674_0354155 3300047319 Bacteria 1191
877 Ga0495674_0763941 3300047319 Unclassified 754
878 Ga0495676_0133206 3300047321 Bacteria 1791
879 Ga0495676_0701596 3300047321 Bacteria 655
880 Ga0495680_0012102 3300047322 Bacteria 7613
881 Ga0495680_0048947 3300047322 Bacteria 3315
882 Ga0495680_0059742 3300047322 Bacteria 2941
883 Ga0495680_0427291 3300047322 Bacteria 910
884 Ga0495675_0420239 3300047444 Bacteria 777
885 Ga0495677_0461855 3300047445 Bacteria 503
886 Ga0495679_039148 3300047446 Bacteria 1480
887 Ga0495684_0030753 3300047471 Bacteria 4122
888 Ga0495684_0066473 3300047471 Bacteria 2741
889 Ga0495684_0178781 3300047471 Bacteria 1574
890 Ga0495593_0008235 3300047673 Bacteria 6065
891 Ga0495593_0504437 3300047673 Bacteria 607
892 Ga0495602_0083189 3300048088 Bacteria 2683
893 Ga0495602_0832330 3300048088 Bacteria 618
894 Ga0495614_0000678 3300048089 Bacteria 14326
895 Ga0496100_0036846 3300048903 Bacteria 3088
896 Ga0496100_0165760 3300048903 Bacteria 1587
897 Ga0496100_0306190 3300048903 Bacteria 1190
898 Ga0496100_0491275 3300048903 Bacteria 945
899 Ga0496101_0014314 3300048904 Bacteria 5327
900 Ga0496101_0040024 3300048904 Bacteria 3337
901 Ga0496101_0120919 3300048904 Bacteria 1980
902 Ga0496101_0125189 3300048904 Bacteria 1947
903 Ga0496101_0374106 3300048904 Bacteria 1120
904 Ga0496101_0805107 3300048904 Bacteria 741
905 Ga0496101_1221646 3300048904 Bacteria 589
906 Ga0496102_0003853 3300048905 Bacteria 12703
907 Ga0496102_0035747 3300048905 Bacteria 4473
908 Ga0496102_0133017 3300048905 Bacteria 2329
909 Ga0496102_0409459 3300048905 Bacteria 1274
910 Ga0496102_1823965 3300048905 Bacteria 525
911 Ga0496103_0010803 3300048906 Bacteria 5404
912 Ga0496103_0022071 3300048906 Bacteria 3831
913 Ga0496103_0247555 3300048906 Bacteria 1147
914 Ga0496103_0266849 3300048906 Bacteria 1101
915 Ga0496103_0417201 3300048906 Bacteria 862
916 Ga0496103_0476332 3300048906 Bacteria 800
917 Ga0496103_0981440 3300048906 Bacteria 527
918 Ga0496104_0001019 3300048907 Bacteria 23962
919 Ga0496104_0009095 3300048907 Bacteria 8836
920 Ga0496104_0021364 3300048907 Bacteria 5942
921 Ga0496104_0037416 3300048907 Bacteria 4539
922 Ga0496104_0044560 3300048907 Bacteria 4168
923 Ga0496104_0067345 3300048907 Bacteria 3401
924 Ga0496104_0068829 3300048907 Bacteria 3363
925 Ga0496105_0142120 3300048908 Bacteria 1975
926 Ga0496105_0147522 3300048908 Bacteria 1934
927 Ga0496105_0224490 3300048908 Unclassified 1528
928 Ga0496105_0275766 3300048908 Bacteria 1357
929 Ga0496105_1028404 3300048908 Unclassified 615
930 Ga0496106_0001780 3300048909 Bacteria 16082
931 Ga0496106_0006450 3300048909 Bacteria 8686
932 Ga0496106_0031219 3300048909 Bacteria 3970
933 Ga0496106_0082320 3300048909 Bacteria 2474
934 Ga0496106_0223290 3300048909 Bacteria 1503
935 Ga0496106_0646640 3300048909 Bacteria 845
936 Ga0496106_1337558 3300048909 Bacteria 555
937 Ga0496106_1401958 3300048909 Bacteria 540
938 Ga0496107_0003441 3300048910 Bacteria 10574
939 Ga0496107_0018842 3300048910 Bacteria 4865
940 Ga0496107_0242340 3300048910 Bacteria 1342
941 Ga0496107_0277904 3300048910 Bacteria 1247
942 Ga0496107_0426246 3300048910 Unclassified 986
943 Ga0496107_0535653 3300048910 Bacteria 868
944 Ga0496107_0722656 3300048910 Bacteria 732
945 Ga0496107_1205977 3300048910 Bacteria 544
946 Ga0496108_0001877 3300048911 Bacteria 16825
947 Ga0496108_0002868 3300048911 Bacteria 13837
948 Ga0496108_0009594 3300048911 Bacteria 7844
949 Ga0496108_0146847 3300048911 Bacteria 2033
950 Ga0496108_0393574 3300048911 Bacteria 1210
951 Ga0496108_0413824 3300048911 Bacteria 1177
952 Ga0496108_0857991 3300048911 Bacteria 781
953 Ga0496108_1717731 3300048911 Bacteria 516
954 Ga0496108_1791868 3300048911 Bacteria 503
955 Ga0496109_0002513 3300048912 Bacteria 15384
956 Ga0496109_0015852 3300048912 Bacteria 6579
957 Ga0496109_0050303 3300048912 Bacteria 3795
958 Ga0496109_0059462 3300048912 Bacteria 3491
959 Ga0496109_0091320 3300048912 Bacteria 2816
960 Ga0496109_0146169 3300048912 Bacteria 2212
961 Ga0496109_0216543 3300048912 Bacteria 1801
962 Ga0496109_0252137 3300048912 Bacteria 1662
963 Ga0496109_0265350 3300048912 Bacteria 1617
964 Ga0496109_0754121 3300048912 Bacteria 911
965 Ga0496109_1511028 3300048912 Bacteria 606
966 Ga0496110_0004610 3300048913 Bacteria 10705
967 Ga0496110_0004774 3300048913 Bacteria 10555
968 Ga0496110_0007895 3300048913 Bacteria 8522
969 Ga0496110_0027964 3300048913 Bacteria 4838
970 Ga0496110_0327763 3300048913 Bacteria 1395
971 Ga0496110_0413011 3300048913 Bacteria 1230
972 Ga0496110_0561898 3300048913 Bacteria 1037
973 Ga0496110_0876444 3300048913 Unclassified 803
974 Ga0496110_0983999 3300048913 Bacteria 751
975 Ga0496110_1069991 3300048913 Unclassified 714
976 Ga0496110_1254905 3300048913 Bacteria 650
977 Ga0496110_1816665 3300048913 Bacteria 520
978 Ga0496111_0000101 3300048914 Bacteria 37061
979 Ga0496111_0000206 3300048914 Bacteria 27638
980 Ga0496111_0001511 3300048914 Bacteria 13342
981 Ga0496111_0037728 3300048914 Bacteria 3459
982 Ga0496111_0054026 3300048914 Bacteria 2903
983 Ga0496111_0142364 3300048914 Bacteria 1777
984 Ga0496111_0195999 3300048914 Bacteria 1501
985 Ga0496111_0257160 3300048914 Bacteria 1296
986 Ga0496111_1177532 3300048914 Unclassified 544
987 Ga0496112_0032584 3300048915 Bacteria 5061
988 Ga0496112_0038417 3300048915 Bacteria 4674
989 Ga0496112_0068170 3300048915 Unclassified 3513
990 Ga0496112_0085501 3300048915 Bacteria 3120
991 Ga0496112_0124358 3300048915 Bacteria 2550
992 Ga0496112_0236536 3300048915 Bacteria 1780
993 Ga0496112_0239451 3300048915 Bacteria 1767
994 Ga0496112_0247734 3300048915 Bacteria 1733
995 Ga0496112_0262405 3300048915 Bacteria 1677
996 Ga0496112_0750051 3300048915 Bacteria 902
997 Ga0496113_0016018 3300048916 Bacteria 5171
998 Ga0496113_0033779 3300048916 Bacteria 3727
999 Ga0496113_0061451 3300048916 Bacteria 2835
1000 Ga0496113_0149532 3300048916 Bacteria 1842
1001 Ga0496113_0176337 3300048916 Bacteria 1694
1002 Ga0496113_0247472 3300048916 Bacteria 1423
1003 Ga0496113_0286146 3300048916 Bacteria 1318
1004 Ga0496114_0000184 3300048917 Bacteria 44982
1005 Ga0496114_0003315 3300048917 Bacteria 12374
1006 Ga0496114_0014305 3300048917 Bacteria 6366
1007 Ga0496114_0020391 3300048917 Bacteria 5381
1008 Ga0496114_0029756 3300048917 Bacteria 4489
1009 Ga0496114_0063508 3300048917 Bacteria 3092
1010 Ga0496114_0464234 3300048917 Bacteria 1121
1011 Ga0496114_1092276 3300048917 Bacteria 682
1012 Ga0496114_1157429 3300048917 Bacteria 659
1013 Ga0496114_1313294 3300048917 Bacteria 610
1014 Ga0496114_1702293 3300048917 Bacteria 519
1015 Ga0496114_1728087 3300048917 Unclassified 514
1016 Ga0496115_0050995 3300048918 Bacteria 3317
1017 Ga0496115_1127898 3300048918 Bacteria 593
1018 Ga0496115_1179963 3300048918 Unclassified 576
1019 Ga0496115_1311347 3300048918 Unclassified 539
1020 Ga0501031_0000601 3300049568 Bacteria 21207
1021 Ga0501031_0323000 3300049568 Bacteria 1000
1022 Ga0501032_0036522 3300049569 Bacteria 3353
1023 Ga0501033_0685284 3300049570 Bacteria 698
1024 Ga0501036_0010058 3300049572 Bacteria 7792
1025 Ga0501036_0474851 3300049572 Bacteria 1041
1026 Ga0501037_0483123 3300049573 Bacteria 842
1027 Ga0501038_0039708 3300049574 Bacteria 4116
1028 Ga0501038_0444375 3300049574 Bacteria 998
1029 Ga0501039_0002203 3300049575 Bacteria 14420
1030 Ga0501039_0356647 3300049575 Bacteria 1149
1031 Ga0501040_0025092 3300049576 Bacteria 4005
1032 Ga0501040_0146027 3300049576 Bacteria 1667
1033 Ga0501040_0162364 3300049576 Bacteria 1580
1034 Ga0501040_1286889 3300049576 Unclassified 531
1035 Ga0501041_0002538 3300049577 Bacteria 10402
1036 Ga0501041_0066256 3300049577 Bacteria 2213
1037 Ga0501042_0025482 3300049578 Bacteria 4154
1038 Ga0501043_0725612 3300049579 Bacteria 724
1039 Ga0501046_0086637 3300049580 Bacteria 2414
1040 Ga0501046_0324456 3300049580 Bacteria 1121
1041 Ga0501046_0834261 3300049580 Bacteria 645
1042 Ga0501048_0002986 3300049582 Bacteria 12912
1043 Ga0501048_0815062 3300049582 Bacteria 671
1044 Ga0501048_0862509 3300049582 Bacteria 651
1045 Ga0501067_0050330 3300049583 Bacteria 2309
1046 Ga0501067_0294608 3300049583 Bacteria 903
1047 Ga0501068_0477232 3300049584 Bacteria 808
1048 Ga0501069_0093240 3300049585 Bacteria 1704
1049 Ga0501069_0152261 3300049585 Bacteria 1329
1050 Ga0501070_0161017 3300049586 Bacteria 1850
1051 Ga0501070_0646751 3300049586 Bacteria 840
1052 Ga0501071_0017473 3300049587 Bacteria 4947
1053 Ga0501071_0605751 3300049587 Bacteria 842
1054 Ga0501071_0657047 3300049587 Bacteria 807
1055 Ga0501071_0996474 3300049587 Bacteria 647
1056 Ga0501072_0010020 3300049588 Bacteria 7208
1057 Ga0501074_0052565 3300049590 Bacteria 2940
1058 Ga0501074_1196782 3300049590 Bacteria 533
1059 Ga0501075_0080307 3300049591 Bacteria 2468
1060 Ga0501075_0643403 3300049591 Unclassified 808
1061 Ga0501075_0737850 3300049591 Bacteria 750
1062 Ga0501076_0003423 3300049592 Bacteria 11130
1063 Ga0501076_0411209 3300049592 Bacteria 1113
1064 Ga0501076_0469679 3300049592 Bacteria 1036
1065 Ga0501077_0011243 3300049593 Bacteria 5585
1066 Ga0501077_0028471 3300049593 Bacteria 3550
1067 Ga0501077_0221716 3300049593 Bacteria 1202
1068 Ga0501077_0455435 3300049593 Unclassified 819
1069 Ga0501077_1120407 3300049593 Bacteria 507
1070 Ga0501250_099747 3300049680 Unclassified 516
1071 Ga0501079_0001804 3300049741 Bacteria 15292
1072 Ga0501079_0755185 3300049741 Bacteria 766
1073 Ga0501079_1507237 3300049741 Unclassified 529
1074 Ga0501080_0109006 3300049742 Bacteria 2566
1075 Ga0501081_0005074 3300049743 Bacteria 8473
1076 Ga0501081_0328999 3300049743 Bacteria 1124
1077 Ga0501081_1475206 3300049743 Unclassified 516
1078 Ga0501045_0001212 3300049824 Bacteria 17175
1079 Ga0501045_0083418 3300049824 Bacteria 2358
1080 Ga0501045_0476126 3300049824 Bacteria 928
1081 Ga0501045_0643566 3300049824 Bacteria 784
1082 Ga0501045_0772315 3300049824 Bacteria 708
1083 nmdc:mga05p37_1600132_c1 3300050507 Unclassified 642
1084 nmdc:mga05p37_193269_c1 3300050507 Bacteria 2469
1085 nmdc:mga05p37_436525_c1 3300050507 Bacteria 1520
1086 nmdc:mga09592_289913_c1 3300050508 Bacteria 1419
1087 nmdc:mga0qj67_421516_c1 3300050509 Bacteria 1076
1088 nmdc:mga06r32_384203_c1 3300050510 Bacteria 1387
1089 nmdc:mga08y16_531170_c1 3300050511 Bacteria 1192
1090 nmdc:mga08y16_648373_c1 3300050511 Bacteria 1060
1091 nmdc:mga0n895_186540_c1 3300050512 Unclassified 2105
1092 nmdc:mga0n895_1946624_c1 3300050512 Bacteria 546
1093 nmdc:mga0n895_970873_c1 3300050512 Bacteria 832
1094 nmdc:mga0rr50_1787074_c1 3300050513 Bacteria 517
1095 nmdc:mga0rr50_923123_c1 3300050513 Unclassified 744
1096 nmdc:mga0rr50_93045_c1 3300050513 Bacteria 2351
1097 nmdc:mga08x19_1135254_c1 3300050514 Bacteria 554
1098 nmdc:mga08x19_159387_c1 3300050514 Bacteria 1532
1099 nmdc:mga0a205_134724_c1 3300050515 Unclassified 2370
1100 nmdc:mga0a205_345930_c1 3300050515 Bacteria 1355
1101 Ga0495601_0015727 3300053077 Bacteria 4576
1102 Ga0495601_0033085 3300053077 Bacteria 3220
1103 Ga0495601_0675869 3300053077 Unclassified 660
1104 Ga0495612_0038564 3300053078 Bacteria 1941
1105 Ga0495612_0149552 3300053078 Bacteria 1016
1106 Ga0495612_0161493 3300053078 Bacteria 978
1107 Ga0495655_0314183 3300053083 Bacteria 541
1108 Ga0495595_0021009 3300053084 Bacteria 2848
1109 Ga0495595_0050929 3300053084 Bacteria 1918
1110 Ga0495595_0174820 3300053084 Bacteria 1064
1111 Ga0495619_0041937 3300053085 Bacteria 2995
1112 Ga0495619_0042075 3300053085 Bacteria 2990
1113 Ga0495619_0136802 3300053085 Bacteria 1685
1114 Ga0495619_0992349 3300053085 Unclassified 562
1115 Ga0500566_0128889 3300053094 Bacteria 1356
1116 Ga0500641_0082212 3300053096 Unclassified 1368
1117 Ga0501084_0009493 3300054114 Bacteria 8051
1118 Ga0501084_0714254 3300054114 Bacteria 845
1119 Ga0590075_008580 3300059424 Bacteria 2442
1120 Ga0590077_013046 3300059426 Bacteria 1726
1121 Ga0587086_032724 3300059507 Bacteria 773
1122 Ga0587079_075237 3300059647 Bacteria 762
1123 Ga0501082_0005605 3300060353 Bacteria 10896
1124 Ga0501082_0297051 3300060353 Bacteria 1406
1125 Ga0501082_0491687 3300060353 Bacteria 1072
1126 Ga0501082_0701530 3300060353 Bacteria 886
1127 Ga0501082_1020994 3300060353 Bacteria 723
1128 Ga0466962_0009007 3300061719 Bacteria 4780
1129 Ga0530510_0138944 3300061734 Bacteria 1789
1130 Ga0530510_0896172 3300061734 Unclassified 678
1131 Ga0070686_100066880
1132 JGI25406J46586_10119438
1133 Ga0058861_12077871
1134 Ga0058862_10037025
1135 Ga0058862_12790353
1136 Ga0070658_10074452
1137 Ga0070658_10319182
1138 Ga0070658_11210014
1139 Ga0070683_100000868
1140 Ga0070683_100040644
1141 Ga0070683_100145369
1142 Ga0070683_100246273
1143 Ga0070683_100534364
1144 Ga0070683_101090155
1145 Ga0070683_101300780
1146 Ga0070690_100313134
1147 Ga0070690_100341220
1148 Ga0070677_10288818
1149 Ga0068869_100719515
1150 Ga0068869_101594688
1151 Ga0070680_100028977
1152 Ga0070680_100082461
1153 Ga0070680_100102501
1154 Ga0070680_100124163
1155 Ga0070680_100962909
1156 Ga0070682_100015362
1157 Ga0070682_100094764
1158 Ga0070682_100516341
1159 Ga0068868_101353759
1160 Ga0068868_101591313
1161 Ga0070660_100003046
1162 Ga0070660_100034719
1163 Ga0070660_100040413
1164 Ga0070660_100069382
1165 Ga0070660_100122214
1166 Ga0070660_100247724
1167 Ga0070660_100311067
1168 Ga0070660_100379554
1169 Ga0070691_10023507
1170 Ga0070691_10050196
1171 Ga0070687_100876283
1172 Ga0070661_100026212
1173 Ga0070661_100093483
1174 Ga0070661_101115187
1175 Ga0070692_10095426
1176 Ga0070692_10196104
1177 Ga0070668_100429693
1178 Ga0070668_100434705
1179 Ga0070669_100525889
1180 Ga0070669_101574308
1181 Ga0070675_100126955
1182 Ga0070675_100734991
1183 Ga0070675_100863166
1184 Ga0070671_100305329
1185 Ga0070671_100675377
1186 Ga0070674_100040566
1187 Ga0070674_100170077
1188 Ga0070674_100175008
1189 Ga0070674_100986046
1190 Ga0070673_100971050
1191 Ga0070688_100280113
1192 Ga0070659_100190088
1193 Ga0070659_100298135
1194 Ga0070659_100335846
1195 Ga0070659_101872474
1196 Ga0070667_101230052
1197 Ga0070667_101429923
1198 Ga0070703_10070046
1199 Ga0070709_10042207
1200 Ga0070709_10363015
1201 Ga0070714_100034545
1202 Ga0070714_100036286
1203 Ga0070714_100038130
1204 Ga0070714_100095306
1205 Ga0070714_101004778
1206 Ga0070714_102100303
1207 Ga0070714_102142229
1208 Ga0070713_100013333
1209 Ga0070713_100054867
1210 Ga0070713_100072102
1211 Ga0070713_101406229
1212 Ga0070713_102488164
1213 Ga0070710_10060396
1214 Ga0070711_100031738
1215 Ga0070711_100357894
1216 Ga0070711_100918521
1217 Ga0070711_100966135
1218 Ga0070705_100443351
1219 Ga0070705_100824096
1220 Ga0070705_101874188
1221 Ga0070700_100937075
1222 Ga0070694_100087673
1223 Ga0070694_100481040
1224 Ga0070694_100670821
1225 Ga0070694_100787655
1226 Ga0070663_101696985
1227 Ga0070678_100665538
1228 Ga0070678_101224066
1229 Ga0070678_101579151
1230 Ga0070678_101599106
1231 Ga0070678_102088662
1232 Ga0070662_100130770
1233 Ga0070662_100329746
1234 Ga0070662_100643623
1235 Ga0070681_10017975
1236 Ga0070681_10032197
1237 Ga0070681_10032468
1238 Ga0070681_10158844
1239 Ga0070681_10281407
1240 Ga0070681_10325216
1241 Ga0070681_11641366
1242 Ga0068867_100057577
1243 Ga0068867_101172992
1244 Ga0068867_101480017
1245 Ga0070685_11267604
1246 Ga0070706_100323158
1247 Ga0070706_100473032
1248 Ga0070706_100653673
1249 Ga0070706_101421625
1250 Ga0070707_100065510
1251 Ga0070707_100398184
1252 Ga0070698_100155192
1253 Ga0070698_100172441
1254 Ga0070698_100459844
1255 Ga0070699_100377454
1256 Ga0070699_100524773
1257 Ga0070699_101264833
1258 Ga0070679_100016115
1259 Ga0070679_100016881
1260 Ga0070679_100025921
1261 Ga0070679_100050560
1262 Ga0070679_100230973
1263 Ga0070679_100242485
1264 Ga0070684_100000550
1265 Ga0070684_100021823
1266 Ga0070684_100071955
1267 Ga0070684_100160404
1268 Ga0070684_100370237
1269 Ga0070684_100808053
1270 Ga0070684_101882211
1271 Ga0070697_101058008
1272 Ga0068853_100904503
1273 Ga0070672_100630200
1274 Ga0070672_101173047
1275 Ga0070672_101539039
1276 Ga0070686_100033576
1277 Ga0070695_100321166
1278 Ga0070695_100581297
1279 Ga0070695_101776680
1280 Ga0070695_101843496
1281 Ga0070695_101884812
1282 Ga0070696_100060907
1283 Ga0070696_100161700
1284 Ga0070696_100624874
1285 Ga0070693_100018552
1286 Ga0070693_100121267
1287 Ga0070693_100201288
1288 Ga0070693_100823771
1289 Ga0070665_101571174
1290 Ga0070704_100117866
1291 Ga0070704_101113387
1292 Ga0070704_101941298
1293 Ga0068855_100103666
1294 Ga0068855_100161909
1295 Ga0068855_100341242
1296 Ga0068855_100541849
1297 Ga0068855_100588683
1298 Ga0070664_100111763
1299 Ga0070664_102009280
1300 Ga0070664_102356546
1301 Ga0068857_100107948
1302 Ga0068857_100752897
1303 Ga0068857_101874709
1304 Ga0068854_101695639
1305 Ga0068854_101867622
1306 Ga0068856_100081618
1307 Ga0068856_100143874
1308 Ga0068856_100200793
1309 Ga0068856_100216040
1310 Ga0068856_102652931
1311 Ga0070702_100327798
1312 Ga0070702_101463242
1313 Ga0068852_100065799
1314 Ga0068852_100137776
1315 Ga0068852_100714557
1316 Ga0068852_100795399
1317 Ga0068852_100801920
1318 Ga0068859_100933765
1319 Ga0068864_100896358
1320 Ga0068866_10032502
1321 Ga0068861_100103693
1322 Ga0068861_100689272
1323 Ga0068861_101768114
1324 Ga0068851_10799230
1325 Ga0068870_10113620
1326 Ga0068863_101306895
1327 Ga0068863_102300870
1328 Ga0068858_100063104
1329 Ga0068858_100621350
1330 Ga0068858_101108551
1331 Ga0068860_100660251
1332 Ga0068862_100168652
1333 Ga0068862_100622462
1334 Ga0068862_101363735
1335 Ga0081455_10017634
1336 Ga0081455_10056348
1337 Ga0081538_10021393
1338 Ga0081539_10001603
1339 Ga0070717_10008104
1340 Ga0070717_10051688
1341 Ga0070717_10517701
1342 Ga0070715_10004504
1343 Ga0070716_100055187
1344 Ga0070716_100952352
1345 Ga0070716_100964920
1346 Ga0070712_100036396
1347 Ga0070712_100273210
1348 Ga0070712_100595100
1349 Ga0070712_101296426
1350 Ga0070712_101834525
1351 Ga0097621_101467439
1352 Ga0097621_102041837
1353 Ga0068871_100580293
1354 Ga0068871_101722405
1355 Ga0075428_100521684
1356 Ga0075433_10392320
1357 Ga0075434_100542090
1358 Ga0075434_101314783
1359 Ga0075434_101411972
1360 Ga0075434_101754384
1361 Ga0068865_100150173
1362 Ga0068865_101030211
1363 Ga0068865_101502140
1364 Ga0075436_100134882
1365 Ga0075436_100463576
1366 Ga0075436_100830702
1367 Ga0097620_100933814
1368 Ga0075435_100091233
1369 Ga0075435_100629323
1370 Ga0105240_10217526
1371 Ga0105240_10617069
1372 Ga0111539_10652099
1373 Ga0111539_11068787
1374 Ga0111539_11341228
1375 Ga0105245_10014664
1376 Ga0105245_10021496
1377 Ga0105245_10137528
1378 Ga0105245_10194195
1379 Ga0105245_10234205
1380 Ga0105245_10262856
1381 Ga0105245_10543179
1382 Ga0105245_11922665
1383 Ga0105247_10124108
1384 Ga0105247_10939931
1385 Ga0114129_10399143
1386 Ga0114129_11021377
1387 Ga0114129_11840264
1388 Ga0114129_13116683
1389 Ga0105243_10055503
1390 Ga0105243_10430756
1391 Ga0105243_10668143
1392 Ga0105243_11512132
1393 Ga0105241_10039640
1394 Ga0105241_11871259
1395 Ga0105241_12604152
1396 Ga0105242_10070241
1397 Ga0105242_10302770
1398 Ga0105248_10025022
1399 Ga0105248_10968780
1400 Ga0105237_10248490
1401 Ga0105237_10667708
1402 Ga0105237_11389726
1403 Ga0105237_11550514
1404 Ga0105237_12018137
1405 Ga0105238_10211062
1406 Ga0105238_10977778
1407 Ga0105238_10980626
1408 Ga0105249_10105886
1409 Ga0105249_10338557
1410 Ga0105249_10440570
1411 Ga0105249_10475406
1412 Ga0105249_13553755
1413 Ga0105239_10757308
1414 Ga0105239_11439471
1415 Ga0105239_11531413
1416 Ga0105239_11583995
1417 Ga0105239_12205523
1418 Ga0105246_10156111
1419 Ga0105246_10188017
1420 Ga0105246_11386229
1421 Ga0105246_12255889
1422 Ga0157373_10125718
1423 Ga0157373_10516387
1424 Ga0157373_10799889
1425 Ga0157371_10498479
1426 Ga0157371_10776204
1427 Ga0157371_11556247
1428 Ga0157370_10050281
1429 Ga0157370_10904137
1430 Ga0157370_11261183
1431 Ga0157369_10005853
1432 Ga0157369_10452362
1433 Ga0157369_10840443
1434 Ga0157369_11485240
1435 Ga0157369_12269038
1436 Ga0157374_10041104
1437 Ga0157374_10587499
1438 Ga0157374_10763524
1439 Ga0157374_12666162
1440 Ga0157378_10862901
1441 Ga0157378_11010031
1442 Ga0157378_11653463
1443 Ga0163162_10191884
1444 Ga0163162_12105617
1445 Ga0163162_12331794
1446 Ga0157372_10136121
1447 Ga0157372_10291480
1448 Ga0157372_10293503
1449 Ga0157372_10956392
1450 Ga0157372_12231242
1451 Ga0157372_12458820
1452 Ga0157375_10233236
1453 Ga0157375_10254470
1454 Ga0157375_10618297
1455 Ga0157375_11399629
1456 Ga0157375_13065829
1457 Ga0157375_13152194
1458 Ga0163163_10330626
1459 Ga0163163_10352363
1460 Ga0163163_10531821
1461 Ga0163163_11007265
1462 Ga0163163_11268998
1463 Ga0163163_11822917
1464 Ga0157380_12097626
1465 Ga0157380_12271686
1466 Ga0157380_13094223
1467 Ga0157380_13198963
1468 Ga0157380_13264885
1469 Ga0182008_10041678
1470 Ga0157377_10067767
1471 Ga0157377_10098333
1472 Ga0157377_10198018
1473 Ga0157377_10330800
1474 Ga0157377_10886026
1475 Ga0157379_10074183
1476 Ga0157379_10741123
1477 Ga0157379_11013963
1478 Ga0157376_10262856
1479 Ga0157376_11205881
1480 Ga0182006_1035178
1481 Ga0182007_10133703
1482 Ga0163161_10468077
1483 Ga0197907_11003049
1484 Ga0197907_11235624
1485 Ga0206356_10267656
1486 Ga0206356_10577645
1487 Ga0206356_11557596
1488 Ga0206356_11815991
1489 Ga0206349_1860178
1490 Ga0206355_1445200
1491 Ga0206355_1476787
1492 Ga0206350_10344085
1493 Ga0206354_10813093
1494 Ga0206354_11640104
1495 Ga0206353_10584395
1496 Ga0206353_10669531
1497 Ga0206353_11931564
1498 Ga0154015_1469048
1499 Ga0154015_1585765
1500 Ga0213871_10002417
1501 Ga0224712_10004092
1502 Ga0224712_10016945
1503 Ga0224712_10142166
1504 Ga0207653_10335147
1505 Ga0207692_10029445
1506 Ga0207692_10479299
1507 Ga0207692_10512250
1508 Ga0207642_10014509
1509 Ga0207642_10722093
1510 Ga0207710_10064493
1511 Ga0207688_10085578
1512 Ga0207688_10465411
1513 Ga0207647_10125607
1514 Ga0207685_10079708
1515 Ga0207699_10007837
1516 Ga0207699_10152906
1517 Ga0207645_10247029
1518 Ga0207643_10146690
1519 Ga0207705_10009942
1520 Ga0207705_10046097
1521 Ga0207705_10186512
1522 Ga0207705_10194289
1523 Ga0207705_11464251
1524 Ga0207684_10051716
1525 Ga0207684_10170037
1526 Ga0207684_11451714
1527 Ga0207684_11456788
1528 Ga0207654_10216092
1529 Ga0207654_10430014
1530 Ga0207707_10017739
1531 Ga0207707_10040778
1532 Ga0207707_10168432
1533 Ga0207707_10255601
1534 Ga0207707_10297668
1535 Ga0207707_10486548
1536 Ga0207707_11317681
1537 Ga0207707_11540361
1538 Ga0207695_10097570
1539 Ga0207695_10651889
1540 Ga0207695_11233852
1541 Ga0207671_10804682
1542 Ga0207671_10804844
1543 Ga0207693_10045089
1544 Ga0207693_10901245
1545 Ga0207693_11062808
1546 Ga0207663_10002700
1547 Ga0207663_10404169
1548 Ga0207660_10060438
1549 Ga0207660_10077844
1550 Ga0207660_10138895
1551 Ga0207660_10368643
1552 Ga0207660_10377260
1553 Ga0207660_10716727
1554 Ga0207662_10021294
1555 Ga0207657_10002847
1556 Ga0207657_10006585
1557 Ga0207657_10006650
1558 Ga0207657_10067084
1559 Ga0207657_10084751
1560 Ga0207657_10207008
1561 Ga0207657_10305683
1562 Ga0207657_11216246
1563 Ga0207649_10243340
1564 Ga0207649_10354871
1565 Ga0207649_11023326
1566 Ga0207649_11558581
1567 Ga0207652_10027919
1568 Ga0207652_10029233
1569 Ga0207652_10034477
1570 Ga0207652_10041618
1571 Ga0207652_10189917
1572 Ga0207652_10253357
1573 Ga0207652_10832166
1574 Ga0207652_11072071
1575 Ga0207652_11261140
1576 Ga0207646_10054364
1577 Ga0207646_10072696
1578 Ga0207646_10455800
1579 Ga0207646_10596095
1580 Ga0207681_10462177
1581 Ga0207694_10144531
1582 Ga0207694_10583569
1583 Ga0207650_11646138
1584 Ga0207659_10432310
1585 Ga0207659_11005506
1586 Ga0207687_10012897
1587 Ga0207687_10032610
1588 Ga0207687_10154421
1589 Ga0207687_10322853
1590 Ga0207687_10435359
1591 Ga0207687_10840248
1592 Ga0207687_10891578
1593 Ga0207700_10016444
1594 Ga0207700_10304022
1595 Ga0207700_10508834
1596 Ga0207700_11116524
1597 Ga0207664_10017486
1598 Ga0207664_10022929
1599 Ga0207664_10033418
1600 Ga0207664_10081648
1601 Ga0207664_10128921
1602 Ga0207664_10178797
1603 Ga0207664_10820123
1604 Ga0207664_11678095
1605 Ga0207664_11806507
1606 Ga0207644_10138772
1607 Ga0207644_10473147
1608 Ga0207644_11005189
1609 Ga0207690_10465779
1610 Ga0207690_10699821
1611 Ga0207690_11128864
1612 Ga0207690_11203703
1613 Ga0207690_11262684
1614 Ga0207706_10112274
1615 Ga0207706_10490682
1616 Ga0207706_10570963
1617 Ga0207706_11327520
1618 Ga0207686_10027322
1619 Ga0207686_10185373
1620 Ga0207709_10026392
1621 Ga0207709_10609662
1622 Ga0207669_10144446
1623 Ga0207669_10432598
1624 Ga0207669_11099164
1625 Ga0207704_10259951
1626 Ga0207665_10002480
1627 Ga0207665_10040336
1628 Ga0207691_11008129
1629 Ga0207691_11025530
1630 Ga0207711_10986529
1631 Ga0207711_11202080
1632 Ga0207689_10525776
1633 Ga0207689_10717858
1634 Ga0207661_10018170
1635 Ga0207661_10049001
1636 Ga0207661_10131724
1637 Ga0207661_10228188
1638 Ga0207661_10759907
1639 Ga0207661_11191541
1640 Ga0207661_11192909
1641 Ga0207679_10053927
1642 Ga0207679_11481832
1643 Ga0207667_10743563
1644 Ga0207667_10909665
1645 Ga0207667_10958254
1646 Ga0207712_10063875
1647 Ga0207712_10085150
1648 Ga0207712_10090041
1649 Ga0207712_10314741
1650 Ga0207668_10418927
1651 Ga0207668_11194671
1652 Ga0207640_10432491
1653 Ga0207640_10746593
1654 Ga0207640_11899758
1655 Ga0207677_10116763
1656 Ga0207677_10694747
1657 Ga0207677_11154253
1658 Ga0207703_10979135
1659 Ga0207678_10066743
1660 Ga0207678_10163639
1661 Ga0207678_10418463
1662 Ga0207678_11644659
1663 Ga0207708_10004691
1664 Ga0207708_11207279
1665 Ga0207708_11569577
1666 Ga0207702_10137672
1667 Ga0207702_10526304
1668 Ga0207702_10540184
1669 Ga0207702_10890913
1670 Ga0207702_12209432
1671 Ga0207641_10737514
1672 Ga0207641_12219937
1673 Ga0207648_10020890
1674 Ga0207648_10530173
1675 Ga0207648_10885594
1676 Ga0207674_10063055
1677 Ga0207674_12068328
1678 Ga0207674_12083305
1679 Ga0207675_100017398
1680 Ga0207675_100293238
1681 Ga0207675_100883619
1682 Ga0207675_101315903
1683 Ga0207683_10279417
1684 Ga0207683_10447165
1685 Ga0207683_10806431
1686 Ga0207698_10104318
1687 Ga0207698_10126397
1688 Ga0207698_10162402
1689 Ga0207698_11754066
1690 Ga0207698_11770053
1691 Ga0207698_12166051
1692 Ga0209966_1040336
1693 Ga0268266_11514632
1694 Ga0268266_11975673
1695 Ga0268265_10107935
1696 Ga0268265_10386150
1697 Ga0268264_10504599
1698 Ga0265337_1033629
1699 Ga0265337_1114612
1700 Ga0265326_10045479
1701 Ga0265319_1002177
1702 Ga0265334_10039417
1703 Ga0265318_10006074
1704 Ga0265318_10130749
1705 Ga0265322_10012994
1706 Ga0265322_10070747
1707 Ga0265338_10011194
1708 Ga0265338_10082600
1709 Ga0265324_10061275
1710 Ga0265330_10143920
1711 Ga0265328_10148088
1712 Ga0265328_10199204
1713 Ga0265320_10016472
1714 Ga0265320_10250243
1715 Ga0265320_10472094
1716 Ga0265325_10105746
1717 Ga0265325_10119360
1718 Ga0265329_10023651
1719 Ga0265340_10063196
1720 Ga0265339_10028523
1721 Ga0265331_10090744
1722 Ga0265327_10011377
1723 Ga0265327_10026939
1724 Ga0265327_10123636
1725 Ga0265316_10018516
1726 Ga0265316_10045508
1727 Ga0307408_100027257
1728 Ga0307408_100937474
1729 Ga0265313_10054583
1730 Ga0265313_10060798
1731 Ga0265314_10009672
1732 Ga0265314_10038259
1733 Ga0265342_10009927
1734 Ga0265342_10213930
1735 Ga0265342_10383401
1736 Ga0307405_10101774
1737 Ga0307405_10384877
1738 Ga0307413_10390205
1739 Ga0307410_10011770
1740 Ga0307410_10528024
1741 Ga0307406_10060794
1742 Ga0307407_10000662
1743 Ga0307412_10247954
1744 Ga0307412_11968602
1745 Ga0307409_100017482
1746 Ga0307409_102090840
1747 Ga0307416_100002728
1748 Ga0307414_10063369
1749 Ga0307411_10055307
1750 Ga0307415_100016833
1751 Ga0307415_102047354
1752 Ga0373950_0052860
1753 Ga0373938_0126586
1754 Ga0373926_0005523
1755 Ga0373928_0150219
1756 Ga0373934_0135754
1757 Ga0373944_0027607
1758 Ga0373949_0036587
1759 Ga0373932_0222584
1760 Ga0373932_0459968
1761 Ga0373945_0022615
1762 Ga0373953_0233253
1763 Ga0373954_0045163
1764 Ga0373956_0170340
1765 Ga0373960_0116091
1766 Ga0373960_0341926
1767 Ga0373960_0416142
1768 Ga0373943_0001283
1769 Ga0373943_0657228
1770 Ga0373946_0046255
1771 Ga0373955_0448203
1772 Ga0373955_1032370
1773 Ga0373942_0085251
1774 Ga0373962_0039778
1775 Ga0373931_1063960
1776 Ga0373931_1106373
1777 Ga0373935_0020364
1778 Ga0373935_0064209
1779 Ga0373935_0943052
1780 Ga0373927_0259318
1781 Ga0373933_0244472
1782 Ga0373947_0002113
1783 Ga0373937_0052542
1784 Ga0373937_0129914
1785 Ga0373925_0001501
1786 Ga0373925_0232012
1787 Ga0373925_1696008
1788 Ga0373925_1725107
1789 Ga0395899_0284953
1790 Ga0395899_0478665
1791 Ga0395900_0093322
1792 Ga0395900_0173074
1793 Ga0395900_1741559
1794 Ga0395898_0027064
1795 Ga0395898_0094323
1796 Ga0395898_0337135
1797 Ga0395905_0190867
1798 Ga0395905_0196229
1799 Ga0395905_0367710
1800 Ga0395905_1297088
1801 Ga0395901_0130635
1802 Ga0395901_0385734
1803 Ga0395901_0756842
1804 Ga0395901_1548679
1805 Ga0395901_1587519
1806 Ga0436360_0548929
1807 Ga0436360_0556691
1808 Ga0436362_0539041
1809 Ga0439439_0019644
1810 Ga0451853_1447046
1811 Ga0451853_2374780
1812 Ga0451853_2840255
1813 Ga0439431_0005605
1814 Ga0439433_0001351
1815 Ga0439437_044543
1816 Ga0439442_119542
1817 Ga0439449_0048052
1818 Ga0439457_021945
1819 Ga0439462_0098367
1820 Ga0450920_007751
1821 Ga0450923_054944
1822 Ga0450923_106515
1823 Ga0450898_103249
1824 Ga0450910_026494
1825 Ga0439446_0006869
1826 Ga0439458_0102954
1827 Ga0439434_0010766
1828 Ga0439435_0284375
1829 Ga0450918_064626
1830 Ga0451577_0194803
1831 Ga0466965_0297133
1832 Ga0466965_0327523
1833 Ga0466966_0209753
1834 Ga0466961_0019364
1835 Ga0466961_0382081
1836 Ga0466963_0001805
1837 Ga0466963_0003165
1838 Ga0466963_0021168
1839 Ga0466963_0113320
1840 Ga0466963_0129442
1841 Ga0466964_0003980
1842 Ga0466964_0006104
1843 Ga0466964_0016278
1844 Ga0466964_0018404
1845 Ga0466964_0034357
1846 Ga0466964_0661989
1847 Ga0466971_0028641
1848 Ga0466971_0042813
1849 Ga0466971_0082844
1850 Ga0466971_0561136
1851 Ga0466968_0000933
1852 Ga0466968_0006910
1853 Ga0466968_0077786
1854 Ga0466968_0098167
1855 Ga0466968_0389868
1856 Ga0466970_0922567
1857 Ga0466957_0007794
1858 Ga0466957_0114378
1859 Ga0466957_0219670
1860 Ga0466957_0676792
1861 Ga0466960_0038972
1862 Ga0466960_0477670
1863 Ga0466960_0528884
1864 Ga0466959_0027231
1865 Ga0466959_0125664
1866 Ga0466959_0263408
1867 Ga0466959_0371445
1868 Ga0451576_0979851
1869 Ga0466958_0001480
1870 Ga0466958_0057280
1871 Ga0466958_0081027
1872 Ga0466958_0248521
1873 Ga0466958_0683229
1874 Ga0466967_0005380
1875 Ga0466967_0006129
1876 Ga0466967_0006388
1877 Ga0466967_0006609
1878 Ga0466967_0008400
1879 Ga0466967_0010274
1880 Ga0466967_0012465
1881 Ga0466967_0029028
1882 Ga0466967_0084154
1883 Ga0466967_0118967
1884 Ga0466967_0135873
1885 Ga0466967_0173397
1886 Ga0466967_0182389
1887 Ga0466967_0201238
1888 Ga0466967_0317424
1889 Ga0466967_0716619
1890 Ga0466967_0742559
1891 Ga0466967_1338725
1892 Ga0466967_1913969
1893 Ga0466967_2165880
1894 Ga0495592_0002297
1895 Ga0495592_0051471
1896 Ga0495592_0132620
1897 Ga0495603_0008076
1898 Ga0495629_0073277
1899 Ga0495629_0156180
1900 Ga0495629_0255970
1901 Ga0495629_1108703
1902 Ga0495641_0005407
1903 Ga0495641_0042686
1904 Ga0495651_0129457
1905 Ga0495651_0271899
1906 Ga0495653_0025614
1907 Ga0495653_0151727
1908 Ga0495580_0033594
1909 Ga0495582_0028215
1910 Ga0495582_0046446
1911 Ga0495582_0054842
1912 Ga0495582_0385323
1913 Ga0495639_0000977
1914 Ga0495662_0047065
1915 Ga0495662_0520872
1916 Ga0495664_0014004
1917 Ga0495664_0029420
1918 Ga0495584_0264036
1919 Ga0495584_0265452
1920 Ga0495585_0218318
1921 Ga0495585_0340090
1922 Ga0495585_0445109
1923 Ga0495585_0575875
1924 Ga0495594_0123707
1925 Ga0495594_0336804
1926 Ga0495596_0139657
1927 Ga0495608_0039334
1928 Ga0495608_0220896
1929 Ga0495608_0779540
1930 Ga0495618_0014789
1931 Ga0495618_0028699
1932 Ga0495628_0026160
1933 Ga0495628_0129262
1934 Ga0495628_0151690
1935 Ga0495630_0598800
1936 Ga0495630_0766400
1937 Ga0495631_0177822
1938 Ga0495637_0253596
1939 Ga0495644_0147802
1940 Ga0495644_0294691
1941 Ga0495644_0378766
1942 Ga0495663_0063825
1943 Ga0495666_0003161
1944 Ga0495642_0151334
1945 Ga0495652_0023704
1946 Ga0495652_0045218
1947 Ga0495652_0160562
1948 Ga0495652_0635670
1949 Ga0495665_0003374
1950 Ga0495640_0030108
1951 Ga0495640_0620661
1952 Ga0495586_0004202
1953 Ga0495586_0791265
1954 Ga0495587_0121823
1955 Ga0495587_0207312
1956 Ga0495645_0040289
1957 Ga0495633_0407679
1958 Ga0495667_0028876
1959 Ga0495656_0281531
1960 Ga0495656_0460219
1961 Ga0495656_0575761
1962 Ga0495668_0848606
1963 Ga0495634_0012359
1964 Ga0495634_0319116
1965 Ga0495611_0119800
1966 Ga0495635_0015964
1967 Ga0495635_0018898
1968 Ga0495635_0399806
1969 Ga0495635_0629829
1970 Ga0495588_0190208
1971 Ga0495657_0043885
1972 Ga0495657_0351878
1973 Ga0495657_0546213
1974 Ga0495657_0686293
1975 Ga0495657_0863333
1976 Ga0495599_0040124
1977 Ga0495599_0109794
1978 Ga0495599_0717051
1979 Ga0495599_0844750
1980 Ga0495646_0083812
1981 Ga0495646_0119813
1982 Ga0495646_0225973
1983 Ga0495647_0001014
1984 Ga0495647_0034678
1985 Ga0495647_0093667
1986 Ga0495647_0472601
1987 Ga0495658_0003312
1988 Ga0495658_0142464
1989 Ga0495658_0313315
1990 Ga0495658_0886443
1991 Ga0495613_0051740
1992 Ga0495613_0091801
1993 Ga0495613_0247899
1994 Ga0495613_0254193
1995 Ga0495624_0017657
1996 Ga0495624_0684395
1997 Ga0495670_0193540
1998 Ga0495670_0427378
1999 Ga0495589_0229086
2000 Ga0495600_0040286
2001 Ga0495600_0190434
2002 Ga0495581_0434870
2003 Ga0495581_0833567
2004 Ga0495674_0122532
2005 Ga0495674_0208392
2006 Ga0495674_0354155
2007 Ga0495674_0763941
2008 Ga0495676_0133206
2009 Ga0495676_0701596
2010 Ga0495680_0012102
2011 Ga0495680_0048947
2012 Ga0495680_0059742
2013 Ga0495680_0427291
2014 Ga0495675_0420239
2015 Ga0495677_0461855
2016 Ga0495679_039148
2017 Ga0495684_0030753
2018 Ga0495684_0066473
2019 Ga0495684_0178781
2020 Ga0495593_0008235
2021 Ga0495593_0504437
2022 Ga0495602_0083189
2023 Ga0495602_0832330
2024 Ga0495614_0000678
2025 Ga0496100_0036846
2026 Ga0496100_0165760
2027 Ga0496100_0306190
2028 Ga0496100_0491275
2029 Ga0496101_0014314
2030 Ga0496101_0040024
2031 Ga0496101_0120919
2032 Ga0496101_0125189
2033 Ga0496101_0374106
2034 Ga0496101_0805107
2035 Ga0496101_1221646
2036 Ga0496102_0003853
2037 Ga0496102_0035747
2038 Ga0496102_0133017
2039 Ga0496102_0409459
2040 Ga0496102_1823965
2041 Ga0496103_0010803
2042 Ga0496103_0022071
2043 Ga0496103_0247555
2044 Ga0496103_0266849
2045 Ga0496103_0417201
2046 Ga0496103_0476332
2047 Ga0496103_0981440
2048 Ga0496104_0001019
2049 Ga0496104_0009095
2050 Ga0496104_0021364
2051 Ga0496104_0037416
2052 Ga0496104_0044560
2053 Ga0496104_0067345
2054 Ga0496104_0068829
2055 Ga0496105_0142120
2056 Ga0496105_0147522
2057 Ga0496105_0224490
2058 Ga0496105_0275766
2059 Ga0496105_1028404
2060 Ga0496106_0001780
2061 Ga0496106_0006450
2062 Ga0496106_0031219
2063 Ga0496106_0082320
2064 Ga0496106_0223290
2065 Ga0496106_0646640
2066 Ga0496106_1337558
2067 Ga0496106_1401958
2068 Ga0496107_0003441
2069 Ga0496107_0018842
2070 Ga0496107_0242340
2071 Ga0496107_0277904
2072 Ga0496107_0426246
2073 Ga0496107_0535653
2074 Ga0496107_0722656
2075 Ga0496107_1205977
2076 Ga0496108_0001877
2077 Ga0496108_0002868
2078 Ga0496108_0009594
2079 Ga0496108_0146847
2080 Ga0496108_0393574
2081 Ga0496108_0413824
2082 Ga0496108_0857991
2083 Ga0496108_1717731
2084 Ga0496108_1791868
2085 Ga0496109_0002513
2086 Ga0496109_0015852
2087 Ga0496109_0050303
2088 Ga0496109_0059462
2089 Ga0496109_0091320
2090 Ga0496109_0146169
2091 Ga0496109_0216543
2092 Ga0496109_0252137
2093 Ga0496109_0265350
2094 Ga0496109_0754121
2095 Ga0496109_1511028
2096 Ga0496110_0004610
2097 Ga0496110_0004774
2098 Ga0496110_0007895
2099 Ga0496110_0027964
2100 Ga0496110_0327763
2101 Ga0496110_0413011
2102 Ga0496110_0561898
2103 Ga0496110_0876444
2104 Ga0496110_0983999
2105 Ga0496110_1069991
2106 Ga0496110_1254905
2107 Ga0496110_1816665
2108 Ga0496111_0000101
2109 Ga0496111_0000206
2110 Ga0496111_0001511
2111 Ga0496111_0037728
2112 Ga0496111_0054026
2113 Ga0496111_0142364
2114 Ga0496111_0195999
2115 Ga0496111_0257160
2116 Ga0496111_1177532
2117 Ga0496112_0032584
2118 Ga0496112_0038417
2119 Ga0496112_0068170
2120 Ga0496112_0085501
2121 Ga0496112_0124358
2122 Ga0496112_0236536
2123 Ga0496112_0239451
2124 Ga0496112_0247734
2125 Ga0496112_0262405
2126 Ga0496112_0750051
2127 Ga0496113_0016018
2128 Ga0496113_0033779
2129 Ga0496113_0061451
2130 Ga0496113_0149532
2131 Ga0496113_0176337
2132 Ga0496113_0247472
2133 Ga0496113_0286146
2134 Ga0496114_0000184
2135 Ga0496114_0003315
2136 Ga0496114_0014305
2137 Ga0496114_0020391
2138 Ga0496114_0029756
2139 Ga0496114_0063508
2140 Ga0496114_0464234
2141 Ga0496114_1092276
2142 Ga0496114_1157429
2143 Ga0496114_1313294
2144 Ga0496114_1702293
2145 Ga0496114_1728087
2146 Ga0496115_0050995
2147 Ga0496115_1127898
2148 Ga0496115_1179963
2149 Ga0496115_1311347
2150 Ga0501031_0000601
2151 Ga0501031_0323000
2152 Ga0501032_0036522
2153 Ga0501033_0685284
2154 Ga0501036_0010058
2155 Ga0501036_0474851
2156 Ga0501037_0483123
2157 Ga0501038_0039708
2158 Ga0501038_0444375
2159 Ga0501039_0002203
2160 Ga0501039_0356647
2161 Ga0501040_0025092
2162 Ga0501040_0146027
2163 Ga0501040_0162364
2164 Ga0501040_1286889
2165 Ga0501041_0002538
2166 Ga0501041_0066256
2167 Ga0501042_0025482
2168 Ga0501043_0725612
2169 Ga0501046_0086637
2170 Ga0501046_0324456
2171 Ga0501046_0834261
2172 Ga0501048_0002986
2173 Ga0501048_0815062
2174 Ga0501048_0862509
2175 Ga0501067_0050330
2176 Ga0501067_0294608
2177 Ga0501068_0477232
2178 Ga0501069_0093240
2179 Ga0501069_0152261
2180 Ga0501070_0161017
2181 Ga0501070_0646751
2182 Ga0501071_0017473
2183 Ga0501071_0605751
2184 Ga0501071_0657047
2185 Ga0501071_0996474
2186 Ga0501072_0010020
2187 Ga0501074_0052565
2188 Ga0501074_1196782
2189 Ga0501075_0080307
2190 Ga0501075_0643403
2191 Ga0501075_0737850
2192 Ga0501076_0003423
2193 Ga0501076_0411209
2194 Ga0501076_0469679
2195 Ga0501077_0011243
2196 Ga0501077_0028471
2197 Ga0501077_0221716
2198 Ga0501077_0455435
2199 Ga0501077_1120407
2200 Ga0501250_099747
2201 Ga0501079_0001804
2202 Ga0501079_0755185
2203 Ga0501079_1507237
2204 Ga0501080_0109006
2205 Ga0501081_0005074
2206 Ga0501081_0328999
2207 Ga0501081_1475206
2208 Ga0501045_0001212
2209 Ga0501045_0083418
2210 Ga0501045_0476126
2211 Ga0501045_0643566
2212 Ga0501045_0772315
2213 nmdc:mga05p37_1600132_c1
2214 nmdc:mga05p37_193269_c1
2215 nmdc:mga05p37_436525_c1
2216 nmdc:mga09592_289913_c1
2217 nmdc:mga0qj67_421516_c1
2218 nmdc:mga06r32_384203_c1
2219 nmdc:mga08y16_531170_c1
2220 nmdc:mga08y16_648373_c1
2221 nmdc:mga0n895_186540_c1
2222 nmdc:mga0n895_1946624_c1
2223 nmdc:mga0n895_970873_c1
2224 nmdc:mga0rr50_1787074_c1
2225 nmdc:mga0rr50_923123_c1
2226 nmdc:mga0rr50_93045_c1
2227 nmdc:mga08x19_1135254_c1
2228 nmdc:mga08x19_159387_c1
2229 nmdc:mga0a205_134724_c1
2230 nmdc:mga0a205_345930_c1
2231 Ga0495601_0015727
2232 Ga0495601_0033085
2233 Ga0495601_0675869
2234 Ga0495612_0038564
2235 Ga0495612_0149552
2236 Ga0495612_0161493
2237 Ga0495655_0314183
2238 Ga0495595_0021009
2239 Ga0495595_0050929
2240 Ga0495595_0174820
2241 Ga0495619_0041937
2242 Ga0495619_0042075
2243 Ga0495619_0136802
2244 Ga0495619_0992349
2245 Ga0500566_0128889
2246 Ga0500641_0082212
2247 Ga0501084_0009493
2248 Ga0501084_0714254
2249 Ga0590075_008580
2250 Ga0590077_013046
2251 Ga0587086_032724
2252 Ga0587079_075237
2253 Ga0501082_0005605
2254 Ga0501082_0297051
2255 Ga0501082_0491687
2256 Ga0501082_0701530
2257 Ga0501082_1020994
2258 Ga0466962_0009007
2259 Ga0530510_0138944
2260 Ga0530510_0896172

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

16

50

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hot-assembly1.cif.gz_A phage selected homeodomain bound to modified dna 0.4302 9 58
2hot-assembly1.cif.gz_A phage selected homeodomain bound to modified dna 0.3777 9 58
2az2-assembly1.cif.gz_B flock house virus b2-dsrna complex (p4122) 0.3223 5 72
2az2-assembly1.cif.gz_B flock house virus b2-dsrna complex (p4122) 0.2908 5 72
ID Description Score Start End Superfamily
3icxC01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.4818 9 62 1.10.287.660
3icxA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.4812 9 62 1.10.287.660
2hotB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.4316 9 57 1.10.10.60
2hotA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.4302 9 58 1.10.10.60
3njtA02 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.4078 6 41 3.10.20.310
ID Description Score Start End GO Terms
AF-A0A7K2AZH0-F1-model_v4 Mycothiol system anti-sigma-R factor 0.7265 6 74
AF-H5WRG0-F1-model_v4 Putative zinc-finger domain-containing protein 0.7193 8 65
AF-A0A1F3ZNX4-F1-model_v4 Putative zinc-finger domain-containing protein 0.6474 8 65
AF-H5WRG0-F1-model_v4 Putative zinc-finger domain-containing protein 0.6463 8 65
AF-A0A399YUL8-F1-model_v4 Uncharacterized protein 0.6364 5 73

Map