F490531
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1130 | 419 | 2260 | 78 |
Family's Representative Sequence
| Representative Sequence | 3300005544|Ga0070686_100066880|Ga0070686_1000668804 |
| Length | 86 |
| Sequence | LRAPGAGCVSAYLDPCDKCEEVMQPYLDRALDEGERAEAEAHLADCGYCRKRYRFEESLRVFVRQVCAEEMPPELKQKLAALRTPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 125 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 130 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 196 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 197 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 206 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 227 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 228 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 229 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 230 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 248 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 255 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 256 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 257 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 258 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 259 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 260 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 261 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 262 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 263 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 264 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 265 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 266 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 267 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 268 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 269 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 270 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 271 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 272 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 273 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 274 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 275 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 276 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 277 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 278 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 279 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 280 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 281 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 282 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 283 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 284 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 285 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 290 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 291 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 292 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 355 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 356 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 357 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 358 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 359 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 360 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 363 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 364 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 365 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 366 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 367 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 368 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 392 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 411 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 412 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 414 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 415 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 419 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.79 |
| Metatranscriptomes | 2.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.18 |
| Nodule | 0 |
| Rhizoplane | 11.06 |
| Rhizosphere | 88.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070686_100066880 | 3300005544 | Unclassified | 2339 |
| 2 | JGI25406J46586_10119438 | 3300003203 | Bacteria | 776 |
| 3 | Ga0058861_12077871 | 3300004800 | Bacteria | 898 |
| 4 | Ga0058862_10037025 | 3300004803 | Bacteria | 964 |
| 5 | Ga0058862_12790353 | 3300004803 | Bacteria | 840 |
| 6 | Ga0070658_10074452 | 3300005327 | Bacteria | 2785 |
| 7 | Ga0070658_10319182 | 3300005327 | Bacteria | 1326 |
| 8 | Ga0070658_11210014 | 3300005327 | Bacteria | 657 |
| 9 | Ga0070683_100000868 | 3300005329 | Bacteria | 22387 |
| 10 | Ga0070683_100040644 | 3300005329 | Bacteria | 4276 |
| 11 | Ga0070683_100145369 | 3300005329 | Bacteria | 2247 |
| 12 | Ga0070683_100246273 | 3300005329 | Bacteria | 1700 |
| 13 | Ga0070683_100534364 | 3300005329 | Bacteria | 1121 |
| 14 | Ga0070683_101090155 | 3300005329 | Bacteria | 767 |
| 15 | Ga0070683_101300780 | 3300005329 | Bacteria | 699 |
| 16 | Ga0070690_100313134 | 3300005330 | Bacteria | 1129 |
| 17 | Ga0070690_100341220 | 3300005330 | Unclassified | 1085 |
| 18 | Ga0070677_10288818 | 3300005333 | Bacteria | 829 |
| 19 | Ga0068869_100719515 | 3300005334 | Bacteria | 853 |
| 20 | Ga0068869_101594688 | 3300005334 | Bacteria | 581 |
| 21 | Ga0070680_100028977 | 3300005336 | Bacteria | 4444 |
| 22 | Ga0070680_100082461 | 3300005336 | Bacteria | 2654 |
| 23 | Ga0070680_100102501 | 3300005336 | Bacteria | 2377 |
| 24 | Ga0070680_100124163 | 3300005336 | Bacteria | 2156 |
| 25 | Ga0070680_100962909 | 3300005336 | Bacteria | 737 |
| 26 | Ga0070682_100015362 | 3300005337 | Bacteria | 4434 |
| 27 | Ga0070682_100094764 | 3300005337 | Bacteria | 1959 |
| 28 | Ga0070682_100516341 | 3300005337 | Bacteria | 928 |
| 29 | Ga0068868_101353759 | 3300005338 | Bacteria | 663 |
| 30 | Ga0068868_101591313 | 3300005338 | Bacteria | 614 |
| 31 | Ga0070660_100003046 | 3300005339 | Bacteria | 11532 |
| 32 | Ga0070660_100034719 | 3300005339 | Unclassified | 3812 |
| 33 | Ga0070660_100040413 | 3300005339 | Bacteria | 3550 |
| 34 | Ga0070660_100069382 | 3300005339 | Bacteria | 2749 |
| 35 | Ga0070660_100122214 | 3300005339 | Bacteria | 2078 |
| 36 | Ga0070660_100247724 | 3300005339 | Bacteria | 1452 |
| 37 | Ga0070660_100311067 | 3300005339 | Bacteria | 1293 |
| 38 | Ga0070660_100379554 | 3300005339 | Bacteria | 1167 |
| 39 | Ga0070691_10023507 | 3300005341 | Bacteria | 2862 |
| 40 | Ga0070691_10050196 | 3300005341 | Bacteria | 1990 |
| 41 | Ga0070687_100876283 | 3300005343 | Unclassified | 642 |
| 42 | Ga0070661_100026212 | 3300005344 | Bacteria | 4190 |
| 43 | Ga0070661_100093483 | 3300005344 | Bacteria | 2228 |
| 44 | Ga0070661_101115187 | 3300005344 | Bacteria | 658 |
| 45 | Ga0070692_10095426 | 3300005345 | Bacteria | 1623 |
| 46 | Ga0070692_10196104 | 3300005345 | Bacteria | 1180 |
| 47 | Ga0070668_100429693 | 3300005347 | Bacteria | 1132 |
| 48 | Ga0070668_100434705 | 3300005347 | Bacteria | 1126 |
| 49 | Ga0070669_100525889 | 3300005353 | Bacteria | 984 |
| 50 | Ga0070669_101574308 | 3300005353 | Bacteria | 572 |
| 51 | Ga0070675_100126955 | 3300005354 | Unclassified | 2171 |
| 52 | Ga0070675_100734991 | 3300005354 | Bacteria | 900 |
| 53 | Ga0070675_100863166 | 3300005354 | Bacteria | 829 |
| 54 | Ga0070671_100305329 | 3300005355 | Bacteria | 1355 |
| 55 | Ga0070671_100675377 | 3300005355 | Bacteria | 895 |
| 56 | Ga0070674_100040566 | 3300005356 | Unclassified | 3150 |
| 57 | Ga0070674_100170077 | 3300005356 | Bacteria | 1661 |
| 58 | Ga0070674_100175008 | 3300005356 | Bacteria | 1639 |
| 59 | Ga0070674_100986046 | 3300005356 | Bacteria | 739 |
| 60 | Ga0070673_100971050 | 3300005364 | Bacteria | 790 |
| 61 | Ga0070688_100280113 | 3300005365 | Bacteria | 1198 |
| 62 | Ga0070659_100190088 | 3300005366 | Bacteria | 1687 |
| 63 | Ga0070659_100298135 | 3300005366 | Bacteria | 1344 |
| 64 | Ga0070659_100335846 | 3300005366 | Bacteria | 1265 |
| 65 | Ga0070659_101872474 | 3300005366 | Bacteria | 538 |
| 66 | Ga0070667_101230052 | 3300005367 | Bacteria | 701 |
| 67 | Ga0070667_101429923 | 3300005367 | Bacteria | 649 |
| 68 | Ga0070703_10070046 | 3300005406 | Unclassified | 1169 |
| 69 | Ga0070709_10042207 | 3300005434 | Bacteria | 2815 |
| 70 | Ga0070709_10363015 | 3300005434 | Bacteria | 1073 |
| 71 | Ga0070714_100034545 | 3300005435 | Bacteria | 4234 |
| 72 | Ga0070714_100036286 | 3300005435 | Bacteria | 4133 |
| 73 | Ga0070714_100038130 | 3300005435 | Bacteria | 4041 |
| 74 | Ga0070714_100095306 | 3300005435 | Bacteria | 2613 |
| 75 | Ga0070714_101004778 | 3300005435 | Unclassified | 812 |
| 76 | Ga0070714_102100303 | 3300005435 | Bacteria | 550 |
| 77 | Ga0070714_102142229 | 3300005435 | Bacteria | 545 |
| 78 | Ga0070713_100013333 | 3300005436 | Bacteria | 6066 |
| 79 | Ga0070713_100054867 | 3300005436 | Bacteria | 3308 |
| 80 | Ga0070713_100072102 | 3300005436 | Bacteria | 2921 |
| 81 | Ga0070713_101406229 | 3300005436 | Bacteria | 677 |
| 82 | Ga0070713_102488164 | 3300005436 | Unclassified | 500 |
| 83 | Ga0070710_10060396 | 3300005437 | Unclassified | 2156 |
| 84 | Ga0070711_100031738 | 3300005439 | Bacteria | 3509 |
| 85 | Ga0070711_100357894 | 3300005439 | Bacteria | 1175 |
| 86 | Ga0070711_100918521 | 3300005439 | Unclassified | 748 |
| 87 | Ga0070711_100966135 | 3300005439 | Bacteria | 730 |
| 88 | Ga0070705_100443351 | 3300005440 | Bacteria | 972 |
| 89 | Ga0070705_100824096 | 3300005440 | Bacteria | 740 |
| 90 | Ga0070705_101874188 | 3300005440 | Bacteria | 510 |
| 91 | Ga0070700_100937075 | 3300005441 | Bacteria | 708 |
| 92 | Ga0070694_100087673 | 3300005444 | Bacteria | 2177 |
| 93 | Ga0070694_100481040 | 3300005444 | Unclassified | 985 |
| 94 | Ga0070694_100670821 | 3300005444 | Bacteria | 841 |
| 95 | Ga0070694_100787655 | 3300005444 | Bacteria | 779 |
| 96 | Ga0070663_101696985 | 3300005455 | Bacteria | 565 |
| 97 | Ga0070678_100665538 | 3300005456 | Bacteria | 935 |
| 98 | Ga0070678_101224066 | 3300005456 | Unclassified | 697 |
| 99 | Ga0070678_101579151 | 3300005456 | Bacteria | 616 |
| 100 | Ga0070678_101599106 | 3300005456 | Bacteria | 612 |
| 101 | Ga0070678_102088662 | 3300005456 | Bacteria | 537 |
| 102 | Ga0070662_100130770 | 3300005457 | Bacteria | 1935 |
| 103 | Ga0070662_100329746 | 3300005457 | Bacteria | 1247 |
| 104 | Ga0070662_100643623 | 3300005457 | Bacteria | 894 |
| 105 | Ga0070681_10017975 | 3300005458 | Bacteria | 7066 |
| 106 | Ga0070681_10032197 | 3300005458 | Bacteria | 5262 |
| 107 | Ga0070681_10032468 | 3300005458 | Bacteria | 5240 |
| 108 | Ga0070681_10158844 | 3300005458 | Bacteria | 2185 |
| 109 | Ga0070681_10281407 | 3300005458 | Bacteria | 1574 |
| 110 | Ga0070681_10325216 | 3300005458 | Bacteria | 1447 |
| 111 | Ga0070681_11641366 | 3300005458 | Bacteria | 569 |
| 112 | Ga0068867_100057577 | 3300005459 | Bacteria | 2878 |
| 113 | Ga0068867_101172992 | 3300005459 | Bacteria | 704 |
| 114 | Ga0068867_101480017 | 3300005459 | Bacteria | 632 |
| 115 | Ga0070685_11267604 | 3300005466 | Unclassified | 562 |
| 116 | Ga0070706_100323158 | 3300005467 | Bacteria | 1439 |
| 117 | Ga0070706_100473032 | 3300005467 | Bacteria | 1166 |
| 118 | Ga0070706_100653673 | 3300005467 | Unclassified | 976 |
| 119 | Ga0070706_101421625 | 3300005467 | Bacteria | 635 |
| 120 | Ga0070707_100065510 | 3300005468 | Bacteria | 3490 |
| 121 | Ga0070707_100398184 | 3300005468 | Bacteria | 1337 |
| 122 | Ga0070698_100155192 | 3300005471 | Unclassified | 2235 |
| 123 | Ga0070698_100172441 | 3300005471 | Unclassified | 2104 |
| 124 | Ga0070698_100459844 | 3300005471 | Bacteria | 1208 |
| 125 | Ga0070699_100377454 | 3300005518 | Archaea | 1280 |
| 126 | Ga0070699_100524773 | 3300005518 | Bacteria | 1077 |
| 127 | Ga0070699_101264833 | 3300005518 | Bacteria | 677 |
| 128 | Ga0070679_100016115 | 3300005530 | Bacteria | 7201 |
| 129 | Ga0070679_100016881 | 3300005530 | Bacteria | 7057 |
| 130 | Ga0070679_100025921 | 3300005530 | Bacteria | 5753 |
| 131 | Ga0070679_100050560 | 3300005530 | Bacteria | 4140 |
| 132 | Ga0070679_100230973 | 3300005530 | Bacteria | 1809 |
| 133 | Ga0070679_100242485 | 3300005530 | Bacteria | 1760 |
| 134 | Ga0070684_100000550 | 3300005535 | Bacteria | 25812 |
| 135 | Ga0070684_100021823 | 3300005535 | Bacteria | 5333 |
| 136 | Ga0070684_100071955 | 3300005535 | Bacteria | 3043 |
| 137 | Ga0070684_100160404 | 3300005535 | Bacteria | 2040 |
| 138 | Ga0070684_100370237 | 3300005535 | Unclassified | 1319 |
| 139 | Ga0070684_100808053 | 3300005535 | Bacteria | 877 |
| 140 | Ga0070684_101882211 | 3300005535 | Bacteria | 564 |
| 141 | Ga0070697_101058008 | 3300005536 | Bacteria | 722 |
| 142 | Ga0068853_100904503 | 3300005539 | Bacteria | 848 |
| 143 | Ga0070672_100630200 | 3300005543 | Bacteria | 935 |
| 144 | Ga0070672_101173047 | 3300005543 | Bacteria | 684 |
| 145 | Ga0070672_101539039 | 3300005543 | Bacteria | 596 |
| 146 | Ga0070686_100033576 | 3300005544 | Bacteria | 3154 |
| 147 | Ga0070695_100321166 | 3300005545 | Bacteria | 1151 |
| 148 | Ga0070695_100581297 | 3300005545 | Bacteria | 877 |
| 149 | Ga0070695_101776680 | 3300005545 | Bacteria | 517 |
| 150 | Ga0070695_101843496 | 3300005545 | Bacteria | 508 |
| 151 | Ga0070695_101884812 | 3300005545 | Unclassified | 502 |
| 152 | Ga0070696_100060907 | 3300005546 | Bacteria | 2640 |
| 153 | Ga0070696_100161700 | 3300005546 | Bacteria | 1650 |
| 154 | Ga0070696_100624874 | 3300005546 | Bacteria | 871 |
| 155 | Ga0070693_100018552 | 3300005547 | Unclassified | 3637 |
| 156 | Ga0070693_100121267 | 3300005547 | Bacteria | 1622 |
| 157 | Ga0070693_100201288 | 3300005547 | Bacteria | 1293 |
| 158 | Ga0070693_100823771 | 3300005547 | Bacteria | 690 |
| 159 | Ga0070665_101571174 | 3300005548 | Bacteria | 666 |
| 160 | Ga0070704_100117866 | 3300005549 | Unclassified | 2033 |
| 161 | Ga0070704_101113387 | 3300005549 | Bacteria | 718 |
| 162 | Ga0070704_101941298 | 3300005549 | Bacteria | 546 |
| 163 | Ga0068855_100103666 | 3300005563 | Bacteria | 3272 |
| 164 | Ga0068855_100161909 | 3300005563 | Bacteria | 2539 |
| 165 | Ga0068855_100341242 | 3300005563 | Bacteria | 1652 |
| 166 | Ga0068855_100541849 | 3300005563 | Bacteria | 1261 |
| 167 | Ga0068855_100588683 | 3300005563 | Bacteria | 1201 |
| 168 | Ga0070664_100111763 | 3300005564 | Unclassified | 2385 |
| 169 | Ga0070664_102009280 | 3300005564 | Bacteria | 549 |
| 170 | Ga0070664_102356546 | 3300005564 | Bacteria | 505 |
| 171 | Ga0068857_100107948 | 3300005577 | Bacteria | 2500 |
| 172 | Ga0068857_100752897 | 3300005577 | Unclassified | 928 |
| 173 | Ga0068857_101874709 | 3300005577 | Unclassified | 587 |
| 174 | Ga0068854_101695639 | 3300005578 | Bacteria | 578 |
| 175 | Ga0068854_101867622 | 3300005578 | Unclassified | 552 |
| 176 | Ga0068856_100081618 | 3300005614 | Bacteria | 3208 |
| 177 | Ga0068856_100143874 | 3300005614 | Unclassified | 2392 |
| 178 | Ga0068856_100200793 | 3300005614 | Bacteria | 2008 |
| 179 | Ga0068856_100216040 | 3300005614 | Bacteria | 1933 |
| 180 | Ga0068856_102652931 | 3300005614 | Bacteria | 507 |
| 181 | Ga0070702_100327798 | 3300005615 | Bacteria | 1070 |
| 182 | Ga0070702_101463242 | 3300005615 | Bacteria | 561 |
| 183 | Ga0068852_100065799 | 3300005616 | Bacteria | 3164 |
| 184 | Ga0068852_100137776 | 3300005616 | Bacteria | 2255 |
| 185 | Ga0068852_100714557 | 3300005616 | Bacteria | 1013 |
| 186 | Ga0068852_100795399 | 3300005616 | Bacteria | 960 |
| 187 | Ga0068852_100801920 | 3300005616 | Bacteria | 956 |
| 188 | Ga0068859_100933765 | 3300005617 | Bacteria | 951 |
| 189 | Ga0068864_100896358 | 3300005618 | Bacteria | 876 |
| 190 | Ga0068866_10032502 | 3300005718 | Bacteria | 2524 |
| 191 | Ga0068861_100103693 | 3300005719 | Bacteria | 2267 |
| 192 | Ga0068861_100689272 | 3300005719 | Bacteria | 948 |
| 193 | Ga0068861_101768114 | 3300005719 | Unclassified | 613 |
| 194 | Ga0068851_10799230 | 3300005834 | Unclassified | 586 |
| 195 | Ga0068870_10113620 | 3300005840 | Bacteria | 1550 |
| 196 | Ga0068863_101306895 | 3300005841 | Unclassified | 732 |
| 197 | Ga0068863_102300870 | 3300005841 | Bacteria | 549 |
| 198 | Ga0068858_100063104 | 3300005842 | Bacteria | 3428 |
| 199 | Ga0068858_100621350 | 3300005842 | Bacteria | 1049 |
| 200 | Ga0068858_101108551 | 3300005842 | Bacteria | 777 |
| 201 | Ga0068860_100660251 | 3300005843 | Bacteria | 1054 |
| 202 | Ga0068862_100168652 | 3300005844 | Bacteria | 1959 |
| 203 | Ga0068862_100622462 | 3300005844 | Bacteria | 1038 |
| 204 | Ga0068862_101363735 | 3300005844 | Bacteria | 712 |
| 205 | Ga0081455_10017634 | 3300005937 | Bacteria | 6834 |
| 206 | Ga0081455_10056348 | 3300005937 | Bacteria | 3338 |
| 207 | Ga0081538_10021393 | 3300005981 | Bacteria | 4724 |
| 208 | Ga0081539_10001603 | 3300005985 | Bacteria | 37270 |
| 209 | Ga0070717_10008104 | 3300006028 | Bacteria | 7837 |
| 210 | Ga0070717_10051688 | 3300006028 | Bacteria | 3383 |
| 211 | Ga0070717_10517701 | 3300006028 | Bacteria | 1079 |
| 212 | Ga0070715_10004504 | 3300006163 | Bacteria | 4579 |
| 213 | Ga0070716_100055187 | 3300006173 | Unclassified | 2272 |
| 214 | Ga0070716_100952352 | 3300006173 | Bacteria | 676 |
| 215 | Ga0070716_100964920 | 3300006173 | Bacteria | 672 |
| 216 | Ga0070712_100036396 | 3300006175 | Bacteria | 3349 |
| 217 | Ga0070712_100273210 | 3300006175 | Bacteria | 1359 |
| 218 | Ga0070712_100595100 | 3300006175 | Unclassified | 935 |
| 219 | Ga0070712_101296426 | 3300006175 | Bacteria | 635 |
| 220 | Ga0070712_101834525 | 3300006175 | Unclassified | 531 |
| 221 | Ga0097621_101467439 | 3300006237 | Bacteria | 647 |
| 222 | Ga0097621_102041837 | 3300006237 | Bacteria | 548 |
| 223 | Ga0068871_100580293 | 3300006358 | Bacteria | 1018 |
| 224 | Ga0068871_101722405 | 3300006358 | Bacteria | 594 |
| 225 | Ga0075428_100521684 | 3300006844 | Unclassified | 1271 |
| 226 | Ga0075433_10392320 | 3300006852 | Bacteria | 1225 |
| 227 | Ga0075434_100542090 | 3300006871 | Unclassified | 1183 |
| 228 | Ga0075434_101314783 | 3300006871 | Bacteria | 734 |
| 229 | Ga0075434_101411972 | 3300006871 | Bacteria | 706 |
| 230 | Ga0075434_101754384 | 3300006871 | Bacteria | 628 |
| 231 | Ga0068865_100150173 | 3300006881 | Bacteria | 1767 |
| 232 | Ga0068865_101030211 | 3300006881 | Bacteria | 722 |
| 233 | Ga0068865_101502140 | 3300006881 | Bacteria | 604 |
| 234 | Ga0075436_100134882 | 3300006914 | Bacteria | 1733 |
| 235 | Ga0075436_100463576 | 3300006914 | Bacteria | 924 |
| 236 | Ga0075436_100830702 | 3300006914 | Unclassified | 689 |
| 237 | Ga0097620_100933814 | 3300006931 | Bacteria | 951 |
| 238 | Ga0075435_100091233 | 3300007076 | Bacteria | 2514 |
| 239 | Ga0075435_100629323 | 3300007076 | Unclassified | 931 |
| 240 | Ga0105240_10217526 | 3300009093 | Bacteria | 2228 |
| 241 | Ga0105240_10617069 | 3300009093 | Bacteria | 1192 |
| 242 | Ga0111539_10652099 | 3300009094 | Bacteria | 1226 |
| 243 | Ga0111539_11068787 | 3300009094 | Bacteria | 938 |
| 244 | Ga0111539_11341228 | 3300009094 | Unclassified | 830 |
| 245 | Ga0105245_10014664 | 3300009098 | Bacteria | 6824 |
| 246 | Ga0105245_10021496 | 3300009098 | Bacteria | 5661 |
| 247 | Ga0105245_10137528 | 3300009098 | Bacteria | 2297 |
| 248 | Ga0105245_10194195 | 3300009098 | Bacteria | 1946 |
| 249 | Ga0105245_10234205 | 3300009098 | Unclassified | 1777 |
| 250 | Ga0105245_10262856 | 3300009098 | Bacteria | 1680 |
| 251 | Ga0105245_10543179 | 3300009098 | Bacteria | 1183 |
| 252 | Ga0105245_11922665 | 3300009098 | Bacteria | 645 |
| 253 | Ga0105247_10124108 | 3300009101 | Bacteria | 1676 |
| 254 | Ga0105247_10939931 | 3300009101 | Bacteria | 671 |
| 255 | Ga0114129_10399143 | 3300009147 | Unclassified | 1812 |
| 256 | Ga0114129_11021377 | 3300009147 | Archaea | 1040 |
| 257 | Ga0114129_11840264 | 3300009147 | Unclassified | 735 |
| 258 | Ga0114129_13116683 | 3300009147 | Bacteria | 542 |
| 259 | Ga0105243_10055503 | 3300009148 | Bacteria | 3148 |
| 260 | Ga0105243_10430756 | 3300009148 | Bacteria | 1233 |
| 261 | Ga0105243_10668143 | 3300009148 | Unclassified | 1009 |
| 262 | Ga0105243_11512132 | 3300009148 | Bacteria | 695 |
| 263 | Ga0105241_10039640 | 3300009174 | Bacteria | 3554 |
| 264 | Ga0105241_11871259 | 3300009174 | Bacteria | 587 |
| 265 | Ga0105241_12604152 | 3300009174 | Bacteria | 508 |
| 266 | Ga0105242_10070241 | 3300009176 | Bacteria | 2903 |
| 267 | Ga0105242_10302770 | 3300009176 | Bacteria | 1460 |
| 268 | Ga0105248_10025022 | 3300009177 | Bacteria | 6636 |
| 269 | Ga0105248_10968780 | 3300009177 | Bacteria | 961 |
| 270 | Ga0105237_10248490 | 3300009545 | Bacteria | 1781 |
| 271 | Ga0105237_10667708 | 3300009545 | Bacteria | 1046 |
| 272 | Ga0105237_11389726 | 3300009545 | Bacteria | 708 |
| 273 | Ga0105237_11550514 | 3300009545 | Bacteria | 669 |
| 274 | Ga0105237_12018137 | 3300009545 | Bacteria | 585 |
| 275 | Ga0105238_10211062 | 3300009551 | Bacteria | 1917 |
| 276 | Ga0105238_10977778 | 3300009551 | Bacteria | 867 |
| 277 | Ga0105238_10980626 | 3300009551 | Bacteria | 866 |
| 278 | Ga0105249_10105886 | 3300009553 | Bacteria | 2652 |
| 279 | Ga0105249_10338557 | 3300009553 | Bacteria | 1520 |
| 280 | Ga0105249_10440570 | 3300009553 | Bacteria | 1340 |
| 281 | Ga0105249_10475406 | 3300009553 | Bacteria | 1292 |
| 282 | Ga0105249_13553755 | 3300009553 | Bacteria | 502 |
| 283 | Ga0105239_10757308 | 3300010375 | Bacteria | 1112 |
| 284 | Ga0105239_11439471 | 3300010375 | Bacteria | 796 |
| 285 | Ga0105239_11531413 | 3300010375 | Bacteria | 771 |
| 286 | Ga0105239_11583995 | 3300010375 | Bacteria | 757 |
| 287 | Ga0105239_12205523 | 3300010375 | Bacteria | 640 |
| 288 | Ga0105246_10156111 | 3300011119 | Bacteria | 1733 |
| 289 | Ga0105246_10188017 | 3300011119 | Bacteria | 1596 |
| 290 | Ga0105246_11386229 | 3300011119 | Unclassified | 655 |
| 291 | Ga0105246_12255889 | 3300011119 | Archaea | 531 |
| 292 | Ga0157373_10125718 | 3300013100 | Bacteria | 1803 |
| 293 | Ga0157373_10516387 | 3300013100 | Bacteria | 864 |
| 294 | Ga0157373_10799889 | 3300013100 | Bacteria | 695 |
| 295 | Ga0157371_10498479 | 3300013102 | Bacteria | 899 |
| 296 | Ga0157371_10776204 | 3300013102 | Bacteria | 721 |
| 297 | Ga0157371_11556247 | 3300013102 | Archaea | 517 |
| 298 | Ga0157370_10050281 | 3300013104 | Bacteria | 3984 |
| 299 | Ga0157370_10904137 | 3300013104 | Bacteria | 801 |
| 300 | Ga0157370_11261183 | 3300013104 | Bacteria | 666 |
| 301 | Ga0157369_10005853 | 3300013105 | Bacteria | 14285 |
| 302 | Ga0157369_10452362 | 3300013105 | Bacteria | 1330 |
| 303 | Ga0157369_10840443 | 3300013105 | Bacteria | 943 |
| 304 | Ga0157369_11485240 | 3300013105 | Unclassified | 690 |
| 305 | Ga0157369_12269038 | 3300013105 | Bacteria | 550 |
| 306 | Ga0157374_10041104 | 3300013296 | Bacteria | 4259 |
| 307 | Ga0157374_10587499 | 3300013296 | Bacteria | 1123 |
| 308 | Ga0157374_10763524 | 3300013296 | Bacteria | 982 |
| 309 | Ga0157374_12666162 | 3300013296 | Bacteria | 527 |
| 310 | Ga0157378_10862901 | 3300013297 | Bacteria | 934 |
| 311 | Ga0157378_11010031 | 3300013297 | Archaea | 866 |
| 312 | Ga0157378_11653463 | 3300013297 | Bacteria | 687 |
| 313 | Ga0163162_10191884 | 3300013306 | Bacteria | 2171 |
| 314 | Ga0163162_12105617 | 3300013306 | Bacteria | 647 |
| 315 | Ga0163162_12331794 | 3300013306 | Bacteria | 615 |
| 316 | Ga0157372_10136121 | 3300013307 | Bacteria | 2829 |
| 317 | Ga0157372_10291480 | 3300013307 | Bacteria | 1898 |
| 318 | Ga0157372_10293503 | 3300013307 | Bacteria | 1891 |
| 319 | Ga0157372_10956392 | 3300013307 | Bacteria | 993 |
| 320 | Ga0157372_12231242 | 3300013307 | Bacteria | 629 |
| 321 | Ga0157372_12458820 | 3300013307 | Bacteria | 598 |
| 322 | Ga0157375_10233236 | 3300013308 | Bacteria | 1999 |
| 323 | Ga0157375_10254470 | 3300013308 | Bacteria | 1917 |
| 324 | Ga0157375_10618297 | 3300013308 | Bacteria | 1241 |
| 325 | Ga0157375_11399629 | 3300013308 | Bacteria | 824 |
| 326 | Ga0157375_13065829 | 3300013308 | Bacteria | 558 |
| 327 | Ga0157375_13152194 | 3300013308 | Bacteria | 550 |
| 328 | Ga0163163_10330626 | 3300014325 | Bacteria | 1578 |
| 329 | Ga0163163_10352363 | 3300014325 | Bacteria | 1528 |
| 330 | Ga0163163_10531821 | 3300014325 | Bacteria | 1238 |
| 331 | Ga0163163_11007265 | 3300014325 | Unclassified | 896 |
| 332 | Ga0163163_11268998 | 3300014325 | Bacteria | 799 |
| 333 | Ga0163163_11822917 | 3300014325 | Bacteria | 669 |
| 334 | Ga0157380_12097626 | 3300014326 | Bacteria | 628 |
| 335 | Ga0157380_12271686 | 3300014326 | Unclassified | 607 |
| 336 | Ga0157380_13094223 | 3300014326 | Unclassified | 530 |
| 337 | Ga0157380_13198963 | 3300014326 | Bacteria | 523 |
| 338 | Ga0157380_13264885 | 3300014326 | Bacteria | 518 |
| 339 | Ga0182008_10041678 | 3300014497 | Bacteria | 2290 |
| 340 | Ga0157377_10067767 | 3300014745 | Bacteria | 2055 |
| 341 | Ga0157377_10098333 | 3300014745 | Bacteria | 1739 |
| 342 | Ga0157377_10198018 | 3300014745 | Bacteria | 1274 |
| 343 | Ga0157377_10330800 | 3300014745 | Bacteria | 1016 |
| 344 | Ga0157377_10886026 | 3300014745 | Unclassified | 666 |
| 345 | Ga0157379_10074183 | 3300014968 | Bacteria | 3046 |
| 346 | Ga0157379_10741123 | 3300014968 | Bacteria | 924 |
| 347 | Ga0157379_11013963 | 3300014968 | Bacteria | 792 |
| 348 | Ga0157376_10262856 | 3300014969 | Bacteria | 1618 |
| 349 | Ga0157376_11205881 | 3300014969 | Bacteria | 785 |
| 350 | Ga0182006_1035178 | 3300015261 | Bacteria | 1999 |
| 351 | Ga0182007_10133703 | 3300015262 | Bacteria | 836 |
| 352 | Ga0163161_10468077 | 3300017792 | Bacteria | 1021 |
| 353 | Ga0197907_11003049 | 3300020069 | Bacteria | 1061 |
| 354 | Ga0197907_11235624 | 3300020069 | Bacteria | 1110 |
| 355 | Ga0206356_10267656 | 3300020070 | Bacteria | 4257 |
| 356 | Ga0206356_10577645 | 3300020070 | Bacteria | 572 |
| 357 | Ga0206356_11557596 | 3300020070 | Bacteria | 2060 |
| 358 | Ga0206356_11815991 | 3300020070 | Bacteria | 1308 |
| 359 | Ga0206349_1860178 | 3300020075 | Bacteria | 1336 |
| 360 | Ga0206355_1445200 | 3300020076 | Bacteria | 562 |
| 361 | Ga0206355_1476787 | 3300020076 | Bacteria | 632 |
| 362 | Ga0206350_10344085 | 3300020080 | Unclassified | 594 |
| 363 | Ga0206354_10813093 | 3300020081 | Bacteria | 595 |
| 364 | Ga0206354_11640104 | 3300020081 | Bacteria | 1562 |
| 365 | Ga0206353_10584395 | 3300020082 | Bacteria | 1637 |
| 366 | Ga0206353_10669531 | 3300020082 | Unclassified | 644 |
| 367 | Ga0206353_11931564 | 3300020082 | Bacteria | 1434 |
| 368 | Ga0154015_1469048 | 3300020610 | Bacteria | 786 |
| 369 | Ga0154015_1585765 | 3300020610 | Bacteria | 586 |
| 370 | Ga0213871_10002417 | 3300021441 | Bacteria | 3429 |
| 371 | Ga0224712_10004092 | 3300022467 | Bacteria | 3893 |
| 372 | Ga0224712_10016945 | 3300022467 | Bacteria | 2406 |
| 373 | Ga0224712_10142166 | 3300022467 | Unclassified | 1057 |
| 374 | Ga0207653_10335147 | 3300025885 | Bacteria | 590 |
| 375 | Ga0207692_10029445 | 3300025898 | Bacteria | 2610 |
| 376 | Ga0207692_10479299 | 3300025898 | Unclassified | 787 |
| 377 | Ga0207692_10512250 | 3300025898 | Unclassified | 763 |
| 378 | Ga0207642_10014509 | 3300025899 | Bacteria | 2909 |
| 379 | Ga0207642_10722093 | 3300025899 | Bacteria | 629 |
| 380 | Ga0207710_10064493 | 3300025900 | Bacteria | 1668 |
| 381 | Ga0207688_10085578 | 3300025901 | Bacteria | 1805 |
| 382 | Ga0207688_10465411 | 3300025901 | Bacteria | 789 |
| 383 | Ga0207647_10125607 | 3300025904 | Bacteria | 1510 |
| 384 | Ga0207685_10079708 | 3300025905 | Unclassified | 1352 |
| 385 | Ga0207699_10007837 | 3300025906 | Bacteria | 5235 |
| 386 | Ga0207699_10152906 | 3300025906 | Unclassified | 1529 |
| 387 | Ga0207645_10247029 | 3300025907 | Bacteria | 1180 |
| 388 | Ga0207643_10146690 | 3300025908 | Bacteria | 1412 |
| 389 | Ga0207705_10009942 | 3300025909 | Bacteria | 6926 |
| 390 | Ga0207705_10046097 | 3300025909 | Bacteria | 3132 |
| 391 | Ga0207705_10186512 | 3300025909 | Bacteria | 1567 |
| 392 | Ga0207705_10194289 | 3300025909 | Bacteria | 1536 |
| 393 | Ga0207705_11464251 | 3300025909 | Bacteria | 518 |
| 394 | Ga0207684_10051716 | 3300025910 | Bacteria | 3486 |
| 395 | Ga0207684_10170037 | 3300025910 | Bacteria | 1879 |
| 396 | Ga0207684_11451714 | 3300025910 | Unclassified | 560 |
| 397 | Ga0207684_11456788 | 3300025910 | Bacteria | 559 |
| 398 | Ga0207654_10216092 | 3300025911 | Bacteria | 1269 |
| 399 | Ga0207654_10430014 | 3300025911 | Bacteria | 923 |
| 400 | Ga0207707_10017739 | 3300025912 | Bacteria | 6209 |
| 401 | Ga0207707_10040778 | 3300025912 | Bacteria | 4054 |
| 402 | Ga0207707_10168432 | 3300025912 | Bacteria | 1914 |
| 403 | Ga0207707_10255601 | 3300025912 | Bacteria | 1521 |
| 404 | Ga0207707_10297668 | 3300025912 | Bacteria | 1395 |
| 405 | Ga0207707_10486548 | 3300025912 | Bacteria | 1054 |
| 406 | Ga0207707_11317681 | 3300025912 | Bacteria | 579 |
| 407 | Ga0207707_11540361 | 3300025912 | Unclassified | 525 |
| 408 | Ga0207695_10097570 | 3300025913 | Bacteria | 2940 |
| 409 | Ga0207695_10651889 | 3300025913 | Bacteria | 934 |
| 410 | Ga0207695_11233852 | 3300025913 | Unclassified | 628 |
| 411 | Ga0207671_10804682 | 3300025914 | Bacteria | 745 |
| 412 | Ga0207671_10804844 | 3300025914 | Bacteria | 745 |
| 413 | Ga0207693_10045089 | 3300025915 | Bacteria | 3465 |
| 414 | Ga0207693_10901245 | 3300025915 | Bacteria | 678 |
| 415 | Ga0207693_11062808 | 3300025915 | Bacteria | 616 |
| 416 | Ga0207663_10002700 | 3300025916 | Bacteria | 8557 |
| 417 | Ga0207663_10404169 | 3300025916 | Bacteria | 1045 |
| 418 | Ga0207660_10060438 | 3300025917 | Bacteria | 2724 |
| 419 | Ga0207660_10077844 | 3300025917 | Bacteria | 2429 |
| 420 | Ga0207660_10138895 | 3300025917 | Bacteria | 1856 |
| 421 | Ga0207660_10368643 | 3300025917 | Bacteria | 1153 |
| 422 | Ga0207660_10377260 | 3300025917 | Bacteria | 1139 |
| 423 | Ga0207660_10716727 | 3300025917 | Bacteria | 816 |
| 424 | Ga0207662_10021294 | 3300025918 | Bacteria | 3705 |
| 425 | Ga0207657_10002847 | 3300025919 | Bacteria | 18595 |
| 426 | Ga0207657_10006585 | 3300025919 | Bacteria | 12032 |
| 427 | Ga0207657_10006650 | 3300025919 | Bacteria | 11964 |
| 428 | Ga0207657_10067084 | 3300025919 | Bacteria | 3052 |
| 429 | Ga0207657_10084751 | 3300025919 | Bacteria | 2655 |
| 430 | Ga0207657_10207008 | 3300025919 | Bacteria | 1576 |
| 431 | Ga0207657_10305683 | 3300025919 | Bacteria | 1259 |
| 432 | Ga0207657_11216246 | 3300025919 | Bacteria | 572 |
| 433 | Ga0207649_10243340 | 3300025920 | Bacteria | 1292 |
| 434 | Ga0207649_10354871 | 3300025920 | Bacteria | 1086 |
| 435 | Ga0207649_11023326 | 3300025920 | Unclassified | 650 |
| 436 | Ga0207649_11558581 | 3300025920 | Bacteria | 523 |
| 437 | Ga0207652_10027919 | 3300025921 | Bacteria | 4707 |
| 438 | Ga0207652_10029233 | 3300025921 | Bacteria | 4605 |
| 439 | Ga0207652_10034477 | 3300025921 | Bacteria | 4266 |
| 440 | Ga0207652_10041618 | 3300025921 | Bacteria | 3907 |
| 441 | Ga0207652_10189917 | 3300025921 | Bacteria | 1848 |
| 442 | Ga0207652_10253357 | 3300025921 | Bacteria | 1587 |
| 443 | Ga0207652_10832166 | 3300025921 | Bacteria | 818 |
| 444 | Ga0207652_11072071 | 3300025921 | Bacteria | 706 |
| 445 | Ga0207652_11261140 | 3300025921 | Bacteria | 641 |
| 446 | Ga0207646_10054364 | 3300025922 | Bacteria | 3582 |
| 447 | Ga0207646_10072696 | 3300025922 | Bacteria | 3072 |
| 448 | Ga0207646_10455800 | 3300025922 | Bacteria | 1154 |
| 449 | Ga0207646_10596095 | 3300025922 | Bacteria | 992 |
| 450 | Ga0207681_10462177 | 3300025923 | Bacteria | 1034 |
| 451 | Ga0207694_10144531 | 3300025924 | Bacteria | 1914 |
| 452 | Ga0207694_10583569 | 3300025924 | Bacteria | 940 |
| 453 | Ga0207650_11646138 | 3300025925 | Bacteria | 544 |
| 454 | Ga0207659_10432310 | 3300025926 | Bacteria | 1106 |
| 455 | Ga0207659_11005506 | 3300025926 | Bacteria | 717 |
| 456 | Ga0207687_10012897 | 3300025927 | Bacteria | 5462 |
| 457 | Ga0207687_10032610 | 3300025927 | Bacteria | 3528 |
| 458 | Ga0207687_10154421 | 3300025927 | Bacteria | 1755 |
| 459 | Ga0207687_10322853 | 3300025927 | Bacteria | 1250 |
| 460 | Ga0207687_10435359 | 3300025927 | Bacteria | 1085 |
| 461 | Ga0207687_10840248 | 3300025927 | Bacteria | 784 |
| 462 | Ga0207687_10891578 | 3300025927 | Unclassified | 761 |
| 463 | Ga0207700_10016444 | 3300025928 | Bacteria | 4915 |
| 464 | Ga0207700_10304022 | 3300025928 | Bacteria | 1378 |
| 465 | Ga0207700_10508834 | 3300025928 | Unclassified | 1066 |
| 466 | Ga0207700_11116524 | 3300025928 | Bacteria | 705 |
| 467 | Ga0207664_10017486 | 3300025929 | Bacteria | 5258 |
| 468 | Ga0207664_10022929 | 3300025929 | Bacteria | 4670 |
| 469 | Ga0207664_10033418 | 3300025929 | Bacteria | 3951 |
| 470 | Ga0207664_10081648 | 3300025929 | Bacteria | 2631 |
| 471 | Ga0207664_10128921 | 3300025929 | Bacteria | 2127 |
| 472 | Ga0207664_10178797 | 3300025929 | Unclassified | 1820 |
| 473 | Ga0207664_10820123 | 3300025929 | Unclassified | 837 |
| 474 | Ga0207664_11678095 | 3300025929 | Bacteria | 558 |
| 475 | Ga0207664_11806507 | 3300025929 | Bacteria | 534 |
| 476 | Ga0207644_10138772 | 3300025931 | Bacteria | 1870 |
| 477 | Ga0207644_10473147 | 3300025931 | Bacteria | 1031 |
| 478 | Ga0207644_11005189 | 3300025931 | Unclassified | 700 |
| 479 | Ga0207690_10465779 | 3300025932 | Bacteria | 1018 |
| 480 | Ga0207690_10699821 | 3300025932 | Bacteria | 833 |
| 481 | Ga0207690_11128864 | 3300025932 | Unclassified | 654 |
| 482 | Ga0207690_11203703 | 3300025932 | Bacteria | 632 |
| 483 | Ga0207690_11262684 | 3300025932 | Unclassified | 617 |
| 484 | Ga0207706_10112274 | 3300025933 | Bacteria | 2398 |
| 485 | Ga0207706_10490682 | 3300025933 | Bacteria | 1061 |
| 486 | Ga0207706_10570963 | 3300025933 | Bacteria | 973 |
| 487 | Ga0207706_11327520 | 3300025933 | Bacteria | 593 |
| 488 | Ga0207686_10027322 | 3300025934 | Bacteria | 3341 |
| 489 | Ga0207686_10185373 | 3300025934 | Bacteria | 1479 |
| 490 | Ga0207709_10026392 | 3300025935 | Bacteria | 3336 |
| 491 | Ga0207709_10609662 | 3300025935 | Bacteria | 865 |
| 492 | Ga0207669_10144446 | 3300025937 | Bacteria | 1657 |
| 493 | Ga0207669_10432598 | 3300025937 | Unclassified | 1038 |
| 494 | Ga0207669_11099164 | 3300025937 | Bacteria | 671 |
| 495 | Ga0207704_10259951 | 3300025938 | Bacteria | 1308 |
| 496 | Ga0207665_10002480 | 3300025939 | Bacteria | 12442 |
| 497 | Ga0207665_10040336 | 3300025939 | Bacteria | 3114 |
| 498 | Ga0207691_11008129 | 3300025940 | Bacteria | 695 |
| 499 | Ga0207691_11025530 | 3300025940 | Bacteria | 688 |
| 500 | Ga0207711_10986529 | 3300025941 | Unclassified | 782 |
| 501 | Ga0207711_11202080 | 3300025941 | Bacteria | 700 |
| 502 | Ga0207689_10525776 | 3300025942 | Bacteria | 992 |
| 503 | Ga0207689_10717858 | 3300025942 | Bacteria | 843 |
| 504 | Ga0207661_10018170 | 3300025944 | Bacteria | 5224 |
| 505 | Ga0207661_10049001 | 3300025944 | Bacteria | 3360 |
| 506 | Ga0207661_10131724 | 3300025944 | Bacteria | 2142 |
| 507 | Ga0207661_10228188 | 3300025944 | Bacteria | 1648 |
| 508 | Ga0207661_10759907 | 3300025944 | Unclassified | 892 |
| 509 | Ga0207661_11191541 | 3300025944 | Unclassified | 701 |
| 510 | Ga0207661_11192909 | 3300025944 | Bacteria | 700 |
| 511 | Ga0207679_10053927 | 3300025945 | Bacteria | 2957 |
| 512 | Ga0207679_11481832 | 3300025945 | Unclassified | 622 |
| 513 | Ga0207667_10743563 | 3300025949 | Bacteria | 980 |
| 514 | Ga0207667_10909665 | 3300025949 | Bacteria | 871 |
| 515 | Ga0207667_10958254 | 3300025949 | Unclassified | 845 |
| 516 | Ga0207712_10063875 | 3300025961 | Bacteria | 2622 |
| 517 | Ga0207712_10085150 | 3300025961 | Bacteria | 2312 |
| 518 | Ga0207712_10090041 | 3300025961 | Bacteria | 2257 |
| 519 | Ga0207712_10314741 | 3300025961 | Bacteria | 1289 |
| 520 | Ga0207668_10418927 | 3300025972 | Bacteria | 1136 |
| 521 | Ga0207668_11194671 | 3300025972 | Bacteria | 683 |
| 522 | Ga0207640_10432491 | 3300025981 | Bacteria | 1080 |
| 523 | Ga0207640_10746593 | 3300025981 | Bacteria | 843 |
| 524 | Ga0207640_11899758 | 3300025981 | Unclassified | 539 |
| 525 | Ga0207677_10116763 | 3300026023 | Bacteria | 1999 |
| 526 | Ga0207677_10694747 | 3300026023 | Bacteria | 902 |
| 527 | Ga0207677_11154253 | 3300026023 | Bacteria | 708 |
| 528 | Ga0207703_10979135 | 3300026035 | Unclassified | 811 |
| 529 | Ga0207678_10066743 | 3300026067 | Unclassified | 3088 |
| 530 | Ga0207678_10163639 | 3300026067 | Bacteria | 1900 |
| 531 | Ga0207678_10418463 | 3300026067 | Bacteria | 1162 |
| 532 | Ga0207678_11644659 | 3300026067 | Unclassified | 565 |
| 533 | Ga0207708_10004691 | 3300026075 | Bacteria | 10054 |
| 534 | Ga0207708_11207279 | 3300026075 | Bacteria | 661 |
| 535 | Ga0207708_11569577 | 3300026075 | Bacteria | 578 |
| 536 | Ga0207702_10137672 | 3300026078 | Unclassified | 2205 |
| 537 | Ga0207702_10526304 | 3300026078 | Bacteria | 1154 |
| 538 | Ga0207702_10540184 | 3300026078 | Bacteria | 1139 |
| 539 | Ga0207702_10890913 | 3300026078 | Bacteria | 881 |
| 540 | Ga0207702_12209432 | 3300026078 | Unclassified | 539 |
| 541 | Ga0207641_10737514 | 3300026088 | Bacteria | 972 |
| 542 | Ga0207641_12219937 | 3300026088 | Bacteria | 549 |
| 543 | Ga0207648_10020890 | 3300026089 | Bacteria | 5895 |
| 544 | Ga0207648_10530173 | 3300026089 | Bacteria | 1080 |
| 545 | Ga0207648_10885594 | 3300026089 | Bacteria | 833 |
| 546 | Ga0207674_10063055 | 3300026116 | Bacteria | 3742 |
| 547 | Ga0207674_12068328 | 3300026116 | Unclassified | 534 |
| 548 | Ga0207674_12083305 | 3300026116 | Bacteria | 531 |
| 549 | Ga0207675_100017398 | 3300026118 | Bacteria | 6710 |
| 550 | Ga0207675_100293238 | 3300026118 | Bacteria | 1583 |
| 551 | Ga0207675_100883619 | 3300026118 | Bacteria | 909 |
| 552 | Ga0207675_101315903 | 3300026118 | Bacteria | 743 |
| 553 | Ga0207683_10279417 | 3300026121 | Bacteria | 1526 |
| 554 | Ga0207683_10447165 | 3300026121 | Bacteria | 1191 |
| 555 | Ga0207683_10806431 | 3300026121 | Bacteria | 871 |
| 556 | Ga0207698_10104318 | 3300026142 | Unclassified | 2358 |
| 557 | Ga0207698_10126397 | 3300026142 | Bacteria | 2175 |
| 558 | Ga0207698_10162402 | 3300026142 | Bacteria | 1956 |
| 559 | Ga0207698_11754066 | 3300026142 | Bacteria | 636 |
| 560 | Ga0207698_11770053 | 3300026142 | Bacteria | 633 |
| 561 | Ga0207698_12166051 | 3300026142 | Unclassified | 569 |
| 562 | Ga0209966_1040336 | 3300027695 | Bacteria | 971 |
| 563 | Ga0268266_11514632 | 3300028379 | Bacteria | 646 |
| 564 | Ga0268266_11975673 | 3300028379 | Bacteria | 557 |
| 565 | Ga0268265_10107935 | 3300028380 | Bacteria | 2265 |
| 566 | Ga0268265_10386150 | 3300028380 | Bacteria | 1290 |
| 567 | Ga0268264_10504599 | 3300028381 | Bacteria | 1180 |
| 568 | Ga0265337_1033629 | 3300028556 | Bacteria | 1512 |
| 569 | Ga0265337_1114612 | 3300028556 | Bacteria | 731 |
| 570 | Ga0265326_10045479 | 3300028558 | Bacteria | 1245 |
| 571 | Ga0265319_1002177 | 3300028563 | Bacteria | 10916 |
| 572 | Ga0265334_10039417 | 3300028573 | Bacteria | 1854 |
| 573 | Ga0265318_10006074 | 3300028577 | Bacteria | 5597 |
| 574 | Ga0265318_10130749 | 3300028577 | Bacteria | 923 |
| 575 | Ga0265322_10012994 | 3300028654 | Bacteria | 2410 |
| 576 | Ga0265322_10070747 | 3300028654 | Bacteria | 990 |
| 577 | Ga0265338_10011194 | 3300028800 | Bacteria | 10397 |
| 578 | Ga0265338_10082600 | 3300028800 | Bacteria | 2689 |
| 579 | Ga0265324_10061275 | 3300029957 | Bacteria | 1286 |
| 580 | Ga0265330_10143920 | 3300031235 | Bacteria | 1013 |
| 581 | Ga0265328_10148088 | 3300031239 | Bacteria | 883 |
| 582 | Ga0265328_10199204 | 3300031239 | Bacteria | 760 |
| 583 | Ga0265320_10016472 | 3300031240 | Bacteria | 4140 |
| 584 | Ga0265320_10250243 | 3300031240 | Unclassified | 786 |
| 585 | Ga0265320_10472094 | 3300031240 | Bacteria | 554 |
| 586 | Ga0265325_10105746 | 3300031241 | Bacteria | 1373 |
| 587 | Ga0265325_10119360 | 3300031241 | Bacteria | 1273 |
| 588 | Ga0265329_10023651 | 3300031242 | Bacteria | 2045 |
| 589 | Ga0265340_10063196 | 3300031247 | Bacteria | 1767 |
| 590 | Ga0265339_10028523 | 3300031249 | Bacteria | 3173 |
| 591 | Ga0265331_10090744 | 3300031250 | Bacteria | 1412 |
| 592 | Ga0265327_10011377 | 3300031251 | Bacteria | 6133 |
| 593 | Ga0265327_10026939 | 3300031251 | Bacteria | 3318 |
| 594 | Ga0265327_10123636 | 3300031251 | Bacteria | 1224 |
| 595 | Ga0265316_10018516 | 3300031344 | Bacteria | 5980 |
| 596 | Ga0265316_10045508 | 3300031344 | Bacteria | 3482 |
| 597 | Ga0307408_100027257 | 3300031548 | Bacteria | 3935 |
| 598 | Ga0307408_100937474 | 3300031548 | Unclassified | 794 |
| 599 | Ga0265313_10054583 | 3300031595 | Unclassified | 1897 |
| 600 | Ga0265313_10060798 | 3300031595 | Bacteria | 1770 |
| 601 | Ga0265314_10009672 | 3300031711 | Bacteria | 8117 |
| 602 | Ga0265314_10038259 | 3300031711 | Bacteria | 3468 |
| 603 | Ga0265342_10009927 | 3300031712 | Bacteria | 6656 |
| 604 | Ga0265342_10213930 | 3300031712 | Bacteria | 1041 |
| 605 | Ga0265342_10383401 | 3300031712 | Bacteria | 728 |
| 606 | Ga0307405_10101774 | 3300031731 | Unclassified | 1928 |
| 607 | Ga0307405_10384877 | 3300031731 | Unclassified | 1093 |
| 608 | Ga0307413_10390205 | 3300031824 | Unclassified | 1087 |
| 609 | Ga0307410_10011770 | 3300031852 | Bacteria | 5022 |
| 610 | Ga0307410_10528024 | 3300031852 | Bacteria | 975 |
| 611 | Ga0307406_10060794 | 3300031901 | Bacteria | 2437 |
| 612 | Ga0307407_10000662 | 3300031903 | Bacteria | 11078 |
| 613 | Ga0307412_10247954 | 3300031911 | Unclassified | 1381 |
| 614 | Ga0307412_11968602 | 3300031911 | Bacteria | 540 |
| 615 | Ga0307409_100017482 | 3300031995 | Bacteria | 4782 |
| 616 | Ga0307409_102090840 | 3300031995 | Bacteria | 596 |
| 617 | Ga0307416_100002728 | 3300032002 | Bacteria | 10236 |
| 618 | Ga0307414_10063369 | 3300032004 | Bacteria | 2627 |
| 619 | Ga0307411_10055307 | 3300032005 | Bacteria | 2610 |
| 620 | Ga0307415_100016833 | 3300032126 | Bacteria | 4369 |
| 621 | Ga0307415_102047354 | 3300032126 | Unclassified | 558 |
| 622 | Ga0373950_0052860 | 3300034818 | Bacteria | 801 |
| 623 | Ga0373938_0126586 | 3300034957 | Bacteria | 663 |
| 624 | Ga0373926_0005523 | 3300035083 | Bacteria | 4171 |
| 625 | Ga0373928_0150219 | 3300035084 | Bacteria | 644 |
| 626 | Ga0373934_0135754 | 3300035086 | Bacteria | 1005 |
| 627 | Ga0373944_0027607 | 3300035089 | Bacteria | 1684 |
| 628 | Ga0373949_0036587 | 3300035090 | Bacteria | 1191 |
| 629 | Ga0373932_0222584 | 3300035112 | Unclassified | 679 |
| 630 | Ga0373932_0459968 | 3300035112 | Bacteria | 501 |
| 631 | Ga0373945_0022615 | 3300035116 | Bacteria | 2167 |
| 632 | Ga0373953_0233253 | 3300035117 | Unclassified | 798 |
| 633 | Ga0373954_0045163 | 3300035118 | Bacteria | 2058 |
| 634 | Ga0373956_0170340 | 3300035119 | Bacteria | 1028 |
| 635 | Ga0373960_0116091 | 3300035121 | Unclassified | 884 |
| 636 | Ga0373960_0341926 | 3300035121 | Bacteria | 565 |
| 637 | Ga0373960_0416142 | 3300035121 | Unclassified | 521 |
| 638 | Ga0373943_0001283 | 3300035170 | Bacteria | 11248 |
| 639 | Ga0373943_0657228 | 3300035170 | Bacteria | 620 |
| 640 | Ga0373946_0046255 | 3300035171 | Bacteria | 1803 |
| 641 | Ga0373955_0448203 | 3300035172 | Unclassified | 786 |
| 642 | Ga0373955_1032370 | 3300035172 | Bacteria | 506 |
| 643 | Ga0373942_0085251 | 3300035207 | Bacteria | 944 |
| 644 | Ga0373962_0039778 | 3300035242 | Unclassified | 1321 |
| 645 | Ga0373931_1063960 | 3300035691 | Bacteria | 550 |
| 646 | Ga0373931_1106373 | 3300035691 | Bacteria | 540 |
| 647 | Ga0373935_0020364 | 3300035692 | Bacteria | 4053 |
| 648 | Ga0373935_0064209 | 3300035692 | Bacteria | 2354 |
| 649 | Ga0373935_0943052 | 3300035692 | Unclassified | 640 |
| 650 | Ga0373927_0259318 | 3300035695 | Bacteria | 1143 |
| 651 | Ga0373933_0244472 | 3300035724 | Bacteria | 1155 |
| 652 | Ga0373947_0002113 | 3300035725 | Bacteria | 12113 |
| 653 | Ga0373937_0052542 | 3300036401 | Bacteria | 3736 |
| 654 | Ga0373937_0129914 | 3300036401 | Bacteria | 2352 |
| 655 | Ga0373925_0001501 | 3300037068 | Bacteria | 19995 |
| 656 | Ga0373925_0232012 | 3300037068 | Bacteria | 1476 |
| 657 | Ga0373925_1696008 | 3300037068 | Bacteria | 516 |
| 658 | Ga0373925_1725107 | 3300037068 | Unclassified | 511 |
| 659 | Ga0395899_0284953 | 3300037312 | Bacteria | 1123 |
| 660 | Ga0395899_0478665 | 3300037312 | Bacteria | 811 |
| 661 | Ga0395900_0093322 | 3300037418 | Bacteria | 3092 |
| 662 | Ga0395900_0173074 | 3300037418 | Bacteria | 2197 |
| 663 | Ga0395900_1741559 | 3300037418 | Unclassified | 534 |
| 664 | Ga0395898_0027064 | 3300037466 | Bacteria | 5761 |
| 665 | Ga0395898_0094323 | 3300037466 | Bacteria | 2876 |
| 666 | Ga0395898_0337135 | 3300037466 | Unclassified | 1438 |
| 667 | Ga0395905_0190867 | 3300037471 | Bacteria | 1922 |
| 668 | Ga0395905_0196229 | 3300037471 | Bacteria | 1893 |
| 669 | Ga0395905_0367710 | 3300037471 | Bacteria | 1331 |
| 670 | Ga0395905_1297088 | 3300037471 | Bacteria | 632 |
| 671 | Ga0395901_0130635 | 3300038443 | Bacteria | 2639 |
| 672 | Ga0395901_0385734 | 3300038443 | Bacteria | 1441 |
| 673 | Ga0395901_0756842 | 3300038443 | Bacteria | 964 |
| 674 | Ga0395901_1548679 | 3300038443 | Bacteria | 618 |
| 675 | Ga0395901_1587519 | 3300038443 | Unclassified | 608 |
| 676 | Ga0436360_0548929 | 3300039438 | Bacteria | 1018 |
| 677 | Ga0436360_0556691 | 3300039438 | Bacteria | 7187 |
| 678 | Ga0436362_0539041 | 3300039453 | Unclassified | 745 |
| 679 | Ga0439439_0019644 | 3300041406 | Bacteria | 1678 |
| 680 | Ga0451853_1447046 | 3300041512 | Bacteria | 714 |
| 681 | Ga0451853_2374780 | 3300041512 | Bacteria | 930 |
| 682 | Ga0451853_2840255 | 3300041512 | Bacteria | 540 |
| 683 | Ga0439431_0005605 | 3300041997 | Bacteria | 2769 |
| 684 | Ga0439433_0001351 | 3300041999 | Bacteria | 5049 |
| 685 | Ga0439437_044543 | 3300042000 | Bacteria | 580 |
| 686 | Ga0439442_119542 | 3300042002 | Bacteria | 576 |
| 687 | Ga0439449_0048052 | 3300042007 | Bacteria | 1580 |
| 688 | Ga0439457_021945 | 3300042014 | Bacteria | 1414 |
| 689 | Ga0439462_0098367 | 3300042015 | Bacteria | 805 |
| 690 | Ga0450920_007751 | 3300042122 | Bacteria | 1949 |
| 691 | Ga0450923_054944 | 3300042125 | Unclassified | 861 |
| 692 | Ga0450923_106515 | 3300042125 | Bacteria | 651 |
| 693 | Ga0450898_103249 | 3300042134 | Bacteria | 597 |
| 694 | Ga0450910_026494 | 3300042147 | Bacteria | 896 |
| 695 | Ga0439446_0006869 | 3300042156 | Bacteria | 2980 |
| 696 | Ga0439458_0102954 | 3300042157 | Bacteria | 742 |
| 697 | Ga0439434_0010766 | 3300042435 | Bacteria | 2698 |
| 698 | Ga0439435_0284375 | 3300042436 | Bacteria | 563 |
| 699 | Ga0450918_064626 | 3300042531 | Bacteria | 680 |
| 700 | Ga0451577_0194803 | 3300042876 | Bacteria | 1829 |
| 701 | Ga0466965_0297133 | 3300044683 | Unclassified | 875 |
| 702 | Ga0466965_0327523 | 3300044683 | Unclassified | 835 |
| 703 | Ga0466966_0209753 | 3300044684 | Bacteria | 1177 |
| 704 | Ga0466961_0019364 | 3300044693 | Bacteria | 4377 |
| 705 | Ga0466961_0382081 | 3300044693 | Bacteria | 855 |
| 706 | Ga0466963_0001805 | 3300044694 | Bacteria | 11654 |
| 707 | Ga0466963_0003165 | 3300044694 | Bacteria | 9347 |
| 708 | Ga0466963_0021168 | 3300044694 | Bacteria | 4098 |
| 709 | Ga0466963_0113320 | 3300044694 | Bacteria | 1862 |
| 710 | Ga0466963_0129442 | 3300044694 | Bacteria | 1742 |
| 711 | Ga0466964_0003980 | 3300044706 | Bacteria | 5433 |
| 712 | Ga0466964_0006104 | 3300044706 | Bacteria | 4491 |
| 713 | Ga0466964_0016278 | 3300044706 | Bacteria | 2837 |
| 714 | Ga0466964_0018404 | 3300044706 | Bacteria | 2681 |
| 715 | Ga0466964_0034357 | 3300044706 | Bacteria | 2023 |
| 716 | Ga0466964_0661989 | 3300044706 | Unclassified | 578 |
| 717 | Ga0466971_0028641 | 3300044719 | Bacteria | 2492 |
| 718 | Ga0466971_0042813 | 3300044719 | Bacteria | 2035 |
| 719 | Ga0466971_0082844 | 3300044719 | Bacteria | 1464 |
| 720 | Ga0466971_0561136 | 3300044719 | Bacteria | 567 |
| 721 | Ga0466968_0000933 | 3300044735 | Bacteria | 10298 |
| 722 | Ga0466968_0006910 | 3300044735 | Bacteria | 4297 |
| 723 | Ga0466968_0077786 | 3300044735 | Bacteria | 1453 |
| 724 | Ga0466968_0098167 | 3300044735 | Bacteria | 1305 |
| 725 | Ga0466968_0389868 | 3300044735 | Bacteria | 681 |
| 726 | Ga0466970_0922567 | 3300044765 | Bacteria | 514 |
| 727 | Ga0466957_0007794 | 3300044842 | Bacteria | 6064 |
| 728 | Ga0466957_0114378 | 3300044842 | Bacteria | 1714 |
| 729 | Ga0466957_0219670 | 3300044842 | Bacteria | 1254 |
| 730 | Ga0466957_0676792 | 3300044842 | Bacteria | 727 |
| 731 | Ga0466960_0038972 | 3300044901 | Bacteria | 2238 |
| 732 | Ga0466960_0477670 | 3300044901 | Unclassified | 728 |
| 733 | Ga0466960_0528884 | 3300044901 | Bacteria | 693 |
| 734 | Ga0466959_0027231 | 3300045049 | Bacteria | 4239 |
| 735 | Ga0466959_0125664 | 3300045049 | Bacteria | 1821 |
| 736 | Ga0466959_0263408 | 3300045049 | Bacteria | 1186 |
| 737 | Ga0466959_0371445 | 3300045049 | Bacteria | 974 |
| 738 | Ga0451576_0979851 | 3300045051 | Bacteria | 886 |
| 739 | Ga0466958_0001480 | 3300045836 | Bacteria | 11201 |
| 740 | Ga0466958_0057280 | 3300045836 | Bacteria | 2368 |
| 741 | Ga0466958_0081027 | 3300045836 | Bacteria | 1997 |
| 742 | Ga0466958_0248521 | 3300045836 | Bacteria | 1137 |
| 743 | Ga0466958_0683229 | 3300045836 | Bacteria | 668 |
| 744 | Ga0466967_0005380 | 3300045976 | Bacteria | 8862 |
| 745 | Ga0466967_0006129 | 3300045976 | Bacteria | 8460 |
| 746 | Ga0466967_0006388 | 3300045976 | Bacteria | 8332 |
| 747 | Ga0466967_0006609 | 3300045976 | Bacteria | 8238 |
| 748 | Ga0466967_0008400 | 3300045976 | Bacteria | 7559 |
| 749 | Ga0466967_0010274 | 3300045976 | Bacteria | 7007 |
| 750 | Ga0466967_0012465 | 3300045976 | Bacteria | 6505 |
| 751 | Ga0466967_0029028 | 3300045976 | Bacteria | 4624 |
| 752 | Ga0466967_0084154 | 3300045976 | Bacteria | 2878 |
| 753 | Ga0466967_0118967 | 3300045976 | Bacteria | 2437 |
| 754 | Ga0466967_0135873 | 3300045976 | Bacteria | 2286 |
| 755 | Ga0466967_0173397 | 3300045976 | Bacteria | 2030 |
| 756 | Ga0466967_0182389 | 3300045976 | Bacteria | 1981 |
| 757 | Ga0466967_0201238 | 3300045976 | Bacteria | 1886 |
| 758 | Ga0466967_0317424 | 3300045976 | Bacteria | 1502 |
| 759 | Ga0466967_0716619 | 3300045976 | Bacteria | 991 |
| 760 | Ga0466967_0742559 | 3300045976 | Bacteria | 973 |
| 761 | Ga0466967_1338725 | 3300045976 | Bacteria | 713 |
| 762 | Ga0466967_1913969 | 3300045976 | Bacteria | 590 |
| 763 | Ga0466967_2165880 | 3300045976 | Bacteria | 552 |
| 764 | Ga0495592_0002297 | 3300046454 | Bacteria | 13484 |
| 765 | Ga0495592_0051471 | 3300046454 | Bacteria | 3059 |
| 766 | Ga0495592_0132620 | 3300046454 | Bacteria | 1741 |
| 767 | Ga0495603_0008076 | 3300046455 | Bacteria | 6359 |
| 768 | Ga0495629_0073277 | 3300046459 | Bacteria | 2391 |
| 769 | Ga0495629_0156180 | 3300046459 | Bacteria | 1585 |
| 770 | Ga0495629_0255970 | 3300046459 | Unclassified | 1204 |
| 771 | Ga0495629_1108703 | 3300046459 | Unclassified | 511 |
| 772 | Ga0495641_0005407 | 3300046461 | Bacteria | 8637 |
| 773 | Ga0495641_0042686 | 3300046461 | Bacteria | 2100 |
| 774 | Ga0495651_0129457 | 3300046462 | Bacteria | 1844 |
| 775 | Ga0495651_0271899 | 3300046462 | Bacteria | 1148 |
| 776 | Ga0495653_0025614 | 3300046463 | Bacteria | 4736 |
| 777 | Ga0495653_0151727 | 3300046463 | Bacteria | 1618 |
| 778 | Ga0495580_0033594 | 3300046472 | Bacteria | 3695 |
| 779 | Ga0495582_0028215 | 3300046473 | Bacteria | 3080 |
| 780 | Ga0495582_0046446 | 3300046473 | Bacteria | 2391 |
| 781 | Ga0495582_0054842 | 3300046473 | Bacteria | 2197 |
| 782 | Ga0495582_0385323 | 3300046473 | Bacteria | 808 |
| 783 | Ga0495639_0000977 | 3300046475 | Bacteria | 12876 |
| 784 | Ga0495662_0047065 | 3300046476 | Bacteria | 2082 |
| 785 | Ga0495662_0520872 | 3300046476 | Bacteria | 583 |
| 786 | Ga0495664_0014004 | 3300046477 | Bacteria | 4543 |
| 787 | Ga0495664_0029420 | 3300046477 | Bacteria | 3213 |
| 788 | Ga0495584_0264036 | 3300046491 | Unclassified | 875 |
| 789 | Ga0495584_0265452 | 3300046491 | Unclassified | 873 |
| 790 | Ga0495585_0218318 | 3300046492 | Bacteria | 963 |
| 791 | Ga0495585_0340090 | 3300046492 | Unclassified | 731 |
| 792 | Ga0495585_0445109 | 3300046492 | Unclassified | 620 |
| 793 | Ga0495585_0575875 | 3300046492 | Unclassified | 531 |
| 794 | Ga0495594_0123707 | 3300046499 | Bacteria | 1463 |
| 795 | Ga0495594_0336804 | 3300046499 | Bacteria | 859 |
| 796 | Ga0495596_0139657 | 3300046500 | Unclassified | 941 |
| 797 | Ga0495608_0039334 | 3300046511 | Bacteria | 3170 |
| 798 | Ga0495608_0220896 | 3300046511 | Bacteria | 1189 |
| 799 | Ga0495608_0779540 | 3300046511 | Unclassified | 565 |
| 800 | Ga0495618_0014789 | 3300046514 | Bacteria | 4760 |
| 801 | Ga0495618_0028699 | 3300046514 | Bacteria | 3468 |
| 802 | Ga0495628_0026160 | 3300046516 | Bacteria | 4763 |
| 803 | Ga0495628_0129262 | 3300046516 | Bacteria | 1933 |
| 804 | Ga0495628_0151690 | 3300046516 | Unclassified | 1765 |
| 805 | Ga0495630_0598800 | 3300046517 | Bacteria | 845 |
| 806 | Ga0495630_0766400 | 3300046517 | Bacteria | 737 |
| 807 | Ga0495631_0177822 | 3300046518 | Bacteria | 912 |
| 808 | Ga0495637_0253596 | 3300046520 | Bacteria | 633 |
| 809 | Ga0495644_0147802 | 3300046523 | Bacteria | 899 |
| 810 | Ga0495644_0294691 | 3300046523 | Bacteria | 634 |
| 811 | Ga0495644_0378766 | 3300046523 | Unclassified | 559 |
| 812 | Ga0495663_0063825 | 3300046525 | Unclassified | 1162 |
| 813 | Ga0495666_0003161 | 3300046526 | Bacteria | 8288 |
| 814 | Ga0495642_0151334 | 3300046528 | Unclassified | 1004 |
| 815 | Ga0495652_0023704 | 3300046529 | Bacteria | 5439 |
| 816 | Ga0495652_0045218 | 3300046529 | Bacteria | 3787 |
| 817 | Ga0495652_0160562 | 3300046529 | Bacteria | 1746 |
| 818 | Ga0495652_0635670 | 3300046529 | Bacteria | 724 |
| 819 | Ga0495665_0003374 | 3300046531 | Bacteria | 8667 |
| 820 | Ga0495640_0030108 | 3300046533 | Bacteria | 3889 |
| 821 | Ga0495640_0620661 | 3300046533 | Bacteria | 652 |
| 822 | Ga0495586_0004202 | 3300046535 | Bacteria | 7714 |
| 823 | Ga0495586_0791265 | 3300046535 | Unclassified | 547 |
| 824 | Ga0495587_0121823 | 3300046536 | Bacteria | 1494 |
| 825 | Ga0495587_0207312 | 3300046536 | Bacteria | 1107 |
| 826 | Ga0495645_0040289 | 3300046543 | Bacteria | 3408 |
| 827 | Ga0495633_0407679 | 3300046558 | Unclassified | 615 |
| 828 | Ga0495667_0028876 | 3300046559 | Bacteria | 3734 |
| 829 | Ga0495656_0281531 | 3300046615 | Unclassified | 848 |
| 830 | Ga0495656_0460219 | 3300046615 | Bacteria | 671 |
| 831 | Ga0495656_0575761 | 3300046615 | Unclassified | 601 |
| 832 | Ga0495668_0848606 | 3300046616 | Unclassified | 506 |
| 833 | Ga0495634_0012359 | 3300046642 | Bacteria | 6183 |
| 834 | Ga0495634_0319116 | 3300046642 | Unclassified | 936 |
| 835 | Ga0495611_0119800 | 3300046648 | Bacteria | 1227 |
| 836 | Ga0495635_0015964 | 3300046663 | Bacteria | 5245 |
| 837 | Ga0495635_0018898 | 3300046663 | Bacteria | 4809 |
| 838 | Ga0495635_0399806 | 3300046663 | Bacteria | 913 |
| 839 | Ga0495635_0629829 | 3300046663 | Bacteria | 699 |
| 840 | Ga0495588_0190208 | 3300046674 | Archaea | 1084 |
| 841 | Ga0495657_0043885 | 3300046675 | Bacteria | 3045 |
| 842 | Ga0495657_0351878 | 3300046675 | Unclassified | 872 |
| 843 | Ga0495657_0546213 | 3300046675 | Bacteria | 673 |
| 844 | Ga0495657_0686293 | 3300046675 | Unclassified | 589 |
| 845 | Ga0495657_0863333 | 3300046675 | Bacteria | 515 |
| 846 | Ga0495599_0040124 | 3300046678 | Bacteria | 2940 |
| 847 | Ga0495599_0109794 | 3300046678 | Bacteria | 1718 |
| 848 | Ga0495599_0717051 | 3300046678 | Unclassified | 576 |
| 849 | Ga0495599_0844750 | 3300046678 | Bacteria | 521 |
| 850 | Ga0495646_0083812 | 3300046680 | Bacteria | 1852 |
| 851 | Ga0495646_0119813 | 3300046680 | Bacteria | 1490 |
| 852 | Ga0495646_0225973 | 3300046680 | Bacteria | 1010 |
| 853 | Ga0495647_0001014 | 3300046681 | Bacteria | 8554 |
| 854 | Ga0495647_0034678 | 3300046681 | Bacteria | 1891 |
| 855 | Ga0495647_0093667 | 3300046681 | Bacteria | 1235 |
| 856 | Ga0495647_0472601 | 3300046681 | Bacteria | 582 |
| 857 | Ga0495658_0003312 | 3300046683 | Bacteria | 7996 |
| 858 | Ga0495658_0142464 | 3300046683 | Bacteria | 1467 |
| 859 | Ga0495658_0313315 | 3300046683 | Archaea | 994 |
| 860 | Ga0495658_0886443 | 3300046683 | Bacteria | 570 |
| 861 | Ga0495613_0051740 | 3300046689 | Bacteria | 3026 |
| 862 | Ga0495613_0091801 | 3300046689 | Bacteria | 2199 |
| 863 | Ga0495613_0247899 | 3300046689 | Bacteria | 1244 |
| 864 | Ga0495613_0254193 | 3300046689 | Bacteria | 1226 |
| 865 | Ga0495624_0017657 | 3300046690 | Bacteria | 4784 |
| 866 | Ga0495624_0684395 | 3300046690 | Bacteria | 609 |
| 867 | Ga0495670_0193540 | 3300046691 | Unclassified | 1076 |
| 868 | Ga0495670_0427378 | 3300046691 | Bacteria | 717 |
| 869 | Ga0495589_0229086 | 3300046794 | Bacteria | 872 |
| 870 | Ga0495600_0040286 | 3300046809 | Bacteria | 3042 |
| 871 | Ga0495600_0190434 | 3300046809 | Bacteria | 1319 |
| 872 | Ga0495581_0434870 | 3300047315 | Bacteria | 764 |
| 873 | Ga0495581_0833567 | 3300047315 | Bacteria | 528 |
| 874 | Ga0495674_0122532 | 3300047319 | Bacteria | 2196 |
| 875 | Ga0495674_0208392 | 3300047319 | Bacteria | 1620 |
| 876 | Ga0495674_0354155 | 3300047319 | Bacteria | 1191 |
| 877 | Ga0495674_0763941 | 3300047319 | Unclassified | 754 |
| 878 | Ga0495676_0133206 | 3300047321 | Bacteria | 1791 |
| 879 | Ga0495676_0701596 | 3300047321 | Bacteria | 655 |
| 880 | Ga0495680_0012102 | 3300047322 | Bacteria | 7613 |
| 881 | Ga0495680_0048947 | 3300047322 | Bacteria | 3315 |
| 882 | Ga0495680_0059742 | 3300047322 | Bacteria | 2941 |
| 883 | Ga0495680_0427291 | 3300047322 | Bacteria | 910 |
| 884 | Ga0495675_0420239 | 3300047444 | Bacteria | 777 |
| 885 | Ga0495677_0461855 | 3300047445 | Bacteria | 503 |
| 886 | Ga0495679_039148 | 3300047446 | Bacteria | 1480 |
| 887 | Ga0495684_0030753 | 3300047471 | Bacteria | 4122 |
| 888 | Ga0495684_0066473 | 3300047471 | Bacteria | 2741 |
| 889 | Ga0495684_0178781 | 3300047471 | Bacteria | 1574 |
| 890 | Ga0495593_0008235 | 3300047673 | Bacteria | 6065 |
| 891 | Ga0495593_0504437 | 3300047673 | Bacteria | 607 |
| 892 | Ga0495602_0083189 | 3300048088 | Bacteria | 2683 |
| 893 | Ga0495602_0832330 | 3300048088 | Bacteria | 618 |
| 894 | Ga0495614_0000678 | 3300048089 | Bacteria | 14326 |
| 895 | Ga0496100_0036846 | 3300048903 | Bacteria | 3088 |
| 896 | Ga0496100_0165760 | 3300048903 | Bacteria | 1587 |
| 897 | Ga0496100_0306190 | 3300048903 | Bacteria | 1190 |
| 898 | Ga0496100_0491275 | 3300048903 | Bacteria | 945 |
| 899 | Ga0496101_0014314 | 3300048904 | Bacteria | 5327 |
| 900 | Ga0496101_0040024 | 3300048904 | Bacteria | 3337 |
| 901 | Ga0496101_0120919 | 3300048904 | Bacteria | 1980 |
| 902 | Ga0496101_0125189 | 3300048904 | Bacteria | 1947 |
| 903 | Ga0496101_0374106 | 3300048904 | Bacteria | 1120 |
| 904 | Ga0496101_0805107 | 3300048904 | Bacteria | 741 |
| 905 | Ga0496101_1221646 | 3300048904 | Bacteria | 589 |
| 906 | Ga0496102_0003853 | 3300048905 | Bacteria | 12703 |
| 907 | Ga0496102_0035747 | 3300048905 | Bacteria | 4473 |
| 908 | Ga0496102_0133017 | 3300048905 | Bacteria | 2329 |
| 909 | Ga0496102_0409459 | 3300048905 | Bacteria | 1274 |
| 910 | Ga0496102_1823965 | 3300048905 | Bacteria | 525 |
| 911 | Ga0496103_0010803 | 3300048906 | Bacteria | 5404 |
| 912 | Ga0496103_0022071 | 3300048906 | Bacteria | 3831 |
| 913 | Ga0496103_0247555 | 3300048906 | Bacteria | 1147 |
| 914 | Ga0496103_0266849 | 3300048906 | Bacteria | 1101 |
| 915 | Ga0496103_0417201 | 3300048906 | Bacteria | 862 |
| 916 | Ga0496103_0476332 | 3300048906 | Bacteria | 800 |
| 917 | Ga0496103_0981440 | 3300048906 | Bacteria | 527 |
| 918 | Ga0496104_0001019 | 3300048907 | Bacteria | 23962 |
| 919 | Ga0496104_0009095 | 3300048907 | Bacteria | 8836 |
| 920 | Ga0496104_0021364 | 3300048907 | Bacteria | 5942 |
| 921 | Ga0496104_0037416 | 3300048907 | Bacteria | 4539 |
| 922 | Ga0496104_0044560 | 3300048907 | Bacteria | 4168 |
| 923 | Ga0496104_0067345 | 3300048907 | Bacteria | 3401 |
| 924 | Ga0496104_0068829 | 3300048907 | Bacteria | 3363 |
| 925 | Ga0496105_0142120 | 3300048908 | Bacteria | 1975 |
| 926 | Ga0496105_0147522 | 3300048908 | Bacteria | 1934 |
| 927 | Ga0496105_0224490 | 3300048908 | Unclassified | 1528 |
| 928 | Ga0496105_0275766 | 3300048908 | Bacteria | 1357 |
| 929 | Ga0496105_1028404 | 3300048908 | Unclassified | 615 |
| 930 | Ga0496106_0001780 | 3300048909 | Bacteria | 16082 |
| 931 | Ga0496106_0006450 | 3300048909 | Bacteria | 8686 |
| 932 | Ga0496106_0031219 | 3300048909 | Bacteria | 3970 |
| 933 | Ga0496106_0082320 | 3300048909 | Bacteria | 2474 |
| 934 | Ga0496106_0223290 | 3300048909 | Bacteria | 1503 |
| 935 | Ga0496106_0646640 | 3300048909 | Bacteria | 845 |
| 936 | Ga0496106_1337558 | 3300048909 | Bacteria | 555 |
| 937 | Ga0496106_1401958 | 3300048909 | Bacteria | 540 |
| 938 | Ga0496107_0003441 | 3300048910 | Bacteria | 10574 |
| 939 | Ga0496107_0018842 | 3300048910 | Bacteria | 4865 |
| 940 | Ga0496107_0242340 | 3300048910 | Bacteria | 1342 |
| 941 | Ga0496107_0277904 | 3300048910 | Bacteria | 1247 |
| 942 | Ga0496107_0426246 | 3300048910 | Unclassified | 986 |
| 943 | Ga0496107_0535653 | 3300048910 | Bacteria | 868 |
| 944 | Ga0496107_0722656 | 3300048910 | Bacteria | 732 |
| 945 | Ga0496107_1205977 | 3300048910 | Bacteria | 544 |
| 946 | Ga0496108_0001877 | 3300048911 | Bacteria | 16825 |
| 947 | Ga0496108_0002868 | 3300048911 | Bacteria | 13837 |
| 948 | Ga0496108_0009594 | 3300048911 | Bacteria | 7844 |
| 949 | Ga0496108_0146847 | 3300048911 | Bacteria | 2033 |
| 950 | Ga0496108_0393574 | 3300048911 | Bacteria | 1210 |
| 951 | Ga0496108_0413824 | 3300048911 | Bacteria | 1177 |
| 952 | Ga0496108_0857991 | 3300048911 | Bacteria | 781 |
| 953 | Ga0496108_1717731 | 3300048911 | Bacteria | 516 |
| 954 | Ga0496108_1791868 | 3300048911 | Bacteria | 503 |
| 955 | Ga0496109_0002513 | 3300048912 | Bacteria | 15384 |
| 956 | Ga0496109_0015852 | 3300048912 | Bacteria | 6579 |
| 957 | Ga0496109_0050303 | 3300048912 | Bacteria | 3795 |
| 958 | Ga0496109_0059462 | 3300048912 | Bacteria | 3491 |
| 959 | Ga0496109_0091320 | 3300048912 | Bacteria | 2816 |
| 960 | Ga0496109_0146169 | 3300048912 | Bacteria | 2212 |
| 961 | Ga0496109_0216543 | 3300048912 | Bacteria | 1801 |
| 962 | Ga0496109_0252137 | 3300048912 | Bacteria | 1662 |
| 963 | Ga0496109_0265350 | 3300048912 | Bacteria | 1617 |
| 964 | Ga0496109_0754121 | 3300048912 | Bacteria | 911 |
| 965 | Ga0496109_1511028 | 3300048912 | Bacteria | 606 |
| 966 | Ga0496110_0004610 | 3300048913 | Bacteria | 10705 |
| 967 | Ga0496110_0004774 | 3300048913 | Bacteria | 10555 |
| 968 | Ga0496110_0007895 | 3300048913 | Bacteria | 8522 |
| 969 | Ga0496110_0027964 | 3300048913 | Bacteria | 4838 |
| 970 | Ga0496110_0327763 | 3300048913 | Bacteria | 1395 |
| 971 | Ga0496110_0413011 | 3300048913 | Bacteria | 1230 |
| 972 | Ga0496110_0561898 | 3300048913 | Bacteria | 1037 |
| 973 | Ga0496110_0876444 | 3300048913 | Unclassified | 803 |
| 974 | Ga0496110_0983999 | 3300048913 | Bacteria | 751 |
| 975 | Ga0496110_1069991 | 3300048913 | Unclassified | 714 |
| 976 | Ga0496110_1254905 | 3300048913 | Bacteria | 650 |
| 977 | Ga0496110_1816665 | 3300048913 | Bacteria | 520 |
| 978 | Ga0496111_0000101 | 3300048914 | Bacteria | 37061 |
| 979 | Ga0496111_0000206 | 3300048914 | Bacteria | 27638 |
| 980 | Ga0496111_0001511 | 3300048914 | Bacteria | 13342 |
| 981 | Ga0496111_0037728 | 3300048914 | Bacteria | 3459 |
| 982 | Ga0496111_0054026 | 3300048914 | Bacteria | 2903 |
| 983 | Ga0496111_0142364 | 3300048914 | Bacteria | 1777 |
| 984 | Ga0496111_0195999 | 3300048914 | Bacteria | 1501 |
| 985 | Ga0496111_0257160 | 3300048914 | Bacteria | 1296 |
| 986 | Ga0496111_1177532 | 3300048914 | Unclassified | 544 |
| 987 | Ga0496112_0032584 | 3300048915 | Bacteria | 5061 |
| 988 | Ga0496112_0038417 | 3300048915 | Bacteria | 4674 |
| 989 | Ga0496112_0068170 | 3300048915 | Unclassified | 3513 |
| 990 | Ga0496112_0085501 | 3300048915 | Bacteria | 3120 |
| 991 | Ga0496112_0124358 | 3300048915 | Bacteria | 2550 |
| 992 | Ga0496112_0236536 | 3300048915 | Bacteria | 1780 |
| 993 | Ga0496112_0239451 | 3300048915 | Bacteria | 1767 |
| 994 | Ga0496112_0247734 | 3300048915 | Bacteria | 1733 |
| 995 | Ga0496112_0262405 | 3300048915 | Bacteria | 1677 |
| 996 | Ga0496112_0750051 | 3300048915 | Bacteria | 902 |
| 997 | Ga0496113_0016018 | 3300048916 | Bacteria | 5171 |
| 998 | Ga0496113_0033779 | 3300048916 | Bacteria | 3727 |
| 999 | Ga0496113_0061451 | 3300048916 | Bacteria | 2835 |
| 1000 | Ga0496113_0149532 | 3300048916 | Bacteria | 1842 |
| 1001 | Ga0496113_0176337 | 3300048916 | Bacteria | 1694 |
| 1002 | Ga0496113_0247472 | 3300048916 | Bacteria | 1423 |
| 1003 | Ga0496113_0286146 | 3300048916 | Bacteria | 1318 |
| 1004 | Ga0496114_0000184 | 3300048917 | Bacteria | 44982 |
| 1005 | Ga0496114_0003315 | 3300048917 | Bacteria | 12374 |
| 1006 | Ga0496114_0014305 | 3300048917 | Bacteria | 6366 |
| 1007 | Ga0496114_0020391 | 3300048917 | Bacteria | 5381 |
| 1008 | Ga0496114_0029756 | 3300048917 | Bacteria | 4489 |
| 1009 | Ga0496114_0063508 | 3300048917 | Bacteria | 3092 |
| 1010 | Ga0496114_0464234 | 3300048917 | Bacteria | 1121 |
| 1011 | Ga0496114_1092276 | 3300048917 | Bacteria | 682 |
| 1012 | Ga0496114_1157429 | 3300048917 | Bacteria | 659 |
| 1013 | Ga0496114_1313294 | 3300048917 | Bacteria | 610 |
| 1014 | Ga0496114_1702293 | 3300048917 | Bacteria | 519 |
| 1015 | Ga0496114_1728087 | 3300048917 | Unclassified | 514 |
| 1016 | Ga0496115_0050995 | 3300048918 | Bacteria | 3317 |
| 1017 | Ga0496115_1127898 | 3300048918 | Bacteria | 593 |
| 1018 | Ga0496115_1179963 | 3300048918 | Unclassified | 576 |
| 1019 | Ga0496115_1311347 | 3300048918 | Unclassified | 539 |
| 1020 | Ga0501031_0000601 | 3300049568 | Bacteria | 21207 |
| 1021 | Ga0501031_0323000 | 3300049568 | Bacteria | 1000 |
| 1022 | Ga0501032_0036522 | 3300049569 | Bacteria | 3353 |
| 1023 | Ga0501033_0685284 | 3300049570 | Bacteria | 698 |
| 1024 | Ga0501036_0010058 | 3300049572 | Bacteria | 7792 |
| 1025 | Ga0501036_0474851 | 3300049572 | Bacteria | 1041 |
| 1026 | Ga0501037_0483123 | 3300049573 | Bacteria | 842 |
| 1027 | Ga0501038_0039708 | 3300049574 | Bacteria | 4116 |
| 1028 | Ga0501038_0444375 | 3300049574 | Bacteria | 998 |
| 1029 | Ga0501039_0002203 | 3300049575 | Bacteria | 14420 |
| 1030 | Ga0501039_0356647 | 3300049575 | Bacteria | 1149 |
| 1031 | Ga0501040_0025092 | 3300049576 | Bacteria | 4005 |
| 1032 | Ga0501040_0146027 | 3300049576 | Bacteria | 1667 |
| 1033 | Ga0501040_0162364 | 3300049576 | Bacteria | 1580 |
| 1034 | Ga0501040_1286889 | 3300049576 | Unclassified | 531 |
| 1035 | Ga0501041_0002538 | 3300049577 | Bacteria | 10402 |
| 1036 | Ga0501041_0066256 | 3300049577 | Bacteria | 2213 |
| 1037 | Ga0501042_0025482 | 3300049578 | Bacteria | 4154 |
| 1038 | Ga0501043_0725612 | 3300049579 | Bacteria | 724 |
| 1039 | Ga0501046_0086637 | 3300049580 | Bacteria | 2414 |
| 1040 | Ga0501046_0324456 | 3300049580 | Bacteria | 1121 |
| 1041 | Ga0501046_0834261 | 3300049580 | Bacteria | 645 |
| 1042 | Ga0501048_0002986 | 3300049582 | Bacteria | 12912 |
| 1043 | Ga0501048_0815062 | 3300049582 | Bacteria | 671 |
| 1044 | Ga0501048_0862509 | 3300049582 | Bacteria | 651 |
| 1045 | Ga0501067_0050330 | 3300049583 | Bacteria | 2309 |
| 1046 | Ga0501067_0294608 | 3300049583 | Bacteria | 903 |
| 1047 | Ga0501068_0477232 | 3300049584 | Bacteria | 808 |
| 1048 | Ga0501069_0093240 | 3300049585 | Bacteria | 1704 |
| 1049 | Ga0501069_0152261 | 3300049585 | Bacteria | 1329 |
| 1050 | Ga0501070_0161017 | 3300049586 | Bacteria | 1850 |
| 1051 | Ga0501070_0646751 | 3300049586 | Bacteria | 840 |
| 1052 | Ga0501071_0017473 | 3300049587 | Bacteria | 4947 |
| 1053 | Ga0501071_0605751 | 3300049587 | Bacteria | 842 |
| 1054 | Ga0501071_0657047 | 3300049587 | Bacteria | 807 |
| 1055 | Ga0501071_0996474 | 3300049587 | Bacteria | 647 |
| 1056 | Ga0501072_0010020 | 3300049588 | Bacteria | 7208 |
| 1057 | Ga0501074_0052565 | 3300049590 | Bacteria | 2940 |
| 1058 | Ga0501074_1196782 | 3300049590 | Bacteria | 533 |
| 1059 | Ga0501075_0080307 | 3300049591 | Bacteria | 2468 |
| 1060 | Ga0501075_0643403 | 3300049591 | Unclassified | 808 |
| 1061 | Ga0501075_0737850 | 3300049591 | Bacteria | 750 |
| 1062 | Ga0501076_0003423 | 3300049592 | Bacteria | 11130 |
| 1063 | Ga0501076_0411209 | 3300049592 | Bacteria | 1113 |
| 1064 | Ga0501076_0469679 | 3300049592 | Bacteria | 1036 |
| 1065 | Ga0501077_0011243 | 3300049593 | Bacteria | 5585 |
| 1066 | Ga0501077_0028471 | 3300049593 | Bacteria | 3550 |
| 1067 | Ga0501077_0221716 | 3300049593 | Bacteria | 1202 |
| 1068 | Ga0501077_0455435 | 3300049593 | Unclassified | 819 |
| 1069 | Ga0501077_1120407 | 3300049593 | Bacteria | 507 |
| 1070 | Ga0501250_099747 | 3300049680 | Unclassified | 516 |
| 1071 | Ga0501079_0001804 | 3300049741 | Bacteria | 15292 |
| 1072 | Ga0501079_0755185 | 3300049741 | Bacteria | 766 |
| 1073 | Ga0501079_1507237 | 3300049741 | Unclassified | 529 |
| 1074 | Ga0501080_0109006 | 3300049742 | Bacteria | 2566 |
| 1075 | Ga0501081_0005074 | 3300049743 | Bacteria | 8473 |
| 1076 | Ga0501081_0328999 | 3300049743 | Bacteria | 1124 |
| 1077 | Ga0501081_1475206 | 3300049743 | Unclassified | 516 |
| 1078 | Ga0501045_0001212 | 3300049824 | Bacteria | 17175 |
| 1079 | Ga0501045_0083418 | 3300049824 | Bacteria | 2358 |
| 1080 | Ga0501045_0476126 | 3300049824 | Bacteria | 928 |
| 1081 | Ga0501045_0643566 | 3300049824 | Bacteria | 784 |
| 1082 | Ga0501045_0772315 | 3300049824 | Bacteria | 708 |
| 1083 | nmdc:mga05p37_1600132_c1 | 3300050507 | Unclassified | 642 |
| 1084 | nmdc:mga05p37_193269_c1 | 3300050507 | Bacteria | 2469 |
| 1085 | nmdc:mga05p37_436525_c1 | 3300050507 | Bacteria | 1520 |
| 1086 | nmdc:mga09592_289913_c1 | 3300050508 | Bacteria | 1419 |
| 1087 | nmdc:mga0qj67_421516_c1 | 3300050509 | Bacteria | 1076 |
| 1088 | nmdc:mga06r32_384203_c1 | 3300050510 | Bacteria | 1387 |
| 1089 | nmdc:mga08y16_531170_c1 | 3300050511 | Bacteria | 1192 |
| 1090 | nmdc:mga08y16_648373_c1 | 3300050511 | Bacteria | 1060 |
| 1091 | nmdc:mga0n895_186540_c1 | 3300050512 | Unclassified | 2105 |
| 1092 | nmdc:mga0n895_1946624_c1 | 3300050512 | Bacteria | 546 |
| 1093 | nmdc:mga0n895_970873_c1 | 3300050512 | Bacteria | 832 |
| 1094 | nmdc:mga0rr50_1787074_c1 | 3300050513 | Bacteria | 517 |
| 1095 | nmdc:mga0rr50_923123_c1 | 3300050513 | Unclassified | 744 |
| 1096 | nmdc:mga0rr50_93045_c1 | 3300050513 | Bacteria | 2351 |
| 1097 | nmdc:mga08x19_1135254_c1 | 3300050514 | Bacteria | 554 |
| 1098 | nmdc:mga08x19_159387_c1 | 3300050514 | Bacteria | 1532 |
| 1099 | nmdc:mga0a205_134724_c1 | 3300050515 | Unclassified | 2370 |
| 1100 | nmdc:mga0a205_345930_c1 | 3300050515 | Bacteria | 1355 |
| 1101 | Ga0495601_0015727 | 3300053077 | Bacteria | 4576 |
| 1102 | Ga0495601_0033085 | 3300053077 | Bacteria | 3220 |
| 1103 | Ga0495601_0675869 | 3300053077 | Unclassified | 660 |
| 1104 | Ga0495612_0038564 | 3300053078 | Bacteria | 1941 |
| 1105 | Ga0495612_0149552 | 3300053078 | Bacteria | 1016 |
| 1106 | Ga0495612_0161493 | 3300053078 | Bacteria | 978 |
| 1107 | Ga0495655_0314183 | 3300053083 | Bacteria | 541 |
| 1108 | Ga0495595_0021009 | 3300053084 | Bacteria | 2848 |
| 1109 | Ga0495595_0050929 | 3300053084 | Bacteria | 1918 |
| 1110 | Ga0495595_0174820 | 3300053084 | Bacteria | 1064 |
| 1111 | Ga0495619_0041937 | 3300053085 | Bacteria | 2995 |
| 1112 | Ga0495619_0042075 | 3300053085 | Bacteria | 2990 |
| 1113 | Ga0495619_0136802 | 3300053085 | Bacteria | 1685 |
| 1114 | Ga0495619_0992349 | 3300053085 | Unclassified | 562 |
| 1115 | Ga0500566_0128889 | 3300053094 | Bacteria | 1356 |
| 1116 | Ga0500641_0082212 | 3300053096 | Unclassified | 1368 |
| 1117 | Ga0501084_0009493 | 3300054114 | Bacteria | 8051 |
| 1118 | Ga0501084_0714254 | 3300054114 | Bacteria | 845 |
| 1119 | Ga0590075_008580 | 3300059424 | Bacteria | 2442 |
| 1120 | Ga0590077_013046 | 3300059426 | Bacteria | 1726 |
| 1121 | Ga0587086_032724 | 3300059507 | Bacteria | 773 |
| 1122 | Ga0587079_075237 | 3300059647 | Bacteria | 762 |
| 1123 | Ga0501082_0005605 | 3300060353 | Bacteria | 10896 |
| 1124 | Ga0501082_0297051 | 3300060353 | Bacteria | 1406 |
| 1125 | Ga0501082_0491687 | 3300060353 | Bacteria | 1072 |
| 1126 | Ga0501082_0701530 | 3300060353 | Bacteria | 886 |
| 1127 | Ga0501082_1020994 | 3300060353 | Bacteria | 723 |
| 1128 | Ga0466962_0009007 | 3300061719 | Bacteria | 4780 |
| 1129 | Ga0530510_0138944 | 3300061734 | Bacteria | 1789 |
| 1130 | Ga0530510_0896172 | 3300061734 | Unclassified | 678 |
| 1131 | Ga0070686_100066880 | |||
| 1132 | JGI25406J46586_10119438 | |||
| 1133 | Ga0058861_12077871 | |||
| 1134 | Ga0058862_10037025 | |||
| 1135 | Ga0058862_12790353 | |||
| 1136 | Ga0070658_10074452 | |||
| 1137 | Ga0070658_10319182 | |||
| 1138 | Ga0070658_11210014 | |||
| 1139 | Ga0070683_100000868 | |||
| 1140 | Ga0070683_100040644 | |||
| 1141 | Ga0070683_100145369 | |||
| 1142 | Ga0070683_100246273 | |||
| 1143 | Ga0070683_100534364 | |||
| 1144 | Ga0070683_101090155 | |||
| 1145 | Ga0070683_101300780 | |||
| 1146 | Ga0070690_100313134 | |||
| 1147 | Ga0070690_100341220 | |||
| 1148 | Ga0070677_10288818 | |||
| 1149 | Ga0068869_100719515 | |||
| 1150 | Ga0068869_101594688 | |||
| 1151 | Ga0070680_100028977 | |||
| 1152 | Ga0070680_100082461 | |||
| 1153 | Ga0070680_100102501 | |||
| 1154 | Ga0070680_100124163 | |||
| 1155 | Ga0070680_100962909 | |||
| 1156 | Ga0070682_100015362 | |||
| 1157 | Ga0070682_100094764 | |||
| 1158 | Ga0070682_100516341 | |||
| 1159 | Ga0068868_101353759 | |||
| 1160 | Ga0068868_101591313 | |||
| 1161 | Ga0070660_100003046 | |||
| 1162 | Ga0070660_100034719 | |||
| 1163 | Ga0070660_100040413 | |||
| 1164 | Ga0070660_100069382 | |||
| 1165 | Ga0070660_100122214 | |||
| 1166 | Ga0070660_100247724 | |||
| 1167 | Ga0070660_100311067 | |||
| 1168 | Ga0070660_100379554 | |||
| 1169 | Ga0070691_10023507 | |||
| 1170 | Ga0070691_10050196 | |||
| 1171 | Ga0070687_100876283 | |||
| 1172 | Ga0070661_100026212 | |||
| 1173 | Ga0070661_100093483 | |||
| 1174 | Ga0070661_101115187 | |||
| 1175 | Ga0070692_10095426 | |||
| 1176 | Ga0070692_10196104 | |||
| 1177 | Ga0070668_100429693 | |||
| 1178 | Ga0070668_100434705 | |||
| 1179 | Ga0070669_100525889 | |||
| 1180 | Ga0070669_101574308 | |||
| 1181 | Ga0070675_100126955 | |||
| 1182 | Ga0070675_100734991 | |||
| 1183 | Ga0070675_100863166 | |||
| 1184 | Ga0070671_100305329 | |||
| 1185 | Ga0070671_100675377 | |||
| 1186 | Ga0070674_100040566 | |||
| 1187 | Ga0070674_100170077 | |||
| 1188 | Ga0070674_100175008 | |||
| 1189 | Ga0070674_100986046 | |||
| 1190 | Ga0070673_100971050 | |||
| 1191 | Ga0070688_100280113 | |||
| 1192 | Ga0070659_100190088 | |||
| 1193 | Ga0070659_100298135 | |||
| 1194 | Ga0070659_100335846 | |||
| 1195 | Ga0070659_101872474 | |||
| 1196 | Ga0070667_101230052 | |||
| 1197 | Ga0070667_101429923 | |||
| 1198 | Ga0070703_10070046 | |||
| 1199 | Ga0070709_10042207 | |||
| 1200 | Ga0070709_10363015 | |||
| 1201 | Ga0070714_100034545 | |||
| 1202 | Ga0070714_100036286 | |||
| 1203 | Ga0070714_100038130 | |||
| 1204 | Ga0070714_100095306 | |||
| 1205 | Ga0070714_101004778 | |||
| 1206 | Ga0070714_102100303 | |||
| 1207 | Ga0070714_102142229 | |||
| 1208 | Ga0070713_100013333 | |||
| 1209 | Ga0070713_100054867 | |||
| 1210 | Ga0070713_100072102 | |||
| 1211 | Ga0070713_101406229 | |||
| 1212 | Ga0070713_102488164 | |||
| 1213 | Ga0070710_10060396 | |||
| 1214 | Ga0070711_100031738 | |||
| 1215 | Ga0070711_100357894 | |||
| 1216 | Ga0070711_100918521 | |||
| 1217 | Ga0070711_100966135 | |||
| 1218 | Ga0070705_100443351 | |||
| 1219 | Ga0070705_100824096 | |||
| 1220 | Ga0070705_101874188 | |||
| 1221 | Ga0070700_100937075 | |||
| 1222 | Ga0070694_100087673 | |||
| 1223 | Ga0070694_100481040 | |||
| 1224 | Ga0070694_100670821 | |||
| 1225 | Ga0070694_100787655 | |||
| 1226 | Ga0070663_101696985 | |||
| 1227 | Ga0070678_100665538 | |||
| 1228 | Ga0070678_101224066 | |||
| 1229 | Ga0070678_101579151 | |||
| 1230 | Ga0070678_101599106 | |||
| 1231 | Ga0070678_102088662 | |||
| 1232 | Ga0070662_100130770 | |||
| 1233 | Ga0070662_100329746 | |||
| 1234 | Ga0070662_100643623 | |||
| 1235 | Ga0070681_10017975 | |||
| 1236 | Ga0070681_10032197 | |||
| 1237 | Ga0070681_10032468 | |||
| 1238 | Ga0070681_10158844 | |||
| 1239 | Ga0070681_10281407 | |||
| 1240 | Ga0070681_10325216 | |||
| 1241 | Ga0070681_11641366 | |||
| 1242 | Ga0068867_100057577 | |||
| 1243 | Ga0068867_101172992 | |||
| 1244 | Ga0068867_101480017 | |||
| 1245 | Ga0070685_11267604 | |||
| 1246 | Ga0070706_100323158 | |||
| 1247 | Ga0070706_100473032 | |||
| 1248 | Ga0070706_100653673 | |||
| 1249 | Ga0070706_101421625 | |||
| 1250 | Ga0070707_100065510 | |||
| 1251 | Ga0070707_100398184 | |||
| 1252 | Ga0070698_100155192 | |||
| 1253 | Ga0070698_100172441 | |||
| 1254 | Ga0070698_100459844 | |||
| 1255 | Ga0070699_100377454 | |||
| 1256 | Ga0070699_100524773 | |||
| 1257 | Ga0070699_101264833 | |||
| 1258 | Ga0070679_100016115 | |||
| 1259 | Ga0070679_100016881 | |||
| 1260 | Ga0070679_100025921 | |||
| 1261 | Ga0070679_100050560 | |||
| 1262 | Ga0070679_100230973 | |||
| 1263 | Ga0070679_100242485 | |||
| 1264 | Ga0070684_100000550 | |||
| 1265 | Ga0070684_100021823 | |||
| 1266 | Ga0070684_100071955 | |||
| 1267 | Ga0070684_100160404 | |||
| 1268 | Ga0070684_100370237 | |||
| 1269 | Ga0070684_100808053 | |||
| 1270 | Ga0070684_101882211 | |||
| 1271 | Ga0070697_101058008 | |||
| 1272 | Ga0068853_100904503 | |||
| 1273 | Ga0070672_100630200 | |||
| 1274 | Ga0070672_101173047 | |||
| 1275 | Ga0070672_101539039 | |||
| 1276 | Ga0070686_100033576 | |||
| 1277 | Ga0070695_100321166 | |||
| 1278 | Ga0070695_100581297 | |||
| 1279 | Ga0070695_101776680 | |||
| 1280 | Ga0070695_101843496 | |||
| 1281 | Ga0070695_101884812 | |||
| 1282 | Ga0070696_100060907 | |||
| 1283 | Ga0070696_100161700 | |||
| 1284 | Ga0070696_100624874 | |||
| 1285 | Ga0070693_100018552 | |||
| 1286 | Ga0070693_100121267 | |||
| 1287 | Ga0070693_100201288 | |||
| 1288 | Ga0070693_100823771 | |||
| 1289 | Ga0070665_101571174 | |||
| 1290 | Ga0070704_100117866 | |||
| 1291 | Ga0070704_101113387 | |||
| 1292 | Ga0070704_101941298 | |||
| 1293 | Ga0068855_100103666 | |||
| 1294 | Ga0068855_100161909 | |||
| 1295 | Ga0068855_100341242 | |||
| 1296 | Ga0068855_100541849 | |||
| 1297 | Ga0068855_100588683 | |||
| 1298 | Ga0070664_100111763 | |||
| 1299 | Ga0070664_102009280 | |||
| 1300 | Ga0070664_102356546 | |||
| 1301 | Ga0068857_100107948 | |||
| 1302 | Ga0068857_100752897 | |||
| 1303 | Ga0068857_101874709 | |||
| 1304 | Ga0068854_101695639 | |||
| 1305 | Ga0068854_101867622 | |||
| 1306 | Ga0068856_100081618 | |||
| 1307 | Ga0068856_100143874 | |||
| 1308 | Ga0068856_100200793 | |||
| 1309 | Ga0068856_100216040 | |||
| 1310 | Ga0068856_102652931 | |||
| 1311 | Ga0070702_100327798 | |||
| 1312 | Ga0070702_101463242 | |||
| 1313 | Ga0068852_100065799 | |||
| 1314 | Ga0068852_100137776 | |||
| 1315 | Ga0068852_100714557 | |||
| 1316 | Ga0068852_100795399 | |||
| 1317 | Ga0068852_100801920 | |||
| 1318 | Ga0068859_100933765 | |||
| 1319 | Ga0068864_100896358 | |||
| 1320 | Ga0068866_10032502 | |||
| 1321 | Ga0068861_100103693 | |||
| 1322 | Ga0068861_100689272 | |||
| 1323 | Ga0068861_101768114 | |||
| 1324 | Ga0068851_10799230 | |||
| 1325 | Ga0068870_10113620 | |||
| 1326 | Ga0068863_101306895 | |||
| 1327 | Ga0068863_102300870 | |||
| 1328 | Ga0068858_100063104 | |||
| 1329 | Ga0068858_100621350 | |||
| 1330 | Ga0068858_101108551 | |||
| 1331 | Ga0068860_100660251 | |||
| 1332 | Ga0068862_100168652 | |||
| 1333 | Ga0068862_100622462 | |||
| 1334 | Ga0068862_101363735 | |||
| 1335 | Ga0081455_10017634 | |||
| 1336 | Ga0081455_10056348 | |||
| 1337 | Ga0081538_10021393 | |||
| 1338 | Ga0081539_10001603 | |||
| 1339 | Ga0070717_10008104 | |||
| 1340 | Ga0070717_10051688 | |||
| 1341 | Ga0070717_10517701 | |||
| 1342 | Ga0070715_10004504 | |||
| 1343 | Ga0070716_100055187 | |||
| 1344 | Ga0070716_100952352 | |||
| 1345 | Ga0070716_100964920 | |||
| 1346 | Ga0070712_100036396 | |||
| 1347 | Ga0070712_100273210 | |||
| 1348 | Ga0070712_100595100 | |||
| 1349 | Ga0070712_101296426 | |||
| 1350 | Ga0070712_101834525 | |||
| 1351 | Ga0097621_101467439 | |||
| 1352 | Ga0097621_102041837 | |||
| 1353 | Ga0068871_100580293 | |||
| 1354 | Ga0068871_101722405 | |||
| 1355 | Ga0075428_100521684 | |||
| 1356 | Ga0075433_10392320 | |||
| 1357 | Ga0075434_100542090 | |||
| 1358 | Ga0075434_101314783 | |||
| 1359 | Ga0075434_101411972 | |||
| 1360 | Ga0075434_101754384 | |||
| 1361 | Ga0068865_100150173 | |||
| 1362 | Ga0068865_101030211 | |||
| 1363 | Ga0068865_101502140 | |||
| 1364 | Ga0075436_100134882 | |||
| 1365 | Ga0075436_100463576 | |||
| 1366 | Ga0075436_100830702 | |||
| 1367 | Ga0097620_100933814 | |||
| 1368 | Ga0075435_100091233 | |||
| 1369 | Ga0075435_100629323 | |||
| 1370 | Ga0105240_10217526 | |||
| 1371 | Ga0105240_10617069 | |||
| 1372 | Ga0111539_10652099 | |||
| 1373 | Ga0111539_11068787 | |||
| 1374 | Ga0111539_11341228 | |||
| 1375 | Ga0105245_10014664 | |||
| 1376 | Ga0105245_10021496 | |||
| 1377 | Ga0105245_10137528 | |||
| 1378 | Ga0105245_10194195 | |||
| 1379 | Ga0105245_10234205 | |||
| 1380 | Ga0105245_10262856 | |||
| 1381 | Ga0105245_10543179 | |||
| 1382 | Ga0105245_11922665 | |||
| 1383 | Ga0105247_10124108 | |||
| 1384 | Ga0105247_10939931 | |||
| 1385 | Ga0114129_10399143 | |||
| 1386 | Ga0114129_11021377 | |||
| 1387 | Ga0114129_11840264 | |||
| 1388 | Ga0114129_13116683 | |||
| 1389 | Ga0105243_10055503 | |||
| 1390 | Ga0105243_10430756 | |||
| 1391 | Ga0105243_10668143 | |||
| 1392 | Ga0105243_11512132 | |||
| 1393 | Ga0105241_10039640 | |||
| 1394 | Ga0105241_11871259 | |||
| 1395 | Ga0105241_12604152 | |||
| 1396 | Ga0105242_10070241 | |||
| 1397 | Ga0105242_10302770 | |||
| 1398 | Ga0105248_10025022 | |||
| 1399 | Ga0105248_10968780 | |||
| 1400 | Ga0105237_10248490 | |||
| 1401 | Ga0105237_10667708 | |||
| 1402 | Ga0105237_11389726 | |||
| 1403 | Ga0105237_11550514 | |||
| 1404 | Ga0105237_12018137 | |||
| 1405 | Ga0105238_10211062 | |||
| 1406 | Ga0105238_10977778 | |||
| 1407 | Ga0105238_10980626 | |||
| 1408 | Ga0105249_10105886 | |||
| 1409 | Ga0105249_10338557 | |||
| 1410 | Ga0105249_10440570 | |||
| 1411 | Ga0105249_10475406 | |||
| 1412 | Ga0105249_13553755 | |||
| 1413 | Ga0105239_10757308 | |||
| 1414 | Ga0105239_11439471 | |||
| 1415 | Ga0105239_11531413 | |||
| 1416 | Ga0105239_11583995 | |||
| 1417 | Ga0105239_12205523 | |||
| 1418 | Ga0105246_10156111 | |||
| 1419 | Ga0105246_10188017 | |||
| 1420 | Ga0105246_11386229 | |||
| 1421 | Ga0105246_12255889 | |||
| 1422 | Ga0157373_10125718 | |||
| 1423 | Ga0157373_10516387 | |||
| 1424 | Ga0157373_10799889 | |||
| 1425 | Ga0157371_10498479 | |||
| 1426 | Ga0157371_10776204 | |||
| 1427 | Ga0157371_11556247 | |||
| 1428 | Ga0157370_10050281 | |||
| 1429 | Ga0157370_10904137 | |||
| 1430 | Ga0157370_11261183 | |||
| 1431 | Ga0157369_10005853 | |||
| 1432 | Ga0157369_10452362 | |||
| 1433 | Ga0157369_10840443 | |||
| 1434 | Ga0157369_11485240 | |||
| 1435 | Ga0157369_12269038 | |||
| 1436 | Ga0157374_10041104 | |||
| 1437 | Ga0157374_10587499 | |||
| 1438 | Ga0157374_10763524 | |||
| 1439 | Ga0157374_12666162 | |||
| 1440 | Ga0157378_10862901 | |||
| 1441 | Ga0157378_11010031 | |||
| 1442 | Ga0157378_11653463 | |||
| 1443 | Ga0163162_10191884 | |||
| 1444 | Ga0163162_12105617 | |||
| 1445 | Ga0163162_12331794 | |||
| 1446 | Ga0157372_10136121 | |||
| 1447 | Ga0157372_10291480 | |||
| 1448 | Ga0157372_10293503 | |||
| 1449 | Ga0157372_10956392 | |||
| 1450 | Ga0157372_12231242 | |||
| 1451 | Ga0157372_12458820 | |||
| 1452 | Ga0157375_10233236 | |||
| 1453 | Ga0157375_10254470 | |||
| 1454 | Ga0157375_10618297 | |||
| 1455 | Ga0157375_11399629 | |||
| 1456 | Ga0157375_13065829 | |||
| 1457 | Ga0157375_13152194 | |||
| 1458 | Ga0163163_10330626 | |||
| 1459 | Ga0163163_10352363 | |||
| 1460 | Ga0163163_10531821 | |||
| 1461 | Ga0163163_11007265 | |||
| 1462 | Ga0163163_11268998 | |||
| 1463 | Ga0163163_11822917 | |||
| 1464 | Ga0157380_12097626 | |||
| 1465 | Ga0157380_12271686 | |||
| 1466 | Ga0157380_13094223 | |||
| 1467 | Ga0157380_13198963 | |||
| 1468 | Ga0157380_13264885 | |||
| 1469 | Ga0182008_10041678 | |||
| 1470 | Ga0157377_10067767 | |||
| 1471 | Ga0157377_10098333 | |||
| 1472 | Ga0157377_10198018 | |||
| 1473 | Ga0157377_10330800 | |||
| 1474 | Ga0157377_10886026 | |||
| 1475 | Ga0157379_10074183 | |||
| 1476 | Ga0157379_10741123 | |||
| 1477 | Ga0157379_11013963 | |||
| 1478 | Ga0157376_10262856 | |||
| 1479 | Ga0157376_11205881 | |||
| 1480 | Ga0182006_1035178 | |||
| 1481 | Ga0182007_10133703 | |||
| 1482 | Ga0163161_10468077 | |||
| 1483 | Ga0197907_11003049 | |||
| 1484 | Ga0197907_11235624 | |||
| 1485 | Ga0206356_10267656 | |||
| 1486 | Ga0206356_10577645 | |||
| 1487 | Ga0206356_11557596 | |||
| 1488 | Ga0206356_11815991 | |||
| 1489 | Ga0206349_1860178 | |||
| 1490 | Ga0206355_1445200 | |||
| 1491 | Ga0206355_1476787 | |||
| 1492 | Ga0206350_10344085 | |||
| 1493 | Ga0206354_10813093 | |||
| 1494 | Ga0206354_11640104 | |||
| 1495 | Ga0206353_10584395 | |||
| 1496 | Ga0206353_10669531 | |||
| 1497 | Ga0206353_11931564 | |||
| 1498 | Ga0154015_1469048 | |||
| 1499 | Ga0154015_1585765 | |||
| 1500 | Ga0213871_10002417 | |||
| 1501 | Ga0224712_10004092 | |||
| 1502 | Ga0224712_10016945 | |||
| 1503 | Ga0224712_10142166 | |||
| 1504 | Ga0207653_10335147 | |||
| 1505 | Ga0207692_10029445 | |||
| 1506 | Ga0207692_10479299 | |||
| 1507 | Ga0207692_10512250 | |||
| 1508 | Ga0207642_10014509 | |||
| 1509 | Ga0207642_10722093 | |||
| 1510 | Ga0207710_10064493 | |||
| 1511 | Ga0207688_10085578 | |||
| 1512 | Ga0207688_10465411 | |||
| 1513 | Ga0207647_10125607 | |||
| 1514 | Ga0207685_10079708 | |||
| 1515 | Ga0207699_10007837 | |||
| 1516 | Ga0207699_10152906 | |||
| 1517 | Ga0207645_10247029 | |||
| 1518 | Ga0207643_10146690 | |||
| 1519 | Ga0207705_10009942 | |||
| 1520 | Ga0207705_10046097 | |||
| 1521 | Ga0207705_10186512 | |||
| 1522 | Ga0207705_10194289 | |||
| 1523 | Ga0207705_11464251 | |||
| 1524 | Ga0207684_10051716 | |||
| 1525 | Ga0207684_10170037 | |||
| 1526 | Ga0207684_11451714 | |||
| 1527 | Ga0207684_11456788 | |||
| 1528 | Ga0207654_10216092 | |||
| 1529 | Ga0207654_10430014 | |||
| 1530 | Ga0207707_10017739 | |||
| 1531 | Ga0207707_10040778 | |||
| 1532 | Ga0207707_10168432 | |||
| 1533 | Ga0207707_10255601 | |||
| 1534 | Ga0207707_10297668 | |||
| 1535 | Ga0207707_10486548 | |||
| 1536 | Ga0207707_11317681 | |||
| 1537 | Ga0207707_11540361 | |||
| 1538 | Ga0207695_10097570 | |||
| 1539 | Ga0207695_10651889 | |||
| 1540 | Ga0207695_11233852 | |||
| 1541 | Ga0207671_10804682 | |||
| 1542 | Ga0207671_10804844 | |||
| 1543 | Ga0207693_10045089 | |||
| 1544 | Ga0207693_10901245 | |||
| 1545 | Ga0207693_11062808 | |||
| 1546 | Ga0207663_10002700 | |||
| 1547 | Ga0207663_10404169 | |||
| 1548 | Ga0207660_10060438 | |||
| 1549 | Ga0207660_10077844 | |||
| 1550 | Ga0207660_10138895 | |||
| 1551 | Ga0207660_10368643 | |||
| 1552 | Ga0207660_10377260 | |||
| 1553 | Ga0207660_10716727 | |||
| 1554 | Ga0207662_10021294 | |||
| 1555 | Ga0207657_10002847 | |||
| 1556 | Ga0207657_10006585 | |||
| 1557 | Ga0207657_10006650 | |||
| 1558 | Ga0207657_10067084 | |||
| 1559 | Ga0207657_10084751 | |||
| 1560 | Ga0207657_10207008 | |||
| 1561 | Ga0207657_10305683 | |||
| 1562 | Ga0207657_11216246 | |||
| 1563 | Ga0207649_10243340 | |||
| 1564 | Ga0207649_10354871 | |||
| 1565 | Ga0207649_11023326 | |||
| 1566 | Ga0207649_11558581 | |||
| 1567 | Ga0207652_10027919 | |||
| 1568 | Ga0207652_10029233 | |||
| 1569 | Ga0207652_10034477 | |||
| 1570 | Ga0207652_10041618 | |||
| 1571 | Ga0207652_10189917 | |||
| 1572 | Ga0207652_10253357 | |||
| 1573 | Ga0207652_10832166 | |||
| 1574 | Ga0207652_11072071 | |||
| 1575 | Ga0207652_11261140 | |||
| 1576 | Ga0207646_10054364 | |||
| 1577 | Ga0207646_10072696 | |||
| 1578 | Ga0207646_10455800 | |||
| 1579 | Ga0207646_10596095 | |||
| 1580 | Ga0207681_10462177 | |||
| 1581 | Ga0207694_10144531 | |||
| 1582 | Ga0207694_10583569 | |||
| 1583 | Ga0207650_11646138 | |||
| 1584 | Ga0207659_10432310 | |||
| 1585 | Ga0207659_11005506 | |||
| 1586 | Ga0207687_10012897 | |||
| 1587 | Ga0207687_10032610 | |||
| 1588 | Ga0207687_10154421 | |||
| 1589 | Ga0207687_10322853 | |||
| 1590 | Ga0207687_10435359 | |||
| 1591 | Ga0207687_10840248 | |||
| 1592 | Ga0207687_10891578 | |||
| 1593 | Ga0207700_10016444 | |||
| 1594 | Ga0207700_10304022 | |||
| 1595 | Ga0207700_10508834 | |||
| 1596 | Ga0207700_11116524 | |||
| 1597 | Ga0207664_10017486 | |||
| 1598 | Ga0207664_10022929 | |||
| 1599 | Ga0207664_10033418 | |||
| 1600 | Ga0207664_10081648 | |||
| 1601 | Ga0207664_10128921 | |||
| 1602 | Ga0207664_10178797 | |||
| 1603 | Ga0207664_10820123 | |||
| 1604 | Ga0207664_11678095 | |||
| 1605 | Ga0207664_11806507 | |||
| 1606 | Ga0207644_10138772 | |||
| 1607 | Ga0207644_10473147 | |||
| 1608 | Ga0207644_11005189 | |||
| 1609 | Ga0207690_10465779 | |||
| 1610 | Ga0207690_10699821 | |||
| 1611 | Ga0207690_11128864 | |||
| 1612 | Ga0207690_11203703 | |||
| 1613 | Ga0207690_11262684 | |||
| 1614 | Ga0207706_10112274 | |||
| 1615 | Ga0207706_10490682 | |||
| 1616 | Ga0207706_10570963 | |||
| 1617 | Ga0207706_11327520 | |||
| 1618 | Ga0207686_10027322 | |||
| 1619 | Ga0207686_10185373 | |||
| 1620 | Ga0207709_10026392 | |||
| 1621 | Ga0207709_10609662 | |||
| 1622 | Ga0207669_10144446 | |||
| 1623 | Ga0207669_10432598 | |||
| 1624 | Ga0207669_11099164 | |||
| 1625 | Ga0207704_10259951 | |||
| 1626 | Ga0207665_10002480 | |||
| 1627 | Ga0207665_10040336 | |||
| 1628 | Ga0207691_11008129 | |||
| 1629 | Ga0207691_11025530 | |||
| 1630 | Ga0207711_10986529 | |||
| 1631 | Ga0207711_11202080 | |||
| 1632 | Ga0207689_10525776 | |||
| 1633 | Ga0207689_10717858 | |||
| 1634 | Ga0207661_10018170 | |||
| 1635 | Ga0207661_10049001 | |||
| 1636 | Ga0207661_10131724 | |||
| 1637 | Ga0207661_10228188 | |||
| 1638 | Ga0207661_10759907 | |||
| 1639 | Ga0207661_11191541 | |||
| 1640 | Ga0207661_11192909 | |||
| 1641 | Ga0207679_10053927 | |||
| 1642 | Ga0207679_11481832 | |||
| 1643 | Ga0207667_10743563 | |||
| 1644 | Ga0207667_10909665 | |||
| 1645 | Ga0207667_10958254 | |||
| 1646 | Ga0207712_10063875 | |||
| 1647 | Ga0207712_10085150 | |||
| 1648 | Ga0207712_10090041 | |||
| 1649 | Ga0207712_10314741 | |||
| 1650 | Ga0207668_10418927 | |||
| 1651 | Ga0207668_11194671 | |||
| 1652 | Ga0207640_10432491 | |||
| 1653 | Ga0207640_10746593 | |||
| 1654 | Ga0207640_11899758 | |||
| 1655 | Ga0207677_10116763 | |||
| 1656 | Ga0207677_10694747 | |||
| 1657 | Ga0207677_11154253 | |||
| 1658 | Ga0207703_10979135 | |||
| 1659 | Ga0207678_10066743 | |||
| 1660 | Ga0207678_10163639 | |||
| 1661 | Ga0207678_10418463 | |||
| 1662 | Ga0207678_11644659 | |||
| 1663 | Ga0207708_10004691 | |||
| 1664 | Ga0207708_11207279 | |||
| 1665 | Ga0207708_11569577 | |||
| 1666 | Ga0207702_10137672 | |||
| 1667 | Ga0207702_10526304 | |||
| 1668 | Ga0207702_10540184 | |||
| 1669 | Ga0207702_10890913 | |||
| 1670 | Ga0207702_12209432 | |||
| 1671 | Ga0207641_10737514 | |||
| 1672 | Ga0207641_12219937 | |||
| 1673 | Ga0207648_10020890 | |||
| 1674 | Ga0207648_10530173 | |||
| 1675 | Ga0207648_10885594 | |||
| 1676 | Ga0207674_10063055 | |||
| 1677 | Ga0207674_12068328 | |||
| 1678 | Ga0207674_12083305 | |||
| 1679 | Ga0207675_100017398 | |||
| 1680 | Ga0207675_100293238 | |||
| 1681 | Ga0207675_100883619 | |||
| 1682 | Ga0207675_101315903 | |||
| 1683 | Ga0207683_10279417 | |||
| 1684 | Ga0207683_10447165 | |||
| 1685 | Ga0207683_10806431 | |||
| 1686 | Ga0207698_10104318 | |||
| 1687 | Ga0207698_10126397 | |||
| 1688 | Ga0207698_10162402 | |||
| 1689 | Ga0207698_11754066 | |||
| 1690 | Ga0207698_11770053 | |||
| 1691 | Ga0207698_12166051 | |||
| 1692 | Ga0209966_1040336 | |||
| 1693 | Ga0268266_11514632 | |||
| 1694 | Ga0268266_11975673 | |||
| 1695 | Ga0268265_10107935 | |||
| 1696 | Ga0268265_10386150 | |||
| 1697 | Ga0268264_10504599 | |||
| 1698 | Ga0265337_1033629 | |||
| 1699 | Ga0265337_1114612 | |||
| 1700 | Ga0265326_10045479 | |||
| 1701 | Ga0265319_1002177 | |||
| 1702 | Ga0265334_10039417 | |||
| 1703 | Ga0265318_10006074 | |||
| 1704 | Ga0265318_10130749 | |||
| 1705 | Ga0265322_10012994 | |||
| 1706 | Ga0265322_10070747 | |||
| 1707 | Ga0265338_10011194 | |||
| 1708 | Ga0265338_10082600 | |||
| 1709 | Ga0265324_10061275 | |||
| 1710 | Ga0265330_10143920 | |||
| 1711 | Ga0265328_10148088 | |||
| 1712 | Ga0265328_10199204 | |||
| 1713 | Ga0265320_10016472 | |||
| 1714 | Ga0265320_10250243 | |||
| 1715 | Ga0265320_10472094 | |||
| 1716 | Ga0265325_10105746 | |||
| 1717 | Ga0265325_10119360 | |||
| 1718 | Ga0265329_10023651 | |||
| 1719 | Ga0265340_10063196 | |||
| 1720 | Ga0265339_10028523 | |||
| 1721 | Ga0265331_10090744 | |||
| 1722 | Ga0265327_10011377 | |||
| 1723 | Ga0265327_10026939 | |||
| 1724 | Ga0265327_10123636 | |||
| 1725 | Ga0265316_10018516 | |||
| 1726 | Ga0265316_10045508 | |||
| 1727 | Ga0307408_100027257 | |||
| 1728 | Ga0307408_100937474 | |||
| 1729 | Ga0265313_10054583 | |||
| 1730 | Ga0265313_10060798 | |||
| 1731 | Ga0265314_10009672 | |||
| 1732 | Ga0265314_10038259 | |||
| 1733 | Ga0265342_10009927 | |||
| 1734 | Ga0265342_10213930 | |||
| 1735 | Ga0265342_10383401 | |||
| 1736 | Ga0307405_10101774 | |||
| 1737 | Ga0307405_10384877 | |||
| 1738 | Ga0307413_10390205 | |||
| 1739 | Ga0307410_10011770 | |||
| 1740 | Ga0307410_10528024 | |||
| 1741 | Ga0307406_10060794 | |||
| 1742 | Ga0307407_10000662 | |||
| 1743 | Ga0307412_10247954 | |||
| 1744 | Ga0307412_11968602 | |||
| 1745 | Ga0307409_100017482 | |||
| 1746 | Ga0307409_102090840 | |||
| 1747 | Ga0307416_100002728 | |||
| 1748 | Ga0307414_10063369 | |||
| 1749 | Ga0307411_10055307 | |||
| 1750 | Ga0307415_100016833 | |||
| 1751 | Ga0307415_102047354 | |||
| 1752 | Ga0373950_0052860 | |||
| 1753 | Ga0373938_0126586 | |||
| 1754 | Ga0373926_0005523 | |||
| 1755 | Ga0373928_0150219 | |||
| 1756 | Ga0373934_0135754 | |||
| 1757 | Ga0373944_0027607 | |||
| 1758 | Ga0373949_0036587 | |||
| 1759 | Ga0373932_0222584 | |||
| 1760 | Ga0373932_0459968 | |||
| 1761 | Ga0373945_0022615 | |||
| 1762 | Ga0373953_0233253 | |||
| 1763 | Ga0373954_0045163 | |||
| 1764 | Ga0373956_0170340 | |||
| 1765 | Ga0373960_0116091 | |||
| 1766 | Ga0373960_0341926 | |||
| 1767 | Ga0373960_0416142 | |||
| 1768 | Ga0373943_0001283 | |||
| 1769 | Ga0373943_0657228 | |||
| 1770 | Ga0373946_0046255 | |||
| 1771 | Ga0373955_0448203 | |||
| 1772 | Ga0373955_1032370 | |||
| 1773 | Ga0373942_0085251 | |||
| 1774 | Ga0373962_0039778 | |||
| 1775 | Ga0373931_1063960 | |||
| 1776 | Ga0373931_1106373 | |||
| 1777 | Ga0373935_0020364 | |||
| 1778 | Ga0373935_0064209 | |||
| 1779 | Ga0373935_0943052 | |||
| 1780 | Ga0373927_0259318 | |||
| 1781 | Ga0373933_0244472 | |||
| 1782 | Ga0373947_0002113 | |||
| 1783 | Ga0373937_0052542 | |||
| 1784 | Ga0373937_0129914 | |||
| 1785 | Ga0373925_0001501 | |||
| 1786 | Ga0373925_0232012 | |||
| 1787 | Ga0373925_1696008 | |||
| 1788 | Ga0373925_1725107 | |||
| 1789 | Ga0395899_0284953 | |||
| 1790 | Ga0395899_0478665 | |||
| 1791 | Ga0395900_0093322 | |||
| 1792 | Ga0395900_0173074 | |||
| 1793 | Ga0395900_1741559 | |||
| 1794 | Ga0395898_0027064 | |||
| 1795 | Ga0395898_0094323 | |||
| 1796 | Ga0395898_0337135 | |||
| 1797 | Ga0395905_0190867 | |||
| 1798 | Ga0395905_0196229 | |||
| 1799 | Ga0395905_0367710 | |||
| 1800 | Ga0395905_1297088 | |||
| 1801 | Ga0395901_0130635 | |||
| 1802 | Ga0395901_0385734 | |||
| 1803 | Ga0395901_0756842 | |||
| 1804 | Ga0395901_1548679 | |||
| 1805 | Ga0395901_1587519 | |||
| 1806 | Ga0436360_0548929 | |||
| 1807 | Ga0436360_0556691 | |||
| 1808 | Ga0436362_0539041 | |||
| 1809 | Ga0439439_0019644 | |||
| 1810 | Ga0451853_1447046 | |||
| 1811 | Ga0451853_2374780 | |||
| 1812 | Ga0451853_2840255 | |||
| 1813 | Ga0439431_0005605 | |||
| 1814 | Ga0439433_0001351 | |||
| 1815 | Ga0439437_044543 | |||
| 1816 | Ga0439442_119542 | |||
| 1817 | Ga0439449_0048052 | |||
| 1818 | Ga0439457_021945 | |||
| 1819 | Ga0439462_0098367 | |||
| 1820 | Ga0450920_007751 | |||
| 1821 | Ga0450923_054944 | |||
| 1822 | Ga0450923_106515 | |||
| 1823 | Ga0450898_103249 | |||
| 1824 | Ga0450910_026494 | |||
| 1825 | Ga0439446_0006869 | |||
| 1826 | Ga0439458_0102954 | |||
| 1827 | Ga0439434_0010766 | |||
| 1828 | Ga0439435_0284375 | |||
| 1829 | Ga0450918_064626 | |||
| 1830 | Ga0451577_0194803 | |||
| 1831 | Ga0466965_0297133 | |||
| 1832 | Ga0466965_0327523 | |||
| 1833 | Ga0466966_0209753 | |||
| 1834 | Ga0466961_0019364 | |||
| 1835 | Ga0466961_0382081 | |||
| 1836 | Ga0466963_0001805 | |||
| 1837 | Ga0466963_0003165 | |||
| 1838 | Ga0466963_0021168 | |||
| 1839 | Ga0466963_0113320 | |||
| 1840 | Ga0466963_0129442 | |||
| 1841 | Ga0466964_0003980 | |||
| 1842 | Ga0466964_0006104 | |||
| 1843 | Ga0466964_0016278 | |||
| 1844 | Ga0466964_0018404 | |||
| 1845 | Ga0466964_0034357 | |||
| 1846 | Ga0466964_0661989 | |||
| 1847 | Ga0466971_0028641 | |||
| 1848 | Ga0466971_0042813 | |||
| 1849 | Ga0466971_0082844 | |||
| 1850 | Ga0466971_0561136 | |||
| 1851 | Ga0466968_0000933 | |||
| 1852 | Ga0466968_0006910 | |||
| 1853 | Ga0466968_0077786 | |||
| 1854 | Ga0466968_0098167 | |||
| 1855 | Ga0466968_0389868 | |||
| 1856 | Ga0466970_0922567 | |||
| 1857 | Ga0466957_0007794 | |||
| 1858 | Ga0466957_0114378 | |||
| 1859 | Ga0466957_0219670 | |||
| 1860 | Ga0466957_0676792 | |||
| 1861 | Ga0466960_0038972 | |||
| 1862 | Ga0466960_0477670 | |||
| 1863 | Ga0466960_0528884 | |||
| 1864 | Ga0466959_0027231 | |||
| 1865 | Ga0466959_0125664 | |||
| 1866 | Ga0466959_0263408 | |||
| 1867 | Ga0466959_0371445 | |||
| 1868 | Ga0451576_0979851 | |||
| 1869 | Ga0466958_0001480 | |||
| 1870 | Ga0466958_0057280 | |||
| 1871 | Ga0466958_0081027 | |||
| 1872 | Ga0466958_0248521 | |||
| 1873 | Ga0466958_0683229 | |||
| 1874 | Ga0466967_0005380 | |||
| 1875 | Ga0466967_0006129 | |||
| 1876 | Ga0466967_0006388 | |||
| 1877 | Ga0466967_0006609 | |||
| 1878 | Ga0466967_0008400 | |||
| 1879 | Ga0466967_0010274 | |||
| 1880 | Ga0466967_0012465 | |||
| 1881 | Ga0466967_0029028 | |||
| 1882 | Ga0466967_0084154 | |||
| 1883 | Ga0466967_0118967 | |||
| 1884 | Ga0466967_0135873 | |||
| 1885 | Ga0466967_0173397 | |||
| 1886 | Ga0466967_0182389 | |||
| 1887 | Ga0466967_0201238 | |||
| 1888 | Ga0466967_0317424 | |||
| 1889 | Ga0466967_0716619 | |||
| 1890 | Ga0466967_0742559 | |||
| 1891 | Ga0466967_1338725 | |||
| 1892 | Ga0466967_1913969 | |||
| 1893 | Ga0466967_2165880 | |||
| 1894 | Ga0495592_0002297 | |||
| 1895 | Ga0495592_0051471 | |||
| 1896 | Ga0495592_0132620 | |||
| 1897 | Ga0495603_0008076 | |||
| 1898 | Ga0495629_0073277 | |||
| 1899 | Ga0495629_0156180 | |||
| 1900 | Ga0495629_0255970 | |||
| 1901 | Ga0495629_1108703 | |||
| 1902 | Ga0495641_0005407 | |||
| 1903 | Ga0495641_0042686 | |||
| 1904 | Ga0495651_0129457 | |||
| 1905 | Ga0495651_0271899 | |||
| 1906 | Ga0495653_0025614 | |||
| 1907 | Ga0495653_0151727 | |||
| 1908 | Ga0495580_0033594 | |||
| 1909 | Ga0495582_0028215 | |||
| 1910 | Ga0495582_0046446 | |||
| 1911 | Ga0495582_0054842 | |||
| 1912 | Ga0495582_0385323 | |||
| 1913 | Ga0495639_0000977 | |||
| 1914 | Ga0495662_0047065 | |||
| 1915 | Ga0495662_0520872 | |||
| 1916 | Ga0495664_0014004 | |||
| 1917 | Ga0495664_0029420 | |||
| 1918 | Ga0495584_0264036 | |||
| 1919 | Ga0495584_0265452 | |||
| 1920 | Ga0495585_0218318 | |||
| 1921 | Ga0495585_0340090 | |||
| 1922 | Ga0495585_0445109 | |||
| 1923 | Ga0495585_0575875 | |||
| 1924 | Ga0495594_0123707 | |||
| 1925 | Ga0495594_0336804 | |||
| 1926 | Ga0495596_0139657 | |||
| 1927 | Ga0495608_0039334 | |||
| 1928 | Ga0495608_0220896 | |||
| 1929 | Ga0495608_0779540 | |||
| 1930 | Ga0495618_0014789 | |||
| 1931 | Ga0495618_0028699 | |||
| 1932 | Ga0495628_0026160 | |||
| 1933 | Ga0495628_0129262 | |||
| 1934 | Ga0495628_0151690 | |||
| 1935 | Ga0495630_0598800 | |||
| 1936 | Ga0495630_0766400 | |||
| 1937 | Ga0495631_0177822 | |||
| 1938 | Ga0495637_0253596 | |||
| 1939 | Ga0495644_0147802 | |||
| 1940 | Ga0495644_0294691 | |||
| 1941 | Ga0495644_0378766 | |||
| 1942 | Ga0495663_0063825 | |||
| 1943 | Ga0495666_0003161 | |||
| 1944 | Ga0495642_0151334 | |||
| 1945 | Ga0495652_0023704 | |||
| 1946 | Ga0495652_0045218 | |||
| 1947 | Ga0495652_0160562 | |||
| 1948 | Ga0495652_0635670 | |||
| 1949 | Ga0495665_0003374 | |||
| 1950 | Ga0495640_0030108 | |||
| 1951 | Ga0495640_0620661 | |||
| 1952 | Ga0495586_0004202 | |||
| 1953 | Ga0495586_0791265 | |||
| 1954 | Ga0495587_0121823 | |||
| 1955 | Ga0495587_0207312 | |||
| 1956 | Ga0495645_0040289 | |||
| 1957 | Ga0495633_0407679 | |||
| 1958 | Ga0495667_0028876 | |||
| 1959 | Ga0495656_0281531 | |||
| 1960 | Ga0495656_0460219 | |||
| 1961 | Ga0495656_0575761 | |||
| 1962 | Ga0495668_0848606 | |||
| 1963 | Ga0495634_0012359 | |||
| 1964 | Ga0495634_0319116 | |||
| 1965 | Ga0495611_0119800 | |||
| 1966 | Ga0495635_0015964 | |||
| 1967 | Ga0495635_0018898 | |||
| 1968 | Ga0495635_0399806 | |||
| 1969 | Ga0495635_0629829 | |||
| 1970 | Ga0495588_0190208 | |||
| 1971 | Ga0495657_0043885 | |||
| 1972 | Ga0495657_0351878 | |||
| 1973 | Ga0495657_0546213 | |||
| 1974 | Ga0495657_0686293 | |||
| 1975 | Ga0495657_0863333 | |||
| 1976 | Ga0495599_0040124 | |||
| 1977 | Ga0495599_0109794 | |||
| 1978 | Ga0495599_0717051 | |||
| 1979 | Ga0495599_0844750 | |||
| 1980 | Ga0495646_0083812 | |||
| 1981 | Ga0495646_0119813 | |||
| 1982 | Ga0495646_0225973 | |||
| 1983 | Ga0495647_0001014 | |||
| 1984 | Ga0495647_0034678 | |||
| 1985 | Ga0495647_0093667 | |||
| 1986 | Ga0495647_0472601 | |||
| 1987 | Ga0495658_0003312 | |||
| 1988 | Ga0495658_0142464 | |||
| 1989 | Ga0495658_0313315 | |||
| 1990 | Ga0495658_0886443 | |||
| 1991 | Ga0495613_0051740 | |||
| 1992 | Ga0495613_0091801 | |||
| 1993 | Ga0495613_0247899 | |||
| 1994 | Ga0495613_0254193 | |||
| 1995 | Ga0495624_0017657 | |||
| 1996 | Ga0495624_0684395 | |||
| 1997 | Ga0495670_0193540 | |||
| 1998 | Ga0495670_0427378 | |||
| 1999 | Ga0495589_0229086 | |||
| 2000 | Ga0495600_0040286 | |||
| 2001 | Ga0495600_0190434 | |||
| 2002 | Ga0495581_0434870 | |||
| 2003 | Ga0495581_0833567 | |||
| 2004 | Ga0495674_0122532 | |||
| 2005 | Ga0495674_0208392 | |||
| 2006 | Ga0495674_0354155 | |||
| 2007 | Ga0495674_0763941 | |||
| 2008 | Ga0495676_0133206 | |||
| 2009 | Ga0495676_0701596 | |||
| 2010 | Ga0495680_0012102 | |||
| 2011 | Ga0495680_0048947 | |||
| 2012 | Ga0495680_0059742 | |||
| 2013 | Ga0495680_0427291 | |||
| 2014 | Ga0495675_0420239 | |||
| 2015 | Ga0495677_0461855 | |||
| 2016 | Ga0495679_039148 | |||
| 2017 | Ga0495684_0030753 | |||
| 2018 | Ga0495684_0066473 | |||
| 2019 | Ga0495684_0178781 | |||
| 2020 | Ga0495593_0008235 | |||
| 2021 | Ga0495593_0504437 | |||
| 2022 | Ga0495602_0083189 | |||
| 2023 | Ga0495602_0832330 | |||
| 2024 | Ga0495614_0000678 | |||
| 2025 | Ga0496100_0036846 | |||
| 2026 | Ga0496100_0165760 | |||
| 2027 | Ga0496100_0306190 | |||
| 2028 | Ga0496100_0491275 | |||
| 2029 | Ga0496101_0014314 | |||
| 2030 | Ga0496101_0040024 | |||
| 2031 | Ga0496101_0120919 | |||
| 2032 | Ga0496101_0125189 | |||
| 2033 | Ga0496101_0374106 | |||
| 2034 | Ga0496101_0805107 | |||
| 2035 | Ga0496101_1221646 | |||
| 2036 | Ga0496102_0003853 | |||
| 2037 | Ga0496102_0035747 | |||
| 2038 | Ga0496102_0133017 | |||
| 2039 | Ga0496102_0409459 | |||
| 2040 | Ga0496102_1823965 | |||
| 2041 | Ga0496103_0010803 | |||
| 2042 | Ga0496103_0022071 | |||
| 2043 | Ga0496103_0247555 | |||
| 2044 | Ga0496103_0266849 | |||
| 2045 | Ga0496103_0417201 | |||
| 2046 | Ga0496103_0476332 | |||
| 2047 | Ga0496103_0981440 | |||
| 2048 | Ga0496104_0001019 | |||
| 2049 | Ga0496104_0009095 | |||
| 2050 | Ga0496104_0021364 | |||
| 2051 | Ga0496104_0037416 | |||
| 2052 | Ga0496104_0044560 | |||
| 2053 | Ga0496104_0067345 | |||
| 2054 | Ga0496104_0068829 | |||
| 2055 | Ga0496105_0142120 | |||
| 2056 | Ga0496105_0147522 | |||
| 2057 | Ga0496105_0224490 | |||
| 2058 | Ga0496105_0275766 | |||
| 2059 | Ga0496105_1028404 | |||
| 2060 | Ga0496106_0001780 | |||
| 2061 | Ga0496106_0006450 | |||
| 2062 | Ga0496106_0031219 | |||
| 2063 | Ga0496106_0082320 | |||
| 2064 | Ga0496106_0223290 | |||
| 2065 | Ga0496106_0646640 | |||
| 2066 | Ga0496106_1337558 | |||
| 2067 | Ga0496106_1401958 | |||
| 2068 | Ga0496107_0003441 | |||
| 2069 | Ga0496107_0018842 | |||
| 2070 | Ga0496107_0242340 | |||
| 2071 | Ga0496107_0277904 | |||
| 2072 | Ga0496107_0426246 | |||
| 2073 | Ga0496107_0535653 | |||
| 2074 | Ga0496107_0722656 | |||
| 2075 | Ga0496107_1205977 | |||
| 2076 | Ga0496108_0001877 | |||
| 2077 | Ga0496108_0002868 | |||
| 2078 | Ga0496108_0009594 | |||
| 2079 | Ga0496108_0146847 | |||
| 2080 | Ga0496108_0393574 | |||
| 2081 | Ga0496108_0413824 | |||
| 2082 | Ga0496108_0857991 | |||
| 2083 | Ga0496108_1717731 | |||
| 2084 | Ga0496108_1791868 | |||
| 2085 | Ga0496109_0002513 | |||
| 2086 | Ga0496109_0015852 | |||
| 2087 | Ga0496109_0050303 | |||
| 2088 | Ga0496109_0059462 | |||
| 2089 | Ga0496109_0091320 | |||
| 2090 | Ga0496109_0146169 | |||
| 2091 | Ga0496109_0216543 | |||
| 2092 | Ga0496109_0252137 | |||
| 2093 | Ga0496109_0265350 | |||
| 2094 | Ga0496109_0754121 | |||
| 2095 | Ga0496109_1511028 | |||
| 2096 | Ga0496110_0004610 | |||
| 2097 | Ga0496110_0004774 | |||
| 2098 | Ga0496110_0007895 | |||
| 2099 | Ga0496110_0027964 | |||
| 2100 | Ga0496110_0327763 | |||
| 2101 | Ga0496110_0413011 | |||
| 2102 | Ga0496110_0561898 | |||
| 2103 | Ga0496110_0876444 | |||
| 2104 | Ga0496110_0983999 | |||
| 2105 | Ga0496110_1069991 | |||
| 2106 | Ga0496110_1254905 | |||
| 2107 | Ga0496110_1816665 | |||
| 2108 | Ga0496111_0000101 | |||
| 2109 | Ga0496111_0000206 | |||
| 2110 | Ga0496111_0001511 | |||
| 2111 | Ga0496111_0037728 | |||
| 2112 | Ga0496111_0054026 | |||
| 2113 | Ga0496111_0142364 | |||
| 2114 | Ga0496111_0195999 | |||
| 2115 | Ga0496111_0257160 | |||
| 2116 | Ga0496111_1177532 | |||
| 2117 | Ga0496112_0032584 | |||
| 2118 | Ga0496112_0038417 | |||
| 2119 | Ga0496112_0068170 | |||
| 2120 | Ga0496112_0085501 | |||
| 2121 | Ga0496112_0124358 | |||
| 2122 | Ga0496112_0236536 | |||
| 2123 | Ga0496112_0239451 | |||
| 2124 | Ga0496112_0247734 | |||
| 2125 | Ga0496112_0262405 | |||
| 2126 | Ga0496112_0750051 | |||
| 2127 | Ga0496113_0016018 | |||
| 2128 | Ga0496113_0033779 | |||
| 2129 | Ga0496113_0061451 | |||
| 2130 | Ga0496113_0149532 | |||
| 2131 | Ga0496113_0176337 | |||
| 2132 | Ga0496113_0247472 | |||
| 2133 | Ga0496113_0286146 | |||
| 2134 | Ga0496114_0000184 | |||
| 2135 | Ga0496114_0003315 | |||
| 2136 | Ga0496114_0014305 | |||
| 2137 | Ga0496114_0020391 | |||
| 2138 | Ga0496114_0029756 | |||
| 2139 | Ga0496114_0063508 | |||
| 2140 | Ga0496114_0464234 | |||
| 2141 | Ga0496114_1092276 | |||
| 2142 | Ga0496114_1157429 | |||
| 2143 | Ga0496114_1313294 | |||
| 2144 | Ga0496114_1702293 | |||
| 2145 | Ga0496114_1728087 | |||
| 2146 | Ga0496115_0050995 | |||
| 2147 | Ga0496115_1127898 | |||
| 2148 | Ga0496115_1179963 | |||
| 2149 | Ga0496115_1311347 | |||
| 2150 | Ga0501031_0000601 | |||
| 2151 | Ga0501031_0323000 | |||
| 2152 | Ga0501032_0036522 | |||
| 2153 | Ga0501033_0685284 | |||
| 2154 | Ga0501036_0010058 | |||
| 2155 | Ga0501036_0474851 | |||
| 2156 | Ga0501037_0483123 | |||
| 2157 | Ga0501038_0039708 | |||
| 2158 | Ga0501038_0444375 | |||
| 2159 | Ga0501039_0002203 | |||
| 2160 | Ga0501039_0356647 | |||
| 2161 | Ga0501040_0025092 | |||
| 2162 | Ga0501040_0146027 | |||
| 2163 | Ga0501040_0162364 | |||
| 2164 | Ga0501040_1286889 | |||
| 2165 | Ga0501041_0002538 | |||
| 2166 | Ga0501041_0066256 | |||
| 2167 | Ga0501042_0025482 | |||
| 2168 | Ga0501043_0725612 | |||
| 2169 | Ga0501046_0086637 | |||
| 2170 | Ga0501046_0324456 | |||
| 2171 | Ga0501046_0834261 | |||
| 2172 | Ga0501048_0002986 | |||
| 2173 | Ga0501048_0815062 | |||
| 2174 | Ga0501048_0862509 | |||
| 2175 | Ga0501067_0050330 | |||
| 2176 | Ga0501067_0294608 | |||
| 2177 | Ga0501068_0477232 | |||
| 2178 | Ga0501069_0093240 | |||
| 2179 | Ga0501069_0152261 | |||
| 2180 | Ga0501070_0161017 | |||
| 2181 | Ga0501070_0646751 | |||
| 2182 | Ga0501071_0017473 | |||
| 2183 | Ga0501071_0605751 | |||
| 2184 | Ga0501071_0657047 | |||
| 2185 | Ga0501071_0996474 | |||
| 2186 | Ga0501072_0010020 | |||
| 2187 | Ga0501074_0052565 | |||
| 2188 | Ga0501074_1196782 | |||
| 2189 | Ga0501075_0080307 | |||
| 2190 | Ga0501075_0643403 | |||
| 2191 | Ga0501075_0737850 | |||
| 2192 | Ga0501076_0003423 | |||
| 2193 | Ga0501076_0411209 | |||
| 2194 | Ga0501076_0469679 | |||
| 2195 | Ga0501077_0011243 | |||
| 2196 | Ga0501077_0028471 | |||
| 2197 | Ga0501077_0221716 | |||
| 2198 | Ga0501077_0455435 | |||
| 2199 | Ga0501077_1120407 | |||
| 2200 | Ga0501250_099747 | |||
| 2201 | Ga0501079_0001804 | |||
| 2202 | Ga0501079_0755185 | |||
| 2203 | Ga0501079_1507237 | |||
| 2204 | Ga0501080_0109006 | |||
| 2205 | Ga0501081_0005074 | |||
| 2206 | Ga0501081_0328999 | |||
| 2207 | Ga0501081_1475206 | |||
| 2208 | Ga0501045_0001212 | |||
| 2209 | Ga0501045_0083418 | |||
| 2210 | Ga0501045_0476126 | |||
| 2211 | Ga0501045_0643566 | |||
| 2212 | Ga0501045_0772315 | |||
| 2213 | nmdc:mga05p37_1600132_c1 | |||
| 2214 | nmdc:mga05p37_193269_c1 | |||
| 2215 | nmdc:mga05p37_436525_c1 | |||
| 2216 | nmdc:mga09592_289913_c1 | |||
| 2217 | nmdc:mga0qj67_421516_c1 | |||
| 2218 | nmdc:mga06r32_384203_c1 | |||
| 2219 | nmdc:mga08y16_531170_c1 | |||
| 2220 | nmdc:mga08y16_648373_c1 | |||
| 2221 | nmdc:mga0n895_186540_c1 | |||
| 2222 | nmdc:mga0n895_1946624_c1 | |||
| 2223 | nmdc:mga0n895_970873_c1 | |||
| 2224 | nmdc:mga0rr50_1787074_c1 | |||
| 2225 | nmdc:mga0rr50_923123_c1 | |||
| 2226 | nmdc:mga0rr50_93045_c1 | |||
| 2227 | nmdc:mga08x19_1135254_c1 | |||
| 2228 | nmdc:mga08x19_159387_c1 | |||
| 2229 | nmdc:mga0a205_134724_c1 | |||
| 2230 | nmdc:mga0a205_345930_c1 | |||
| 2231 | Ga0495601_0015727 | |||
| 2232 | Ga0495601_0033085 | |||
| 2233 | Ga0495601_0675869 | |||
| 2234 | Ga0495612_0038564 | |||
| 2235 | Ga0495612_0149552 | |||
| 2236 | Ga0495612_0161493 | |||
| 2237 | Ga0495655_0314183 | |||
| 2238 | Ga0495595_0021009 | |||
| 2239 | Ga0495595_0050929 | |||
| 2240 | Ga0495595_0174820 | |||
| 2241 | Ga0495619_0041937 | |||
| 2242 | Ga0495619_0042075 | |||
| 2243 | Ga0495619_0136802 | |||
| 2244 | Ga0495619_0992349 | |||
| 2245 | Ga0500566_0128889 | |||
| 2246 | Ga0500641_0082212 | |||
| 2247 | Ga0501084_0009493 | |||
| 2248 | Ga0501084_0714254 | |||
| 2249 | Ga0590075_008580 | |||
| 2250 | Ga0590077_013046 | |||
| 2251 | Ga0587086_032724 | |||
| 2252 | Ga0587079_075237 | |||
| 2253 | Ga0501082_0005605 | |||
| 2254 | Ga0501082_0297051 | |||
| 2255 | Ga0501082_0491687 | |||
| 2256 | Ga0501082_0701530 | |||
| 2257 | Ga0501082_1020994 | |||
| 2258 | Ga0466962_0009007 | |||
| 2259 | Ga0530510_0138944 | |||
| 2260 | Ga0530510_0896172 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hot-assembly1.cif.gz_A | phage selected homeodomain bound to modified dna | 0.4302 | 9 | 58 |
| 2hot-assembly1.cif.gz_A | phage selected homeodomain bound to modified dna | 0.3777 | 9 | 58 |
| 2az2-assembly1.cif.gz_B | flock house virus b2-dsrna complex (p4122) | 0.3223 | 5 | 72 |
| 2az2-assembly1.cif.gz_B | flock house virus b2-dsrna complex (p4122) | 0.2908 | 5 | 72 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3icxC01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.4818 | 9 | 62 | 1.10.287.660 |
| 3icxA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.4812 | 9 | 62 | 1.10.287.660 |
| 2hotB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.4316 | 9 | 57 | 1.10.10.60 |
| 2hotA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.4302 | 9 | 58 | 1.10.10.60 |
| 3njtA02 | Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac | 0.4078 | 6 | 41 | 3.10.20.310 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K2AZH0-F1-model_v4 | Mycothiol system anti-sigma-R factor | 0.7265 | 6 | 74 |
|
| AF-H5WRG0-F1-model_v4 | Putative zinc-finger domain-containing protein | 0.7193 | 8 | 65 |
|
| AF-A0A1F3ZNX4-F1-model_v4 | Putative zinc-finger domain-containing protein | 0.6474 | 8 | 65 |
|
| AF-H5WRG0-F1-model_v4 | Putative zinc-finger domain-containing protein | 0.6463 | 8 | 65 |
|
| AF-A0A399YUL8-F1-model_v4 | Uncharacterized protein | 0.6364 | 5 | 73 |
|