F490425

General Info

Members Datasets Scaffolds Average Seq Length
1122 581 966 272

Family's Representative Sequence

Representative Sequence 3300053094|Ga0500566_0000747|Ga0500566_0000747_16322_17206
Length 294
Sequence MHTSQSRQWQGGTNSKWAPLMNEASPPVIDSEAAARLLAPLTDLVVAAGKAILAVNRSVMKVDGKTDGSPVTEADLAADRIIADGLARLAPHIPSLSEERALQARLPYRDSFFLIDPLDGTKEFVAGRDEFTVNLALVTRGTPLLGIVAAPALGLIWRGIVGRGAERLTLGNGAPRVEPIRTRLCPPRGAPWTVAVSRSHGDARTEGFIAGRPGAVRSELGSAVKFGRVAEGMVDIYPRLSPTCEWDVGAGHAVVTAAGGRITDSKGAALQFGLGRGDFIVPEFIAWGDPKAAS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
6 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
7 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
11 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
12 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
13 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
14 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
15 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
16 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
17 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
18 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
19 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
20 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
25 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
26 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
27 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
28 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
29 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
30 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
31 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
32 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
33 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
34 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
35 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
36 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
37 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
38 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
39 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
40 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
41 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
42 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
43 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
44 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
45 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
46 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
47 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
48 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
49 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
50 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
51 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
52 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
53 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
54 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
55 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
56 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
57 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
58 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
59 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
60 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
61 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
62 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
63 2922368715
64 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
65 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
66 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
67 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
68 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
69 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
70 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
71 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
72 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
73 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
74 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
75 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
76 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
77 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
78 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
79 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
80 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
81 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
82 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
83 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
84 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
85 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
86 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
87 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
88 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
89 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
90 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
91 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
92 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
93 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
94 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
95 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
96 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
97 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
98 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
99 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
100 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
101 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
102 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
103 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
104 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
105 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
106 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
107 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
108 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
109 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
110 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
111 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
112 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
113 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
114 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
115 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
116 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
117 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
118 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
119 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
120 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
121 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
122 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
123 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
124 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
125 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
126 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
127 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
128 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
129 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
130 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
131 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
132 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
133 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
134 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
135 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
136 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
137 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
138 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
139 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
140 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
141 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
142 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
143 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
144 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
145 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
146 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
147 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
148 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
149 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
150 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
151 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
152 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
153 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
154 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
155 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
156 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
157 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
158 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
159 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
160 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
161 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
162 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
163 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
164 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
165 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
166 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
167 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
168 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
169 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
170 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
171 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
172 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
173 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
174 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
175 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
176 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
177 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
178 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
179 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
180 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
181 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
182 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
183 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
184 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
185 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
186 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
187 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
188 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
189 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
190 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
191 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
192 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
193 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
194 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
195 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
196 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
197 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
198 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
199 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
200 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
201 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
202 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
203 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
204 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
205 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
206 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
207 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
208 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
209 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
210 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
211 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
212 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
213 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
214 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
215 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
216 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
217 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
218 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
219 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
220 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
221 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
222 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
223 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
224 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
225 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
226 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
227 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
228 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
229 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
230 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
231 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
232 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
233 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
234 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
235 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
236 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
240 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
242 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
243 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
244 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
245 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
302 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
303 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
304 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
305 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
306 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
310 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
311 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
312 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
313 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
314 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
315 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
316 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
317 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
318 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
319 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
320 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
321 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
322 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
323 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
324 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
325 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
326 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
327 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
328 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
329 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
330 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
331 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
332 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
333 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
334 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
335 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
336 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
337 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
338 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
339 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
340 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
341 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
342 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
343 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
344 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
345 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
346 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
347 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
348 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
349 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
350 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
351 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
352 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
353 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
354 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
355 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
356 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
357 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
358 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
359 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
360 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
361 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
362 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
363 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
364 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
365 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
366 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
367 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
368 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
369 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
370 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
371 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
372 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
373 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
374 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
375 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
376 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
377 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
378 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
379 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
380 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
381 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
382 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
383 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
384 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
385 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
386 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
387 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
388 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
389 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
390 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
391 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
392 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
393 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
394 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
395 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
396 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
397 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
398 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
399 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
400 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
401 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
402 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
403 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
404 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
405 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
406 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
407 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
408 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
409 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
410 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
411 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
412 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
413 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
414 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
415 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
416 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
417 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
418 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
419 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
420 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
421 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
422 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
423 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
424 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
425 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
426 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
427 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
428 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
429 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
430 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
431 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
432 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
433 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
434 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
435 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
436 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
437 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
438 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
439 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
440 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
441 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
442 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
443 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
444 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
445 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
446 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
447 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
448 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
449 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
450 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
451 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
452 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
453 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
454 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
455 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
456 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
457 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
458 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
459 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
460 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
461 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
462 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
463 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
464 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
465 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
466 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
467 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
468 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
469 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
470 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
471 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
472 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
473 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
474 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
475 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
476 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
477 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
478 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
480 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
485 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
487 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
490 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
491 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
492 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
493 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
494 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
495 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
496 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
497 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
498 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
499 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
500 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
501 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
502 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
503 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
504 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
505 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
506 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
507 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
508 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
509 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
510 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
511 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
512 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
513 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
514 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
515 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
516 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
517 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
518 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
519 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
520 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
521 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
522 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
523 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
524 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
525 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
526 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
527 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
528 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
529 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
530 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
531 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
532 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
533 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
534 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
535 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
536 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
537 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
538 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
539 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
540 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
541 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
542 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
543 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
544 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
545 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
546 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
547 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
548 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
549 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
550 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
551 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
552 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
553 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
554 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
555 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
556 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
557 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
558 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
559 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
560 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
561 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
562 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
563 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
564 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
565 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
566 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
567 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
568 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
569 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
570 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
571 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
572 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
573 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
574 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
575 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
576 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
577 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
578 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
579 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
580 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
581 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.08
Metatranscriptomes 0.09
Isolates 13.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.03
Nodule 11.41
Rhizoplane 7.04
Rhizosphere 60.16
Stem 0
Stem Tuber 0
Unclassified 9.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1005056 3300003214 Bacteria 2628
2 JGI25153J46596_10014616 3300003215 Bacteria 3251
3 JGI25153J46596_10016085 3300003215 Bacteria 3017
4 JGI25153J46596_10019965 3300003215 Bacteria 2548
5 JGI25153J46596_10020621 3300003215 Bacteria 2486
6 JGI25153J46596_10029904 3300003215 Bacteria 1863
7 rootL2_10021398 3300003322 Bacteria 2181
8 rootH1_10084363 3300003323 Bacteria 2274
9 JGI25160J50197_1014574 3300003354 Bacteria 2624
10 JGI25160J50197_1015304 3300003354 Bacteria 2524
11 JGI25160J50197_1025887 3300003354 Bacteria 1629
12 JGI25404J52841_10036249 3300003659 Bacteria 1050
13 Ga0055539_1007251 3300003752 Bacteria 1406
14 Ga0055531_10013520 3300003794 Bacteria 3754
15 Ga0055543_1004423 3300004625 Bacteria 3842
16 Ga0055543_1026183 3300004625 Bacteria 1038
17 Ga0065165_1011200 3300005262 Bacteria 3774
18 Ga0065165_1011960 3300005262 Bacteria 3568
19 Ga0065165_1012428 3300005262 Bacteria 3466
20 Ga0070676_10070586 3300005328 Bacteria 2096
21 Ga0070690_100151682 3300005330 Bacteria 1582
22 Ga0070670_100065629 3300005331 Bacteria 3114
23 Ga0068869_100041983 3300005334 Bacteria 3277
24 Ga0068869_100169788 3300005334 Bacteria 1703
25 Ga0070680_100135074 3300005336 Bacteria 2066
26 Ga0070682_100215803 3300005337 Bacteria 1362
27 Ga0068868_100056796 3300005338 Bacteria 3091
28 Ga0068868_100067737 3300005338 Bacteria 2841
29 Ga0070660_100116984 3300005339 Bacteria 2126
30 Ga0070689_100073660 3300005340 Bacteria 2671
31 Ga0070661_100112884 3300005344 Bacteria 2030
32 Ga0070668_100088699 3300005347 Bacteria 2435
33 Ga0070668_100219478 3300005347 Bacteria 1567
34 Ga0070668_100289544 3300005347 Bacteria 1370
35 Ga0070669_100149431 3300005353 Bacteria 1807
36 Ga0070675_100403544 3300005354 Bacteria 1220
37 Ga0070674_100010171 3300005356 Bacteria 5668
38 Ga0070673_100140805 3300005364 Bacteria 2034
39 Ga0070673_100485482 3300005364 Bacteria 1116
40 Ga0070688_100318288 3300005365 Bacteria 1130
41 Ga0070667_100232928 3300005367 Bacteria 1642
42 Ga0070667_100485349 3300005367 Bacteria 1131
43 Ga0070703_10083140 3300005406 Bacteria 1095
44 Ga0070709_10024169 3300005434 Bacteria 3574
45 Ga0070709_10049496 3300005434 Bacteria 2628
46 Ga0070714_100078572 3300005435 Bacteria 2868
47 Ga0070713_100001652 3300005436 Bacteria 14323
48 Ga0070713_100025253 3300005436 Bacteria 4642
49 Ga0070710_10001958 3300005437 Bacteria 9754
50 Ga0070710_10008105 3300005437 Bacteria 5108
51 Ga0070711_100011930 3300005439 Bacteria 5409
52 Ga0070711_100022927 3300005439 Bacteria 4053
53 Ga0070711_100025635 3300005439 Bacteria 3859
54 Ga0070711_100107517 3300005439 Bacteria 2041
55 Ga0070711_100433553 3300005439 Bacteria 1073
56 Ga0070663_100051861 3300005455 Bacteria 2924
57 Ga0070663_100058684 3300005455 Bacteria 2764
58 Ga0070663_100066321 3300005455 Bacteria 2615
59 Ga0070663_100078084 3300005455 Bacteria 2426
60 Ga0070678_100002219 3300005456 Bacteria 10559
61 Ga0070678_100153852 3300005456 Bacteria 1856
62 Ga0070678_100197019 3300005456 Bacteria 1660
63 Ga0070678_100686094 3300005456 Bacteria 921
64 Ga0070681_10148843 3300005458 Bacteria 2269
65 Ga0070685_10256557 3300005466 Bacteria 1160
66 Ga0070698_100315623 3300005471 Bacteria 1493
67 Ga0070679_100055847 3300005530 Bacteria 3933
68 Ga0070684_100029049 3300005535 Bacteria 4682
69 Ga0068853_100010388 3300005539 Bacteria 7532
70 Ga0068853_100013884 3300005539 Bacteria 6585
71 Ga0068853_100153560 3300005539 Bacteria 2073
72 Ga0068853_100328838 3300005539 Bacteria 1418
73 Ga0070672_100185258 3300005543 Bacteria 1736
74 Ga0070672_100369251 3300005543 Bacteria 1226
75 Ga0070686_100122599 3300005544 Bacteria 1787
76 Ga0070693_100218811 3300005547 Bacteria 1247
77 Ga0070665_100091755 3300005548 Bacteria 3042
78 Ga0070665_100095490 3300005548 Bacteria 2978
79 Ga0070665_100121335 3300005548 Bacteria 2615
80 Ga0070665_100216758 3300005548 Bacteria 1915
81 Ga0070665_100311720 3300005548 Bacteria 1577
82 Ga0070665_100362264 3300005548 Bacteria 1456
83 Ga0070704_100500343 3300005549 Bacteria 1054
84 Ga0068855_100012246 3300005563 Bacteria 10366
85 Ga0068855_100131616 3300005563 Bacteria 2856
86 Ga0068855_100172265 3300005563 Bacteria 2451
87 Ga0068855_100202213 3300005563 Bacteria 2236
88 Ga0068855_100259042 3300005563 Bacteria 1938
89 Ga0068855_100405340 3300005563 Bacteria 1494
90 Ga0068855_100423628 3300005563 Bacteria 1456
91 Ga0068855_100772118 3300005563 Bacteria 1023
92 Ga0068857_100017956 3300005577 Bacteria 6204
93 Ga0068857_100089225 3300005577 Bacteria 2758
94 Ga0068854_100007431 3300005578 Bacteria 7000
95 Ga0068854_100054057 3300005578 Bacteria 2886
96 Ga0068856_100001511 3300005614 Bacteria 24373
97 Ga0068856_100012955 3300005614 Bacteria 8074
98 Ga0068856_100020172 3300005614 Bacteria 6475
99 Ga0068856_100147939 3300005614 Bacteria 2357
100 Ga0068856_100511524 3300005614 Bacteria 1222
101 Ga0068856_100635519 3300005614 Bacteria 1088
102 Ga0068852_100032298 3300005616 Bacteria 4333
103 Ga0068852_100121936 3300005616 Bacteria 2388
104 Ga0068852_100212515 3300005616 Bacteria 1836
105 Ga0068852_100232229 3300005616 Bacteria 1759
106 Ga0068852_100711811 3300005616 Bacteria 1015
107 Ga0068859_100391233 3300005617 Bacteria 1486
108 Ga0068864_100061951 3300005618 Bacteria 3240
109 Ga0068864_100561332 3300005618 Bacteria 1104
110 Ga0068864_100813199 3300005618 Bacteria 919
111 Ga0068861_100226410 3300005719 Bacteria 1583
112 Ga0068861_100242917 3300005719 Bacteria 1532
113 Ga0068851_10002363 3300005834 Bacteria 8300
114 Ga0068851_10148268 3300005834 Bacteria 1280
115 Ga0068870_10088736 3300005840 Bacteria 1724
116 Ga0068863_100146926 3300005841 Bacteria 2255
117 Ga0068858_100384542 3300005842 Bacteria 1347
118 Ga0068860_100027348 3300005843 Bacteria 5495
119 Ga0068860_100155885 3300005843 Bacteria 2201
120 Ga0068860_100345053 3300005843 Bacteria 1464
121 Ga0068862_100282520 3300005844 Bacteria 1521
122 Ga0081455_10069094 3300005937 Bacteria 2939
123 Ga0081455_10071334 3300005937 Bacteria 2880
124 Ga0081455_10093375 3300005937 Bacteria 2433
125 Ga0081455_10164803 3300005937 Bacteria 1695
126 Ga0081540_1004405 3300005983 Bacteria 10757
127 Ga0081540_1004639 3300005983 Bacteria 10394
128 Ga0081540_1006383 3300005983 Bacteria 8598
129 Ga0081540_1009947 3300005983 Bacteria 6485
130 Ga0081540_1014603 3300005983 Bacteria 5020
131 Ga0081540_1031625 3300005983 Bacteria 2906
132 Ga0081540_1045282 3300005983 Bacteria 2237
133 Ga0081540_1048022 3300005983 Bacteria 2141
134 Ga0081540_1048705 3300005983 Bacteria 2120
135 Ga0081539_10000948 3300005985 Bacteria 54410
136 Ga0081539_10008456 3300005985 Bacteria 8959
137 Ga0070717_10011626 3300006028 Bacteria 6694
138 Ga0070717_10021289 3300006028 Bacteria 5107
139 Ga0070717_10246274 3300006028 Bacteria 1578
140 Ga0075365_10048836 3300006038 Bacteria 2787
141 Ga0075365_10060127 3300006038 Bacteria 2534
142 Ga0075365_10078603 3300006038 Bacteria 2231
143 Ga0075365_10092887 3300006038 Bacteria 2057
144 Ga0075365_10100645 3300006038 Bacteria 1978
145 Ga0075365_10109406 3300006038 Bacteria 1898
146 Ga0075365_10203671 3300006038 Bacteria 1387
147 Ga0075365_10245231 3300006038 Bacteria 1258
148 Ga0075365_10278201 3300006038 Bacteria 1177
149 Ga0075368_10005160 3300006042 Bacteria 4478
150 Ga0075368_10012494 3300006042 Bacteria 3105
151 Ga0075368_10013094 3300006042 Bacteria 3042
152 Ga0075363_100023011 3300006048 Bacteria 3154
153 Ga0070716_100001799 3300006173 Bacteria 9712
154 Ga0070716_100056630 3300006173 Bacteria 2249
155 Ga0070712_100017522 3300006175 Bacteria 4638
156 Ga0070712_100019059 3300006175 Bacteria 4466
157 Ga0070712_100030959 3300006175 Bacteria 3601
158 Ga0070712_100187083 3300006175 Bacteria 1617
159 Ga0070712_100353123 3300006175 Bacteria 1204
160 Ga0075362_10058297 3300006177 Bacteria 1741
161 Ga0075362_10149948 3300006177 Bacteria 1118
162 Ga0075367_10035173 3300006178 Bacteria 2898
163 Ga0075367_10077508 3300006178 Bacteria 2006
164 Ga0075369_10127796 3300006186 Bacteria 1153
165 Ga0097621_100061404 3300006237 Bacteria 3082
166 Ga0075370_10047909 3300006353 Bacteria 2420
167 Ga0075370_10100198 3300006353 Bacteria 1676
168 Ga0075428_100192547 3300006844 Bacteria 2205
169 Ga0075434_100018105 3300006871 Bacteria 6797
170 Ga0075434_100039027 3300006871 Bacteria 4705
171 Ga0075429_100512968 3300006880 Bacteria 1051
172 Ga0068865_100029562 3300006881 Bacteria 3637
173 Ga0068865_100078732 3300006881 Bacteria 2359
174 Ga0075436_100261438 3300006914 Bacteria 1234
175 Ga0097620_100391269 3300006931 Bacteria 1486
176 Ga0099824_1017618 3300006942 Bacteria 6126
177 Ga0099794_10026115 3300007265 Bacteria 2697
178 Ga0099795_10035266 3300007788 Bacteria 1748
179 Ga0099795_10086464 3300007788 Bacteria 1208
180 Ga0105240_10003411 3300009093 Bacteria 24689
181 Ga0105240_10006169 3300009093 Bacteria 17666
182 Ga0105240_10015393 3300009093 Bacteria 10397
183 Ga0105240_10096827 3300009093 Bacteria 3596
184 Ga0105240_10161082 3300009093 Bacteria 2665
185 Ga0105240_10330349 3300009093 Bacteria 1735
186 Ga0105240_10364519 3300009093 Bacteria 1636
187 Ga0105245_10104201 3300009098 Bacteria 2630
188 Ga0105245_10280910 3300009098 Bacteria 1627
189 Ga0105245_10494724 3300009098 Bacteria 1238
190 Ga0105245_10559961 3300009098 Bacteria 1166
191 Ga0105245_10736559 3300009098 Bacteria 1021
192 Ga0105245_10756923 3300009098 Bacteria 1008
193 Ga0105247_10046105 3300009101 Bacteria 2675
194 Ga0105247_10143699 3300009101 Bacteria 1566
195 Ga0114129_10000570 3300009147 Bacteria 45373
196 Ga0114129_10150136 3300009147 Bacteria 3189
197 Ga0105243_10096060 3300009148 Bacteria 2451
198 Ga0105243_10180345 3300009148 Bacteria 1836
199 Ga0105241_10051886 3300009174 Bacteria 3129
200 Ga0105241_10151926 3300009174 Bacteria 1895
201 Ga0105241_10162466 3300009174 Bacteria 1837
202 Ga0105241_10202519 3300009174 Bacteria 1659
203 Ga0105248_10071812 3300009177 Bacteria 3889
204 Ga0105248_10098788 3300009177 Bacteria 3289
205 Ga0105248_10190467 3300009177 Bacteria 2311
206 Ga0105248_10590723 3300009177 Bacteria 1253
207 Ga0105237_10016152 3300009545 Bacteria 7765
208 Ga0105237_10041622 3300009545 Bacteria 4632
209 Ga0105237_10062523 3300009545 Bacteria 3722
210 Ga0105237_10121890 3300009545 Bacteria 2602
211 Ga0105237_10240529 3300009545 Bacteria 1811
212 Ga0105237_10254663 3300009545 Bacteria 1758
213 Ga0105237_10793405 3300009545 Bacteria 954
214 Ga0105238_10005788 3300009551 Bacteria 12235
215 Ga0105238_10010373 3300009551 Bacteria 9351
216 Ga0105238_10106814 3300009551 Bacteria 2781
217 Ga0105238_10165687 3300009551 Bacteria 2185
218 Ga0105249_10065998 3300009553 Bacteria 3331
219 Ga0105249_10131766 3300009553 Bacteria 2388
220 Ga0105249_10268626 3300009553 Bacteria 1698
221 Ga0105249_10504980 3300009553 Bacteria 1255
222 Ga0105249_10907464 3300009553 Bacteria 948
223 Ga0099796_10010068 3300010159 Bacteria 2585
224 Ga0105239_10006751 3300010375 Bacteria 13254
225 Ga0105239_10047522 3300010375 Bacteria 4703
226 Ga0105239_10053219 3300010375 Bacteria 4441
227 Ga0105239_10080275 3300010375 Bacteria 3589
228 Ga0105239_10093840 3300010375 Bacteria 3314
229 Ga0105239_10130443 3300010375 Bacteria 2795
230 Ga0105239_10158248 3300010375 Bacteria 2530
231 Ga0105239_10271757 3300010375 Bacteria 1907
232 Ga0105239_10275125 3300010375 Bacteria 1894
233 Ga0105239_10398272 3300010375 Bacteria 1558
234 Ga0105239_10569975 3300010375 Bacteria 1290
235 Ga0105246_10026013 3300011119 Bacteria 3818
236 Ga0105246_10076280 3300011119 Bacteria 2375
237 Ga0105246_10155540 3300011119 Bacteria 1736
238 Ga0157370_10051681 3300013104 Bacteria 3926
239 Ga0157369_10209601 3300013105 Bacteria 2043
240 Ga0157369_10612569 3300013105 Bacteria 1124
241 Ga0157374_10019918 3300013296 Bacteria 5946
242 Ga0157374_10041103 3300013296 Bacteria 4259
243 Ga0157378_10050817 3300013297 Bacteria 3688
244 Ga0157378_10263117 3300013297 Bacteria 1656
245 Ga0157378_10437885 3300013297 Bacteria 1295
246 Ga0163162_10183890 3300013306 Bacteria 2216
247 Ga0163162_10348820 3300013306 Bacteria 1613
248 Ga0163162_10593305 3300013306 Bacteria 1234
249 Ga0157375_10007831 3300013308 Bacteria 9349
250 Ga0157375_10473564 3300013308 Bacteria 1417
251 Ga0157375_10563637 3300013308 Bacteria 1300
252 Ga0163163_10051228 3300014325 Bacteria 4070
253 Ga0163163_10131391 3300014325 Bacteria 2544
254 Ga0163163_10191158 3300014325 Bacteria 2096
255 Ga0163163_10541498 3300014325 Bacteria 1226
256 Ga0157380_10065735 3300014326 Bacteria 2916
257 Ga0157380_10467010 3300014326 Bacteria 1216
258 Ga0157377_10066373 3300014745 Bacteria 2074
259 Ga0157379_10047198 3300014968 Bacteria 3842
260 Ga0157379_10202334 3300014968 Bacteria 1796
261 Ga0157376_10027010 3300014969 Bacteria 4545
262 Ga0157376_10036659 3300014969 Bacteria 3974
263 Ga0163161_10189326 3300017792 Bacteria 1581
264 Ga0214544_1019909 3300021320 Bacteria 4953
265 Ga0214542_1000338 3300021321 Bacteria 80765
266 Ga0214545_1000186 3300021324 Bacteria 80765
267 Ga0214543_1000271 3300021327 Bacteria 80766
268 Ga0213873_10050190 3300021358 Bacteria 1102
269 Ga0213876_10018591 3300021384 Bacteria 3669
270 Ga0213876_10090022 3300021384 Bacteria 1625
271 Ga0213876_10149930 3300021384 Bacteria 1240
272 Ga0209563_106583 3300025230 Bacteria 1985
273 Ga0209677_100687 3300025253 Bacteria 17321
274 Ga0209677_106060 3300025253 Bacteria 2976
275 Ga0209148_1000774 3300025254 Bacteria 23924
276 Ga0209148_1010512 3300025254 Bacteria 1751
277 Ga0209233_1001017 3300025261 Bacteria 11967
278 Ga0209233_1005487 3300025261 Bacteria 4202
279 Ga0209455_1000964 3300025272 Bacteria 14616
280 Ga0209564_1007241 3300025295 Bacteria 5772
281 Ga0209564_1014113 3300025295 Bacteria 3346
282 Ga0209758_1000109 3300025297 Bacteria 214759
283 Ga0209758_1003227 3300025297 Bacteria 15167
284 Ga0209758_1008509 3300025297 Bacteria 6621
285 Ga0209758_1009959 3300025297 Bacteria 5784
286 Ga0209758_1020295 3300025297 Bacteria 3151
287 Ga0209758_1026549 3300025297 Bacteria 2502
288 Ga0209758_1031649 3300025297 Bacteria 2166
289 Ga0209256_1016521 3300025299 Bacteria 2509
290 Ga0209256_1019127 3300025299 Bacteria 2194
291 Ga0207426_1000379 3300025302 Bacteria 76587
292 Ga0207426_1004089 3300025302 Bacteria 7359
293 Ga0207426_1013861 3300025302 Bacteria 2971
294 Ga0207426_1047799 3300025302 Bacteria 1289
295 Ga0209257_1001504 3300025304 Bacteria 27376
296 Ga0209257_1032541 3300025304 Bacteria 1652
297 Ga0207656_10004091 3300025321 Bacteria 5061
298 Ga0207656_10067399 3300025321 Bacteria 1584
299 Ga0207692_10006929 3300025898 Bacteria 4619
300 Ga0207692_10013222 3300025898 Bacteria 3574
301 Ga0207680_10194881 3300025903 Bacteria 1377
302 Ga0207647_10020111 3300025904 Bacteria 4482
303 Ga0207647_10023844 3300025904 Bacteria 4041
304 Ga0207647_10073980 3300025904 Bacteria 2053
305 Ga0207647_10109640 3300025904 Bacteria 1632
306 Ga0207699_10001086 3300025906 Bacteria 12839
307 Ga0207645_10151462 3300025907 Bacteria 1514
308 Ga0207645_10157140 3300025907 Bacteria 1486
309 Ga0207643_10092226 3300025908 Bacteria 1767
310 Ga0207705_10138856 3300025909 Bacteria 1814
311 Ga0207705_10261832 3300025909 Bacteria 1320
312 Ga0207654_10000717 3300025911 Bacteria 18498
313 Ga0207654_10074091 3300025911 Bacteria 2031
314 Ga0207654_10094604 3300025911 Bacteria 1829
315 Ga0207654_10124036 3300025911 Bacteria 1626
316 Ga0207707_10085684 3300025912 Bacteria 2753
317 Ga0207695_10000556 3300025913 Bacteria 76837
318 Ga0207695_10002499 3300025913 Bacteria 27042
319 Ga0207695_10047397 3300025913 Bacteria 4549
320 Ga0207695_10057841 3300025913 Bacteria 4027
321 Ga0207671_10016810 3300025914 Bacteria 5671
322 Ga0207671_10023001 3300025914 Bacteria 4704
323 Ga0207671_10075263 3300025914 Bacteria 2525
324 Ga0207671_10096604 3300025914 Bacteria 2233
325 Ga0207671_10168346 3300025914 Bacteria 1700
326 Ga0207693_10023981 3300025915 Bacteria 4843
327 Ga0207693_10036356 3300025915 Bacteria 3882
328 Ga0207693_10037883 3300025915 Bacteria 3800
329 Ga0207663_10018243 3300025916 Bacteria 3928
330 Ga0207663_10363865 3300025916 Bacteria 1098
331 Ga0207660_10094043 3300025917 Bacteria 2228
332 Ga0207657_10094770 3300025919 Bacteria 2485
333 Ga0207649_10077882 3300025920 Bacteria 2138
334 Ga0207649_10133564 3300025920 Bacteria 1689
335 Ga0207652_10551445 3300025921 Bacteria 1036
336 Ga0207681_10122787 3300025923 Bacteria 1907
337 Ga0207694_10000258 3300025924 Bacteria 50514
338 Ga0207694_10014516 3300025924 Bacteria 5939
339 Ga0207694_10031115 3300025924 Bacteria 4075
340 Ga0207694_10164031 3300025924 Bacteria 1796
341 Ga0207694_10517738 3300025924 Bacteria 999
342 Ga0207650_10155328 3300025925 Bacteria 1809
343 Ga0207650_10298095 3300025925 Bacteria 1316
344 Ga0207659_10163059 3300025926 Bacteria 1752
345 Ga0207659_10434998 3300025926 Bacteria 1102
346 Ga0207687_10244271 3300025927 Bacteria 1424
347 Ga0207700_10008400 3300025928 Bacteria 6395
348 Ga0207700_10021557 3300025928 Bacteria 4402
349 Ga0207664_10269250 3300025929 Bacteria 1492
350 Ga0207644_10078949 3300025931 Bacteria 2427
351 Ga0207644_10096001 3300025931 Bacteria 2218
352 Ga0207644_10471257 3300025931 Bacteria 1033
353 Ga0207690_10101769 3300025932 Bacteria 2053
354 Ga0207706_10134017 3300025933 Bacteria 2179
355 Ga0207706_10339070 3300025933 Bacteria 1308
356 Ga0207686_10045368 3300025934 Bacteria 2704
357 Ga0207709_10121172 3300025935 Bacteria 1766
358 Ga0207670_10293878 3300025936 Bacteria 1270
359 Ga0207669_10031652 3300025937 Bacteria 2959
360 Ga0207704_10109720 3300025938 Bacteria 1862
361 Ga0207704_10238030 3300025938 Bacteria 1358
362 Ga0207665_10016757 3300025939 Bacteria 4813
363 Ga0207665_10036744 3300025939 Bacteria 3258
364 Ga0207665_10147960 3300025939 Bacteria 1680
365 Ga0207691_10310578 3300025940 Bacteria 1353
366 Ga0207711_10040047 3300025941 Bacteria 3986
367 Ga0207689_10144781 3300025942 Bacteria 1958
368 Ga0207679_10264413 3300025945 Bacteria 1469
369 Ga0207679_10442056 3300025945 Bacteria 1152
370 Ga0207679_10624319 3300025945 Bacteria 973
371 Ga0207667_10007013 3300025949 Bacteria 13611
372 Ga0207667_10009886 3300025949 Bacteria 11193
373 Ga0207667_10034700 3300025949 Bacteria 5415
374 Ga0207667_10084975 3300025949 Bacteria 3276
375 Ga0207667_10142302 3300025949 Bacteria 2470
376 Ga0207667_10164557 3300025949 Bacteria 2281
377 Ga0207667_10537087 3300025949 Bacteria 1183
378 Ga0207651_10174207 3300025960 Bacteria 1700
379 Ga0207712_10039179 3300025961 Bacteria 3246
380 Ga0207712_10158881 3300025961 Bacteria 1754
381 Ga0207712_10218354 3300025961 Bacteria 1523
382 Ga0207668_10046434 3300025972 Bacteria 2967
383 Ga0207668_10125863 3300025972 Bacteria 1948
384 Ga0207640_10005931 3300025981 Bacteria 6670
385 Ga0207640_10023275 3300025981 Bacteria 3721
386 Ga0207640_10190713 3300025981 Bacteria 1545
387 Ga0207658_10092187 3300025986 Bacteria 2353
388 Ga0207677_10082120 3300026023 Bacteria 2315
389 Ga0207639_10005744 3300026041 Bacteria 8402
390 Ga0207639_10141351 3300026041 Bacteria 2006
391 Ga0207639_10156495 3300026041 Bacteria 1915
392 Ga0207639_10328464 3300026041 Bacteria 1360
393 Ga0207678_10007240 3300026067 Bacteria 9840
394 Ga0207678_10010142 3300026067 Bacteria 8266
395 Ga0207678_10071696 3300026067 Bacteria 2970
396 Ga0207678_10088812 3300026067 Bacteria 2642
397 Ga0207678_10096072 3300026067 Bacteria 2532
398 Ga0207678_10098727 3300026067 Bacteria 2494
399 Ga0207678_10170615 3300026067 Bacteria 1857
400 Ga0207708_10049067 3300026075 Bacteria 3214
401 Ga0207708_10064854 3300026075 Bacteria 2791
402 Ga0207702_10000006 3300026078 Bacteria 346370
403 Ga0207702_10001149 3300026078 Bacteria 27090
404 Ga0207702_10102511 3300026078 Bacteria 2529
405 Ga0207702_10181911 3300026078 Bacteria 1936
406 Ga0207702_10223514 3300026078 Bacteria 1755
407 Ga0207648_10017047 3300026089 Bacteria 6621
408 Ga0207676_10070538 3300026095 Bacteria 2802
409 Ga0207676_10129105 3300026095 Bacteria 2146
410 Ga0207674_10105742 3300026116 Bacteria 2792
411 Ga0207674_10122226 3300026116 Bacteria 2570
412 Ga0207674_10146637 3300026116 Bacteria 2318
413 Ga0207675_100006810 3300026118 Bacteria 10820
414 Ga0207675_100153465 3300026118 Bacteria 2193
415 Ga0207683_10054333 3300026121 Bacteria 3512
416 Ga0207683_10107807 3300026121 Bacteria 2492
417 Ga0207683_10108584 3300026121 Bacteria 2483
418 Ga0207683_10163065 3300026121 Bacteria 2016
419 Ga0207683_10171822 3300026121 Bacteria 1963
420 Ga0207683_10223019 3300026121 Bacteria 1718
421 Ga0207683_10253521 3300026121 Bacteria 1606
422 Ga0207683_10707065 3300026121 Bacteria 934
423 Ga0207698_10388313 3300026142 Bacteria 1330
424 Ga0209389_1000431 3300027296 Bacteria 24924
425 Ga0209589_1001194 3300027357 Bacteria 41825
426 Ga0209489_104677 3300027361 Bacteria 24924
427 Ga0209813_10005614 3300027866 Bacteria 3056
428 Ga0207428_10073282 3300027907 Bacteria 2687
429 Ga0268266_10001624 3300028379 Bacteria 26147
430 Ga0268266_10052663 3300028379 Bacteria 3495
431 Ga0268266_10088587 3300028379 Bacteria 2708
432 Ga0268266_10169502 3300028379 Bacteria 1981
433 Ga0268266_10192337 3300028379 Bacteria 1863
434 Ga0268266_10408496 3300028379 Bacteria 1285
435 Ga0268265_10069576 3300028380 Bacteria 2733
436 Ga0268265_10294402 3300028380 Bacteria 1458
437 Ga0268264_10000429 3300028381 Bacteria 58174
438 Ga0268264_10148222 3300028381 Bacteria 2101
439 Ga0307517_10000524 3300028786 Bacteria 65717
440 Ga0307515_10091971 3300028794 Bacteria 3782
441 Ga0265338_10000934 3300028800 Bacteria 49279
442 Ga0307511_10025459 3300030521 Bacteria 5454
443 Ga0265330_10008698 3300031235 Bacteria 4870
444 Ga0265330_10023551 3300031235 Bacteria 2796
445 Ga0265332_10007825 3300031238 Bacteria 4823
446 Ga0265325_10008954 3300031241 Bacteria 5879
447 Ga0265340_10027553 3300031247 Bacteria 2864
448 Ga0265339_10008783 3300031249 Bacteria 6401
449 Ga0307408_100178249 3300031548 Bacteria 1702
450 Ga0307408_100341622 3300031548 Bacteria 1267
451 Ga0265313_10034591 3300031595 Bacteria 2554
452 Ga0307508_10026590 3300031616 Bacteria 5244
453 Ga0307508_10272318 3300031616 Bacteria 1287
454 Ga0307508_10311692 3300031616 Bacteria 1166
455 Ga0265314_10012894 3300031711 Bacteria 6791
456 Ga0265314_10019827 3300031711 Bacteria 5200
457 Ga0265314_10060883 3300031711 Bacteria 2574
458 Ga0265314_10092842 3300031711 Bacteria 1961
459 Ga0265342_10004062 3300031712 Bacteria 11674
460 Ga0265342_10058861 3300031712 Bacteria 2270
461 Ga0316578_10063918 3300031728 Bacteria 2171
462 Ga0307516_10044655 3300031730 Bacteria 4382
463 Ga0307516_10141760 3300031730 Bacteria 2172
464 Ga0316577_10107402 3300031733 Bacteria 1566
465 Ga0307413_10025409 3300031824 Bacteria 3247
466 Ga0307412_10333973 3300031911 Bacteria 1211
467 Ga0307416_100204391 3300032002 Bacteria 1877
468 Ga0307416_100331165 3300032002 Bacteria 1530
469 Ga0307411_10045728 3300032005 Bacteria 2817
470 Ga0307411_10133689 3300032005 Bacteria 1817
471 Ga0307510_10077900 3300033180 Bacteria 3247
472 Ga0307510_10103570 3300033180 Bacteria 2623
473 Ga0307510_10190514 3300033180 Bacteria 1599
474 Ga0316215_1002340 3300033544 Bacteria 1793
475 Ga0373926_0116792 3300035083 Bacteria 1004
476 Ga0373934_0010395 3300035086 Bacteria 3494
477 Ga0373934_0030612 3300035086 Bacteria 2105
478 Ga0373952_0001616 3300035092 Bacteria 4101
479 Ga0373923_0000945 3300035111 Bacteria 7778
480 Ga0373932_0011568 3300035112 Bacteria 2158
481 Ga0373936_0017485 3300035113 Bacteria 2762
482 Ga0373936_0091392 3300035113 Bacteria 1277
483 Ga0373941_0019125 3300035115 Bacteria 1902
484 Ga0373945_0060104 3300035116 Bacteria 1416
485 Ga0373953_0000528 3300035117 Bacteria 10623
486 Ga0373954_0005976 3300035118 Bacteria 5294
487 Ga0373954_0077849 3300035118 Bacteria 1581
488 Ga0373956_0001669 3300035119 Bacteria 9135
489 Ga0373957_0003463 3300035120 Bacteria 4665
490 Ga0373943_0093515 3300035170 Bacteria 1561
491 Ga0373955_0025129 3300035172 Bacteria 3055
492 Ga0373955_0030230 3300035172 Bacteria 2825
493 Ga0373942_0007422 3300035207 Bacteria 2543
494 Ga0316574_0012991 3300035398 Bacteria 4777
495 Ga0373924_0003968 3300035410 Bacteria 5136
496 Ga0373924_0054689 3300035410 Bacteria 1660
497 Ga0373931_0000507 3300035691 Bacteria 15939
498 Ga0373935_0009651 3300035692 Bacteria 5776
499 Ga0373935_0043982 3300035692 Bacteria 2813
500 Ga0373927_0001215 3300035695 Bacteria 19550
501 Ga0373927_0007995 3300035695 Bacteria 7143
502 Ga0373927_0013581 3300035695 Bacteria 5409
503 Ga0373927_0156053 3300035695 Bacteria 1495
504 Ga0373933_0000278 3300035724 Bacteria 33265
505 Ga0373933_0012290 3300035724 Bacteria 4727
506 Ga0373933_0145854 3300035724 Bacteria 1497
507 Ga0373947_0006550 3300035725 Bacteria 6756
508 Ga0373947_0315629 3300035725 Bacteria 1044
509 Ga0373937_0091359 3300036401 Bacteria 2821
510 Ga0373937_0157710 3300036401 Bacteria 2127
511 Ga0372808_017632 3300036459 Bacteria 1025
512 Ga0316584_0012832 3300036712 Bacteria 5916
513 Ga0373925_0006083 3300037068 Bacteria 8927
514 Ga0373925_0065533 3300037068 Bacteria 2736
515 Ga0373925_0107353 3300037068 Bacteria 2153
516 Ga0373925_0599175 3300037068 Bacteria 907
517 Ga0395900_0059561 3300037418 Bacteria 3931
518 Ga0395898_0046000 3300037466 Bacteria 4288
519 Ga0395905_0030574 3300037471 Bacteria 5072
520 Ga0395905_0107172 3300037471 Bacteria 2624
521 Ga0436364_0640114 3300037853 Bacteria 2426
522 Ga0436364_0801657 3300037853 Bacteria 910
523 Ga0395901_0044380 3300038443 Bacteria 4611
524 Ga0395901_0384959 3300038443 Bacteria 1443
525 Ga0436365_0039735 3300039437 Bacteria 2463
526 Ga0436365_0655508 3300039437 Bacteria 2512
527 Ga0436365_0764898 3300039437 Bacteria 1612
528 Ga0436365_1619476 3300039437 Bacteria 12276
529 Ga0436360_0840337 3300039438 Bacteria 1354
530 Ga0436363_0590996 3300039450 Bacteria 1320
531 Ga0436363_1169938 3300039450 Bacteria 4202
532 Ga0436363_1645063 3300039450 Bacteria 993
533 Ga0436362_1201525 3300039453 Bacteria 2539
534 Ga0451807_2440058 3300041486 Bacteria 2144
535 Ga0451849_0196853 3300041505 Bacteria 937
536 Ga0466972_0004933 3300044658 Bacteria 6697
537 Ga0466972_0094283 3300044658 Bacteria 1418
538 Ga0466972_0157911 3300044658 Bacteria 1066
539 Ga0466965_0017223 3300044683 Bacteria 3451
540 Ga0466966_0001537 3300044684 Bacteria 14796
541 Ga0466966_0321168 3300044684 Bacteria 930
542 Ga0466961_0021638 3300044693 Bacteria 4137
543 Ga0466963_0050047 3300044694 Bacteria 2765
544 Ga0466964_0189642 3300044706 Bacteria 980
545 Ga0466971_0133402 3300044719 Bacteria 1154
546 Ga0466968_0070116 3300044735 Bacteria 1524
547 Ga0466960_0079237 3300044901 Bacteria 1651
548 Ga0466960_0111589 3300044901 Bacteria 1421
549 Ga0466959_0003334 3300045049 Bacteria 10491
550 Ga0466959_0403719 3300045049 Bacteria 929
551 Ga0466967_0646668 3300045976 Bacteria 1045
552 Ga0495617_089488 3300046452 Bacteria 1005
553 Ga0495592_0015335 3300046454 Bacteria 5815
554 Ga0495592_0019062 3300046454 Bacteria 5222
555 Ga0495592_0105928 3300046454 Bacteria 1997
556 Ga0495603_0025189 3300046455 Bacteria 3597
557 Ga0495603_0033310 3300046455 Bacteria 3100
558 Ga0495603_0054172 3300046455 Bacteria 2378
559 Ga0495603_0081148 3300046455 Bacteria 1900
560 Ga0495603_0295571 3300046455 Bacteria 930
561 Ga0495590_0047570 3300046457 Bacteria 1496
562 Ga0495629_0000314 3300046459 Bacteria 41394
563 Ga0495629_0002501 3300046459 Bacteria 14108
564 Ga0495629_0021109 3300046459 Bacteria 4647
565 Ga0495629_0091357 3300046459 Bacteria 2125
566 Ga0495629_0287312 3300046459 Bacteria 1128
567 Ga0495629_0324444 3300046459 Bacteria 1052
568 Ga0495638_0118626 3300046460 Bacteria 1565
569 Ga0495641_0002314 3300046461 Bacteria 15168
570 Ga0495651_0043472 3300046462 Bacteria 3486
571 Ga0495651_0054693 3300046462 Bacteria 3068
572 Ga0495651_0250892 3300046462 Bacteria 1208
573 Ga0495653_0026984 3300046463 Bacteria 4599
574 Ga0495653_0078813 3300046463 Bacteria 2442
575 Ga0495650_0063965 3300046471 Bacteria 1465
576 Ga0495580_0002541 3300046472 Bacteria 15893
577 Ga0495580_0305543 3300046472 Bacteria 1083
578 Ga0495582_0001544 3300046473 Bacteria 12986
579 Ga0495582_0109974 3300046473 Bacteria 1548
580 Ga0495582_0291798 3300046473 Bacteria 937
581 Ga0495605_0022610 3300046474 Bacteria 3318
582 Ga0495639_0000223 3300046475 Bacteria 29083
583 Ga0495639_0023849 3300046475 Bacteria 2691
584 Ga0495662_0003817 3300046476 Bacteria 7595
585 Ga0495664_0005828 3300046477 Bacteria 6782
586 Ga0495664_0018865 3300046477 Bacteria 3959
587 Ga0495664_0164138 3300046477 Bacteria 1347
588 Ga0495585_0081043 3300046492 Bacteria 1758
589 Ga0495585_0141347 3300046492 Bacteria 1260
590 Ga0495594_0002386 3300046499 Bacteria 9784
591 Ga0495594_0061312 3300046499 Bacteria 2081
592 Ga0495596_0100465 3300046500 Bacteria 1123
593 Ga0495606_0097496 3300046507 Bacteria 1796
594 Ga0495608_0070533 3300046511 Bacteria 2280
595 Ga0495616_0091624 3300046513 Bacteria 1438
596 Ga0495616_0161253 3300046513 Bacteria 1008
597 Ga0495618_0018724 3300046514 Bacteria 4253
598 Ga0495618_0020570 3300046514 Bacteria 4063
599 Ga0495618_0168988 3300046514 Bacteria 1392
600 Ga0495628_0005066 3300046516 Bacteria 11580
601 Ga0495628_0024106 3300046516 Bacteria 4984
602 Ga0495628_0224602 3300046516 Bacteria 1409
603 Ga0495630_0025390 3300046517 Bacteria 4381
604 Ga0495630_0074681 3300046517 Bacteria 2554
605 Ga0495630_0205335 3300046517 Bacteria 1504
606 Ga0495631_0070273 3300046518 Bacteria 1514
607 Ga0495631_0122934 3300046518 Bacteria 1116
608 Ga0495632_0070066 3300046519 Bacteria 1687
609 Ga0495632_0145964 3300046519 Bacteria 1095
610 Ga0495644_0069864 3300046523 Bacteria 1319
611 Ga0495644_0073808 3300046523 Bacteria 1283
612 Ga0495648_0031798 3300046524 Bacteria 3471
613 Ga0495648_0088452 3300046524 Bacteria 1741
614 Ga0495648_0099296 3300046524 Bacteria 1611
615 Ga0495648_0189143 3300046524 Bacteria 1040
616 Ga0495663_0065786 3300046525 Bacteria 1146
617 Ga0495663_0089194 3300046525 Bacteria 1003
618 Ga0495666_0028246 3300046526 Bacteria 2760
619 Ga0495652_0011303 3300046529 Bacteria 8076
620 Ga0495652_0073423 3300046529 Bacteria 2848
621 Ga0495665_0004299 3300046531 Bacteria 7699
622 Ga0495665_0147476 3300046531 Bacteria 1229
623 Ga0495640_0000308 3300046533 Bacteria 33750
624 Ga0495640_0021500 3300046533 Bacteria 4733
625 Ga0495640_0069034 3300046533 Bacteria 2377
626 Ga0495640_0165462 3300046533 Bacteria 1415
627 Ga0495586_0120442 3300046535 Bacteria 1466
628 Ga0495587_0018728 3300046536 Bacteria 4293
629 Ga0495587_0235310 3300046536 Bacteria 1031
630 Ga0495598_0094888 3300046537 Bacteria 978
631 Ga0495609_0041887 3300046538 Bacteria 2057
632 Ga0495645_0049743 3300046543 Bacteria 3052
633 Ga0495622_0004386 3300046557 Bacteria 6567
634 Ga0495622_0160372 3300046557 Bacteria 1014
635 Ga0495633_0018568 3300046558 Bacteria 3529
636 Ga0495667_0006172 3300046559 Bacteria 8120
637 Ga0495667_0024280 3300046559 Bacteria 4082
638 Ga0495667_0051542 3300046559 Bacteria 2714
639 Ga0495667_0082305 3300046559 Bacteria 2092
640 Ga0495667_0305612 3300046559 Bacteria 1007
641 Ga0495656_0054989 3300046615 Bacteria 1714
642 Ga0495656_0214913 3300046615 Bacteria 959
643 Ga0495634_0001740 3300046642 Bacteria 18853
644 Ga0495635_0001578 3300046663 Bacteria 15314
645 Ga0495635_0019563 3300046663 Bacteria 4718
646 Ga0495635_0027113 3300046663 Bacteria 3986
647 Ga0495635_0137695 3300046663 Bacteria 1663
648 Ga0495588_0010698 3300046674 Bacteria 4279
649 Ga0495588_0029460 3300046674 Bacteria 2753
650 Ga0495588_0115317 3300046674 Bacteria 1416
651 Ga0495657_0032972 3300046675 Bacteria 3610
652 Ga0495657_0036296 3300046675 Bacteria 3407
653 Ga0495657_0054191 3300046675 Bacteria 2680
654 Ga0495599_0013408 3300046678 Bacteria 5064
655 Ga0495599_0015277 3300046678 Bacteria 4763
656 Ga0495599_0023816 3300046678 Bacteria 3827
657 Ga0495623_0012417 3300046679 Bacteria 5515
658 Ga0495646_0004049 3300046680 Bacteria 9194
659 Ga0495647_0005969 3300046681 Bacteria 4013
660 Ga0495647_0069296 3300046681 Bacteria 1409
661 Ga0495658_0000927 3300046683 Bacteria 15644
662 Ga0495669_0020563 3300046684 Bacteria 2858
663 Ga0495669_0020616 3300046684 Bacteria 2854
664 Ga0495613_0016990 3300046689 Bacteria 5416
665 Ga0495613_0094278 3300046689 Bacteria 2166
666 Ga0495613_0211913 3300046689 Bacteria 1362
667 Ga0495624_0007405 3300046690 Bacteria 7703
668 Ga0495624_0043933 3300046690 Bacteria 2849
669 Ga0495671_0089772 3300046692 Bacteria 1504
670 Ga0495671_0123294 3300046692 Bacteria 1264
671 Ga0495649_0090346 3300046694 Bacteria 1633
672 Ga0495581_0000846 3300047315 Bacteria 16314
673 Ga0495581_0024579 3300047315 Bacteria 3492
674 Ga0495581_0040504 3300047315 Bacteria 2696
675 Ga0495604_0001459 3300047317 Bacteria 19431
676 Ga0495604_0011053 3300047317 Bacteria 7164
677 Ga0495636_0032747 3300047318 Bacteria 2133
678 Ga0495674_0000375 3300047319 Bacteria 39876
679 Ga0495674_0028279 3300047319 Bacteria 5115
680 Ga0495672_0082895 3300047320 Bacteria 1782
681 Ga0495676_0034038 3300047321 Bacteria 4279
682 Ga0495676_0039296 3300047321 Bacteria 3920
683 Ga0495680_0002851 3300047322 Bacteria 17368
684 Ga0495680_0023894 3300047322 Bacteria 5078
685 Ga0495687_065905 3300047443 Bacteria 1473
686 Ga0495687_082731 3300047443 Bacteria 1252
687 Ga0495675_0067440 3300047444 Bacteria 2261
688 Ga0495677_0077911 3300047445 Bacteria 1240
689 Ga0495673_0049808 3300047469 Bacteria 1842
690 Ga0495684_0011224 3300047471 Bacteria 6925
691 Ga0495684_0011967 3300047471 Bacteria 6691
692 Ga0495684_0016317 3300047471 Bacteria 5718
693 Ga0495686_0022394 3300047472 Bacteria 4182
694 Ga0495686_0112115 3300047472 Bacteria 1634
695 Ga0495593_0001627 3300047673 Bacteria 13302
696 Ga0495593_0013032 3300047673 Bacteria 4747
697 Ga0495593_0032798 3300047673 Bacteria 2830
698 Ga0495593_0068550 3300047673 Bacteria 1846
699 Ga0495602_0024514 3300048088 Bacteria 5852
700 Ga0495602_0070580 3300048088 Bacteria 2988
701 Ga0495602_0093857 3300048088 Bacteria 2481
702 Ga0496100_0002701 3300048903 Bacteria 9058
703 Ga0496100_0014885 3300048903 Bacteria 4529
704 Ga0496100_0111928 3300048903 Bacteria 1898
705 Ga0496100_0183006 3300048903 Bacteria 1516
706 Ga0496100_0234926 3300048903 Bacteria 1350
707 Ga0496101_0031148 3300048904 Bacteria 3747
708 Ga0496101_0092718 3300048904 Bacteria 2249
709 Ga0496101_0093847 3300048904 Bacteria 2235
710 Ga0496101_0106188 3300048904 Bacteria 2108
711 Ga0496101_0233235 3300048904 Bacteria 1431
712 Ga0496102_0001947 3300048905 Bacteria 17803
713 Ga0496102_0038907 3300048905 Bacteria 4295
714 Ga0496102_0096778 3300048905 Bacteria 2737
715 Ga0496102_0161329 3300048905 Bacteria 2109
716 Ga0496102_0177262 3300048905 Bacteria 2007
717 Ga0496103_0065859 3300048906 Bacteria 2260
718 Ga0496103_0159778 3300048906 Bacteria 1445
719 Ga0496104_0018988 3300048907 Bacteria 6281
720 Ga0496104_0020330 3300048907 Bacteria 6084
721 Ga0496104_0032400 3300048907 Bacteria 4863
722 Ga0496104_0059992 3300048907 Bacteria 3603
723 Ga0496104_0160483 3300048907 Bacteria 2156
724 Ga0496104_0278313 3300048907 Bacteria 1586
725 Ga0496104_0472371 3300048907 Bacteria 1166
726 Ga0496105_0008113 3300048908 Bacteria 8164
727 Ga0496105_0017481 3300048908 Bacteria 5751
728 Ga0496105_0109665 3300048908 Bacteria 2278
729 Ga0496105_0160891 3300048908 Bacteria 1843
730 Ga0496105_0516756 3300048908 Bacteria 936
731 Ga0496106_0002570 3300048909 Bacteria 13512
732 Ga0496106_0004112 3300048909 Bacteria 10841
733 Ga0496106_0246196 3300048909 Bacteria 1429
734 Ga0496106_0320411 3300048909 Bacteria 1244
735 Ga0496107_0013494 3300048910 Bacteria 5712
736 Ga0496107_0032234 3300048910 Bacteria 3744
737 Ga0496107_0063374 3300048910 Bacteria 2679
738 Ga0496107_0229173 3300048910 Bacteria 1382
739 Ga0496107_0528336 3300048910 Bacteria 874
740 Ga0496108_0003862 3300048911 Bacteria 12033
741 Ga0496108_0043899 3300048911 Bacteria 3734
742 Ga0496108_0063727 3300048911 Bacteria 3104
743 Ga0496108_0104480 3300048911 Bacteria 2417
744 Ga0496109_0001377 3300048912 Bacteria 20170
745 Ga0496109_0010357 3300048912 Bacteria 7965
746 Ga0496109_0055916 3300048912 Bacteria 3600
747 Ga0496109_0105495 3300048912 Bacteria 2617
748 Ga0496110_0001457 3300048913 Bacteria 17155
749 Ga0496110_0007419 3300048913 Bacteria 8756
750 Ga0496110_0031813 3300048913 Bacteria 4554
751 Ga0496110_0165958 3300048913 Bacteria 2002
752 Ga0496111_0160557 3300048914 Bacteria 1669
753 Ga0496111_0183972 3300048914 Bacteria 1553
754 Ga0496112_0000036 3300048915 Bacteria 106325
755 Ga0496112_0008985 3300048915 Bacteria 8971
756 Ga0496112_0023003 3300048915 Bacteria 5947
757 Ga0496112_0032718 3300048915 Bacteria 5049
758 Ga0496112_0066501 3300048915 Bacteria 3557
759 Ga0496112_0117149 3300048915 Bacteria 2634
760 Ga0496112_0210054 3300048915 Bacteria 1904
761 Ga0496112_0230778 3300048915 Bacteria 1805
762 Ga0496112_0683759 3300048915 Bacteria 954
763 Ga0496113_0033509 3300048916 Bacteria 3740
764 Ga0496113_0083781 3300048916 Bacteria 2447
765 Ga0496113_0107954 3300048916 Bacteria 2163
766 Ga0496113_0125517 3300048916 Bacteria 2009
767 Ga0496114_0002069 3300048917 Bacteria 15273
768 Ga0496114_0002910 3300048917 Bacteria 13118
769 Ga0496114_0219687 3300048917 Bacteria 1668
770 Ga0496114_0309715 3300048917 Bacteria 1395
771 Ga0496114_0469802 3300048917 Bacteria 1113
772 Ga0496114_0568882 3300048917 Bacteria 1001
773 Ga0496115_0060459 3300048918 Bacteria 3053
774 Ga0496115_0219002 3300048918 Bacteria 1571
775 Ga0496115_0220551 3300048918 Bacteria 1565
776 Ga0496115_0228116 3300048918 Bacteria 1536
777 Ga0496115_0274695 3300048918 Bacteria 1384
778 Ga0496115_0461810 3300048918 Bacteria 1024
779 Ga0496115_0462255 3300048918 Bacteria 1024
780 Ga0496116_0066973 3300048919 Bacteria 2296
781 Ga0496117_0016294 3300048920 Bacteria 6280
782 Ga0496117_0098586 3300048920 Bacteria 1857
783 Ga0496118_0020621 3300048921 Bacteria 5839
784 Ga0496118_0103079 3300048921 Bacteria 1921
785 Ga0496118_0120944 3300048921 Bacteria 1707
786 Ga0496118_0145291 3300048921 Bacteria 1495
787 Ga0496118_0199639 3300048921 Bacteria 1186
788 Ga0496119_0017238 3300048922 Bacteria 5443
789 Ga0496119_0039146 3300048922 Bacteria 3050
790 Ga0496120_0075434 3300048923 Bacteria 1840
791 Ga0496121_0000602 3300048924 Bacteria 67586
792 Ga0496121_0001201 3300048924 Bacteria 45377
793 Ga0496121_0001711 3300048924 Bacteria 35905
794 Ga0496121_0025610 3300048924 Bacteria 5591
795 Ga0496121_0030357 3300048924 Bacteria 4964
796 Ga0496121_0122077 3300048924 Bacteria 1965
797 Ga0496121_0134223 3300048924 Bacteria 1846
798 Ga0496121_0286931 3300048924 Bacteria 1123
799 Ga0496122_0029095 3300048925 Bacteria 4670
800 Ga0496122_0115911 3300048925 Bacteria 1744
801 Ga0496124_0010548 3300048927 Bacteria 9341
802 Ga0496124_0084428 3300048927 Bacteria 2604
803 Ga0496124_0091728 3300048927 Bacteria 2475
804 Ga0496124_0144765 3300048927 Bacteria 1871
805 Ga0496125_0008236 3300048928 Bacteria 10953
806 Ga0496125_0040107 3300048928 Bacteria 4021
807 Ga0496125_0052436 3300048928 Bacteria 3354
808 Ga0496125_0123617 3300048928 Bacteria 1839
809 Ga0496125_0139309 3300048928 Bacteria 1690
810 Ga0496125_0139394 3300048928 Bacteria 1689
811 Ga0496126_0005297 3300048929 Bacteria 14803
812 Ga0496126_0018533 3300048929 Bacteria 6893
813 Ga0496126_0024468 3300048929 Bacteria 5830
814 Ga0496126_0027530 3300048929 Bacteria 5428
815 Ga0496126_0085717 3300048929 Bacteria 2776
816 Ga0496126_0094504 3300048929 Bacteria 2623
817 Ga0496126_0105083 3300048929 Bacteria 2466
818 Ga0496126_0171112 3300048929 Bacteria 1850
819 Ga0496126_0238045 3300048929 Bacteria 1522
820 Ga0496126_0301239 3300048929 Bacteria 1322
821 Ga0501032_0060650 3300049569 Bacteria 2537
822 Ga0501032_0103967 3300049569 Bacteria 1881
823 Ga0501032_0170464 3300049569 Bacteria 1427
824 Ga0501033_0007525 3300049570 Bacteria 8476
825 Ga0501033_0009293 3300049570 Bacteria 7573
826 Ga0501033_0069229 3300049570 Bacteria 2594
827 Ga0501033_0100621 3300049570 Bacteria 2109
828 Ga0501034_0028890 3300049571 Bacteria 5639
829 Ga0501034_0033451 3300049571 Bacteria 5215
830 Ga0501034_0116985 3300049571 Bacteria 2653
831 Ga0501034_0210712 3300049571 Bacteria 1899
832 Ga0501036_0026249 3300049572 Bacteria 4915
833 Ga0501036_0117652 3300049572 Bacteria 2244
834 Ga0501037_0016424 3300049573 Bacteria 5449
835 Ga0501038_0000840 3300049574 Bacteria 27347
836 Ga0501038_0020801 3300049574 Bacteria 5897
837 Ga0501039_0009482 3300049575 Bacteria 7421
838 Ga0501039_0020785 3300049575 Bacteria 5031
839 Ga0501039_0116875 3300049575 Bacteria 2088
840 Ga0501039_0324580 3300049575 Bacteria 1210
841 Ga0501040_0098904 3300049576 Bacteria 2033
842 Ga0501043_0008784 3300049579 Bacteria 7952
843 Ga0501043_0012051 3300049579 Bacteria 6760
844 Ga0501043_0031983 3300049579 Bacteria 4135
845 Ga0501046_0049026 3300049580 Bacteria 3342
846 Ga0501046_0197534 3300049580 Bacteria 1498
847 Ga0501046_0278569 3300049580 Bacteria 1225
848 Ga0501047_0006942 3300049581 Bacteria 10636
849 Ga0501047_0020707 3300049581 Bacteria 6316
850 Ga0501047_0060254 3300049581 Bacteria 3663
851 Ga0501047_0069651 3300049581 Bacteria 3387
852 Ga0501067_0006561 3300049583 Bacteria 6449
853 Ga0501067_0111895 3300049583 Bacteria 1518
854 Ga0501068_0008340 3300049584 Bacteria 5761
855 Ga0501069_0023734 3300049585 Bacteria 3343
856 Ga0501070_0041625 3300049586 Bacteria 3827
857 Ga0501070_0063324 3300049586 Bacteria 3063
858 Ga0501070_0183548 3300049586 Bacteria 1721
859 Ga0501071_0028586 3300049587 Bacteria 3931
860 Ga0501071_0033266 3300049587 Bacteria 3663
861 Ga0501072_0028756 3300049588 Bacteria 4339
862 Ga0501073_0035135 3300049589 Bacteria 3563
863 Ga0501074_0013478 3300049590 Bacteria 5944
864 Ga0501074_0054268 3300049590 Bacteria 2890
865 Ga0501076_0056482 3300049592 Bacteria 3116
866 Ga0501077_0019485 3300049593 Bacteria 4292
867 Ga0501079_0014219 3300049741 Bacteria 6067
868 Ga0501080_0010194 3300049742 Bacteria 8593
869 Ga0501080_0062603 3300049742 Bacteria 3462
870 Ga0501080_0163405 3300049742 Bacteria 2056
871 Ga0501081_0116134 3300049743 Bacteria 1903
872 Ga0501083_0014996 3300049744 Bacteria 5424
873 Ga0501035_0077491 3300049822 Bacteria 2937
874 Ga0501035_0117734 3300049822 Bacteria 2324
875 Ga0501035_0172354 3300049822 Bacteria 1868
876 Ga0501044_0022904 3300049823 Bacteria 6651
877 Ga0501044_0024484 3300049823 Bacteria 6406
878 Ga0501044_0047720 3300049823 Bacteria 4428
879 Ga0501044_0110863 3300049823 Bacteria 2752
880 nmdc:mga03683_58301_c1 3300050489 Bacteria 1627
881 nmdc:mga03683_94067_c1 3300050489 Bacteria 1310
882 nmdc:mga03n38_20420_c1 3300050490 Bacteria 2650
883 nmdc:mga0yw44_263309_c1 3300050492 Bacteria 1149
884 nmdc:mga0yw44_57457_c1 3300050492 Bacteria 2373
885 nmdc:mga06z11_12043_c1 3300050494 Bacteria 3750
886 nmdc:mga06z11_97633_c1 3300050494 Bacteria 1606
887 nmdc:mga04h51_22754_c1 3300050495 Bacteria 1900
888 nmdc:mga04h51_23326_c1 3300050495 Bacteria 1883
889 nmdc:mga07m45_16524_c1 3300050496 Bacteria 3951
890 nmdc:mga05p37_1409_c1 3300050507 Bacteria 27980
891 nmdc:mga05p37_79056_c1 3300050507 Bacteria 4050
892 nmdc:mga0rr50_90841_c1 3300050513 Bacteria 2377
893 nmdc:mga0sz30_45558_c1 3300050516 Bacteria 1850
894 Ga0495601_0188466 3300053077 Bacteria 1348
895 Ga0495601_0269898 3300053077 Bacteria 1110
896 Ga0495612_0025036 3300053078 Bacteria 2396
897 Ga0495612_0150723 3300053078 Bacteria 1012
898 Ga0495595_0013999 3300053084 Bacteria 3395
899 Ga0495619_0014295 3300053085 Bacteria 5015
900 Ga0495619_0023835 3300053085 Bacteria 3923
901 Ga0495619_0079830 3300053085 Bacteria 2201
902 Ga0495619_0109880 3300053085 Bacteria 1883
903 Ga0500578_0089189 3300053086 Bacteria 1958
904 Ga0500583_0043669 3300053092 Bacteria 2048
905 Ga0500651_0065173 3300053093 Bacteria 2270
906 Ga0500566_0000356 3300053094 Bacteria 24924
907 Ga0500566_0000747 3300053094 Bacteria 18284
908 Ga0500566_0001460 3300053094 Bacteria 13827
909 Ga0500566_0152945 3300053094 Bacteria 1211
910 Ga0500640_001385 3300053095 Bacteria 7305
911 Ga0500641_0027368 3300053096 Bacteria 2219
912 Ga0500641_0163157 3300053096 Bacteria 960
913 Ga0500554_005925 3300053102 Bacteria 2707
914 Ga0500554_098643 3300053102 Bacteria 976
915 Ga0500557_000125 3300053105 Bacteria 20394
916 Ga0500572_000185 3300053111 Bacteria 21930
917 Ga0500572_001192 3300053111 Bacteria 7413
918 Ga0500572_009132 3300053111 Bacteria 2336
919 Ga0500591_016915 3300053115 Bacteria 3521
920 Ga0500595_007908 3300053119 Bacteria 4375
921 Ga0500595_009149 3300053119 Bacteria 4012
922 Ga0500595_013153 3300053119 Bacteria 3174
923 Ga0500595_015767 3300053119 Bacteria 2830
924 Ga0500595_030259 3300053119 Bacteria 1826
925 Ga0500595_039567 3300053119 Bacteria 1525
926 Ga0500608_059876 3300053122 Bacteria 1821
927 Ga0500559_0000137 3300053136 Bacteria 56803
928 Ga0500559_0005529 3300053136 Bacteria 5805
929 Ga0500559_0081342 3300053136 Bacteria 1472
930 Ga0500559_0081600 3300053136 Bacteria 1470
931 Ga0500564_132857 3300053138 Bacteria 1075
932 Ga0500590_035492 3300053148 Bacteria 2581
933 Ga0500590_041401 3300053148 Bacteria 2369
934 Ga0500603_001300 3300053150 Bacteria 5736
935 Ga0500603_001410 3300053150 Bacteria 5487
936 Ga0500603_002347 3300053150 Bacteria 4159
937 Ga0500603_036559 3300053150 Bacteria 1293
938 Ga0500630_001361 3300053159 Bacteria 11523
939 Ga0500634_0066202 3300053161 Bacteria 1904
940 Ga0500638_000305 3300053162 Bacteria 11061
941 Ga0500638_012424 3300053162 Bacteria 3815
942 Ga0500638_032225 3300053162 Bacteria 2530
943 Ga0500638_041809 3300053162 Bacteria 2226
944 Ga0500639_000013 3300053163 Bacteria 123899
945 Ga0500639_019226 3300053163 Bacteria 3604
946 Ga0500639_177296 3300053163 Bacteria 947
947 Ga0500636_0002510 3300053177 Bacteria 10187
948 Ga0500636_0033011 3300053177 Bacteria 3065
949 Ga0500636_0038049 3300053177 Bacteria 2846
950 Ga0500637_0001408 3300053178 Bacteria 10241
951 Ga0500637_0027717 3300053178 Bacteria 3128
952 Ga0500637_0183815 3300053178 Bacteria 1197
953 Ga0500637_0228271 3300053178 Bacteria 1049
954 Ga0500637_0262730 3300053178 Bacteria 958
955 Ga0500625_017266 3300053729 Bacteria 3369
956 Ga0500645_025749 3300053730 Bacteria 1793
957 Ga0500656_013283 3300053732 Bacteria 941
958 Ga0500596_002171 3300053735 Bacteria 3890
959 Ga0500596_002227 3300053735 Bacteria 3844
960 Ga0500596_004406 3300053735 Bacteria 2581
961 Ga0500601_001117 3300053737 Bacteria 3036
962 Ga0500601_001804 3300053737 Bacteria 2297
963 Ga0500601_001869 3300053737 Bacteria 2259
964 Ga0500661_000947 3300055283 Bacteria 5433
965 Ga0501082_0005755 3300060353 Bacteria 10755
966 Ga0501082_0157839 3300060353 Bacteria 1971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0000278 Ga0373933_0000278_11270_12112 225
2 3300048929 Ga0496126_0085717 Ga0496126_0085717_943_1725 227
3 3300005563 Ga0068855_100772118 Ga0068855_1007721182 234
4 3300035725 Ga0373947_0315629 Ga0373947_0315629_28_732 234
5 3300046689 Ga0495613_0094278 Ga0495613_0094278_1442_2146 234
6 3300053078 Ga0495612_0150723 Ga0495612_0150723_289_993 234
7 3300046531 Ga0495665_0147476 Ga0495665_0147476_419_1207 238
8 3300005436 Ga0070713_100001652 Ga0070713_10000165219 241
9 3300006028 Ga0070717_10021289 Ga0070717_100212892 241
10 3300006175 Ga0070712_100353123 Ga0070712_1003531231 241
11 3300025928 Ga0207700_10008400 Ga0207700_100084003 241
12 3300005539 Ga0068853_100328838 Ga0068853_1003288381 242
13 3300005563 Ga0068855_100202213 Ga0068855_1002022132 242
14 3300005614 Ga0068856_100147939 Ga0068856_1001479393 242
15 3300005616 Ga0068852_100232229 Ga0068852_1002322292 242
16 3300009093 Ga0105240_10006169 Ga0105240_1000616923 242
17 3300009093 Ga0105240_10364519 Ga0105240_103645192 242
18 3300009174 Ga0105241_10151926 Ga0105241_101519262 242
19 3300009174 Ga0105241_10162466 Ga0105241_101624661 242
20 3300009545 Ga0105237_10793405 Ga0105237_107934051 242
21 3300010375 Ga0105239_10158248 Ga0105239_101582482 242
22 3300010375 Ga0105239_10398272 Ga0105239_103982721 242
23 3300013297 Ga0157378_10263117 Ga0157378_102631172 242
24 3300025911 Ga0207654_10094604 Ga0207654_100946041 242
25 3300025913 Ga0207695_10000556 Ga0207695_1000055676 242
26 3300025920 Ga0207649_10133564 Ga0207649_101335641 242
27 3300025949 Ga0207667_10084975 Ga0207667_100849753 242
28 3300026041 Ga0207639_10328464 Ga0207639_103284642 242
29 3300026078 Ga0207702_10102511 Ga0207702_101025113 242
30 3300044694 Ga0466963_0050047 Ga0466963_0050047_154_978 242
31 3300048915 Ga0496112_0210054 Ga0496112_0210054_76_900 242
32 3300003354 JGI25160J50197_1025887 JGI25160J50197_10258872 243
33 3300005262 Ga0065165_1012428 Ga0065165_10124282 243
34 3300006038 Ga0075365_10060127 Ga0075365_100601272 243
35 3300006038 Ga0075365_10203671 Ga0075365_102036711 243
36 3300025302 Ga0207426_1000379 Ga0207426_10003793 243
37 3300025937 Ga0207669_10031652 Ga0207669_100316523 243
38 3300032002 Ga0307416_100204391 Ga0307416_1002043913 243
39 3300041486 Ga0451807_2440058 Ga0451807_2440058_92_919 243
40 3300045049 Ga0466959_0403719 Ga0466959_0403719_76_903 243
41 3300046507 Ga0495606_0097496 Ga0495606_0097496_625_1455 243
42 3300046524 Ga0495648_0099296 Ga0495648_0099296_137_967 243
43 3300046694 Ga0495649_0090346 Ga0495649_0090346_256_1086 243
44 3300047472 Ga0495686_0112115 Ga0495686_0112115_376_1206 243
45 3300053162 Ga0500638_012424 Ga0500638_012424_2177_3007 243
46 3300003215 JGI25153J46596_10014616 JGI25153J46596_100146164 244
47 3300005937 Ga0081455_10069094 Ga0081455_100690943 244
48 3300025253 Ga0209677_106060 Ga0209677_1060603 244
49 3300025297 Ga0209758_1008509 Ga0209758_10085097 244
50 3300025302 Ga0207426_1047799 Ga0207426_10477992 245
51 3300032005 Ga0307411_10045728 Ga0307411_100457282 245
52 3300053096 Ga0500641_0163157 Ga0500641_0163157_70_897 245
53 3300053148 Ga0500590_035492 Ga0500590_035492_391_1221 246
54 3300009147 Ga0114129_10000570 Ga0114129_1000057013 249
55 3300031711 Ga0265314_10012894 Ga0265314_100128947 249
56 3300050507 nmdc:mga05p37_1409_c1 nmdc:mga05p37_1409_c1_16469_17308 249
57 3300038443 Ga0395901_0044380 Ga0395901_0044380_1266_2093 250
58 3300046514 Ga0495618_0168988 Ga0495618_0168988_34_864 250
59 3300046517 Ga0495630_0205335 Ga0495630_0205335_529_1359 250
60 3300046663 Ga0495635_0027113 Ga0495635_0027113_2052_2882 250
61 3300046690 Ga0495624_0043933 Ga0495624_0043933_306_1136 250
62 3300047315 Ga0495581_0024579 Ga0495581_0024579_1634_2464 250
63 3300048088 Ga0495602_0070580 Ga0495602_0070580_1949_2821 250
64 3300048088 Ga0495602_0093857 Ga0495602_0093857_1204_2034 250
65 3300035113 Ga0373936_0091392 Ga0373936_0091392_382_1218 251
66 3300053094 Ga0500566_0000356 Ga0500566_0000356_1859_2695 251
67 3300053095 Ga0500640_001385 Ga0500640_001385_4226_5062 251
68 3300053111 Ga0500572_000185 Ga0500572_000185_825_1661 251
69 3300053115 Ga0500591_016915 Ga0500591_016915_1739_2575 251
70 3300053136 Ga0500559_0005529 Ga0500559_0005529_2063_2899 251
71 3300053148 Ga0500590_041401 Ga0500590_041401_982_1818 251
72 3300053150 Ga0500603_001300 Ga0500603_001300_2025_2861 251
73 3300053159 Ga0500630_001361 Ga0500630_001361_281_1117 251
74 3300053162 Ga0500638_032225 Ga0500638_032225_588_1424 251
75 3300053163 Ga0500639_000013 Ga0500639_000013_3435_4271 251
76 3300053735 Ga0500596_002171 Ga0500596_002171_2760_3596 251
77 3300053737 Ga0500601_001117 Ga0500601_001117_114_950 251
78 3300005548 Ga0070665_100311720 Ga0070665_1003117202 252
79 3300028379 Ga0268266_10192337 Ga0268266_101923372 252
80 3300049580 Ga0501046_0197534 Ga0501046_0197534_501_1331 252
81 3300049581 Ga0501047_0006942 Ga0501047_0006942_9195_10025 252
82 3300049590 Ga0501074_0054268 Ga0501074_0054268_562_1392 252
83 3300049742 Ga0501080_0010194 Ga0501080_0010194_1007_1837 252
84 3300053096 Ga0500641_0027368 Ga0500641_0027368_1271_2095 252
85 3300025230 Ga0209563_106583 Ga0209563_1065833 253
86 3300025254 Ga0209148_1000774 Ga0209148_10007743 253
87 3300047443 Ga0495687_065905 Ga0495687_065905_513_1343 253
88 3300005614 Ga0068856_100001511 Ga0068856_1000015113 255
89 3300026078 Ga0207702_10001149 Ga0207702_1000114924 255
90 3300036401 Ga0373937_0091359 Ga0373937_0091359_1977_2744 255
91 3300046462 Ga0495651_0043472 Ga0495651_0043472_1125_1892 255
92 3300048925 Ga0496122_0115911 Ga0496122_0115911_384_1214 255
93 3300053094 Ga0500566_0001460 Ga0500566_0001460_1826_2656 255
94 3300006038 Ga0075365_10048836 Ga0075365_100488361 256
95 3300053084 Ga0495595_0013999 Ga0495595_0013999_2609_3379 256
96 3300037853 Ga0436364_0801657 Ga0436364_0801657_44_817 257
97 3300048918 Ga0496115_0462255 Ga0496115_0462255_167_1000 257
98 3300048929 Ga0496126_0094504 Ga0496126_0094504_551_1411 257
99 3300048929 Ga0496126_0238045 Ga0496126_0238045_566_1393 257
100 3300053119 Ga0500595_009149 Ga0500595_009149_1357_2187 257
101 3300005328 Ga0070676_10070586 Ga0070676_100705863 258
102 3300005455 Ga0070663_100066321 Ga0070663_1000663212 258
103 3300005456 Ga0070678_100153852 Ga0070678_1001538523 258
104 3300005548 Ga0070665_100121335 Ga0070665_1001213352 258
105 3300005983 Ga0081540_1009947 Ga0081540_10099471 258
106 3300006042 Ga0075368_10013094 Ga0075368_100130943 258
107 3300006048 Ga0075363_100023011 Ga0075363_1000230113 258
108 3300006178 Ga0075367_10077508 Ga0075367_100775082 258
109 3300006353 Ga0075370_10047909 Ga0075370_100479093 258
110 3300009545 Ga0105237_10016152 Ga0105237_100161523 258
111 3300009545 Ga0105237_10041622 Ga0105237_100416222 258
112 3300025907 Ga0207645_10157140 Ga0207645_101571401 258
113 3300025914 Ga0207671_10016810 Ga0207671_100168103 258
114 3300025925 Ga0207650_10298095 Ga0207650_102980952 258
115 3300025931 Ga0207644_10471257 Ga0207644_104712572 258
116 3300025945 Ga0207679_10264413 Ga0207679_102644131 258
117 3300026067 Ga0207678_10088812 Ga0207678_100888123 258
118 3300026121 Ga0207683_10107807 Ga0207683_101078073 258
119 3300028379 Ga0268266_10001624 Ga0268266_1000162413 258
120 3300045976 Ga0466967_0646668 Ga0466967_0646668_216_992 258
121 3300048907 Ga0496104_0059992 Ga0496104_0059992_1288_2115 258
122 3300048915 Ga0496112_0117149 Ga0496112_0117149_398_1225 258
123 3300048918 Ga0496115_0219002 Ga0496115_0219002_568_1395 258
124 3300050490 nmdc:mga03n38_20420_c1 nmdc:mga03n38_20420_c1_618_1445 258
125 3300050494 nmdc:mga06z11_12043_c1 nmdc:mga06z11_12043_c1_2334_3161 258
126 3300050495 nmdc:mga04h51_22754_c1 nmdc:mga04h51_22754_c1_593_1420 258
127 3300050496 nmdc:mga07m45_16524_c1 nmdc:mga07m45_16524_c1_2275_3102 258
128 3300053177 Ga0500636_0033011 Ga0500636_0033011_629_1405 258
129 3300010375 Ga0105239_10569975 Ga0105239_105699751 259
130 3300031711 Ga0265314_10019827 Ga0265314_100198275 259
131 3300031712 Ga0265342_10004062 Ga0265342_1000406210 259
132 3300035113 Ga0373936_0017485 Ga0373936_0017485_1450_2265 259
133 3300049580 Ga0501046_0278569 Ga0501046_0278569_396_1175 259
134 3300026041 Ga0207639_10156495 Ga0207639_101564951 260
135 3300031911 Ga0307412_10333973 Ga0307412_103339731 260
136 3300039438 Ga0436360_0840337 Ga0436360_0840337_120_962 260
137 3300046455 Ga0495603_0033310 Ga0495603_0033310_2308_3090 260
138 3300048924 Ga0496121_0001201 Ga0496121_0001201_1880_2710 260
139 3300053178 Ga0500637_0228271 Ga0500637_0228271_250_1032 260
140 iso_pu_bacteria 8016566248 8016571132 260
141 3300005439 Ga0070711_100022927 Ga0070711_1000229273 261
142 3300006028 Ga0070717_10011626 Ga0070717_100116264 262
143 3300006914 Ga0075436_100261438 Ga0075436_1002614381 262
144 3300048915 Ga0496112_0008985 Ga0496112_0008985_4182_5015 262
145 3300005617 Ga0068859_100391233 Ga0068859_1003912332 263
146 3300005843 Ga0068860_100027348 Ga0068860_1000273483 263
147 3300006931 Ga0097620_100391269 Ga0097620_1003912692 263
148 3300028381 Ga0268264_10000429 Ga0268264_1000042962 263
149 3300031235 Ga0265330_10023551 Ga0265330_100235513 263
150 3300031247 Ga0265340_10027553 Ga0265340_100275532 263
151 3300031616 Ga0307508_10026590 Ga0307508_100265903 263
152 3300031711 Ga0265314_10092842 Ga0265314_100928422 263
153 3300047472 Ga0495686_0022394 Ga0495686_0022394_3248_4090 263
154 3300007788 Ga0099795_10035266 Ga0099795_100352662 264
155 3300010159 Ga0099796_10010068 Ga0099796_100100682 264
156 3300035398 Ga0316574_0012991 Ga0316574_0012991_3666_4484 264
157 3300036712 Ga0316584_0012832 Ga0316584_0012832_4831_5649 264
158 3300048915 Ga0496112_0000036 Ga0496112_0000036_105404_106204 264
159 3300048924 Ga0496121_0286931 Ga0496121_0286931_256_1050 264
160 3300009093 Ga0105240_10161082 Ga0105240_101610822 265
161 3300025297 Ga0209758_1031649 Ga0209758_10316494 265
162 iso_pu_bacteria 2874604998 2874609938 265
163 iso_pu_bacteria 2879110137 2879116702 265
164 3300005344 Ga0070661_100112884 Ga0070661_1001128842 266
165 3300006177 Ga0075362_10058297 Ga0075362_100582972 266
166 3300010375 Ga0105239_10271757 Ga0105239_102717571 266
167 3300014326 Ga0157380_10467010 Ga0157380_104670101 266
168 3300025920 Ga0207649_10077882 Ga0207649_100778822 266
169 3300028380 Ga0268265_10294402 Ga0268265_102944022 266
170 3300031548 Ga0307408_100178249 Ga0307408_1001782492 266
171 3300031728 Ga0316578_10063918 Ga0316578_100639182 266
172 3300031733 Ga0316577_10107402 Ga0316577_101074021 266
173 3300033180 Ga0307510_10190514 Ga0307510_101905142 266
174 3300035086 Ga0373934_0010395 Ga0373934_0010395_1244_2044 266
175 3300035111 Ga0373923_0000945 Ga0373923_0000945_3086_3886 266
176 3300035117 Ga0373953_0000528 Ga0373953_0000528_2386_3186 266
177 3300035118 Ga0373954_0005976 Ga0373954_0005976_3375_4175 266
178 3300035119 Ga0373956_0001669 Ga0373956_0001669_1085_1885 266
179 3300035120 Ga0373957_0003463 Ga0373957_0003463_2717_3517 266
180 3300035172 Ga0373955_0030230 Ga0373955_0030230_1104_1904 266
181 3300035410 Ga0373924_0003968 Ga0373924_0003968_3672_4472 266
182 3300035724 Ga0373933_0012290 Ga0373933_0012290_2807_3607 266
183 3300046452 Ga0495617_089488 Ga0495617_089488_132_950 266
184 3300046455 Ga0495603_0081148 Ga0495603_0081148_121_939 266
185 3300046459 Ga0495629_0002501 Ga0495629_0002501_3078_3878 266
186 3300046459 Ga0495629_0091357 Ga0495629_0091357_663_1481 266
187 3300046463 Ga0495653_0026984 Ga0495653_0026984_2679_3479 266
188 3300046471 Ga0495650_0063965 Ga0495650_0063965_291_1109 266
189 3300046474 Ga0495605_0022610 Ga0495605_0022610_981_1799 266
190 3300046492 Ga0495585_0081043 Ga0495585_0081043_916_1734 266
191 3300046492 Ga0495585_0141347 Ga0495585_0141347_162_980 266
192 3300046499 Ga0495594_0061312 Ga0495594_0061312_969_1787 266
193 3300046500 Ga0495596_0100465 Ga0495596_0100465_281_1099 266
194 3300046513 Ga0495616_0161253 Ga0495616_0161253_172_990 266
195 3300046514 Ga0495618_0020570 Ga0495618_0020570_3247_4047 266
196 3300046516 Ga0495628_0005066 Ga0495628_0005066_1114_1914 266
197 3300046518 Ga0495631_0070273 Ga0495631_0070273_638_1456 266
198 3300046519 Ga0495632_0145964 Ga0495632_0145964_70_888 266
199 3300046523 Ga0495644_0069864 Ga0495644_0069864_234_1052 266
200 3300046524 Ga0495648_0088452 Ga0495648_0088452_233_1051 266
201 3300046524 Ga0495648_0189143 Ga0495648_0189143_47_865 266
202 3300046525 Ga0495663_0065786 Ga0495663_0065786_142_960 266
203 3300046525 Ga0495663_0089194 Ga0495663_0089194_132_950 266
204 3300046533 Ga0495640_0021500 Ga0495640_0021500_2846_3646 266
205 3300046536 Ga0495587_0235310 Ga0495587_0235310_101_901 266
206 3300046537 Ga0495598_0094888 Ga0495598_0094888_39_857 266
207 3300046538 Ga0495609_0041887 Ga0495609_0041887_582_1400 266
208 3300046558 Ga0495633_0018568 Ga0495633_0018568_1707_2525 266
209 3300046559 Ga0495667_0051542 Ga0495667_0051542_1121_1921 266
210 3300046559 Ga0495667_0082305 Ga0495667_0082305_574_1398 266
211 3300046615 Ga0495656_0054989 Ga0495656_0054989_186_1004 266
212 3300046663 Ga0495635_0019563 Ga0495635_0019563_2807_3607 266
213 3300046674 Ga0495588_0029460 Ga0495588_0029460_1647_2465 266
214 3300046675 Ga0495657_0054191 Ga0495657_0054191_922_1722 266
215 3300046678 Ga0495599_0013408 Ga0495599_0013408_1656_2456 266
216 3300046679 Ga0495623_0012417 Ga0495623_0012417_1119_1919 266
217 3300046680 Ga0495646_0004049 Ga0495646_0004049_1042_1842 266
218 3300046692 Ga0495671_0089772 Ga0495671_0089772_80_898 266
219 3300047319 Ga0495674_0028279 Ga0495674_0028279_3358_4158 266
220 3300047445 Ga0495677_0077911 Ga0495677_0077911_71_889 266
221 3300047471 Ga0495684_0011967 Ga0495684_0011967_4110_4910 266
222 3300047673 Ga0495593_0013032 Ga0495593_0013032_3930_4730 266
223 3300048088 Ga0495602_0024514 Ga0495602_0024514_1121_1921 266
224 3300048908 Ga0496105_0516756 Ga0496105_0516756_35_853 266
225 3300048910 Ga0496107_0528336 Ga0496107_0528336_42_860 266
226 3300048929 Ga0496126_0171112 Ga0496126_0171112_209_1027 266
227 3300049583 Ga0501067_0111895 Ga0501067_0111895_360_1169 266
228 3300050507 nmdc:mga05p37_79056_c1 nmdc:mga05p37_79056_c1_1239_2057 266
229 3300053077 Ga0495601_0188466 Ga0495601_0188466_213_1013 266
230 3300053085 Ga0495619_0014295 Ga0495619_0014295_2481_3281 266
231 3300053092 Ga0500583_0043669 Ga0500583_0043669_276_1103 266
232 3300053161 Ga0500634_0066202 Ga0500634_0066202_900_1718 266
233 3300053178 Ga0500637_0262730 Ga0500637_0262730_37_855 266
234 3300053732 Ga0500656_013283 Ga0500656_013283_18_836 266
235 iso_pu_bacteria 8056673599 8056676567 266
236 3300005548 Ga0070665_100095490 Ga0070665_1000954903 267
237 3300005937 Ga0081455_10164803 Ga0081455_101648032 267
238 3300005983 Ga0081540_1014603 Ga0081540_10146034 267
239 3300005985 Ga0081539_10008456 Ga0081539_1000845612 267
240 3300025297 Ga0209758_1003227 Ga0209758_100322717 267
241 3300031824 Ga0307413_10025409 Ga0307413_100254093 267
242 3300032005 Ga0307411_10133689 Ga0307411_101336893 267
243 3300044684 Ga0466966_0321168 Ga0466966_0321168_17_850 267
244 3300048905 Ga0496102_0161329 Ga0496102_0161329_1261_2079 267
245 3300048907 Ga0496104_0020330 Ga0496104_0020330_4502_5320 267
246 3300048908 Ga0496105_0160891 Ga0496105_0160891_951_1769 267
247 3300048909 Ga0496106_0320411 Ga0496106_0320411_379_1197 267
248 3300048910 Ga0496107_0063374 Ga0496107_0063374_1647_2465 267
249 3300048912 Ga0496109_0105495 Ga0496109_0105495_542_1360 267
250 3300048913 Ga0496110_0031813 Ga0496110_0031813_3712_4530 267
251 3300048914 Ga0496111_0183972 Ga0496111_0183972_465_1283 267
252 3300048915 Ga0496112_0230778 Ga0496112_0230778_64_882 267
253 3300048917 Ga0496114_0309715 Ga0496114_0309715_375_1193 267
254 3300048918 Ga0496115_0060459 Ga0496115_0060459_1667_2485 267
255 3300049569 Ga0501032_0060650 Ga0501032_0060650_672_1517 267
256 3300049570 Ga0501033_0100621 Ga0501033_0100621_1028_1873 267
257 3300049579 Ga0501043_0012051 Ga0501043_0012051_864_1709 267
258 3300049581 Ga0501047_0069651 Ga0501047_0069651_1097_1942 267
259 3300049742 Ga0501080_0163405 Ga0501080_0163405_987_1832 267
260 3300049822 Ga0501035_0077491 Ga0501035_0077491_138_983 267
261 3300049823 Ga0501044_0024484 Ga0501044_0024484_2935_3780 267
262 3300050489 nmdc:mga03683_58301_c1 nmdc:mga03683_58301_c1_210_1031 267
263 3300060353 Ga0501082_0157839 Ga0501082_0157839_991_1836 267
264 iso_pu_bacteria 2513237098 2513675429 267
265 iso_pu_bacteria 2513237101 2513698484 267
266 iso_pu_bacteria 2524023210 2524464779 267
267 iso_pu_bacteria 2903768456 2903775159 267
268 iso_pu_bacteria 2922361189 2922363649 267
269 iso_pu_bacteria 8006964411 8006971139 267
270 iso_pu_bacteria 8006984368 8006991541 267
271 iso_pu_bacteria 8006994254 8006999451 267
272 iso_pu_bacteria 8056681323 8056683788 267
273 3300005330 Ga0070690_100151682 Ga0070690_1001516821 268
274 3300005331 Ga0070670_100065629 Ga0070670_1000656294 268
275 3300005334 Ga0068869_100041983 Ga0068869_1000419834 268
276 3300005334 Ga0068869_100169788 Ga0068869_1001697882 268
277 3300005338 Ga0068868_100067737 Ga0068868_1000677374 268
278 3300005339 Ga0070660_100116984 Ga0070660_1001169843 268
279 3300005340 Ga0070689_100073660 Ga0070689_1000736602 268
280 3300005347 Ga0070668_100088699 Ga0070668_1000886992 268
281 3300005347 Ga0070668_100219478 Ga0070668_1002194782 268
282 3300005347 Ga0070668_100289544 Ga0070668_1002895441 268
283 3300005353 Ga0070669_100149431 Ga0070669_1001494311 268
284 3300005354 Ga0070675_100403544 Ga0070675_1004035442 268
285 3300005356 Ga0070674_100010171 Ga0070674_1000101716 268
286 3300005364 Ga0070673_100485482 Ga0070673_1004854821 268
287 3300005365 Ga0070688_100318288 Ga0070688_1003182881 268
288 3300005367 Ga0070667_100232928 Ga0070667_1002329281 268
289 3300005406 Ga0070703_10083140 Ga0070703_100831401 268
290 3300005439 Ga0070711_100011930 Ga0070711_1000119304 268
291 3300005439 Ga0070711_100433553 Ga0070711_1004335531 268
292 3300005455 Ga0070663_100051861 Ga0070663_1000518612 268
293 3300005456 Ga0070678_100686094 Ga0070678_1006860941 268
294 3300005466 Ga0070685_10256557 Ga0070685_102565571 268
295 3300005471 Ga0070698_100315623 Ga0070698_1003156232 268
296 3300005539 Ga0068853_100010388 Ga0068853_1000103882 268
297 3300005539 Ga0068853_100153560 Ga0068853_1001535602 268
298 3300005543 Ga0070672_100369251 Ga0070672_1003692511 268
299 3300005547 Ga0070693_100218811 Ga0070693_1002188111 268
300 3300005548 Ga0070665_100091755 Ga0070665_1000917553 268
301 3300005548 Ga0070665_100216758 Ga0070665_1002167582 268
302 3300005563 Ga0068855_100172265 Ga0068855_1001722651 268
303 3300005563 Ga0068855_100423628 Ga0068855_1004236282 268
304 3300005577 Ga0068857_100017956 Ga0068857_10001795611 268
305 3300005577 Ga0068857_100089225 Ga0068857_1000892253 268
306 3300005614 Ga0068856_100020172 Ga0068856_1000201721 268
307 3300005616 Ga0068852_100711811 Ga0068852_1007118111 268
308 3300005618 Ga0068864_100061951 Ga0068864_1000619513 268
309 3300005719 Ga0068861_100226410 Ga0068861_1002264102 268
310 3300005719 Ga0068861_100242917 Ga0068861_1002429171 268
311 3300005840 Ga0068870_10088736 Ga0068870_100887362 268
312 3300005841 Ga0068863_100146926 Ga0068863_1001469263 268
313 3300005843 Ga0068860_100155885 Ga0068860_1001558853 268
314 3300005843 Ga0068860_100345053 Ga0068860_1003450532 268
315 3300005844 Ga0068862_100282520 Ga0068862_1002825202 268
316 3300005983 Ga0081540_1006383 Ga0081540_100638312 268
317 3300005983 Ga0081540_1048705 Ga0081540_10487054 268
318 3300006038 Ga0075365_10109406 Ga0075365_101094062 268
319 3300006038 Ga0075365_10245231 Ga0075365_102452311 268
320 3300006038 Ga0075365_10278201 Ga0075365_102782011 268
321 3300006042 Ga0075368_10005160 Ga0075368_100051606 268
322 3300006042 Ga0075368_10012494 Ga0075368_100124942 268
323 3300006173 Ga0070716_100056630 Ga0070716_1000566302 268
324 3300006175 Ga0070712_100017522 Ga0070712_1000175223 268
325 3300006177 Ga0075362_10149948 Ga0075362_101499482 268
326 3300006178 Ga0075367_10035173 Ga0075367_100351734 268
327 3300006186 Ga0075369_10127796 Ga0075369_101277961 268
328 3300006237 Ga0097621_100061404 Ga0097621_1000614043 268
329 3300006353 Ga0075370_10100198 Ga0075370_101001982 268
330 3300006844 Ga0075428_100192547 Ga0075428_1001925473 268
331 3300006871 Ga0075434_100039027 Ga0075434_1000390274 268
332 3300006880 Ga0075429_100512968 Ga0075429_1005129682 268
333 3300006881 Ga0068865_100029562 Ga0068865_1000295623 268
334 3300007265 Ga0099794_10026115 Ga0099794_100261152 268
335 3300009093 Ga0105240_10015393 Ga0105240_100153934 268
336 3300009093 Ga0105240_10330349 Ga0105240_103303492 268
337 3300009098 Ga0105245_10494724 Ga0105245_104947241 268
338 3300009098 Ga0105245_10559961 Ga0105245_105599611 268
339 3300009098 Ga0105245_10756923 Ga0105245_107569231 268
340 3300009101 Ga0105247_10046105 Ga0105247_100461052 268
341 3300009147 Ga0114129_10150136 Ga0114129_101501362 268
342 3300009148 Ga0105243_10180345 Ga0105243_101803452 268
343 3300009174 Ga0105241_10051886 Ga0105241_100518862 268
344 3300009174 Ga0105241_10202519 Ga0105241_102025192 268
345 3300009177 Ga0105248_10071812 Ga0105248_100718122 268
346 3300009177 Ga0105248_10190467 Ga0105248_101904672 268
347 3300009177 Ga0105248_10590723 Ga0105248_105907232 268
348 3300009545 Ga0105237_10062523 Ga0105237_100625234 268
349 3300009545 Ga0105237_10121890 Ga0105237_101218903 268
350 3300009551 Ga0105238_10010373 Ga0105238_100103738 268
351 3300009551 Ga0105238_10165687 Ga0105238_101656873 268
352 3300009553 Ga0105249_10065998 Ga0105249_100659983 268
353 3300009553 Ga0105249_10268626 Ga0105249_102686261 268
354 3300009553 Ga0105249_10504980 Ga0105249_105049801 268
355 3300010375 Ga0105239_10080275 Ga0105239_100802754 268
356 3300010375 Ga0105239_10093840 Ga0105239_100938402 268
357 3300011119 Ga0105246_10076280 Ga0105246_100762802 268
358 3300013297 Ga0157378_10437885 Ga0157378_104378851 268
359 3300013306 Ga0163162_10183890 Ga0163162_101838902 268
360 3300013306 Ga0163162_10593305 Ga0163162_105933052 268
361 3300014325 Ga0163163_10131391 Ga0163163_101313912 268
362 3300014326 Ga0157380_10065735 Ga0157380_100657353 268
363 3300014745 Ga0157377_10066373 Ga0157377_100663732 268
364 3300017792 Ga0163161_10189326 Ga0163161_101893262 268
365 3300025321 Ga0207656_10067399 Ga0207656_100673992 268
366 3300025903 Ga0207680_10194881 Ga0207680_101948812 268
367 3300025904 Ga0207647_10020111 Ga0207647_100201114 268
368 3300025904 Ga0207647_10023844 Ga0207647_100238444 268
369 3300025904 Ga0207647_10073980 Ga0207647_100739801 268
370 3300025904 Ga0207647_10109640 Ga0207647_101096402 268
371 3300025907 Ga0207645_10151462 Ga0207645_101514622 268
372 3300025908 Ga0207643_10092226 Ga0207643_100922261 268
373 3300025909 Ga0207705_10138856 Ga0207705_101388561 268
374 3300025911 Ga0207654_10074091 Ga0207654_100740913 268
375 3300025911 Ga0207654_10124036 Ga0207654_101240362 268
376 3300025913 Ga0207695_10057841 Ga0207695_100578413 268
377 3300025914 Ga0207671_10075263 Ga0207671_100752633 268
378 3300025914 Ga0207671_10096604 Ga0207671_100966042 268
379 3300025914 Ga0207671_10168346 Ga0207671_101683462 268
380 3300025915 Ga0207693_10037883 Ga0207693_100378833 268
381 3300025916 Ga0207663_10018243 Ga0207663_100182432 268
382 3300025916 Ga0207663_10363865 Ga0207663_103638652 268
383 3300025921 Ga0207652_10551445 Ga0207652_105514451 268
384 3300025923 Ga0207681_10122787 Ga0207681_101227871 268
385 3300025924 Ga0207694_10014516 Ga0207694_100145163 268
386 3300025924 Ga0207694_10164031 Ga0207694_101640311 268
387 3300025925 Ga0207650_10155328 Ga0207650_101553282 268
388 3300025926 Ga0207659_10434998 Ga0207659_104349981 268
389 3300025929 Ga0207664_10269250 Ga0207664_102692501 268
390 3300025931 Ga0207644_10078949 Ga0207644_100789493 268
391 3300025931 Ga0207644_10096001 Ga0207644_100960012 268
392 3300025932 Ga0207690_10101769 Ga0207690_101017693 268
393 3300025933 Ga0207706_10134017 Ga0207706_101340173 268
394 3300025933 Ga0207706_10339070 Ga0207706_103390702 268
395 3300025934 Ga0207686_10045368 Ga0207686_100453681 268
396 3300025938 Ga0207704_10109720 Ga0207704_101097202 268
397 3300025940 Ga0207691_10310578 Ga0207691_103105782 268
398 3300025941 Ga0207711_10040047 Ga0207711_100400474 268
399 3300025942 Ga0207689_10144781 Ga0207689_101447812 268
400 3300025945 Ga0207679_10442056 Ga0207679_104420561 268
401 3300025949 Ga0207667_10007013 Ga0207667_1000701313 268
402 3300025949 Ga0207667_10164557 Ga0207667_101645572 268
403 3300025961 Ga0207712_10039179 Ga0207712_100391794 268
404 3300025961 Ga0207712_10158881 Ga0207712_101588812 268
405 3300025961 Ga0207712_10218354 Ga0207712_102183541 268
406 3300025972 Ga0207668_10046434 Ga0207668_100464344 268
407 3300025972 Ga0207668_10125863 Ga0207668_101258632 268
408 3300025981 Ga0207640_10190713 Ga0207640_101907131 268
409 3300025986 Ga0207658_10092187 Ga0207658_100921871 268
410 3300026023 Ga0207677_10082120 Ga0207677_100821202 268
411 3300026067 Ga0207678_10010142 Ga0207678_100101428 268
412 3300026067 Ga0207678_10071696 Ga0207678_100716963 268
413 3300026067 Ga0207678_10096072 Ga0207678_100960722 268
414 3300026075 Ga0207708_10049067 Ga0207708_100490671 268
415 3300026075 Ga0207708_10064854 Ga0207708_100648543 268
416 3300026078 Ga0207702_10223514 Ga0207702_102235142 268
417 3300026089 Ga0207648_10017047 Ga0207648_100170477 268
418 3300026095 Ga0207676_10070538 Ga0207676_100705382 268
419 3300026095 Ga0207676_10129105 Ga0207676_101291052 268
420 3300026116 Ga0207674_10105742 Ga0207674_101057422 268
421 3300026116 Ga0207674_10146637 Ga0207674_101466372 268
422 3300026118 Ga0207675_100006810 Ga0207675_1000068103 268
423 3300026118 Ga0207675_100153465 Ga0207675_1001534652 268
424 3300026121 Ga0207683_10163065 Ga0207683_101630652 268
425 3300026121 Ga0207683_10171822 Ga0207683_101718221 268
426 3300026121 Ga0207683_10223019 Ga0207683_102230192 268
427 3300026142 Ga0207698_10388313 Ga0207698_103883132 268
428 3300027866 Ga0209813_10005614 Ga0209813_100056144 268
429 3300027907 Ga0207428_10073282 Ga0207428_100732821 268
430 3300028379 Ga0268266_10052663 Ga0268266_100526633 268
431 3300028379 Ga0268266_10408496 Ga0268266_104084962 268
432 3300028380 Ga0268265_10069576 Ga0268265_100695764 268
433 3300028381 Ga0268264_10148222 Ga0268264_101482221 268
434 3300031235 Ga0265330_10008698 Ga0265330_100086983 268
435 3300031238 Ga0265332_10007825 Ga0265332_100078255 268
436 3300031241 Ga0265325_10008954 Ga0265325_100089547 268
437 3300031595 Ga0265313_10034591 Ga0265313_100345913 268
438 3300031712 Ga0265342_10058861 Ga0265342_100588613 268
439 3300031730 Ga0307516_10141760 Ga0307516_101417601 268
440 3300035695 Ga0373927_0013581 Ga0373927_0013581_2700_3527 268
441 3300035724 Ga0373933_0145854 Ga0373933_0145854_655_1482 268
442 3300037068 Ga0373925_0107353 Ga0373925_0107353_619_1446 268
443 3300037068 Ga0373925_0599175 Ga0373925_0599175_48_875 268
444 3300046455 Ga0495603_0295571 Ga0495603_0295571_86_910 268
445 3300046457 Ga0495590_0047570 Ga0495590_0047570_442_1266 268
446 3300046459 Ga0495629_0287312 Ga0495629_0287312_226_1050 268
447 3300046459 Ga0495629_0324444 Ga0495629_0324444_65_886 268
448 3300046460 Ga0495638_0118626 Ga0495638_0118626_730_1554 268
449 3300046472 Ga0495580_0305543 Ga0495580_0305543_11_838 268
450 3300046473 Ga0495582_0291798 Ga0495582_0291798_12_836 268
451 3300046513 Ga0495616_0091624 Ga0495616_0091624_439_1269 268
452 3300046518 Ga0495631_0122934 Ga0495631_0122934_66_890 268
453 3300046519 Ga0495632_0070066 Ga0495632_0070066_126_950 268
454 3300046523 Ga0495644_0073808 Ga0495644_0073808_117_941 268
455 3300046674 Ga0495588_0010698 Ga0495588_0010698_3450_4256 268
456 3300046681 Ga0495647_0069296 Ga0495647_0069296_391_1266 268
457 3300046684 Ga0495669_0020616 Ga0495669_0020616_418_1242 268
458 3300046692 Ga0495671_0123294 Ga0495671_0123294_107_937 268
459 3300047318 Ga0495636_0032747 Ga0495636_0032747_1253_2077 268
460 3300047443 Ga0495687_082731 Ga0495687_082731_136_966 268
461 3300047673 Ga0495593_0068550 Ga0495593_0068550_55_879 268
462 3300048903 Ga0496100_0111928 Ga0496100_0111928_448_1278 268
463 3300048903 Ga0496100_0183006 Ga0496100_0183006_610_1464 268
464 3300048903 Ga0496100_0234926 Ga0496100_0234926_15_854 268
465 3300048904 Ga0496101_0093847 Ga0496101_0093847_660_1514 268
466 3300048904 Ga0496101_0233235 Ga0496101_0233235_62_883 268
467 3300048905 Ga0496102_0096778 Ga0496102_0096778_750_1574 268
468 3300048905 Ga0496102_0177262 Ga0496102_0177262_293_1123 268
469 3300048906 Ga0496103_0159778 Ga0496103_0159778_160_981 268
470 3300048907 Ga0496104_0278313 Ga0496104_0278313_51_872 268
471 3300048907 Ga0496104_0472371 Ga0496104_0472371_208_1038 268
472 3300048908 Ga0496105_0109665 Ga0496105_0109665_1166_1996 268
473 3300048909 Ga0496106_0246196 Ga0496106_0246196_92_925 268
474 3300048910 Ga0496107_0229173 Ga0496107_0229173_428_1282 268
475 3300048911 Ga0496108_0003862 Ga0496108_0003862_7362_8216 268
476 3300048911 Ga0496108_0043899 Ga0496108_0043899_946_1767 268
477 3300048911 Ga0496108_0104480 Ga0496108_0104480_1149_1979 268
478 3300048912 Ga0496109_0001377 Ga0496109_0001377_13128_13982 268
479 3300048912 Ga0496109_0055916 Ga0496109_0055916_64_894 268
480 3300048913 Ga0496110_0001457 Ga0496110_0001457_12061_12915 268
481 3300048914 Ga0496111_0160557 Ga0496111_0160557_186_1040 268
482 3300048915 Ga0496112_0023003 Ga0496112_0023003_1389_2243 268
483 3300048915 Ga0496112_0683759 Ga0496112_0683759_51_881 268
484 3300048916 Ga0496113_0083781 Ga0496113_0083781_1571_2392 268
485 3300048916 Ga0496113_0107954 Ga0496113_0107954_1023_1853 268
486 3300048917 Ga0496114_0219687 Ga0496114_0219687_586_1410 268
487 3300048918 Ga0496115_0228116 Ga0496115_0228116_641_1495 268
488 3300048918 Ga0496115_0274695 Ga0496115_0274695_345_1169 268
489 3300048918 Ga0496115_0461810 Ga0496115_0461810_24_845 268
490 3300048924 Ga0496121_0025610 Ga0496121_0025610_1138_1974 268
491 3300048924 Ga0496121_0134223 Ga0496121_0134223_953_1777 268
492 3300048925 Ga0496122_0029095 Ga0496122_0029095_1344_2168 268
493 3300048927 Ga0496124_0144765 Ga0496124_0144765_29_862 268
494 3300048928 Ga0496125_0139309 Ga0496125_0139309_577_1407 268
495 3300048929 Ga0496126_0018533 Ga0496126_0018533_3840_4664 268
496 3300048929 Ga0496126_0301239 Ga0496126_0301239_263_1087 268
497 3300049569 Ga0501032_0170464 Ga0501032_0170464_184_996 268
498 3300049570 Ga0501033_0069229 Ga0501033_0069229_852_1664 268
499 3300049571 Ga0501034_0116985 Ga0501034_0116985_1135_1947 268
500 3300049572 Ga0501036_0026249 Ga0501036_0026249_2585_3397 268
501 3300049573 Ga0501037_0016424 Ga0501037_0016424_1049_1861 268
502 3300049574 Ga0501038_0000840 Ga0501038_0000840_1404_2216 268
503 3300049575 Ga0501039_0116875 Ga0501039_0116875_845_1657 268
504 3300049575 Ga0501039_0324580 Ga0501039_0324580_41_865 268
505 3300049581 Ga0501047_0060254 Ga0501047_0060254_648_1460 268
506 3300049586 Ga0501070_0183548 Ga0501070_0183548_769_1581 268
507 3300049587 Ga0501071_0033266 Ga0501071_0033266_2700_3524 268
508 3300049822 Ga0501035_0172354 Ga0501035_0172354_949_1761 268
509 3300049823 Ga0501044_0022904 Ga0501044_0022904_2285_3097 268
510 3300049823 Ga0501044_0110863 Ga0501044_0110863_319_1131 268
511 3300050489 nmdc:mga03683_94067_c1 nmdc:mga03683_94067_c1_348_1169 268
512 3300050492 nmdc:mga0yw44_57457_c1 nmdc:mga0yw44_57457_c1_506_1327 268
513 3300050494 nmdc:mga06z11_97633_c1 nmdc:mga06z11_97633_c1_202_1026 268
514 3300050495 nmdc:mga04h51_23326_c1 nmdc:mga04h51_23326_c1_13_837 268
515 3300050513 nmdc:mga0rr50_90841_c1 nmdc:mga0rr50_90841_c1_1464_2285 268
516 3300050516 nmdc:mga0sz30_45558_c1 nmdc:mga0sz30_45558_c1_667_1488 268
517 3300053077 Ga0495601_0269898 Ga0495601_0269898_251_1078 268
518 3300053093 Ga0500651_0065173 Ga0500651_0065173_85_894 268
519 3300053119 Ga0500595_039567 Ga0500595_039567_215_1039 268
520 3300053150 Ga0500603_036559 Ga0500603_036559_170_1006 268
521 3300053177 Ga0500636_0038049 Ga0500636_0038049_1693_2529 268
522 3300053730 Ga0500645_025749 Ga0500645_025749_868_1692 268
523 3300053737 Ga0500601_001804 Ga0500601_001804_147_983 268
524 iso_pu_bacteria 2721755755 2723848469 268
525 iso_pu_bacteria 2849076700 2849077484 268
526 3300005336 Ga0070680_100135074 Ga0070680_1001350743 269
527 3300005367 Ga0070667_100485349 Ga0070667_1004853491 269
528 3300005455 Ga0070663_100078084 Ga0070663_1000780843 269
529 3300005458 Ga0070681_10148843 Ga0070681_101488431 269
530 3300005530 Ga0070679_100055847 Ga0070679_1000558473 269
531 3300005544 Ga0070686_100122599 Ga0070686_1001225992 269
532 3300005549 Ga0070704_100500343 Ga0070704_1005003431 269
533 3300005563 Ga0068855_100012246 Ga0068855_1000122463 269
534 3300005618 Ga0068864_100561332 Ga0068864_1005613321 269
535 3300005983 Ga0081540_1045282 Ga0081540_10452823 269
536 3300009093 Ga0105240_10096827 Ga0105240_100968273 269
537 3300009101 Ga0105247_10143699 Ga0105247_101436992 269
538 3300009545 Ga0105237_10240529 Ga0105237_102405292 269
539 3300011119 Ga0105246_10155540 Ga0105246_101555402 269
540 3300013104 Ga0157370_10051681 Ga0157370_100516813 269
541 3300013105 Ga0157369_10612569 Ga0157369_106125691 269
542 3300013297 Ga0157378_10050817 Ga0157378_100508174 269
543 3300013308 Ga0157375_10563637 Ga0157375_105636372 269
544 3300014325 Ga0163163_10051228 Ga0163163_100512282 269
545 3300014325 Ga0163163_10541498 Ga0163163_105414982 269
546 3300014968 Ga0157379_10202334 Ga0157379_102023341 269
547 3300025912 Ga0207707_10085684 Ga0207707_100856842 269
548 3300025913 Ga0207695_10047397 Ga0207695_100473974 269
549 3300025917 Ga0207660_10094043 Ga0207660_100940431 269
550 3300025926 Ga0207659_10163059 Ga0207659_101630592 269
551 3300025936 Ga0207670_10293878 Ga0207670_102938781 269
552 3300025939 Ga0207665_10147960 Ga0207665_101479602 269
553 3300025945 Ga0207679_10624319 Ga0207679_106243191 269
554 3300025949 Ga0207667_10034700 Ga0207667_100347003 269
555 3300026067 Ga0207678_10098727 Ga0207678_100987273 269
556 3300026121 Ga0207683_10253521 Ga0207683_102535212 269
557 3300028379 Ga0268266_10088587 Ga0268266_100885872 269
558 3300030521 Ga0307511_10025459 Ga0307511_100254593 269
559 3300031730 Ga0307516_10044655 Ga0307516_100446554 269
560 3300033180 Ga0307510_10103570 Ga0307510_101035702 269
561 3300035083 Ga0373926_0116792 Ga0373926_0116792_88_918 269
562 3300035086 Ga0373934_0030612 Ga0373934_0030612_988_1848 269
563 3300035118 Ga0373954_0077849 Ga0373954_0077849_414_1289 269
564 3300035172 Ga0373955_0025129 Ga0373955_0025129_2111_2971 269
565 3300035695 Ga0373927_0007995 Ga0373927_0007995_4786_5616 269
566 3300037068 Ga0373925_0065533 Ga0373925_0065533_1787_2617 269
567 3300039450 Ga0436363_1645063 Ga0436363_1645063_98_928 269
568 3300046462 Ga0495651_0250892 Ga0495651_0250892_132_1007 269
569 3300046477 Ga0495664_0018865 Ga0495664_0018865_603_1478 269
570 3300046511 Ga0495608_0070533 Ga0495608_0070533_711_1586 269
571 3300046514 Ga0495618_0018724 Ga0495618_0018724_2838_3713 269
572 3300046516 Ga0495628_0024106 Ga0495628_0024106_3387_4262 269
573 3300046529 Ga0495652_0073423 Ga0495652_0073423_61_921 269
574 3300046535 Ga0495586_0120442 Ga0495586_0120442_445_1305 269
575 3300046543 Ga0495645_0049743 Ga0495645_0049743_1923_2798 269
576 3300046559 Ga0495667_0006172 Ga0495667_0006172_6894_7769 269
577 3300046663 Ga0495635_0137695 Ga0495635_0137695_37_912 269
578 3300046678 Ga0495599_0023816 Ga0495599_0023816_1845_2720 269
579 3300047320 Ga0495672_0082895 Ga0495672_0082895_850_1680 269
580 3300047322 Ga0495680_0023894 Ga0495680_0023894_3165_4040 269
581 3300047444 Ga0495675_0067440 Ga0495675_0067440_395_1270 269
582 3300047469 Ga0495673_0049808 Ga0495673_0049808_380_1204 269
583 3300048909 Ga0496106_0004112 Ga0496106_0004112_2365_3195 269
584 3300048913 Ga0496110_0165958 Ga0496110_0165958_776_1603 269
585 3300048919 Ga0496116_0066973 Ga0496116_0066973_321_1142 269
586 3300048920 Ga0496117_0016294 Ga0496117_0016294_3810_4640 269
587 3300048921 Ga0496118_0120944 Ga0496118_0120944_223_1053 269
588 3300048922 Ga0496119_0039146 Ga0496119_0039146_374_1204 269
589 3300048924 Ga0496121_0000602 Ga0496121_0000602_231_1061 269
590 3300048924 Ga0496121_0001711 Ga0496121_0001711_33273_34103 269
591 3300048924 Ga0496121_0030357 Ga0496121_0030357_1401_2246 269
592 3300048927 Ga0496124_0010548 Ga0496124_0010548_5934_6764 269
593 3300048928 Ga0496125_0139394 Ga0496125_0139394_245_1075 269
594 3300048929 Ga0496126_0005297 Ga0496126_0005297_13746_14576 269
595 3300049569 Ga0501032_0103967 Ga0501032_0103967_160_996 269
596 3300049570 Ga0501033_0007525 Ga0501033_0007525_6709_7581 269
597 3300049570 Ga0501033_0009293 Ga0501033_0009293_213_1049 269
598 3300049571 Ga0501034_0028890 Ga0501034_0028890_302_1138 269
599 3300049571 Ga0501034_0033451 Ga0501034_0033451_1145_2017 269
600 3300049572 Ga0501036_0117652 Ga0501036_0117652_322_1194 269
601 3300049574 Ga0501038_0020801 Ga0501038_0020801_1881_2753 269
602 3300049575 Ga0501039_0009482 Ga0501039_0009482_2345_3217 269
603 3300049575 Ga0501039_0020785 Ga0501039_0020785_3180_4016 269
604 3300049576 Ga0501040_0098904 Ga0501040_0098904_1043_1915 269
605 3300049579 Ga0501043_0008784 Ga0501043_0008784_2730_3602 269
606 3300049579 Ga0501043_0031983 Ga0501043_0031983_1762_2634 269
607 3300049580 Ga0501046_0049026 Ga0501046_0049026_689_1525 269
608 3300049581 Ga0501047_0020707 Ga0501047_0020707_1440_2312 269
609 3300049583 Ga0501067_0006561 Ga0501067_0006561_1567_2439 269
610 3300049584 Ga0501068_0008340 Ga0501068_0008340_1929_2801 269
611 3300049585 Ga0501069_0023734 Ga0501069_0023734_1543_2415 269
612 3300049586 Ga0501070_0063324 Ga0501070_0063324_562_1434 269
613 3300049587 Ga0501071_0028586 Ga0501071_0028586_2861_3733 269
614 3300049588 Ga0501072_0028756 Ga0501072_0028756_1321_2193 269
615 3300049589 Ga0501073_0035135 Ga0501073_0035135_319_1155 269
616 3300049590 Ga0501074_0013478 Ga0501074_0013478_1050_1922 269
617 3300049592 Ga0501076_0056482 Ga0501076_0056482_811_1683 269
618 3300049593 Ga0501077_0019485 Ga0501077_0019485_2273_3145 269
619 3300049741 Ga0501079_0014219 Ga0501079_0014219_3348_4220 269
620 3300049742 Ga0501080_0062603 Ga0501080_0062603_2029_2901 269
621 3300049743 Ga0501081_0116134 Ga0501081_0116134_182_1054 269
622 3300049744 Ga0501083_0014996 Ga0501083_0014996_1230_2102 269
623 3300049822 Ga0501035_0117734 Ga0501035_0117734_1259_2131 269
624 3300049823 Ga0501044_0047720 Ga0501044_0047720_2775_3647 269
625 3300053078 Ga0495612_0025036 Ga0495612_0025036_67_942 269
626 3300053094 Ga0500566_0000747 Ga0500566_0000747_16322_17206 269
627 3300053094 Ga0500566_0152945 Ga0500566_0152945_149_979 269
628 3300053102 Ga0500554_098643 Ga0500554_098643_41_925 269
629 3300053119 Ga0500595_013153 Ga0500595_013153_1094_1978 269
630 3300053119 Ga0500595_015767 Ga0500595_015767_1053_1883 269
631 3300053150 Ga0500603_002347 Ga0500603_002347_3141_3971 269
632 3300053162 Ga0500638_000305 Ga0500638_000305_8782_9666 269
633 3300053178 Ga0500637_0001408 Ga0500637_0001408_7632_8516 269
634 3300053735 Ga0500596_004406 Ga0500596_004406_145_975 269
635 3300055283 Ga0500661_000947 Ga0500661_000947_1308_2192 269
636 3300060353 Ga0501082_0005755 Ga0501082_0005755_1929_2801 269
637 iso_pu_bacteria 2508501009 2508540767 269
638 iso_pu_bacteria 2508501042 2508696729 269
639 iso_pu_bacteria 2513237092 2513627825 269
640 iso_pu_bacteria 2513237102 2513705662 269
641 iso_pu_bacteria 2513237104 2513723993 269
642 iso_pu_bacteria 2513237139 2513879548 269
643 iso_pu_bacteria 2515154112 2515631249 269
644 iso_pu_bacteria 2517093001 2517108374 269
645 iso_pu_bacteria 2791355196 2793059811 269
646 iso_pu_bacteria 2824609381 2824617737 269
647 iso_pu_bacteria 2824653114 2824661258 269
648 iso_pu_bacteria 2824704595 2824713879 269
649 iso_pu_bacteria 2842038055 2842045650 269
650 iso_pu_bacteria 2842045827 2842053569 269
651 iso_pu_bacteria 2857509624 2857514950 269
652 iso_pu_bacteria 2879127579 2879127915 269
653 iso_pu_bacteria 2888419890 2888426423 269
654 iso_pu_bacteria 2935819856 2935827355 269
655 iso_pu_bacteria 2935916978 2935925899 269
656 iso_pu_bacteria 8019619141 8019620844 269
657 iso_pu_bacteria 8019629233 8019632350 269
658 iso_pu_bacteria 8019668869 8019669700 269
659 iso_pu_bacteria 8056967851 8056969859 269
660 3300003322 rootL2_10021398 rootL2_100213983 270
661 3300003323 rootH1_10084363 rootH1_100843632 270
662 3300003752 Ga0055539_1007251 Ga0055539_10072512 270
663 3300005337 Ga0070682_100215803 Ga0070682_1002158032 270
664 3300005338 Ga0068868_100056796 Ga0068868_1000567963 270
665 3300005364 Ga0070673_100140805 Ga0070673_1001408051 270
666 3300005436 Ga0070713_100025253 Ga0070713_1000252532 270
667 3300005455 Ga0070663_100058684 Ga0070663_1000586843 270
668 3300005456 Ga0070678_100002219 Ga0070678_10000221913 270
669 3300005456 Ga0070678_100197019 Ga0070678_1001970192 270
670 3300005535 Ga0070684_100029049 Ga0070684_1000290493 270
671 3300005539 Ga0068853_100013884 Ga0068853_1000138842 270
672 3300005543 Ga0070672_100185258 Ga0070672_1001852582 270
673 3300005548 Ga0070665_100362264 Ga0070665_1003622642 270
674 3300005563 Ga0068855_100131616 Ga0068855_1001316162 270
675 3300005563 Ga0068855_100259042 Ga0068855_1002590422 270
676 3300005578 Ga0068854_100007431 Ga0068854_1000074314 270
677 3300005578 Ga0068854_100054057 Ga0068854_1000540572 270
678 3300005614 Ga0068856_100012955 Ga0068856_1000129553 270
679 3300005614 Ga0068856_100511524 Ga0068856_1005115242 270
680 3300005614 Ga0068856_100635519 Ga0068856_1006355192 270
681 3300005616 Ga0068852_100032298 Ga0068852_1000322982 270
682 3300005616 Ga0068852_100121936 Ga0068852_1001219361 270
683 3300005616 Ga0068852_100212515 Ga0068852_1002125152 270
684 3300005618 Ga0068864_100813199 Ga0068864_1008131991 270
685 3300005834 Ga0068851_10002363 Ga0068851_100023635 270
686 3300005834 Ga0068851_10148268 Ga0068851_101482682 270
687 3300005842 Ga0068858_100384542 Ga0068858_1003845422 270
688 3300005985 Ga0081539_10000948 Ga0081539_1000094865 270
689 3300006038 Ga0075365_10078603 Ga0075365_100786032 270
690 3300006175 Ga0070712_100187083 Ga0070712_1001870832 270
691 3300006881 Ga0068865_100078732 Ga0068865_1000787323 270
692 3300007788 Ga0099795_10086464 Ga0099795_100864641 270
693 3300009093 Ga0105240_10003411 Ga0105240_100034118 270
694 3300009098 Ga0105245_10104201 Ga0105245_101042013 270
695 3300009098 Ga0105245_10280910 Ga0105245_102809102 270
696 3300009098 Ga0105245_10736559 Ga0105245_107365592 270
697 3300009148 Ga0105243_10096060 Ga0105243_100960603 270
698 3300009177 Ga0105248_10098788 Ga0105248_100987883 270
699 3300009545 Ga0105237_10254663 Ga0105237_102546633 270
700 3300009551 Ga0105238_10005788 Ga0105238_100057887 270
701 3300009551 Ga0105238_10106814 Ga0105238_101068142 270
702 3300009553 Ga0105249_10907464 Ga0105249_109074641 270
703 3300010375 Ga0105239_10006751 Ga0105239_100067518 270
704 3300010375 Ga0105239_10053219 Ga0105239_100532193 270
705 3300010375 Ga0105239_10130443 Ga0105239_101304433 270
706 3300011119 Ga0105246_10026013 Ga0105246_100260134 270
707 3300013105 Ga0157369_10209601 Ga0157369_102096012 270
708 3300013296 Ga0157374_10019918 Ga0157374_100199183 270
709 3300013296 Ga0157374_10041103 Ga0157374_100411033 270
710 3300013306 Ga0163162_10348820 Ga0163162_103488202 270
711 3300013308 Ga0157375_10007831 Ga0157375_1000783112 270
712 3300013308 Ga0157375_10473564 Ga0157375_104735642 270
713 3300014325 Ga0163163_10191158 Ga0163163_101911583 270
714 3300014968 Ga0157379_10047198 Ga0157379_100471983 270
715 3300014969 Ga0157376_10027010 Ga0157376_100270104 270
716 3300014969 Ga0157376_10036659 Ga0157376_100366593 270
717 3300021384 Ga0213876_10090022 Ga0213876_100900222 270
718 3300021384 Ga0213876_10149930 Ga0213876_101499301 270
719 3300025253 Ga0209677_100687 Ga0209677_1006873 270
720 3300025254 Ga0209148_1010512 Ga0209148_10105122 270
721 3300025261 Ga0209233_1001017 Ga0209233_10010178 270
722 3300025272 Ga0209455_1000964 Ga0209455_100096415 270
723 3300025321 Ga0207656_10004091 Ga0207656_100040911 270
724 3300025909 Ga0207705_10261832 Ga0207705_102618322 270
725 3300025911 Ga0207654_10000717 Ga0207654_100007172 270
726 3300025913 Ga0207695_10002499 Ga0207695_1000249917 270
727 3300025914 Ga0207671_10023001 Ga0207671_100230013 270
728 3300025924 Ga0207694_10000258 Ga0207694_1000025843 270
729 3300025924 Ga0207694_10031115 Ga0207694_100311155 270
730 3300025927 Ga0207687_10244271 Ga0207687_102442712 270
731 3300025928 Ga0207700_10021557 Ga0207700_100215573 270
732 3300025935 Ga0207709_10121172 Ga0207709_101211723 270
733 3300025938 Ga0207704_10238030 Ga0207704_102380302 270
734 3300025949 Ga0207667_10009886 Ga0207667_100098867 270
735 3300025949 Ga0207667_10142302 Ga0207667_101423022 270
736 3300025960 Ga0207651_10174207 Ga0207651_101742072 270
737 3300025981 Ga0207640_10005931 Ga0207640_100059314 270
738 3300025981 Ga0207640_10023275 Ga0207640_100232754 270
739 3300026041 Ga0207639_10005744 Ga0207639_100057448 270
740 3300026041 Ga0207639_10141351 Ga0207639_101413511 270
741 3300026067 Ga0207678_10007240 Ga0207678_100072402 270
742 3300026078 Ga0207702_10000006 Ga0207702_1000000620 270
743 3300026121 Ga0207683_10054333 Ga0207683_100543334 270
744 3300026121 Ga0207683_10108584 Ga0207683_101085843 270
745 3300028379 Ga0268266_10169502 Ga0268266_101695022 270
746 3300028786 Ga0307517_10000524 Ga0307517_1000052469 270
747 3300028794 Ga0307515_10091971 Ga0307515_100919714 270
748 3300028800 Ga0265338_10000934 Ga0265338_1000093438 270
749 3300031548 Ga0307408_100341622 Ga0307408_1003416222 270
750 3300031616 Ga0307508_10272318 Ga0307508_102723182 270
751 3300031711 Ga0265314_10060883 Ga0265314_100608832 270
752 3300032002 Ga0307416_100331165 Ga0307416_1003311651 270
753 3300033544 Ga0316215_1002340 Ga0316215_10023402 270
754 3300035092 Ga0373952_0001616 Ga0373952_0001616_2259_3086 270
755 3300035112 Ga0373932_0011568 Ga0373932_0011568_263_1090 270
756 3300035115 Ga0373941_0019125 Ga0373941_0019125_718_1545 270
757 3300035116 Ga0373945_0060104 Ga0373945_0060104_424_1257 270
758 3300035170 Ga0373943_0093515 Ga0373943_0093515_236_1069 270
759 3300035207 Ga0373942_0007422 Ga0373942_0007422_1621_2448 270
760 3300035410 Ga0373924_0054689 Ga0373924_0054689_225_1058 270
761 3300035691 Ga0373931_0000507 Ga0373931_0000507_4373_5200 270
762 3300035692 Ga0373935_0009651 Ga0373935_0009651_3881_4714 270
763 3300035692 Ga0373935_0043982 Ga0373935_0043982_1646_2473 270
764 3300035695 Ga0373927_0001215 Ga0373927_0001215_2072_2905 270
765 3300035695 Ga0373927_0156053 Ga0373927_0156053_232_1059 270
766 3300035725 Ga0373947_0006550 Ga0373947_0006550_1731_2564 270
767 3300036401 Ga0373937_0157710 Ga0373937_0157710_159_992 270
768 3300036459 Ga0372808_017632 Ga0372808_017632_31_864 270
769 3300037068 Ga0373925_0006083 Ga0373925_0006083_4998_5831 270
770 3300037853 Ga0436364_0640114 Ga0436364_0640114_1434_2276 270
771 3300039437 Ga0436365_0039735 Ga0436365_0039735_283_1116 270
772 3300039437 Ga0436365_0655508 Ga0436365_0655508_718_1560 270
773 3300039437 Ga0436365_0764898 Ga0436365_0764898_438_1271 270
774 3300044706 Ga0466964_0189642 Ga0466964_0189642_46_888 270
775 3300044719 Ga0466971_0133402 Ga0466971_0133402_115_957 270
776 3300046454 Ga0495592_0019062 Ga0495592_0019062_3339_4172 270
777 3300046455 Ga0495603_0025189 Ga0495603_0025189_311_1144 270
778 3300046459 Ga0495629_0000314 Ga0495629_0000314_18624_19457 270
779 3300046461 Ga0495641_0002314 Ga0495641_0002314_4762_5595 270
780 3300046472 Ga0495580_0002541 Ga0495580_0002541_10668_11501 270
781 3300046473 Ga0495582_0001544 Ga0495582_0001544_1238_2071 270
782 3300046473 Ga0495582_0109974 Ga0495582_0109974_78_905 270
783 3300046475 Ga0495639_0000223 Ga0495639_0000223_2582_3415 270
784 3300046475 Ga0495639_0023849 Ga0495639_0023849_1244_2071 270
785 3300046476 Ga0495662_0003817 Ga0495662_0003817_4309_5142 270
786 3300046477 Ga0495664_0005828 Ga0495664_0005828_1291_2124 270
787 3300046477 Ga0495664_0164138 Ga0495664_0164138_495_1322 270
788 3300046499 Ga0495594_0002386 Ga0495594_0002386_1493_2326 270
789 3300046516 Ga0495628_0224602 Ga0495628_0224602_172_1005 270
790 3300046517 Ga0495630_0025390 Ga0495630_0025390_2713_3546 270
791 3300046517 Ga0495630_0074681 Ga0495630_0074681_942_1769 270
792 3300046526 Ga0495666_0028246 Ga0495666_0028246_1329_2162 270
793 3300046529 Ga0495652_0011303 Ga0495652_0011303_1089_1922 270
794 3300046531 Ga0495665_0004299 Ga0495665_0004299_1092_1925 270
795 3300046533 Ga0495640_0000308 Ga0495640_0000308_18818_19651 270
796 3300046557 Ga0495622_0004386 Ga0495622_0004386_3153_3986 270
797 3300046559 Ga0495667_0305612 Ga0495667_0305612_145_978 270
798 3300046642 Ga0495634_0001740 Ga0495634_0001740_9613_10446 270
799 3300046663 Ga0495635_0001578 Ga0495635_0001578_10430_11263 270
800 3300046674 Ga0495588_0115317 Ga0495588_0115317_494_1321 270
801 3300046681 Ga0495647_0005969 Ga0495647_0005969_1084_1917 270
802 3300046683 Ga0495658_0000927 Ga0495658_0000927_13520_14353 270
803 3300046689 Ga0495613_0016990 Ga0495613_0016990_3023_3856 270
804 3300046690 Ga0495624_0007405 Ga0495624_0007405_1046_1879 270
805 3300047315 Ga0495581_0000846 Ga0495581_0000846_11430_12263 270
806 3300047315 Ga0495581_0040504 Ga0495581_0040504_1381_2208 270
807 3300047319 Ga0495674_0000375 Ga0495674_0000375_1291_2124 270
808 3300047321 Ga0495676_0039296 Ga0495676_0039296_634_1467 270
809 3300047471 Ga0495684_0011224 Ga0495684_0011224_5241_6074 270
810 3300047673 Ga0495593_0001627 Ga0495593_0001627_10788_11621 270
811 3300048903 Ga0496100_0002701 Ga0496100_0002701_3635_4462 270
812 3300048903 Ga0496100_0014885 Ga0496100_0014885_851_1678 270
813 3300048904 Ga0496101_0031148 Ga0496101_0031148_1479_2306 270
814 3300048904 Ga0496101_0106188 Ga0496101_0106188_34_861 270
815 3300048905 Ga0496102_0001947 Ga0496102_0001947_1198_2025 270
816 3300048905 Ga0496102_0038907 Ga0496102_0038907_2446_3273 270
817 3300048906 Ga0496103_0065859 Ga0496103_0065859_390_1217 270
818 3300048907 Ga0496104_0018988 Ga0496104_0018988_2509_3336 270
819 3300048907 Ga0496104_0160483 Ga0496104_0160483_1211_2038 270
820 3300048908 Ga0496105_0008113 Ga0496105_0008113_1093_1920 270
821 3300048909 Ga0496106_0002570 Ga0496106_0002570_5187_6014 270
822 3300048910 Ga0496107_0013494 Ga0496107_0013494_3797_4624 270
823 3300048910 Ga0496107_0032234 Ga0496107_0032234_1781_2608 270
824 3300048911 Ga0496108_0063727 Ga0496108_0063727_118_945 270
825 3300048912 Ga0496109_0010357 Ga0496109_0010357_4820_5647 270
826 3300048913 Ga0496110_0007419 Ga0496110_0007419_4868_5695 270
827 3300048915 Ga0496112_0032718 Ga0496112_0032718_44_871 270
828 3300048915 Ga0496112_0066501 Ga0496112_0066501_2083_2916 270
829 3300048916 Ga0496113_0033509 Ga0496113_0033509_269_1096 270
830 3300048917 Ga0496114_0002069 Ga0496114_0002069_1622_2449 270
831 3300048917 Ga0496114_0002910 Ga0496114_0002910_2880_3707 270
832 3300048918 Ga0496115_0220551 Ga0496115_0220551_321_1154 270
833 3300048920 Ga0496117_0098586 Ga0496117_0098586_940_1788 270
834 3300048921 Ga0496118_0020621 Ga0496118_0020621_4508_5437 270
835 3300048921 Ga0496118_0145291 Ga0496118_0145291_578_1414 270
836 3300048924 Ga0496121_0122077 Ga0496121_0122077_843_1772 270
837 3300048928 Ga0496125_0123617 Ga0496125_0123617_88_927 270
838 3300048929 Ga0496126_0027530 Ga0496126_0027530_1707_2552 270
839 3300053085 Ga0495619_0023835 Ga0495619_0023835_2161_2988 270
840 3300053085 Ga0495619_0109880 Ga0495619_0109880_740_1573 270
841 3300053111 Ga0500572_001192 Ga0500572_001192_4431_5276 270
842 3300053119 Ga0500595_030259 Ga0500595_030259_375_1211 270
843 3300053136 Ga0500559_0000137 Ga0500559_0000137_910_1755 270
844 3300053162 Ga0500638_041809 Ga0500638_041809_907_1734 270
845 3300053163 Ga0500639_019226 Ga0500639_019226_118_963 270
846 3300053735 Ga0500596_002227 Ga0500596_002227_1518_2363 270
847 iso_pu_bacteria 2507262055 2507506753 270
848 iso_pu_bacteria 2513237095 2513653243 270
849 iso_pu_bacteria 2524023205 2524442895 270
850 iso_pu_bacteria 2528768022 2528854230 270
851 iso_pu_bacteria 2617270741 2617375172 270
852 iso_pu_bacteria 2816332527 2818243627 270
853 iso_pu_bacteria 2824679649 2824687570 270
854 iso_pu_bacteria 2824746037 2824753728 270
855 iso_pu_bacteria 2874620515 2874625053 270
856 iso_pu_bacteria 2879083081 2879083479 270
857 iso_pu_bacteria 2885366525 2885373062 270
858 iso_pu_bacteria 2888378607 2888386281 270
859 iso_pu_bacteria 2904666416 2904668972 270
860 iso_pu_bacteria 2906626472 2906631969 270
861 iso_pu_bacteria 2908775508 2908782544 270
862 iso_pu_bacteria 2922368715 2922376907 270
863 iso_pu_bacteria 2922393267 2922396072 270
864 iso_pu_bacteria 2932784394 2932790138 270
865 iso_pu_bacteria 2935675223 2935684192 270
866 iso_pu_bacteria 2935777560 2935785537 270
867 iso_pu_bacteria 2935785616 2935787802 270
868 iso_pu_bacteria 2935837841 2935846805 270
869 iso_pu_bacteria 2935959822 2935967073 270
870 iso_pu_bacteria 2935992306 2935998390 270
871 iso_pu_bacteria 3005506211 3005511444 270
872 iso_pu_bacteria 3005587118 3005592544 270
873 iso_pu_bacteria 3005710791 3005716677 270
874 iso_pu_bacteria 8016511872 8016519694 270
875 iso_pu_bacteria 8016522445 8016527720 270
876 iso_pu_bacteria 8016557553 8016564425 270
877 iso_pu_bacteria 8016583857 8016584062 270
878 iso_pu_bacteria 8016603502 8016608030 270
879 iso_pu_bacteria 8016613128 8016616846 270
880 iso_pu_bacteria 8016622563 8016624410 270
881 iso_pu_bacteria 8017057580 8017065837 270
882 iso_pu_bacteria 8019538911 8019547224 270
883 iso_pu_bacteria 8019547302 8019551431 270
884 iso_pu_bacteria 8019608314 8019610161 270
885 3300003354 JGI25160J50197_1014574 JGI25160J50197_10145742 271
886 3300003659 JGI25404J52841_10036249 JGI25404J52841_100362492 271
887 3300004625 Ga0055543_1026183 Ga0055543_10261831 271
888 3300005563 Ga0068855_100405340 Ga0068855_1004053402 271
889 3300005937 Ga0081455_10071334 Ga0081455_100713344 271
890 3300005937 Ga0081455_10093375 Ga0081455_100933754 271
891 3300005983 Ga0081540_1004405 Ga0081540_10044056 271
892 3300005983 Ga0081540_1004639 Ga0081540_100463915 271
893 3300005983 Ga0081540_1031625 Ga0081540_10316252 271
894 3300010375 Ga0105239_10047522 Ga0105239_100475223 271
895 3300025302 Ga0207426_1004089 Ga0207426_10040896 271
896 3300025949 Ga0207667_10537087 Ga0207667_105370871 271
897 3300044658 Ga0466972_0004933 Ga0466972_0004933_1122_1940 271
898 3300044658 Ga0466972_0157911 Ga0466972_0157911_178_993 271
899 3300044683 Ga0466965_0017223 Ga0466965_0017223_1636_2451 271
900 3300044901 Ga0466960_0111589 Ga0466960_0111589_564_1379 271
901 3300046455 Ga0495603_0054172 Ga0495603_0054172_1095_1925 271
902 3300046615 Ga0495656_0214913 Ga0495656_0214913_66_896 271
903 3300046684 Ga0495669_0020563 Ga0495669_0020563_955_1785 271
904 3300048917 Ga0496114_0469802 Ga0496114_0469802_264_1097 271
905 3300048928 Ga0496125_0008236 Ga0496125_0008236_2796_3635 271
906 3300048929 Ga0496126_0024468 Ga0496126_0024468_682_1521 271
907 3300049571 Ga0501034_0210712 Ga0501034_0210712_962_1801 271
908 3300049586 Ga0501070_0041625 Ga0501070_0041625_925_1764 271
909 3300053119 Ga0500595_007908 Ga0500595_007908_29_865 271
910 iso_pu_bacteria 2824753945 2824763514 271
911 iso_pu_bacteria 2824763712 2824770696 271
912 iso_pu_bacteria 2841957949 2841963156 271
913 iso_pu_bacteria 2874612657 2874617063 271
914 iso_pu_bacteria 2874628541 2874634325 271
915 iso_pu_bacteria 2874645413 2874646565 271
916 iso_pu_bacteria 2876771140 2876771510 271
917 iso_pu_bacteria 2876818435 2876818845 271
918 iso_pu_bacteria 2879074833 2879075296 271
919 iso_pu_bacteria 2879142872 2879143808 271
920 iso_pu_bacteria 2881665667 2881666493 271
921 iso_pu_bacteria 2904711408 2904715698 271
922 iso_pu_bacteria 2935608549 2935616505 271
923 iso_pu_bacteria 2935648319 2935656814 271
924 iso_pu_bacteria 2935656913 2935665641 271
925 iso_pu_bacteria 2935847175 2935854729 271
926 iso_pu_bacteria 2935908558 2935915334 271
927 iso_pu_bacteria 2935926038 2935932591 271
928 iso_pu_bacteria 2935934488 2935941084 271
929 iso_pu_bacteria 2935942939 2935949261 271
930 iso_pu_bacteria 2935951376 2935957851 271
931 iso_pu_bacteria 2935967501 2935974267 271
932 iso_pu_bacteria 2935975950 2935983595 271
933 iso_pu_bacteria 2935984226 2935991432 271
934 iso_pu_bacteria 2936011229 2936019697 271
935 iso_pu_bacteria 2936019824 2936028296 271
936 iso_pu_bacteria 2936028420 2936037166 271
937 iso_pu_bacteria 2936046547 2936055160 271
938 iso_pu_bacteria 2936055302 2936063815 271
939 iso_pu_bacteria 3005483717 3005487661 271
940 iso_pu_bacteria 3005594810 3005601205 271
941 iso_pu_bacteria 3005718088 3005723948 271
942 iso_pu_bacteria 8006926726 8006926765 271
943 iso_pu_bacteria 8016630954 8016634113 271
944 iso_pu_bacteria 8019638758 8019647528 271
945 iso_pu_bacteria 8019678201 8019686397 271
946 iso_pu_bacteria 8019687851 8019692554 271
947 3300003215 JGI25153J46596_10019965 JGI25153J46596_100199652 272
948 3300003794 Ga0055531_10013520 Ga0055531_100135204 272
949 3300005262 Ga0065165_1011200 Ga0065165_10112003 272
950 3300005434 Ga0070709_10049496 Ga0070709_100494963 272
951 3300005435 Ga0070714_100078572 Ga0070714_1000785723 272
952 3300005437 Ga0070710_10008105 Ga0070710_100081053 272
953 3300005439 Ga0070711_100107517 Ga0070711_1001075172 272
954 3300006038 Ga0075365_10100645 Ga0075365_101006452 272
955 3300006175 Ga0070712_100019059 Ga0070712_1000190596 272
956 3300006871 Ga0075434_100018105 Ga0075434_1000181056 272
957 3300025295 Ga0209564_1007241 Ga0209564_10072415 272
958 3300025297 Ga0209758_1000109 Ga0209758_10001093 272
959 3300025299 Ga0209256_1019127 Ga0209256_10191272 272
960 3300025304 Ga0209257_1001504 Ga0209257_100150428 272
961 3300025898 Ga0207692_10013222 Ga0207692_100132224 272
962 3300025915 Ga0207693_10036356 Ga0207693_100363565 272
963 3300025919 Ga0207657_10094770 Ga0207657_100947703 272
964 3300025939 Ga0207665_10036744 Ga0207665_100367443 272
965 3300026067 Ga0207678_10170615 Ga0207678_101706151 272
966 3300026078 Ga0207702_10181911 Ga0207702_101819113 272
967 3300026121 Ga0207683_10707065 Ga0207683_107070651 272
968 3300031249 Ga0265339_10008783 Ga0265339_1000878310 272
969 3300033180 Ga0307510_10077900 Ga0307510_100779003 272
970 3300037418 Ga0395900_0059561 Ga0395900_0059561_2261_3085 272
971 3300037466 Ga0395898_0046000 Ga0395898_0046000_2246_3070 272
972 3300037471 Ga0395905_0107172 Ga0395905_0107172_49_873 272
973 3300038443 Ga0395901_0384959 Ga0395901_0384959_585_1409 272
974 3300041505 Ga0451849_0196853 Ga0451849_0196853_54_881 272
975 3300046524 Ga0495648_0031798 Ga0495648_0031798_1535_2374 272
976 3300048921 Ga0496118_0103079 Ga0496118_0103079_697_1521 272
977 3300050492 nmdc:mga0yw44_263309_c1 nmdc:mga0yw44_263309_c1_222_1049 272
978 3300053086 Ga0500578_0089189 Ga0500578_0089189_941_1765 272
979 3300053102 Ga0500554_005925 Ga0500554_005925_178_1017 272
980 3300053150 Ga0500603_001410 Ga0500603_001410_3678_4517 272
981 3300053163 Ga0500639_177296 Ga0500639_177296_26_868 272
982 3300053178 Ga0500637_0027717 Ga0500637_0027717_1731_2573 272
983 iso_pu_bacteria 2824617872 2824626433 272
984 iso_pu_bacteria 2824626560 2824632267 272
985 iso_pu_bacteria 2824635225 2824643779 272
986 iso_pu_bacteria 2824644064 2824652445 272
987 iso_pu_bacteria 2824661429 2824666397 272
988 iso_pu_bacteria 2824723954 2824732645 272
989 iso_pu_bacteria 2881364244 2881371326 272
990 iso_pu_bacteria 2885409591 2885410237 272
991 iso_pu_bacteria 2888388044 2888392001 272
992 iso_pu_bacteria 2929615660 2929621548 272
993 iso_pu_bacteria 2929624759 2929632047 272
994 iso_pu_bacteria 2932828146 2932833402 272
995 iso_pu_bacteria 2933577622 2933583427 272
996 iso_pu_bacteria 2935616580 2935621323 272
997 iso_pu_bacteria 2935638405 2935644673 272
998 iso_pu_bacteria 2935665750 2935671320 272
999 iso_pu_bacteria 2935684952 2935693378 272
1000 iso_pu_bacteria 2935694250 2935700181 272
1001 iso_pu_bacteria 2935703347 2935710816 272
1002 iso_pu_bacteria 2935713505 2935720833 272
1003 iso_pu_bacteria 2935722832 2935730680 272
1004 iso_pu_bacteria 2935732158 2935740555 272
1005 iso_pu_bacteria 2935741537 2935749971 272
1006 iso_pu_bacteria 2935750917 2935759209 272
1007 iso_pu_bacteria 2935769743 2935772351 272
1008 iso_pu_bacteria 2935793552 2935793641 272
1009 iso_pu_bacteria 2935801545 2935810431 272
1010 iso_pu_bacteria 2935827899 2935833923 272
1011 iso_pu_bacteria 2935855204 2935859484 272
1012 iso_pu_bacteria 2935864058 2935869873 272
1013 iso_pu_bacteria 2935873716 2935880835 272
1014 iso_pu_bacteria 2936002035 2936008714 272
1015 iso_pu_bacteria 2940556831 2940565265 272
1016 iso_pu_bacteria 2941538514 2941542810 272
1017 iso_pu_bacteria 8016530956 8016532820 272
1018 iso_pu_bacteria 8016548790 8016556065 272
1019 iso_pu_bacteria 8016575299 8016583627 272
1020 iso_pu_bacteria 8016595262 8016602096 272
1021 iso_pu_bacteria 8019530166 8019532625 272
1022 iso_pu_bacteria 8019576017 8019585272 272
1023 iso_pu_bacteria 8019586578 8019593247 272
1024 iso_pu_bacteria 8019597564 8019598216 272
1025 iso_pu_bacteria 8055742211 8055744249 272
1026 3300003214 JGI25165J46597_1005056 JGI25165J46597_10050563 273
1027 3300003215 JGI25153J46596_10016085 JGI25153J46596_100160852 273
1028 3300003215 JGI25153J46596_10020621 JGI25153J46596_100206212 273
1029 3300003215 JGI25153J46596_10029904 JGI25153J46596_100299042 273
1030 3300003354 JGI25160J50197_1015304 JGI25160J50197_10153042 273
1031 3300004625 Ga0055543_1004423 Ga0055543_10044234 273
1032 3300005262 Ga0065165_1011960 Ga0065165_10119604 273
1033 3300005434 Ga0070709_10024169 Ga0070709_100241693 273
1034 3300005437 Ga0070710_10001958 Ga0070710_1000195810 273
1035 3300005439 Ga0070711_100025635 Ga0070711_1000256354 273
1036 3300005983 Ga0081540_1048022 Ga0081540_10480224 273
1037 3300006028 Ga0070717_10246274 Ga0070717_102462742 273
1038 3300006038 Ga0075365_10092887 Ga0075365_100928872 273
1039 3300006173 Ga0070716_100001799 Ga0070716_1000017994 273
1040 3300006175 Ga0070712_100030959 Ga0070712_1000309593 273
1041 3300006942 Ga0099824_1017618 Ga0099824_10176182 273
1042 3300009553 Ga0105249_10131766 Ga0105249_101317662 273
1043 3300010375 Ga0105239_10275125 Ga0105239_102751252 273
1044 3300021320 Ga0214544_1019909 Ga0214544_10199093 273
1045 3300021321 Ga0214542_1000338 Ga0214542_10003383 273
1046 3300021324 Ga0214545_1000186 Ga0214545_10001863 273
1047 3300021327 Ga0214543_1000271 Ga0214543_10002713 273
1048 3300021358 Ga0213873_10050190 Ga0213873_100501901 273
1049 3300021384 Ga0213876_10018591 Ga0213876_100185913 273
1050 3300025261 Ga0209233_1005487 Ga0209233_10054872 273
1051 3300025295 Ga0209564_1014113 Ga0209564_10141134 273
1052 3300025297 Ga0209758_1009959 Ga0209758_10099596 273
1053 3300025297 Ga0209758_1020295 Ga0209758_10202953 273
1054 3300025297 Ga0209758_1026549 Ga0209758_10265493 273
1055 3300025299 Ga0209256_1016521 Ga0209256_10165212 273
1056 3300025302 Ga0207426_1013861 Ga0207426_10138613 273
1057 3300025304 Ga0209257_1032541 Ga0209257_10325412 273
1058 3300025898 Ga0207692_10006929 Ga0207692_100069294 273
1059 3300025906 Ga0207699_10001086 Ga0207699_100010863 273
1060 3300025915 Ga0207693_10023981 Ga0207693_100239815 273
1061 3300025924 Ga0207694_10517738 Ga0207694_105177381 273
1062 3300025939 Ga0207665_10016757 Ga0207665_100167573 273
1063 3300026116 Ga0207674_10122226 Ga0207674_101222263 273
1064 3300027296 Ga0209389_1000431 Ga0209389_10004313 273
1065 3300027357 Ga0209589_1001194 Ga0209589_10011943 273
1066 3300027361 Ga0209489_104677 Ga0209489_1046773 273
1067 3300031616 Ga0307508_10311692 Ga0307508_103116922 273
1068 3300037471 Ga0395905_0030574 Ga0395905_0030574_2551_3375 273
1069 3300039437 Ga0436365_1619476 Ga0436365_1619476_1153_1995 273
1070 3300039450 Ga0436363_0590996 Ga0436363_0590996_146_988 273
1071 3300039450 Ga0436363_1169938 Ga0436363_1169938_2087_2929 273
1072 3300039453 Ga0436362_1201525 Ga0436362_1201525_1114_1956 273
1073 3300044658 Ga0466972_0094283 Ga0466972_0094283_581_1408 273
1074 3300044684 Ga0466966_0001537 Ga0466966_0001537_12806_13633 273
1075 3300044693 Ga0466961_0021638 Ga0466961_0021638_2247_3074 273
1076 3300044735 Ga0466968_0070116 Ga0466968_0070116_172_999 273
1077 3300044901 Ga0466960_0079237 Ga0466960_0079237_148_975 273
1078 3300045049 Ga0466959_0003334 Ga0466959_0003334_8500_9327 273
1079 3300046454 Ga0495592_0015335 Ga0495592_0015335_4123_4950 273
1080 3300046454 Ga0495592_0105928 Ga0495592_0105928_115_945 273
1081 3300046459 Ga0495629_0021109 Ga0495629_0021109_2321_3151 273
1082 3300046462 Ga0495651_0054693 Ga0495651_0054693_1114_1944 273
1083 3300046463 Ga0495653_0078813 Ga0495653_0078813_1100_1927 273
1084 3300046533 Ga0495640_0069034 Ga0495640_0069034_409_1239 273
1085 3300046533 Ga0495640_0165462 Ga0495640_0165462_320_1147 273
1086 3300046536 Ga0495587_0018728 Ga0495587_0018728_1000_1827 273
1087 3300046557 Ga0495622_0160372 Ga0495622_0160372_24_854 273
1088 3300046559 Ga0495667_0024280 Ga0495667_0024280_207_1034 273
1089 3300046675 Ga0495657_0032972 Ga0495657_0032972_1558_2388 273
1090 3300046675 Ga0495657_0036296 Ga0495657_0036296_114_941 273
1091 3300046678 Ga0495599_0015277 Ga0495599_0015277_1049_1876 273
1092 3300046689 Ga0495613_0211913 Ga0495613_0211913_22_852 273
1093 3300047317 Ga0495604_0001459 Ga0495604_0001459_17470_18297 273
1094 3300047317 Ga0495604_0011053 Ga0495604_0011053_3171_4001 273
1095 3300047321 Ga0495676_0034038 Ga0495676_0034038_339_1169 273
1096 3300047322 Ga0495680_0002851 Ga0495680_0002851_1276_2103 273
1097 3300047471 Ga0495684_0016317 Ga0495684_0016317_205_1035 273
1098 3300047673 Ga0495593_0032798 Ga0495593_0032798_496_1326 273
1099 3300048904 Ga0496101_0092718 Ga0496101_0092718_1154_1984 273
1100 3300048907 Ga0496104_0032400 Ga0496104_0032400_1524_2354 273
1101 3300048908 Ga0496105_0017481 Ga0496105_0017481_1177_2007 273
1102 3300048916 Ga0496113_0125517 Ga0496113_0125517_70_900 273
1103 3300048917 Ga0496114_0568882 Ga0496114_0568882_142_972 273
1104 3300048921 Ga0496118_0199639 Ga0496118_0199639_185_1015 273
1105 3300048922 Ga0496119_0017238 Ga0496119_0017238_1820_2650 273
1106 3300048923 Ga0496120_0075434 Ga0496120_0075434_898_1731 273
1107 3300048927 Ga0496124_0084428 Ga0496124_0084428_887_1717 273
1108 3300048927 Ga0496124_0091728 Ga0496124_0091728_524_1354 273
1109 3300048928 Ga0496125_0040107 Ga0496125_0040107_2495_3322 273
1110 3300048928 Ga0496125_0052436 Ga0496125_0052436_453_1283 273
1111 3300048929 Ga0496126_0105083 Ga0496126_0105083_984_1814 273
1112 3300053085 Ga0495619_0079830 Ga0495619_0079830_1159_1986 273
1113 3300053105 Ga0500557_000125 Ga0500557_000125_1152_1985 273
1114 3300053111 Ga0500572_009132 Ga0500572_009132_1131_1958 273
1115 3300053122 Ga0500608_059876 Ga0500608_059876_175_1002 273
1116 3300053136 Ga0500559_0081342 Ga0500559_0081342_470_1297 273
1117 3300053136 Ga0500559_0081600 Ga0500559_0081600_247_1077 273
1118 3300053138 Ga0500564_132857 Ga0500564_132857_164_991 273
1119 3300053177 Ga0500636_0002510 Ga0500636_0002510_3974_4801 273
1120 3300053178 Ga0500637_0183815 Ga0500637_0183815_192_1019 273
1121 3300053729 Ga0500625_017266 Ga0500625_017266_1116_1949 273
1122 3300053737 Ga0500601_001869 Ga0500601_001869_1156_1986 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

34

292

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zhh-assembly1.cif.gz_A structure of inositol monophosphatase from anabaena (nostoc) sp. pcc 7120 0.8471 11 272
5zhh-assembly1.cif.gz_D structure of inositol monophosphatase from anabaena (nostoc) sp. pcc 7120 0.8447 11 267
5eyh-assembly1.cif.gz_B crystal structure of impase/nadp phosphatase complexed with nadp and ca2+ at ph 7.0 0.8434 11 272
5zhh-assembly1.cif.gz_C structure of inositol monophosphatase from anabaena (nostoc) sp. pcc 7120 0.8398 11 272
4n81-assembly1.cif.gz_A-2 another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis 0.8397 19 272
ID Description Score Start End Superfamily
af_P22255_147_245_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9475 168 264 3.40.190.80
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.93 11 142 3.30.540.10
af_P38710_3_147_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9203 10 142 3.30.540.10
af_Q6F2U7_1_143_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9123 11 140 3.30.540.10
2pcrB01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9062 14 142 3.30.540.10
ID Description Score Start End GO Terms
AF-A0A661QES6-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ 0.9574 97 264 GO:0000103
GO:0008441
GO:0046872
GO:0050427
AF-A0A346A4A1-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ 0.9528 30 272 GO:0000103
GO:0008441
GO:0046854
GO:0046872
GO:0050427
AF-A0A6J4SQP2-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ (EC 3.1.3.7) (3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase) (3'-phosphoadenosine 5'-phosphate phosphatase) (PAP phosphatase) 0.9464 10 265 GO:0000103
GO:0000287
GO:0005886
GO:0008441
GO:0046854
GO:0050427
AF-A0A7U2UWV7-F1-model_v4 deleted 0.9463 2 272
AF-A0A2V3U9G8-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ (EC 3.1.3.7) (3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase) (3'-phosphoadenosine 5'-phosphate phosphatase) (PAP phosphatase) 0.9453 11 272 GO:0000103
GO:0000287
GO:0005886
GO:0008441
GO:0046854
GO:0050427

Feature Viewer

pLDDT pTM Quality
93.16 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map