F490416

General Info

Members Datasets Scaffolds Average Seq Length
1122 636 896 382

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10084184|Ga0105247_100841842
Length 451
Sequence LGKDGDVELEGSGIETTTAERLRRMYARPLFVVVGIFGPVIRGGARRHHRQGFLHHPRLPRLAVRDAADIRIRTMNEAIRPAPPVPLQTADIPIVSVVVPTFNERDNVTTLYRRLEAAFKDVSWEVVFVDDNSPDGTWQVVRELSRNDSRVRCIRRIGRRGLSGACIEGILAASAPFAAVIDADLQHDETQLPKMLSLLQSGAAELVVGSRYVEGGSAASFDTKRAGASAFATEIARRALKVEVNDPMSGFFMIRRDRFEQIAPKLSTQGFKILLDIIASAEGGLRTVEVPYTFGSRLHGESKLDSMVALDFLGLVLAKMTNDVVSLRFLMFAMVGGIGLFVHLATLFLGLNLFDMPFAEAQALGAFIAMTSNFILNNFLTYRDQRLKGFAILRGLLAFYLVCSVGLLANVGVAFSVYDQEPIWWLAGAAGALMGVVWNYAMSGLFVWRKR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
23 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
24 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
25 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
26 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
27 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
28 2643221651 Afipia sp. Root123D2 Isolate Unclassified
29 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
30 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
31 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
32 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
33 2791355199
34 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
37 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
38 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
39 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
40 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
41 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
42 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
43 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
44 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
45 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
46 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
47 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
48 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
49 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
50 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
51 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
52 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
53 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
54 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
55 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
56 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
57 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
58 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
59 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
60 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
61 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
62 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
63 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
64 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
65 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
66 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
67 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
68 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
69 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
70 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
71 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
72 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
73 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
74 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
75 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
76 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
77 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
78 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
79 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
80 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
81 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
82 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
83 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
84 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
85 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
86 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
87 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
88 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
89 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
90 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
91 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
92 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
93 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
94 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
95 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
96 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
97 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
98 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
99 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
100 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
101 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
102 2904699407
103 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
104 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
105 2906610324
106 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
107 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
108 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
109 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
110 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
111 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
112 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
113 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
114 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
115 2922368715
116 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
117 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
118 2922425934
119 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
120 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
121 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
122 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
123 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
124 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
125 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
126 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
127 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
128 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
129 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
130 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
131 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
132 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
133 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
134 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
135 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
136 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
137 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
138 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
139 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
140 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
141 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
142 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
143 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
144 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
145 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
146 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
147 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
148 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
149 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
150 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
151 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
152 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
153 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
154 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
155 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
156 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
157 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
158 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
159 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
160 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
161 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
162 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
163 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
164 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
165 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
166 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
167 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
168 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
169 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
170 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
171 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
172 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
173 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
174 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
175 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
176 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
177 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
178 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
179 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
180 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
181 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
182 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
183 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
184 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
185 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
186 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
187 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
188 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
189 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
190 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
191 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
192 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
193 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
194 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
195 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
196 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
197 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
198 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
199 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
200 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
201 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
202 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
203 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
204 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
205 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
206 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
207 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
208 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
209 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
210 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
211 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
212 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
213 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
214 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
215 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
216 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
217 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
218 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
219 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
220 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
221 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
222 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
223 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
224 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
225 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
226 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
227 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
228 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
229 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
230 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
231 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
232 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
233 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
234 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
235 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
236 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
237 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
238 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
239 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
240 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
241 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
242 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
243 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
244 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
245 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
246 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
247 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
248 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
249 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
250 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
251 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
252 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
253 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
254 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
255 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
256 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
257 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
258 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
259 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
260 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
261 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
262 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
263 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
264 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
265 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
266 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
267 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
268 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
269 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
270 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
271 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
272 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
273 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
274 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
275 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
276 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
277 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
278 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
279 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
280 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
281 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
282 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
283 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
284 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
285 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
286 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
287 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
288 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
289 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
290 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
291 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
292 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
293 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
294 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
295 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
296 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
299 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
301 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
302 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
303 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
304 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
351 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
352 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
353 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
354 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
355 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
356 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
360 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
361 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
362 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
363 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
364 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
365 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
366 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
367 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
368 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
369 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
370 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
371 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
372 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
373 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
374 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
375 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
376 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
377 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
378 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
379 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
380 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
381 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
382 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
383 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
384 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
385 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
386 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
387 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
388 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
389 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
390 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
391 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
392 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
393 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
394 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
395 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
396 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
397 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
398 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
399 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
400 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
401 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
402 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
403 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
404 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
405 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
406 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
407 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
408 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
409 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
410 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
411 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
412 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
413 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
414 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
415 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
416 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
417 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
418 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
419 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
420 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
421 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
422 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
423 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
424 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
425 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
426 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
427 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
428 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
429 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
430 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
431 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
432 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
433 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
434 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
435 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
436 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
437 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
438 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
439 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
440 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
441 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
442 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
443 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
444 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
445 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
446 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
447 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
448 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
449 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
450 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
451 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
452 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
453 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
454 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
455 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
456 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
457 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
458 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
459 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
460 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
461 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
462 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
463 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
464 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
465 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
466 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
467 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
468 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
469 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
470 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
471 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
472 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
473 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
474 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
475 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
476 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
477 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
478 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
479 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
480 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
481 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
482 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
483 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
484 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
485 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
486 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
487 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
488 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
489 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
490 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
491 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
492 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
493 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
494 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
495 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
496 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
497 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
498 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
499 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
500 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
501 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
502 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
503 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
504 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
505 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
506 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
507 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
508 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
509 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
510 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
511 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
512 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
513 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
514 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
515 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
516 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
517 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
520 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
521 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
522 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
523 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
524 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
525 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
526 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
527 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
528 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
529 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
531 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
532 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
533 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
534 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
535 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
536 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
537 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
538 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
539 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
540 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
541 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
542 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
543 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
544 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
545 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
546 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
547 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
548 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
549 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
550 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
551 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
552 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
553 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
554 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
555 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
556 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
557 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
558 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
559 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
560 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
561 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
562 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
563 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
564 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
565 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
566 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
567 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
568 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
569 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
570 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
571 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
572 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
573 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
574 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
575 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
576 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
577 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
578 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
579 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
580 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
581 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
582 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
583 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
584 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
585 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
586 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
587 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
588 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
589 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
590 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
591 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
592 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
593 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
594 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
595 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
596 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
597 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
598 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
599 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
600 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
601 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
602 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
603 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
604 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
605 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
606 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
607 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
608 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
609 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
610 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
611 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
612 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
613 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
614 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
615 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
616 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
617 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
618 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
619 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
620 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
621 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
622 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
623 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
624 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
625 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
626 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
627 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
628 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
629 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
630 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
631 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
632 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
633 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
634 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
635 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
636 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.13
Metatranscriptomes 0.09
Isolates 19.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.03
Nodule 15.86
Rhizoplane 4.81
Rhizosphere 56.42
Stem 0
Stem Tuber 0
Unclassified 10.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10022084 3300001979 Bacteria 2196
2 JGI24737J22298_10004937 3300001990 Bacteria 4622
3 JGI24737J22298_10037209 3300001990 Bacteria 1500
4 JGI25406J46586_10000700 3300003203 Bacteria 15651
5 JGI25153J46596_10001125 3300003215 Bacteria 16201
6 rootH2_10001288 3300003320 Bacteria 28436
7 rootH1_10167409 3300003323 Bacteria 3072
8 JGI25160J50197_1002409 3300003354 Bacteria 8720
9 Ga0055539_1005731 3300003752 Bacteria 1604
10 Ga0055531_10007045 3300003794 Bacteria 6223
11 Ga0055531_10009469 3300003794 Bacteria 4975
12 Ga0055543_1006074 3300004625 Bacteria 2980
13 Ga0065165_1000278 3300005262 Bacteria 87353
14 Ga0065165_1002873 3300005262 Bacteria 13275
15 Ga0065165_1003794 3300005262 Bacteria 10105
16 Ga0070658_10091665 3300005327 Bacteria 2504
17 Ga0070683_100009575 3300005329 Bacteria 8295
18 Ga0070690_100134148 3300005330 Bacteria 1675
19 Ga0070670_100266966 3300005331 Bacteria 1492
20 Ga0068869_100011108 3300005334 Bacteria 5899
21 Ga0070680_100162499 3300005336 Bacteria 1877
22 Ga0070682_100005543 3300005337 Bacteria 7029
23 Ga0068868_100018795 3300005338 Bacteria 5170
24 Ga0068868_100252254 3300005338 Bacteria 1485
25 Ga0070660_100006525 3300005339 Bacteria 8094
26 Ga0070691_10030477 3300005341 Bacteria 2527
27 Ga0070661_100121025 3300005344 Bacteria 1961
28 Ga0070668_100057426 3300005347 Bacteria 3007
29 Ga0070669_100222214 3300005353 Bacteria 1494
30 Ga0070673_100078954 3300005364 Bacteria 2663
31 Ga0070659_100188558 3300005366 Bacteria 1694
32 Ga0070709_10000431 3300005434 Bacteria 25383
33 Ga0070709_10003284 3300005434 Bacteria 8697
34 Ga0070714_100045563 3300005435 Bacteria 3717
35 Ga0070713_100001721 3300005436 Bacteria 14092
36 Ga0070713_100106690 3300005436 Bacteria 2435
37 Ga0070710_10002809 3300005437 Bacteria 8299
38 Ga0070710_10006341 3300005437 Bacteria 5676
39 Ga0070711_100008795 3300005439 Bacteria 6196
40 Ga0070711_100014959 3300005439 Bacteria 4902
41 Ga0070708_100121134 3300005445 Bacteria 2413
42 Ga0070663_100087297 3300005455 Bacteria 2305
43 Ga0070678_100009616 3300005456 Bacteria 5870
44 Ga0070678_100063165 3300005456 Bacteria 2738
45 Ga0070681_10013583 3300005458 Bacteria 8102
46 Ga0070681_10099637 3300005458 Bacteria 2851
47 Ga0068867_100165393 3300005459 Bacteria 1748
48 Ga0070707_100133263 3300005468 Bacteria 2417
49 Ga0070698_100066098 3300005471 Bacteria 3640
50 Ga0070679_100003512 3300005530 Bacteria 14359
51 Ga0070679_100058123 3300005530 Bacteria 3854
52 Ga0070684_100017018 3300005535 Bacteria 5958
53 Ga0070684_100056264 3300005535 Bacteria 3432
54 Ga0070684_100149286 3300005535 Bacteria 2117
55 Ga0068853_100015346 3300005539 Bacteria 6295
56 Ga0068853_100018955 3300005539 Bacteria 5699
57 Ga0070672_100066915 3300005543 Bacteria 2845
58 Ga0070672_100140484 3300005543 Bacteria 1992
59 Ga0070693_100011838 3300005547 Bacteria 4401
60 Ga0070693_100060480 3300005547 Bacteria 2199
61 Ga0070665_100013416 3300005548 Bacteria 8245
62 Ga0070665_100085138 3300005548 Bacteria 3166
63 Ga0070665_100104399 3300005548 Bacteria 2836
64 Ga0070665_100108350 3300005548 Bacteria 2780
65 Ga0068855_100012484 3300005563 Bacteria 10253
66 Ga0068855_100013959 3300005563 Bacteria 9685
67 Ga0068855_100067026 3300005563 Bacteria 4184
68 Ga0068855_100334602 3300005563 Bacteria 1671
69 Ga0070664_100033848 3300005564 Bacteria 4284
70 Ga0070664_100171422 3300005564 Bacteria 1925
71 Ga0068857_100023185 3300005577 Bacteria 5462
72 Ga0068854_100046236 3300005578 Bacteria 3098
73 Ga0068854_100049966 3300005578 Bacteria 2990
74 Ga0068854_100202305 3300005578 Bacteria 1562
75 Ga0068856_100001907 3300005614 Bacteria 21736
76 Ga0068856_100005219 3300005614 Bacteria 12817
77 Ga0068856_100021414 3300005614 Bacteria 6285
78 Ga0068856_100233861 3300005614 Bacteria 1853
79 Ga0068852_100016271 3300005616 Bacteria 5794
80 Ga0068852_100025493 3300005616 Bacteria 4791
81 Ga0068852_100048809 3300005616 Bacteria 3619
82 Ga0068864_100025431 3300005618 Bacteria 4985
83 Ga0068866_10071860 3300005718 Bacteria 1831
84 Ga0068861_100308018 3300005719 Bacteria 1374
85 Ga0068851_10002991 3300005834 Bacteria 7467
86 Ga0068851_10091855 3300005834 Bacteria 1599
87 Ga0068858_100152170 3300005842 Bacteria 2176
88 Ga0068860_100000240 3300005843 Bacteria 83866
89 Ga0068860_100102392 3300005843 Bacteria 2732
90 Ga0068860_100137338 3300005843 Bacteria 2348
91 Ga0068860_100152239 3300005843 Bacteria 2227
92 Ga0081455_10003365 3300005937 Bacteria 18435
93 Ga0081455_10014665 3300005937 Bacteria 7662
94 Ga0081455_10020871 3300005937 Bacteria 6156
95 Ga0081455_10037951 3300005937 Bacteria 4269
96 Ga0081455_10141774 3300005937 Bacteria 1866
97 Ga0081540_1000978 3300005983 Bacteria 25763
98 Ga0081540_1001241 3300005983 Bacteria 22259
99 Ga0081540_1001715 3300005983 Bacteria 18546
100 Ga0081540_1002512 3300005983 Bacteria 14912
101 Ga0081540_1006586 3300005983 Bacteria 8430
102 Ga0081540_1021387 3300005983 Bacteria 3854
103 Ga0081540_1037358 3300005983 Bacteria 2576
104 Ga0081539_10000255 3300005985 Bacteria 123054
105 Ga0081539_10000726 3300005985 Bacteria 66051
106 Ga0081539_10020566 3300005985 Bacteria 4454
107 Ga0081539_10039627 3300005985 Bacteria 2777
108 Ga0070717_10002854 3300006028 Bacteria 12254
109 Ga0070717_10004642 3300006028 Bacteria 9960
110 Ga0070717_10036271 3300006028 Bacteria 3998
111 Ga0075365_10152551 3300006038 Bacteria 1607
112 Ga0075368_10012243 3300006042 Bacteria 3133
113 Ga0075363_100028621 3300006048 Bacteria 2868
114 Ga0075363_100032211 3300006048 Bacteria 2721
115 Ga0075364_10031725 3300006051 Bacteria 3394
116 Ga0075364_10102033 3300006051 Bacteria 1910
117 Ga0070715_10003359 3300006163 Bacteria 5073
118 Ga0070716_100005655 3300006173 Bacteria 6071
119 Ga0070716_100014652 3300006173 Bacteria 4020
120 Ga0070712_100022313 3300006175 Bacteria 4169
121 Ga0070712_100039641 3300006175 Bacteria 3224
122 Ga0075367_10004792 3300006178 Bacteria 6653
123 Ga0075367_10024756 3300006178 Bacteria 3386
124 Ga0075367_10134631 3300006178 Bacteria 1528
125 Ga0075369_10023402 3300006186 Bacteria 2553
126 Ga0075369_10029967 3300006186 Bacteria 2290
127 Ga0075369_10033346 3300006186 Bacteria 2182
128 Ga0075366_10008198 3300006195 Bacteria 5796
129 Ga0075366_10040984 3300006195 Bacteria 2740
130 Ga0097621_100102410 3300006237 Bacteria 2410
131 Ga0097621_100153517 3300006237 Bacteria 1975
132 Ga0097621_100204045 3300006237 Bacteria 1717
133 Ga0075370_10042995 3300006353 Bacteria 2553
134 Ga0075370_10062976 3300006353 Bacteria 2113
135 Ga0075370_10104790 3300006353 Bacteria 1639
136 Ga0075428_100104263 3300006844 Bacteria 3092
137 Ga0068865_100024561 3300006881 Bacteria 3955
138 Ga0068865_100136298 3300006881 Bacteria 1845
139 Ga0099825_1026880 3300006941 Bacteria 3005
140 Ga0099824_1016459 3300006942 Bacteria 6695
141 Ga0099822_1002963 3300006943 Bacteria 21553
142 Ga0099823_1013686 3300006944 Bacteria 8147
143 Ga0075435_100129072 3300007076 Bacteria 2114
144 Ga0105250_10060242 3300009092 Bacteria 1525
145 Ga0105240_10006290 3300009093 Bacteria 17471
146 Ga0105240_10025799 3300009093 Bacteria 7718
147 Ga0105240_10032117 3300009093 Bacteria 6799
148 Ga0105240_10157997 3300009093 Bacteria 2695
149 Ga0105245_10013251 3300009098 Bacteria 7185
150 Ga0105245_10046289 3300009098 Bacteria 3887
151 Ga0105245_10057995 3300009098 Bacteria 3484
152 Ga0105245_10148087 3300009098 Bacteria 2217
153 Ga0105245_10149348 3300009098 Bacteria 2208
154 Ga0105247_10025838 3300009101 Bacteria 3544
155 Ga0105247_10029784 3300009101 Bacteria 3309
156 Ga0105247_10084184 3300009101 Bacteria 2009
157 Ga0105247_10098494 3300009101 Bacteria 1866
158 Ga0105241_10000872 3300009174 Bacteria 22829
159 Ga0105241_10057806 3300009174 Bacteria 2977
160 Ga0105241_10259872 3300009174 Bacteria 1475
161 Ga0105241_10299934 3300009174 Bacteria 1379
162 Ga0105242_10105461 3300009176 Bacteria 2394
163 Ga0105242_10194172 3300009176 Bacteria 1799
164 Ga0105237_10003947 3300009545 Bacteria 17368
165 Ga0105237_10026955 3300009545 Bacteria 5870
166 Ga0105237_10027826 3300009545 Bacteria 5761
167 Ga0105237_10030267 3300009545 Bacteria 5500
168 Ga0105237_10034577 3300009545 Bacteria 5117
169 Ga0105237_10048829 3300009545 Bacteria 4254
170 Ga0105237_10196643 3300009545 Bacteria 2016
171 Ga0105237_10245323 3300009545 Bacteria 1793
172 Ga0105238_10007520 3300009551 Bacteria 10911
173 Ga0105238_10012425 3300009551 Bacteria 8588
174 Ga0105238_10026555 3300009551 Bacteria 5904
175 Ga0105238_10049128 3300009551 Bacteria 4250
176 Ga0105238_10055335 3300009551 Bacteria 3983
177 Ga0105249_10355872 3300009553 Bacteria 1484
178 Ga0105249_10445100 3300009553 Bacteria 1333
179 Ga0105239_10008436 3300010375 Bacteria 11728
180 Ga0105239_10014132 3300010375 Bacteria 8860
181 Ga0105239_10014787 3300010375 Bacteria 8656
182 Ga0105239_10015059 3300010375 Bacteria 8573
183 Ga0105239_10049080 3300010375 Bacteria 4628
184 Ga0105239_10067898 3300010375 Bacteria 3918
185 Ga0105239_10082749 3300010375 Bacteria 3535
186 Ga0105239_10086236 3300010375 Bacteria 3460
187 Ga0105239_10333935 3300010375 Bacteria 1710
188 Ga0105239_10369734 3300010375 Bacteria 1620
189 Ga0105246_10036888 3300011119 Bacteria 3277
190 Ga0105246_10056886 3300011119 Bacteria 2705
191 Ga0157371_10023274 3300013102 Bacteria 4530
192 Ga0157370_10025179 3300013104 Bacteria 5890
193 Ga0157370_10036670 3300013104 Bacteria 4756
194 Ga0157370_10072684 3300013104 Bacteria 3245
195 Ga0157369_10009653 3300013105 Bacteria 11037
196 Ga0157369_10037411 3300013105 Bacteria 5313
197 Ga0157369_10114976 3300013105 Bacteria 2857
198 Ga0157369_10258860 3300013105 Bacteria 1815
199 Ga0157378_10014368 3300013297 Bacteria 6931
200 Ga0163162_10535819 3300013306 Bacteria 1300
201 Ga0157375_10056472 3300013308 Bacteria 3876
202 Ga0163163_10013717 3300014325 Bacteria 7426
203 Ga0163163_10173620 3300014325 Bacteria 2202
204 Ga0163163_10278843 3300014325 Bacteria 1723
205 Ga0157380_10134712 3300014326 Bacteria 2113
206 Ga0157380_10161391 3300014326 Bacteria 1948
207 Ga0157379_10175992 3300014968 Bacteria 1932
208 Ga0157379_10231584 3300014968 Bacteria 1674
209 Ga0157376_10021228 3300014969 Bacteria 5042
210 Ga0157376_10068292 3300014969 Bacteria 3010
211 Ga0157376_10094649 3300014969 Bacteria 2596
212 Ga0214544_1000020 3300021320 Bacteria 178560
213 Ga0214542_1000024 3300021321 Bacteria 191218
214 Ga0214545_1000011 3300021324 Bacteria 190550
215 Ga0214543_1000033 3300021327 Bacteria 190419
216 Ga0213876_10023374 3300021384 Bacteria 3265
217 Ga0209677_102267 3300025253 Bacteria 7435
218 Ga0209148_1000574 3300025254 Bacteria 34124
219 Ga0209233_1010953 3300025261 Bacteria 2690
220 Ga0209455_1004011 3300025272 Bacteria 4983
221 Ga0209564_1000164 3300025295 Bacteria 160675
222 Ga0209564_1003632 3300025295 Bacteria 10245
223 Ga0209564_1004939 3300025295 Bacteria 7883
224 Ga0209758_1000065 3300025297 Bacteria 306288
225 Ga0209758_1000498 3300025297 Bacteria 64011
226 Ga0209758_1002030 3300025297 Bacteria 21763
227 Ga0209758_1003889 3300025297 Bacteria 13063
228 Ga0209758_1005790 3300025297 Bacteria 9267
229 Ga0209758_1014715 3300025297 Bacteria 4132
230 Ga0209758_1016433 3300025297 Bacteria 3759
231 Ga0209758_1018995 3300025297 Bacteria 3338
232 Ga0209256_1006613 3300025299 Bacteria 6057
233 Ga0207426_1000721 3300025302 Bacteria 38161
234 Ga0207426_1013877 3300025302 Bacteria 2969
235 Ga0209257_1001031 3300025304 Bacteria 37368
236 Ga0209257_1024026 3300025304 Bacteria 2123
237 Ga0207653_10011889 3300025885 Bacteria 2714
238 Ga0207692_10001280 3300025898 Bacteria 9333
239 Ga0207692_10002139 3300025898 Bacteria 7544
240 Ga0207692_10007388 3300025898 Bacteria 4506
241 Ga0207680_10083113 3300025903 Bacteria 2017
242 Ga0207647_10000486 3300025904 Bacteria 31906
243 Ga0207647_10003213 3300025904 Bacteria 12258
244 Ga0207699_10002307 3300025906 Bacteria 9018
245 Ga0207699_10032744 3300025906 Bacteria 2931
246 Ga0207645_10144063 3300025907 Bacteria 1553
247 Ga0207684_10036712 3300025910 Bacteria 4159
248 Ga0207654_10127702 3300025911 Bacteria 1605
249 Ga0207654_10158427 3300025911 Bacteria 1460
250 Ga0207707_10002451 3300025912 Bacteria 16695
251 Ga0207707_10007228 3300025912 Bacteria 9663
252 Ga0207707_10101122 3300025912 Bacteria 2519
253 Ga0207707_10114364 3300025912 Bacteria 2358
254 Ga0207695_10000029 3300025913 Bacteria 548364
255 Ga0207695_10001543 3300025913 Bacteria 37956
256 Ga0207695_10121382 3300025913 Bacteria 2581
257 Ga0207671_10002273 3300025914 Bacteria 20786
258 Ga0207671_10032059 3300025914 Bacteria 3912
259 Ga0207671_10086745 3300025914 Bacteria 2353
260 Ga0207671_10112844 3300025914 Bacteria 2070
261 Ga0207693_10000723 3300025915 Bacteria 29753
262 Ga0207693_10005552 3300025915 Bacteria 10494
263 Ga0207693_10125323 3300025915 Bacteria 2018
264 Ga0207663_10005442 3300025916 Bacteria 6415
265 Ga0207663_10032760 3300025916 Bacteria 3088
266 Ga0207663_10075087 3300025916 Bacteria 2193
267 Ga0207660_10006133 3300025917 Bacteria 7800
268 Ga0207660_10037939 3300025917 Bacteria 3360
269 Ga0207660_10047545 3300025917 Bacteria 3034
270 Ga0207657_10005831 3300025919 Bacteria 12831
271 Ga0207657_10038250 3300025919 Bacteria 4274
272 Ga0207649_10090500 3300025920 Bacteria 2002
273 Ga0207652_10016568 3300025921 Bacteria 6019
274 Ga0207652_10037786 3300025921 Bacteria 4088
275 Ga0207652_10047929 3300025921 Bacteria 3651
276 Ga0207652_10143237 3300025921 Bacteria 2138
277 Ga0207681_10130378 3300025923 Bacteria 1858
278 Ga0207681_10225714 3300025923 Bacteria 1451
279 Ga0207694_10010545 3300025924 Bacteria 6971
280 Ga0207694_10013338 3300025924 Bacteria 6188
281 Ga0207694_10038644 3300025924 Bacteria 3670
282 Ga0207694_10043322 3300025924 Bacteria 3474
283 Ga0207694_10160495 3300025924 Bacteria 1816
284 Ga0207694_10179544 3300025924 Bacteria 1716
285 Ga0207687_10024884 3300025927 Bacteria 4003
286 Ga0207687_10061979 3300025927 Bacteria 2643
287 Ga0207687_10102693 3300025927 Bacteria 2107
288 Ga0207700_10006043 3300025928 Bacteria 7289
289 Ga0207700_10020115 3300025928 Bacteria 4525
290 Ga0207700_10074252 3300025928 Bacteria 2630
291 Ga0207700_10146908 3300025928 Bacteria 1944
292 Ga0207664_10024588 3300025929 Bacteria 4528
293 Ga0207664_10125955 3300025929 Bacteria 2150
294 Ga0207644_10106156 3300025931 Bacteria 2117
295 Ga0207690_10090776 3300025932 Bacteria 2157
296 Ga0207706_10012522 3300025933 Bacteria 7726
297 Ga0207706_10101580 3300025933 Bacteria 2530
298 Ga0207686_10049584 3300025934 Bacteria 2607
299 Ga0207665_10000064 3300025939 Bacteria 68931
300 Ga0207665_10009565 3300025939 Bacteria 6366
301 Ga0207665_10022510 3300025939 Bacteria 4146
302 Ga0207665_10235094 3300025939 Bacteria 1348
303 Ga0207691_10167185 3300025940 Bacteria 1927
304 Ga0207711_10085541 3300025941 Bacteria 2763
305 Ga0207711_10179037 3300025941 Bacteria 1927
306 Ga0207689_10008007 3300025942 Bacteria 9225
307 Ga0207661_10002727 3300025944 Bacteria 12148
308 Ga0207661_10088353 3300025944 Bacteria 2576
309 Ga0207679_10064328 3300025945 Bacteria 2741
310 Ga0207667_10011808 3300025949 Bacteria 10119
311 Ga0207667_10013789 3300025949 Bacteria 9234
312 Ga0207667_10021994 3300025949 Bacteria 7057
313 Ga0207667_10060535 3300025949 Bacteria 3963
314 Ga0207667_10110436 3300025949 Bacteria 2836
315 Ga0207667_10256447 3300025949 Bacteria 1789
316 Ga0207712_10023761 3300025961 Bacteria 4051
317 Ga0207640_10018060 3300025981 Bacteria 4139
318 Ga0207640_10054955 3300025981 Bacteria 2605
319 Ga0207640_10126305 3300025981 Bacteria 1842
320 Ga0207640_10160943 3300025981 Bacteria 1661
321 Ga0207703_10036553 3300026035 Bacteria 3910
322 Ga0207703_10051235 3300026035 Bacteria 3344
323 Ga0207703_10058266 3300026035 Bacteria 3152
324 Ga0207703_10103579 3300026035 Bacteria 2416
325 Ga0207703_10283850 3300026035 Bacteria 1505
326 Ga0207639_10006484 3300026041 Bacteria 7956
327 Ga0207639_10029262 3300026041 Bacteria 4031
328 Ga0207639_10063595 3300026041 Bacteria 2858
329 Ga0207678_10017845 3300026067 Bacteria 6232
330 Ga0207678_10021989 3300026067 Bacteria 5590
331 Ga0207678_10047437 3300026067 Bacteria 3715
332 Ga0207678_10054204 3300026067 Bacteria 3453
333 Ga0207678_10071473 3300026067 Bacteria 2975
334 Ga0207678_10114723 3300026067 Bacteria 2298
335 Ga0207708_10154231 3300026075 Bacteria 1810
336 Ga0207702_10000005 3300026078 Bacteria 420296
337 Ga0207702_10000403 3300026078 Bacteria 49280
338 Ga0207702_10184601 3300026078 Bacteria 1923
339 Ga0207702_10185846 3300026078 Bacteria 1916
340 Ga0207702_10290808 3300026078 Bacteria 1548
341 Ga0207676_10034015 3300026095 Bacteria 3856
342 Ga0207676_10128855 3300026095 Bacteria 2148
343 Ga0207674_10007797 3300026116 Bacteria 12452
344 Ga0207674_10009659 3300026116 Bacteria 11000
345 Ga0207674_10012698 3300026116 Bacteria 9412
346 Ga0207674_10022025 3300026116 Bacteria 6853
347 Ga0207674_10094786 3300026116 Bacteria 2971
348 Ga0207675_100240003 3300026118 Bacteria 1751
349 Ga0207683_10015940 3300026121 Bacteria 6396
350 Ga0207683_10265774 3300026121 Bacteria 1567
351 Ga0207698_10103212 3300026142 Bacteria 2369
352 Ga0207698_10188496 3300026142 Bacteria 1834
353 Ga0207698_10279093 3300026142 Bacteria 1544
354 Ga0209389_1000011 3300027296 Bacteria 223265
355 Ga0209389_1000025 3300027296 Bacteria 149588
356 Ga0209589_1000018 3300027357 Bacteria 192614
357 Ga0209589_1000066 3300027357 Bacteria 100795
358 Ga0209489_100017 3300027361 Bacteria 223265
359 Ga0209489_100026 3300027361 Bacteria 192614
360 Ga0209489_100030 3300027361 Bacteria 185999
361 Ga0209700_100027 3300027363 Bacteria 223462
362 Ga0209700_100035 3300027363 Bacteria 192614
363 Ga0209813_10033936 3300027866 Bacteria 1520
364 Ga0207428_10090372 3300027907 Bacteria 2379
365 Ga0268266_10003137 3300028379 Bacteria 16797
366 Ga0268266_10003952 3300028379 Bacteria 14394
367 Ga0268266_10013301 3300028379 Bacteria 7093
368 Ga0268266_10032383 3300028379 Bacteria 4442
369 Ga0268266_10034331 3300028379 Bacteria 4314
370 Ga0268266_10406073 3300028379 Bacteria 1289
371 Ga0268265_10040545 3300028380 Bacteria 3439
372 Ga0268265_10343121 3300028380 Bacteria 1361
373 Ga0268264_10000035 3300028381 Bacteria 398196
374 Ga0268264_10187409 3300028381 Bacteria 1883
375 Ga0265337_1031546 3300028556 Bacteria 1573
376 Ga0265334_10034157 3300028573 Bacteria 2019
377 Ga0265318_10006322 3300028577 Bacteria 5469
378 Ga0265323_10002189 3300028653 Bacteria 9111
379 Ga0265336_10006616 3300028666 Bacteria 4163
380 Ga0307517_10003575 3300028786 Bacteria 24130
381 Ga0307515_10066798 3300028794 Bacteria 4973
382 Ga0265338_10002444 3300028800 Bacteria 27875
383 Ga0265338_10013740 3300028800 Bacteria 9104
384 Ga0265332_10025251 3300031238 Bacteria 2611
385 Ga0265320_10000034 3300031240 Bacteria 141117
386 Ga0265320_10091814 3300031240 Bacteria 1406
387 Ga0265325_10003020 3300031241 Bacteria 11153
388 Ga0265340_10020095 3300031247 Bacteria 3437
389 Ga0265340_10096641 3300031247 Bacteria 1376
390 Ga0265339_10001392 3300031249 Bacteria 18003
391 Ga0265339_10064560 3300031249 Bacteria 1964
392 Ga0265331_10070024 3300031250 Bacteria 1642
393 Ga0265313_10000665 3300031595 Bacteria 35397
394 Ga0307508_10000650 3300031616 Bacteria 41770
395 Ga0307508_10004051 3300031616 Bacteria 14501
396 Ga0307508_10101377 3300031616 Bacteria 2474
397 Ga0307508_10230392 3300031616 Unclassified 1451
398 Ga0265314_10003187 3300031711 Bacteria 16061
399 Ga0265314_10057962 3300031711 Bacteria 2656
400 Ga0265342_10058050 3300031712 Bacteria 2288
401 Ga0307516_10031887 3300031730 Bacteria 5311
402 Ga0307516_10052030 3300031730 Bacteria 4012
403 Ga0307516_10090567 3300031730 Bacteria 2887
404 Ga0307405_10054277 3300031731 Bacteria 2501
405 Ga0307412_10261115 3300031911 Bacteria 1350
406 Ga0307409_100067780 3300031995 Bacteria 2819
407 Ga0307416_100076218 3300032002 Bacteria 2810
408 Ga0307415_100070517 3300032126 Bacteria 2454
409 Ga0307507_10053828 3300033179 Bacteria 3839
410 Ga0307510_10025336 3300033180 Bacteria 6841
411 Ga0307510_10032671 3300033180 Bacteria 5860
412 Ga0307510_10087718 3300033180 Bacteria 2975
413 Ga0307510_10088432 3300033180 Bacteria 2957
414 Ga0315911_1000011 3300033442 Bacteria 264678
415 Ga0373926_0006551 3300035083 Bacteria 3866
416 Ga0373926_0074259 3300035083 Bacteria 1252
417 Ga0373934_0035810 3300035086 Bacteria 1954
418 Ga0373934_0041741 3300035086 Bacteria 1811
419 Ga0373940_0006754 3300035088 Bacteria 2563
420 Ga0373923_0036370 3300035111 Bacteria 2009
421 Ga0373936_0020740 3300035113 Bacteria 2554
422 Ga0373945_0030570 3300035116 Bacteria 1899
423 Ga0373953_0002754 3300035117 Bacteria 5340
424 Ga0373954_0008277 3300035118 Bacteria 4561
425 Ga0373954_0043259 3300035118 Bacteria 2100
426 Ga0373956_0004160 3300035119 Bacteria 5803
427 Ga0373956_0011086 3300035119 Bacteria 3711
428 Ga0373956_0039813 3300035119 Bacteria 2084
429 Ga0373957_0002175 3300035120 Bacteria 5534
430 Ga0373960_0044337 3300035121 Bacteria 1299
431 Ga0373946_0037289 3300035171 Bacteria 1974
432 Ga0373955_0000510 3300035172 Bacteria 16513
433 Ga0373955_0013167 3300035172 Bacteria 3990
434 Ga0373955_0014368 3300035172 Bacteria 3850
435 Ga0373955_0030619 3300035172 Bacteria 2811
436 Ga0373924_0011441 3300035410 Bacteria 3296
437 Ga0373924_0038476 3300035410 Bacteria 1951
438 Ga0373924_0070339 3300035410 Bacteria 1475
439 Ga0373931_0002710 3300035691 Bacteria 7877
440 Ga0373931_0072073 3300035691 Bacteria 1888
441 Ga0373935_0007256 3300035692 Bacteria 6624
442 Ga0373935_0027681 3300035692 Bacteria 3504
443 Ga0373935_0072367 3300035692 Bacteria 2225
444 Ga0373927_0001621 3300035695 Bacteria 16865
445 Ga0373927_0060511 3300035695 Bacteria 2450
446 Ga0373927_0065019 3300035695 Bacteria 2359
447 Ga0373933_0000405 3300035724 Bacteria 27323
448 Ga0373933_0006367 3300035724 Bacteria 6424
449 Ga0373933_0077991 3300035724 Bacteria 2026
450 Ga0373933_0122504 3300035724 Bacteria 1629
451 Ga0373947_0001795 3300035725 Bacteria 13125
452 Ga0373947_0002633 3300035725 Bacteria 10777
453 Ga0373947_0015294 3300035725 Bacteria 4404
454 Ga0373947_0150035 3300035725 Bacteria 1501
455 Ga0373937_0023676 3300036401 Bacteria 5534
456 Ga0373937_0043679 3300036401 Bacteria 4093
457 Ga0373937_0107071 3300036401 Bacteria 2599
458 Ga0373937_0112028 3300036401 Bacteria 2538
459 Ga0373937_0138283 3300036401 Bacteria 2278
460 Ga0372808_001316 3300036459 Bacteria 2522
461 Ga0373925_0006728 3300037068 Bacteria 8428
462 Ga0373925_0028136 3300037068 Bacteria 4117
463 Ga0395899_0090148 3300037312 Bacteria 2223
464 Ga0395898_0070289 3300037466 Bacteria 3385
465 Ga0395898_0122783 3300037466 Bacteria 2489
466 Ga0395898_0183238 3300037466 Bacteria 2001
467 Ga0395905_0034044 3300037471 Bacteria 4784
468 Ga0436364_0662595 3300037853 Bacteria 1656
469 Ga0436364_1342884 3300037853 Bacteria 15035
470 Ga0395901_0007795 3300038443 Bacteria 10805
471 Ga0436365_0607645 3300039437 Bacteria 7674
472 Ga0436360_1294928 3300039438 Bacteria 3411
473 Ga0466972_0000648 3300044658 Bacteria 16770
474 Ga0466966_0000008 3300044684 Bacteria 155597
475 Ga0466966_0001391 3300044684 Bacteria 15558
476 Ga0466961_0000167 3300044693 Bacteria 44505
477 Ga0466963_0085348 3300044694 Bacteria 2143
478 Ga0466963_0234149 3300044694 Bacteria 1287
479 Ga0466964_0087931 3300044706 Bacteria 1347
480 Ga0466970_0030263 3300044765 Bacteria 2855
481 Ga0466957_0049313 3300044842 Bacteria 2560
482 Ga0466960_0001540 3300044901 Bacteria 8416
483 Ga0466959_0000257 3300045049 Bacteria 32605
484 Ga0466959_0018179 3300045049 Bacteria 5160
485 Ga0466959_0092799 3300045049 Bacteria 2167
486 Ga0466967_0148362 3300045976 Bacteria 2189
487 Ga0495617_019755 3300046452 Bacteria 2277
488 Ga0495592_0029930 3300046454 Bacteria 4118
489 Ga0495592_0035643 3300046454 Bacteria 3749
490 Ga0495592_0116152 3300046454 Bacteria 1889
491 Ga0495603_0000094 3300046455 Bacteria 40636
492 Ga0495603_0012995 3300046455 Bacteria 5033
493 Ga0495603_0018344 3300046455 Bacteria 4233
494 Ga0495629_0000612 3300046459 Bacteria 29083
495 Ga0495629_0004307 3300046459 Bacteria 10669
496 Ga0495629_0109103 3300046459 Bacteria 1930
497 Ga0495629_0121151 3300046459 Bacteria 1822
498 Ga0495638_0001554 3300046460 Bacteria 20587
499 Ga0495638_0035056 3300046460 Bacteria 3199
500 Ga0495638_0035929 3300046460 Bacteria 3156
501 Ga0495638_0077178 3300046460 Bacteria 2029
502 Ga0495641_0001895 3300046461 Bacteria 17085
503 Ga0495651_0036353 3300046462 Bacteria 3834
504 Ga0495651_0117906 3300046462 Bacteria 1953
505 Ga0495653_0000399 3300046463 Bacteria 34847
506 Ga0495653_0072447 3300046463 Bacteria 2572
507 Ga0495580_0002744 3300046472 Bacteria 15166
508 Ga0495582_0001055 3300046473 Bacteria 15486
509 Ga0495605_0065499 3300046474 Bacteria 1728
510 Ga0495639_0000114 3300046475 Bacteria 40307
511 Ga0495662_0000093 3300046476 Bacteria 32243
512 Ga0495664_0006628 3300046477 Bacteria 6403
513 Ga0495664_0033601 3300046477 Bacteria 3014
514 Ga0495585_0116110 3300046492 Bacteria 1419
515 Ga0495606_0006792 3300046507 Bacteria 10457
516 Ga0495608_0001226 3300046511 Bacteria 18178
517 Ga0495610_0008306 3300046512 Bacteria 6741
518 Ga0495610_0082184 3300046512 Bacteria 1477
519 Ga0495618_0027537 3300046514 Bacteria 3537
520 Ga0495618_0176291 3300046514 Bacteria 1359
521 Ga0495628_0082230 3300046516 Bacteria 2501
522 Ga0495628_0084487 3300046516 Bacteria 2463
523 Ga0495628_0112357 3300046516 Bacteria 2094
524 Ga0495628_0171772 3300046516 Bacteria 1643
525 Ga0495630_0000459 3300046517 Bacteria 30805
526 Ga0495630_0044428 3300046517 Bacteria 3320
527 Ga0495631_0022910 3300046518 Bacteria 2901
528 Ga0495643_0017992 3300046522 Bacteria 4116
529 Ga0495643_0022609 3300046522 Bacteria 3586
530 Ga0495644_0041560 3300046523 Bacteria 1731
531 Ga0495644_0064788 3300046523 Bacteria 1373
532 Ga0495648_0001784 3300046524 Bacteria 20695
533 Ga0495648_0057247 3300046524 Bacteria 2340
534 Ga0495648_0067160 3300046524 Bacteria 2098
535 Ga0495666_0099665 3300046526 Bacteria 1369
536 Ga0495642_0081062 3300046528 Bacteria 1366
537 Ga0495652_0027433 3300046529 Bacteria 5018
538 Ga0495652_0028960 3300046529 Bacteria 4865
539 Ga0495652_0111366 3300046529 Bacteria 2201
540 Ga0495665_0000613 3300046531 Bacteria 18131
541 Ga0495665_0024504 3300046531 Bacteria 3241
542 Ga0495640_0014863 3300046533 Bacteria 5872
543 Ga0495640_0015770 3300046533 Bacteria 5671
544 Ga0495640_0029758 3300046533 Bacteria 3916
545 Ga0495640_0030534 3300046533 Bacteria 3857
546 Ga0495640_0031782 3300046533 Bacteria 3766
547 Ga0495587_0001432 3300046536 Bacteria 15878
548 Ga0495609_0060286 3300046538 Bacteria 1678
549 Ga0495597_0059231 3300046542 Bacteria 1672
550 Ga0495645_0024571 3300046543 Bacteria 4373
551 Ga0495645_0074327 3300046543 Bacteria 2448
552 Ga0495622_0001333 3300046557 Bacteria 12627
553 Ga0495667_0001452 3300046559 Bacteria 15607
554 Ga0495667_0030262 3300046559 Bacteria 3640
555 Ga0495667_0120590 3300046559 Bacteria 1693
556 Ga0495656_0040131 3300046615 Bacteria 1949
557 Ga0495634_0001601 3300046642 Bacteria 19807
558 Ga0495634_0050455 3300046642 Bacteria 2794
559 Ga0495634_0056873 3300046642 Bacteria 2612
560 Ga0495634_0190415 3300046642 Bacteria 1280
561 Ga0495635_0000088 3300046663 Bacteria 54355
562 Ga0495635_0001000 3300046663 Bacteria 18675
563 Ga0495588_0009215 3300046674 Bacteria 4558
564 Ga0495588_0038624 3300046674 Bacteria 2429
565 Ga0495657_0001352 3300046675 Bacteria 21318
566 Ga0495657_0027054 3300046675 Bacteria 4053
567 Ga0495657_0141187 3300046675 Bacteria 1501
568 Ga0495599_0061777 3300046678 Bacteria 2340
569 Ga0495599_0065968 3300046678 Bacteria 2261
570 Ga0495623_0010431 3300046679 Bacteria 6014
571 Ga0495623_0084635 3300046679 Bacteria 1957
572 Ga0495646_0031727 3300046680 Bacteria 3291
573 Ga0495646_0101785 3300046680 Bacteria 1646
574 Ga0495646_0170019 3300046680 Bacteria 1202
575 Ga0495647_0000070 3300046681 Bacteria 24847
576 Ga0495658_0001004 3300046683 Bacteria 14900
577 Ga0495613_0003317 3300046689 Bacteria 12056
578 Ga0495613_0071654 3300046689 Bacteria 2526
579 Ga0495624_0003008 3300046690 Bacteria 12614
580 Ga0495624_0032884 3300046690 Bacteria 3361
581 Ga0495624_0058391 3300046690 Bacteria 2423
582 Ga0495671_0091306 3300046692 Bacteria 1490
583 Ga0495649_0058586 3300046694 Bacteria 2075
584 Ga0495600_0000484 3300046809 Bacteria 20528
585 Ga0495600_0006880 3300046809 Bacteria 6935
586 Ga0495600_0036737 3300046809 Bacteria 3183
587 Ga0495581_0000082 3300047315 Bacteria 38294
588 Ga0495604_0004387 3300047317 Bacteria 11167
589 Ga0495604_0011766 3300047317 Bacteria 6956
590 Ga0495604_0027775 3300047317 Bacteria 4500
591 Ga0495674_0005809 3300047319 Bacteria 11832
592 Ga0495674_0036094 3300047319 Bacteria 4452
593 Ga0495676_0021438 3300047321 Bacteria 5642
594 Ga0495680_0018227 3300047322 Bacteria 5968
595 Ga0495680_0028622 3300047322 Bacteria 4567
596 Ga0495687_026026 3300047443 Bacteria 2758
597 Ga0495675_0004649 3300047444 Bacteria 8340
598 Ga0495673_0007496 3300047469 Bacteria 6261
599 Ga0495684_0001326 3300047471 Bacteria 19921
600 Ga0495684_0009235 3300047471 Bacteria 7614
601 Ga0495684_0137230 3300047471 Bacteria 1835
602 Ga0495686_0010639 3300047472 Bacteria 6533
603 Ga0495686_0053042 3300047472 Bacteria 2542
604 Ga0495593_0000206 3300047673 Bacteria 31187
605 Ga0495593_0005786 3300047673 Bacteria 7290
606 Ga0495593_0027986 3300047673 Bacteria 3098
607 Ga0495602_0039586 3300048088 Bacteria 4338
608 Ga0495602_0145863 3300048088 Bacteria 1867
609 Ga0495614_0058901 3300048089 Bacteria 1649
610 Ga0496100_0033039 3300048903 Bacteria 3234
611 Ga0496100_0057827 3300048903 Bacteria 2542
612 Ga0496101_0005595 3300048904 Bacteria 8022
613 Ga0496101_0034967 3300048904 Bacteria 3552
614 Ga0496102_0021781 3300048905 Bacteria 5671
615 Ga0496102_0043876 3300048905 Bacteria 4056
616 Ga0496102_0181495 3300048905 Bacteria 1983
617 Ga0496103_0038793 3300048906 Bacteria 2925
618 Ga0496104_0010576 3300048907 Bacteria 8241
619 Ga0496104_0039497 3300048907 Bacteria 4418
620 Ga0496104_0045505 3300048907 Bacteria 4128
621 Ga0496104_0068809 3300048907 Bacteria 3364
622 Ga0496104_0086868 3300048907 Bacteria 2986
623 Ga0496104_0103275 3300048907 Bacteria 2730
624 Ga0496104_0178470 3300048907 Bacteria 2034
625 Ga0496105_0004214 3300048908 Bacteria 10803
626 Ga0496105_0031127 3300048908 Bacteria 4373
627 Ga0496105_0108332 3300048908 Bacteria 2293
628 Ga0496105_0289013 3300048908 Bacteria 1320
629 Ga0496106_0001874 3300048909 Bacteria 15739
630 Ga0496106_0037975 3300048909 Bacteria 3603
631 Ga0496107_0003415 3300048910 Bacteria 10621
632 Ga0496107_0026546 3300048910 Bacteria 4107
633 Ga0496108_0032155 3300048911 Bacteria 4357
634 Ga0496108_0064703 3300048911 Bacteria 3081
635 Ga0496108_0094889 3300048911 Bacteria 2539
636 Ga0496109_0000767 3300048912 Bacteria 26714
637 Ga0496109_0037794 3300048912 Bacteria 4363
638 Ga0496109_0060890 3300048912 Bacteria 3450
639 Ga0496109_0127133 3300048912 Bacteria 2377
640 Ga0496110_0020114 3300048913 Bacteria 5631
641 Ga0496110_0035417 3300048913 Bacteria 4330
642 Ga0496110_0061946 3300048913 Bacteria 3303
643 Ga0496110_0266253 3300048913 Bacteria 1560
644 Ga0496110_0426339 3300048913 Bacteria 1209
645 Ga0496111_0016531 3300048914 Bacteria 5086
646 Ga0496111_0100497 3300048914 Bacteria 2124
647 Ga0496112_0000016 3300048915 Bacteria 194634
648 Ga0496112_0016187 3300048915 Bacteria 6978
649 Ga0496112_0031588 3300048915 Bacteria 5138
650 Ga0496112_0050257 3300048915 Bacteria 4088
651 Ga0496112_0061112 3300048915 Bacteria 3713
652 Ga0496112_0090064 3300048915 Bacteria 3036
653 Ga0496112_0120152 3300048915 Bacteria 2597
654 Ga0496113_0010421 3300048916 Bacteria 6145
655 Ga0496113_0078007 3300048916 Bacteria 2534
656 Ga0496113_0158758 3300048916 Bacteria 1787
657 Ga0496114_0029797 3300048917 Bacteria 4486
658 Ga0496114_0081236 3300048917 Bacteria 2738
659 Ga0496115_0001214 3300048918 Bacteria 18485
660 Ga0496115_0028522 3300048918 Bacteria 4376
661 Ga0496115_0063304 3300048918 Bacteria 2984
662 Ga0496115_0115411 3300048918 Bacteria 2208
663 Ga0496116_0000887 3300048919 Bacteria 37313
664 Ga0496116_0079774 3300048919 Bacteria 2035
665 Ga0496117_0010525 3300048920 Bacteria 8412
666 Ga0496117_0041120 3300048920 Bacteria 3391
667 Ga0496118_0002852 3300048921 Bacteria 22557
668 Ga0496118_0117775 3300048921 Bacteria 1741
669 Ga0496119_0105327 3300048922 Bacteria 1576
670 Ga0496120_0014244 3300048923 Bacteria 5309
671 Ga0496120_0022800 3300048923 Bacteria 3934
672 Ga0496121_0000041 3300048924 Bacteria 346686
673 Ga0496121_0000744 3300048924 Bacteria 59867
674 Ga0496121_0002334 3300048924 Bacteria 29308
675 Ga0496121_0002685 3300048924 Bacteria 26602
676 Ga0496121_0013525 3300048924 Bacteria 8756
677 Ga0496121_0017799 3300048924 Bacteria 7219
678 Ga0496121_0076211 3300048924 Bacteria 2675
679 Ga0496121_0087108 3300048924 Bacteria 2452
680 Ga0496121_0243521 3300048924 Bacteria 1251
681 Ga0496122_0172992 3300048925 Bacteria 1298
682 Ga0496123_0012664 3300048926 Bacteria 7162
683 Ga0496123_0037135 3300048926 Bacteria 3444
684 Ga0496124_0099057 3300048927 Bacteria 2364
685 Ga0496125_0000092 3300048928 Bacteria 211050
686 Ga0496125_0009888 3300048928 Bacteria 9704
687 Ga0496125_0032161 3300048928 Bacteria 4664
688 Ga0496125_0050130 3300048928 Bacteria 3460
689 Ga0496126_0003893 3300048929 Bacteria 18354
690 Ga0496126_0004798 3300048929 Bacteria 15887
691 Ga0496126_0009161 3300048929 Bacteria 10564
692 Ga0496126_0009826 3300048929 Bacteria 10129
693 Ga0496126_0026815 3300048929 Bacteria 5516
694 Ga0496126_0063952 3300048929 Bacteria 3296
695 Ga0496126_0066024 3300048929 Bacteria 3236
696 Ga0496126_0131725 3300048929 Bacteria 2160
697 Ga0496126_0148217 3300048929 Bacteria 2013
698 Ga0496126_0213781 3300048929 Bacteria 1622
699 Ga0496126_0278204 3300048929 Bacteria 1387
700 Ga0495682_0016840 3300049460 Bacteria 2764
701 Ga0501031_0010093 3300049568 Bacteria 6154
702 Ga0501031_0126629 3300049568 Bacteria 1668
703 Ga0501032_0000107 3300049569 Bacteria 71122
704 Ga0501032_0000318 3300049569 Bacteria 40445
705 Ga0501032_0078193 3300049569 Bacteria 2202
706 Ga0501033_0000144 3300049570 Bacteria 68553
707 Ga0501033_0001175 3300049570 Bacteria 23612
708 Ga0501033_0010540 3300049570 Bacteria 7087
709 Ga0501033_0016116 3300049570 Bacteria 5658
710 Ga0501033_0041619 3300049570 Bacteria 3427
711 Ga0501033_0129906 3300049570 Bacteria 1825
712 Ga0501034_0000061 3300049571 Bacteria 195178
713 Ga0501034_0000412 3300049571 Bacteria 71925
714 Ga0501034_0107111 3300049571 Bacteria 2788
715 Ga0501034_0120666 3300049571 Bacteria 2608
716 Ga0501036_0000007 3300049572 Bacteria 240500
717 Ga0501036_0000387 3300049572 Bacteria 31150
718 Ga0501037_0000066 3300049573 Bacteria 96723
719 Ga0501037_0000104 3300049573 Bacteria 80204
720 Ga0501037_0000457 3300049573 Bacteria 33231
721 Ga0501037_0094501 3300049573 Bacteria 2162
722 Ga0501038_0002223 3300049574 Bacteria 18059
723 Ga0501038_0013623 3300049574 Bacteria 7409
724 Ga0501038_0023857 3300049574 Bacteria 5461
725 Ga0501038_0024872 3300049574 Bacteria 5337
726 Ga0501038_0088993 3300049574 Bacteria 2590
727 Ga0501038_0217028 3300049574 Bacteria 1528
728 Ga0501039_0000005 3300049575 Bacteria 295471
729 Ga0501039_0000536 3300049575 Bacteria 27529
730 Ga0501039_0005841 3300049575 Bacteria 9322
731 Ga0501039_0111908 3300049575 Bacteria 2134
732 Ga0501040_0042235 3300049576 Bacteria 3105
733 Ga0501042_0021996 3300049578 Bacteria 4451
734 Ga0501042_0066707 3300049578 Bacteria 2573
735 Ga0501042_0112695 3300049578 Bacteria 1958
736 Ga0501043_0000036 3300049579 Bacteria 132959
737 Ga0501043_0000161 3300049579 Bacteria 60738
738 Ga0501043_0037811 3300049579 Bacteria 3796
739 Ga0501046_0000032 3300049580 Bacteria 180265
740 Ga0501046_0008502 3300049580 Bacteria 8938
741 Ga0501047_0000077 3300049581 Bacteria 123480
742 Ga0501047_0000122 3300049581 Bacteria 95307
743 Ga0501047_0000815 3300049581 Bacteria 32451
744 Ga0501047_0004734 3300049581 Bacteria 12797
745 Ga0501047_0030093 3300049581 Bacteria 5234
746 Ga0501047_0083576 3300049581 Bacteria 3068
747 Ga0501047_0156510 3300049581 Bacteria 2152
748 Ga0501048_0000053 3300049582 Bacteria 57136
749 Ga0501048_0018667 3300049582 Bacteria 5098
750 Ga0501067_0000194 3300049583 Bacteria 34364
751 Ga0501067_0002271 3300049583 Bacteria 10608
752 Ga0501067_0005167 3300049583 Bacteria 7256
753 Ga0501067_0006064 3300049583 Bacteria 6701
754 Ga0501067_0018088 3300049583 Bacteria 3902
755 Ga0501068_0002401 3300049584 Bacteria 9949
756 Ga0501068_0022723 3300049584 Bacteria 3670
757 Ga0501069_0002581 3300049585 Bacteria 9247
758 Ga0501069_0003508 3300049585 Bacteria 8075
759 Ga0501069_0007163 3300049585 Bacteria 5846
760 Ga0501070_0000070 3300049586 Bacteria 86706
761 Ga0501070_0000659 3300049586 Bacteria 31835
762 Ga0501070_0011879 3300049586 Bacteria 7354
763 Ga0501070_0080943 3300049586 Bacteria 2687
764 Ga0501070_0127243 3300049586 Bacteria 2105
765 Ga0501071_0096680 3300049587 Bacteria 2174
766 Ga0501072_0000606 3300049588 Bacteria 25831
767 Ga0501072_0000739 3300049588 Bacteria 23844
768 Ga0501072_0030322 3300049588 Bacteria 4229
769 Ga0501073_0000233 3300049589 Bacteria 36619
770 Ga0501073_0001231 3300049589 Bacteria 18682
771 Ga0501073_0049354 3300049589 Bacteria 2951
772 Ga0501073_0070215 3300049589 Bacteria 2440
773 Ga0501074_0000656 3300049590 Bacteria 21579
774 Ga0501074_0001541 3300049590 Bacteria 15580
775 Ga0501074_0018352 3300049590 Bacteria 5081
776 Ga0501079_0027792 3300049741 Bacteria 4339
777 Ga0501080_0000132 3300049742 Bacteria 52967
778 Ga0501080_0025776 3300049742 Bacteria 5461
779 Ga0501080_0067266 3300049742 Bacteria 3332
780 Ga0501080_0170031 3300049742 Bacteria 2010
781 Ga0501083_0001610 3300049744 Bacteria 15439
782 Ga0501083_0027555 3300049744 Bacteria 3920
783 Ga0501035_0000016 3300049822 Bacteria 243412
784 Ga0501035_0000099 3300049822 Bacteria 108224
785 Ga0501035_0055062 3300049822 Bacteria 3552
786 Ga0501035_0055812 3300049822 Bacteria 3526
787 Ga0501035_0060678 3300049822 Bacteria 3366
788 Ga0501044_0000195 3300049823 Bacteria 76643
789 Ga0501044_0002688 3300049823 Bacteria 20220
790 Ga0501044_0006383 3300049823 Bacteria 13039
791 Ga0501044_0030002 3300049823 Bacteria 5733
792 Ga0501044_0058173 3300049823 Bacteria 3965
793 Ga0501044_0075919 3300049823 Bacteria 3412
794 Ga0501044_0076035 3300049823 Bacteria 3409
795 Ga0501044_0108470 3300049823 Bacteria 2786
796 Ga0501044_0324394 3300049823 Bacteria 1463
797 Ga0501044_0441821 3300049823 Bacteria 1208
798 Ga0501045_0034236 3300049824 Bacteria 3686
799 nmdc:mga03n38_103458_c1 3300050490 Bacteria 1377
800 nmdc:mga00v17_83601_c1 3300050491 Bacteria 1997
801 nmdc:mga0yw44_151082_c1 3300050492 Bacteria 1515
802 nmdc:mga0yw44_5535_c1 3300050492 Bacteria 5986
803 nmdc:mga0yw44_78912_c1 3300050492 Bacteria 2059
804 nmdc:mga0k408_95234_c1 3300050493 Bacteria 1752
805 nmdc:mga06z11_111691_c1 3300050494 Bacteria 1514
806 nmdc:mga07m45_137994_c1 3300050496 Bacteria 1412
807 nmdc:mga07m45_18120_c1 3300050496 Bacteria 3795
808 nmdc:mga07m45_67495_c1 3300050496 Bacteria 2033
809 nmdc:mga08y16_117307_c1 3300050511 Bacteria 2771
810 nmdc:mga0sz30_24073_c1 3300050516 Bacteria 2483
811 nmdc:mga0sz30_26276_c1 3300050516 Bacteria 2386
812 nmdc:mga0sz30_9477_c1 3300050516 Bacteria 3392
813 Ga0495601_0023544 3300053077 Bacteria 3785
814 Ga0495601_0131740 3300053077 Bacteria 1629
815 Ga0495612_0024682 3300053078 Bacteria 2413
816 Ga0495595_0007012 3300053084 Bacteria 4602
817 Ga0495619_0000332 3300053085 Bacteria 33066
818 Ga0495619_0020566 3300053085 Bacteria 4206
819 Ga0495619_0164996 3300053085 Bacteria 1530
820 Ga0500643_000019 3300053087 Bacteria 294301
821 Ga0500643_012081 3300053087 Bacteria 3110
822 Ga0500647_0069839 3300053091 Bacteria 1689
823 Ga0500647_0103879 3300053091 Bacteria 1355
824 Ga0500651_0011482 3300053093 Bacteria 5342
825 Ga0500651_0073718 3300053093 Bacteria 2122
826 Ga0500566_0000537 3300053094 Bacteria 21255
827 Ga0500566_0000601 3300053094 Bacteria 20208
828 Ga0500566_0001951 3300053094 Bacteria 12138
829 Ga0500640_002416 3300053095 Bacteria 6166
830 Ga0500640_012322 3300053095 Bacteria 3510
831 Ga0500648_052555 3300053097 Bacteria 2311
832 Ga0500650_0001416 3300053098 Bacteria 7218
833 Ga0500650_0103427 3300053098 Bacteria 1332
834 Ga0500555_001381 3300053103 Bacteria 7493
835 Ga0500556_0000024 3300053104 Bacteria 167556
836 Ga0500557_000090 3300053105 Bacteria 31022
837 Ga0500572_000758 3300053111 Bacteria 10364
838 Ga0500572_001291 3300053111 Bacteria 7010
839 Ga0500572_010449 3300053111 Bacteria 2220
840 Ga0500592_000902 3300053116 Bacteria 4851
841 Ga0500595_000286 3300053119 Bacteria 33353
842 Ga0500595_000540 3300053119 Bacteria 22705
843 Ga0500595_005782 3300053119 Bacteria 5341
844 Ga0500595_006869 3300053119 Bacteria 4785
845 Ga0500595_011713 3300053119 Bacteria 3418
846 Ga0500595_025451 3300053119 Bacteria 2051
847 Ga0500608_006275 3300053122 Bacteria 4825
848 Ga0500614_001807 3300053123 Bacteria 4956
849 Ga0500618_024391 3300053125 Bacteria 1457
850 Ga0500642_0000035 3300053130 Bacteria 106656
851 Ga0500642_0000203 3300053130 Bacteria 24329
852 Ga0500652_000134 3300053131 Bacteria 27819
853 Ga0500559_0001329 3300053136 Bacteria 14235
854 Ga0500559_0001730 3300053136 Bacteria 11975
855 Ga0500559_0006207 3300053136 Bacteria 5410
856 Ga0500559_0015073 3300053136 Bacteria 3267
857 Ga0500559_0044324 3300053136 Bacteria 1945
858 Ga0500564_049740 3300053138 Bacteria 1919
859 Ga0500568_0002132 3300053139 Bacteria 11939
860 Ga0500568_0009922 3300053139 Bacteria 4495
861 Ga0500568_0029518 3300053139 Bacteria 2275
862 Ga0500573_0121613 3300053140 Bacteria 1452
863 Ga0500590_071244 3300053148 Bacteria 1726
864 Ga0500603_000817 3300053150 Bacteria 7433
865 Ga0500603_002275 3300053150 Bacteria 4223
866 Ga0500603_005730 3300053150 Bacteria 2683
867 Ga0500603_010343 3300053150 Bacteria 2105
868 Ga0500604_0020517 3300053151 Bacteria 1861
869 Ga0500616_0000084 3300053153 Bacteria 195562
870 Ga0500616_0000122 3300053153 Bacteria 140228
871 Ga0500620_003161 3300053155 Bacteria 3475
872 Ga0500622_0001260 3300053156 Bacteria 20664
873 Ga0500627_0025661 3300053158 Bacteria 2424
874 Ga0500630_001904 3300053159 Bacteria 10017
875 Ga0500634_0087688 3300053161 Bacteria 1588
876 Ga0500638_000361 3300053162 Bacteria 10532
877 Ga0500638_077418 3300053162 Bacteria 1583
878 Ga0500639_000166 3300053163 Bacteria 32001
879 Ga0500639_017659 3300053163 Bacteria 3766
880 Ga0500636_0000076 3300053177 Bacteria 48321
881 Ga0500636_0013917 3300053177 Bacteria 4729
882 Ga0500636_0027304 3300053177 Bacteria 3372
883 Ga0500636_0090858 3300053177 Bacteria 1748
884 Ga0500637_0003785 3300053178 Bacteria 7033
885 Ga0500637_0017525 3300053178 Bacteria 3835
886 Ga0500625_000655 3300053729 Bacteria 10043
887 Ga0500645_006029 3300053730 Bacteria 4374
888 Ga0500609_005292 3300053731 Bacteria 1763
889 Ga0500609_006430 3300053731 Bacteria 1601
890 Ga0500596_000099 3300053735 Bacteria 11805
891 Ga0500596_002257 3300053735 Bacteria 3822
892 Ga0500599_002472 3300053736 Bacteria 2216
893 Ga0500601_000030 3300053737 Bacteria 31644
894 Ga0501084_0054780 3300054114 Bacteria 3336
895 Ga0500661_000031 3300055283 Bacteria 21207
896 Ga0501082_0007057 3300060353 Bacteria 9698

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_100252254 Ga0068868_1002522541 348
2 3300005719 Ga0068861_100308018 Ga0068861_1003080181 348
3 3300014326 Ga0157380_10161391 Ga0157380_101613912 348
4 3300025923 Ga0207681_10225714 Ga0207681_102257142 348
5 3300027907 Ga0207428_10090372 Ga0207428_100903722 348
6 3300050511 nmdc:mga08y16_117307_c1 nmdc:mga08y16_117307_c1_712_1911 348
7 3300005548 Ga0070665_100085138 Ga0070665_1000851386 353
8 3300053119 Ga0500595_011713 Ga0500595_011713_278_1342 354
9 3300003323 rootH1_10167409 rootH1_101674093 359
10 3300009098 Ga0105245_10148087 Ga0105245_101480873 359
11 3300009098 Ga0105245_10149348 Ga0105245_101493482 359
12 3300009174 Ga0105241_10259872 Ga0105241_102598722 359
13 3300014969 Ga0157376_10094649 Ga0157376_100946491 359
14 3300025927 Ga0207687_10024884 Ga0207687_100248845 359
15 3300028577 Ga0265318_10006322 Ga0265318_100063226 359
16 3300031238 Ga0265332_10025251 Ga0265332_100252512 359
17 3300031240 Ga0265320_10091814 Ga0265320_100918142 359
18 3300031595 Ga0265313_10000665 Ga0265313_1000066513 359
19 3300031711 Ga0265314_10003187 Ga0265314_100031879 359
20 3300049570 Ga0501033_0016116 Ga0501033_0016116_2957_4036 359
21 3300049570 Ga0501033_0129906 Ga0501033_0129906_496_1575 359
22 3300049573 Ga0501037_0094501 Ga0501037_0094501_450_1529 359
23 3300049574 Ga0501038_0217028 Ga0501038_0217028_57_1136 359
24 3300049580 Ga0501046_0008502 Ga0501046_0008502_5918_6997 359
25 3300049581 Ga0501047_0004734 Ga0501047_0004734_5313_6392 359
26 3300049581 Ga0501047_0156510 Ga0501047_0156510_796_1875 359
27 3300049586 Ga0501070_0080943 Ga0501070_0080943_1085_2164 359
28 3300049589 Ga0501073_0070215 Ga0501073_0070215_756_1835 359
29 3300049822 Ga0501035_0055062 Ga0501035_0055062_616_1695 359
30 3300049823 Ga0501044_0076035 Ga0501044_0076035_460_1539 359
31 3300053119 Ga0500595_005782 Ga0500595_005782_149_1291 360
32 3300053731 Ga0500609_006430 Ga0500609_006430_107_1249 360
33 3300005364 Ga0070673_100078954 Ga0070673_1000789542 361
34 3300005843 Ga0068860_100152239 Ga0068860_1001522393 361
35 3300006881 Ga0068865_100024561 Ga0068865_1000245612 361
36 3300009176 Ga0105242_10105461 Ga0105242_101054613 361
37 3300025933 Ga0207706_10012522 Ga0207706_100125221 361
38 3300025961 Ga0207712_10023761 Ga0207712_100237611 361
39 3300046523 Ga0495644_0064788 Ga0495644_0064788_32_1231 361
40 3300046615 Ga0495656_0040131 Ga0495656_0040131_43_1242 361
41 3300025924 Ga0207694_10160495 Ga0207694_101604951 362
42 3300044684 Ga0466966_0000008 Ga0466966_0000008_8363_9472 362
43 3300044693 Ga0466961_0000167 Ga0466961_0000167_8474_9583 362
44 3300045049 Ga0466959_0000257 Ga0466959_0000257_23063_24172 362
45 iso_pu_bacteria 2933594066 2933597161 362
46 3300005937 Ga0081455_10014665 Ga0081455_100146653 364
47 3300031240 Ga0265320_10000034 Ga0265320_1000003456 364
48 3300031241 Ga0265325_10003020 Ga0265325_1000302011 364
49 3300005563 Ga0068855_100334602 Ga0068855_1003346022 365
50 3300053119 Ga0500595_000540 Ga0500595_000540_11818_12951 365
51 3300006237 Ga0097621_100102410 Ga0097621_1001024102 366
52 3300025911 Ga0207654_10158427 Ga0207654_101584272 366
53 iso_pu_bacteria 2643221651 2644287834 366
54 3300036401 Ga0373937_0112028 Ga0373937_0112028_1403_2527 367
55 iso_pu_bacteria 642555112 642594086 367
56 3300013105 Ga0157369_10009653 Ga0157369_100096534 368
57 3300048088 Ga0495602_0145863 Ga0495602_0145863_740_1846 368
58 3300048907 Ga0496104_0039497 Ga0496104_0039497_2577_3707 368
59 3300048908 Ga0496105_0031127 Ga0496105_0031127_661_1791 368
60 3300049568 Ga0501031_0126629 Ga0501031_0126629_522_1640 368
61 3300049570 Ga0501033_0010540 Ga0501033_0010540_2508_3626 368
62 3300049573 Ga0501037_0000457 Ga0501037_0000457_26734_27852 368
63 3300049574 Ga0501038_0023857 Ga0501038_0023857_1685_2803 368
64 3300049575 Ga0501039_0005841 Ga0501039_0005841_3156_4274 368
65 3300049578 Ga0501042_0112695 Ga0501042_0112695_573_1691 368
66 3300049579 Ga0501043_0037811 Ga0501043_0037811_258_1376 368
67 3300049581 Ga0501047_0000815 Ga0501047_0000815_16349_17464 368
68 3300049583 Ga0501067_0006064 Ga0501067_0006064_4756_5871 368
69 3300049588 Ga0501072_0000739 Ga0501072_0000739_905_2020 368
70 3300049741 Ga0501079_0027792 Ga0501079_0027792_2807_3922 368
71 3300049742 Ga0501080_0067266 Ga0501080_0067266_428_1543 368
72 3300049822 Ga0501035_0060678 Ga0501035_0060678_1075_2193 368
73 3300054114 Ga0501084_0054780 Ga0501084_0054780_1256_2371 368
74 3300005338 Ga0068868_100018795 Ga0068868_1000187955 369
75 3300005456 Ga0070678_100063165 Ga0070678_1000631654 369
76 3300005535 Ga0070684_100149286 Ga0070684_1001492862 369
77 3300005564 Ga0070664_100033848 Ga0070664_1000338482 369
78 3300005834 Ga0068851_10091855 Ga0068851_100918551 369
79 3300009098 Ga0105245_10046289 Ga0105245_100462892 369
80 3300011119 Ga0105246_10036888 Ga0105246_100368882 369
81 3300013308 Ga0157375_10056472 Ga0157375_100564722 369
82 3300014969 Ga0157376_10021228 Ga0157376_100212284 369
83 3300025927 Ga0207687_10061979 Ga0207687_100619793 369
84 3300025981 Ga0207640_10126305 Ga0207640_101263052 369
85 3300026067 Ga0207678_10017845 Ga0207678_100178455 369
86 3300026121 Ga0207683_10265774 Ga0207683_102657741 369
87 3300048903 Ga0496100_0057827 Ga0496100_0057827_230_1507 369
88 3300048904 Ga0496101_0005595 Ga0496101_0005595_4999_6276 369
89 3300048909 Ga0496106_0037975 Ga0496106_0037975_1701_2978 369
90 3300048913 Ga0496110_0020114 Ga0496110_0020114_2294_3571 369
91 3300048915 Ga0496112_0061112 Ga0496112_0061112_1727_3004 369
92 3300048918 Ga0496115_0001214 Ga0496115_0001214_2801_4078 369
93 3300049823 Ga0501044_0002688 Ga0501044_0002688_6954_8075 369
94 iso_pu_bacteria 2602042107 2603861069 369
95 iso_pu_bacteria 2857524615 2857528804 369
96 iso_pu_bacteria 2893066018 2893068998 369
97 iso_pu_bacteria 2919073203 2919079231 369
98 3300005327 Ga0070658_10091665 Ga0070658_100916652 370
99 3300025929 Ga0207664_10125955 Ga0207664_101259554 370
100 3300038443 Ga0395901_0007795 Ga0395901_0007795_6738_7901 370
101 3300048910 Ga0496107_0026546 Ga0496107_0026546_1627_2739 370
102 3300048924 Ga0496121_0000744 Ga0496121_0000744_18906_20018 370
103 3300048929 Ga0496126_0063952 Ga0496126_0063952_1935_3047 370
104 3300049571 Ga0501034_0120666 Ga0501034_0120666_609_1874 370
105 3300049581 Ga0501047_0030093 Ga0501047_0030093_2045_3157 370
106 3300049581 Ga0501047_0083576 Ga0501047_0083576_1470_2582 370
107 3300049586 Ga0501070_0127243 Ga0501070_0127243_944_2056 370
108 3300049822 Ga0501035_0055812 Ga0501035_0055812_1392_2504 370
109 3300049823 Ga0501044_0075919 Ga0501044_0075919_2130_3242 370
110 3300053153 Ga0500616_0000084 Ga0500616_0000084_191995_193107 370
111 3300003320 rootH2_10001288 rootH2_1000128817 371
112 3300005614 Ga0068856_100001907 Ga0068856_10000190720 371
113 3300026078 Ga0207702_10000403 Ga0207702_100004038 371
114 3300031247 Ga0265340_10020095 Ga0265340_100200952 371
115 3300035724 Ga0373933_0000405 Ga0373933_0000405_4258_5436 371
116 iso_pu_bacteria 2508501042 2508698054 371
117 iso_pu_bacteria 2513237092 2513628169 371
118 iso_pu_bacteria 2513237094 2513643539 371
119 iso_pu_bacteria 2617270741 2617378935 371
120 iso_pu_bacteria 2824679649 2824684219 371
121 iso_pu_bacteria 2824732956 2824740549 371
122 iso_pu_bacteria 2824746037 2824752374 371
123 iso_pu_bacteria 2844315083 2844317758 371
124 iso_pu_bacteria 2874590934 2874596756 371
125 iso_pu_bacteria 2874612657 2874618240 371
126 iso_pu_bacteria 2874645413 2874653014 371
127 iso_pu_bacteria 2876771140 2876776948 371
128 iso_pu_bacteria 2876818435 2876825302 371
129 iso_pu_bacteria 2879074833 2879081085 371
130 iso_pu_bacteria 2879127579 2879130823 371
131 iso_pu_bacteria 2879142872 2879147587 371
132 iso_pu_bacteria 2881665667 2881671743 371
133 iso_pu_bacteria 2903727486 2903735436 371
134 iso_pu_bacteria 2906602504 2906608645 371
135 iso_pu_bacteria 2908775508 2908778727 371
136 iso_pu_bacteria 2922393267 2922395000 371
137 iso_pu_bacteria 2932794094 2932797342 371
138 iso_pu_bacteria 2932801729 2932804773 371
139 iso_pu_bacteria 2935648319 2935648522 371
140 iso_pu_bacteria 2935656913 2935657490 371
141 iso_pu_bacteria 2935883170 2935884991 371
142 iso_pu_bacteria 2935984226 2935987878 371
143 iso_pu_bacteria 2936011229 2936011432 371
144 iso_pu_bacteria 2936019824 2936020027 371
145 iso_pu_bacteria 2936028420 2936028623 371
146 iso_pu_bacteria 2936046547 2936046750 371
147 iso_pu_bacteria 2936055302 2936058375 371
148 iso_pu_bacteria 3005483717 3005487952 371
149 iso_pu_bacteria 3005587118 3005589459 371
150 iso_pu_bacteria 3005594810 3005597498 371
151 iso_pu_bacteria 3005718088 3005720926 371
152 iso_pu_bacteria 8016630954 8016632564 371
153 iso_pu_bacteria 8019648815 8019656488 371
154 iso_pu_bacteria 8019678201 8019682769 371
155 iso_pu_bacteria 8056967851 8056969556 371
156 3300005330 Ga0070690_100134148 Ga0070690_1001341482 372
157 3300005578 Ga0068854_100202305 Ga0068854_1002023052 372
158 3300005614 Ga0068856_100005219 Ga0068856_1000052196 372
159 3300005616 Ga0068852_100048809 Ga0068852_1000488092 372
160 3300009093 Ga0105240_10157997 Ga0105240_101579972 372
161 3300009551 Ga0105238_10055335 Ga0105238_100553352 372
162 3300010375 Ga0105239_10015059 Ga0105239_100150596 372
163 3300013102 Ga0157371_10023274 Ga0157371_100232742 372
164 3300013104 Ga0157370_10025179 Ga0157370_100251792 372
165 3300025295 Ga0209564_1000164 Ga0209564_1000164137 372
166 3300025904 Ga0207647_10000486 Ga0207647_1000048621 372
167 3300025919 Ga0207657_10038250 Ga0207657_100382504 372
168 3300025921 Ga0207652_10143237 Ga0207652_101432372 372
169 3300025924 Ga0207694_10013338 Ga0207694_100133385 372
170 3300025981 Ga0207640_10054955 Ga0207640_100549552 372
171 3300025981 Ga0207640_10160943 Ga0207640_101609431 372
172 3300026041 Ga0207639_10006484 Ga0207639_100064846 372
173 3300035691 Ga0373931_0072073 Ga0373931_0072073_418_1566 372
174 3300048908 Ga0496105_0108332 Ga0496105_0108332_1091_2233 372
175 3300048913 Ga0496110_0426339 Ga0496110_0426339_39_1181 372
176 3300049568 Ga0501031_0010093 Ga0501031_0010093_1205_2335 372
177 3300049569 Ga0501032_0000107 Ga0501032_0000107_15517_16776 372
178 3300049569 Ga0501032_0000318 Ga0501032_0000318_3336_4466 372
179 3300049570 Ga0501033_0000144 Ga0501033_0000144_2297_3556 372
180 3300049570 Ga0501033_0001175 Ga0501033_0001175_2756_3886 372
181 3300049571 Ga0501034_0000061 Ga0501034_0000061_47606_48736 372
182 3300049571 Ga0501034_0000412 Ga0501034_0000412_63670_64929 372
183 3300049572 Ga0501036_0000007 Ga0501036_0000007_112590_113849 372
184 3300049572 Ga0501036_0000387 Ga0501036_0000387_21146_22276 372
185 3300049573 Ga0501037_0000066 Ga0501037_0000066_6829_8088 372
186 3300049573 Ga0501037_0000104 Ga0501037_0000104_70263_71393 372
187 3300049574 Ga0501038_0002223 Ga0501038_0002223_2169_3428 372
188 3300049574 Ga0501038_0013623 Ga0501038_0013623_1012_2142 372
189 3300049574 Ga0501038_0024872 Ga0501038_0024872_3029_4159 372
190 3300049574 Ga0501038_0088993 Ga0501038_0088993_870_2000 372
191 3300049575 Ga0501039_0000005 Ga0501039_0000005_138342_139601 372
192 3300049575 Ga0501039_0000536 Ga0501039_0000536_8280_9410 372
193 3300049575 Ga0501039_0111908 Ga0501039_0111908_414_1544 372
194 3300049576 Ga0501040_0042235 Ga0501040_0042235_1355_2485 372
195 3300049578 Ga0501042_0021996 Ga0501042_0021996_1669_2799 372
196 3300049578 Ga0501042_0066707 Ga0501042_0066707_893_2152 372
197 3300049579 Ga0501043_0000036 Ga0501043_0000036_16768_18027 372
198 3300049579 Ga0501043_0000161 Ga0501043_0000161_28188_29318 372
199 3300049580 Ga0501046_0000032 Ga0501046_0000032_155423_156682 372
200 3300049581 Ga0501047_0000077 Ga0501047_0000077_112482_113741 372
201 3300049581 Ga0501047_0000122 Ga0501047_0000122_41373_42503 372
202 3300049582 Ga0501048_0000053 Ga0501048_0000053_5318_6448 372
203 3300049582 Ga0501048_0018667 Ga0501048_0018667_1534_2664 372
204 3300049583 Ga0501067_0000194 Ga0501067_0000194_22623_23753 372
205 3300049583 Ga0501067_0002271 Ga0501067_0002271_7432_8691 372
206 3300049583 Ga0501067_0018088 Ga0501067_0018088_1387_2517 372
207 3300049584 Ga0501068_0002401 Ga0501068_0002401_7245_8504 372
208 3300049584 Ga0501068_0022723 Ga0501068_0022723_585_1715 372
209 3300049585 Ga0501069_0002581 Ga0501069_0002581_1956_3215 372
210 3300049585 Ga0501069_0003508 Ga0501069_0003508_3007_4137 372
211 3300049585 Ga0501069_0007163 Ga0501069_0007163_3184_4314 372
212 3300049586 Ga0501070_0000070 Ga0501070_0000070_55754_57013 372
213 3300049586 Ga0501070_0000659 Ga0501070_0000659_13869_14999 372
214 3300049587 Ga0501071_0096680 Ga0501071_0096680_161_1291 372
215 3300049588 Ga0501072_0000606 Ga0501072_0000606_8363_9493 372
216 3300049588 Ga0501072_0030322 Ga0501072_0030322_1344_2474 372
217 3300049589 Ga0501073_0000233 Ga0501073_0000233_28736_29995 372
218 3300049589 Ga0501073_0001231 Ga0501073_0001231_2805_3935 372
219 3300049589 Ga0501073_0049354 Ga0501073_0049354_1335_2465 372
220 3300049590 Ga0501074_0000656 Ga0501074_0000656_5528_6658 372
221 3300049590 Ga0501074_0001541 Ga0501074_0001541_8682_9941 372
222 3300049742 Ga0501080_0000132 Ga0501080_0000132_36316_37575 372
223 3300049742 Ga0501080_0025776 Ga0501080_0025776_4157_5287 372
224 3300049744 Ga0501083_0001610 Ga0501083_0001610_3562_4692 372
225 3300049744 Ga0501083_0027555 Ga0501083_0027555_1457_2587 372
226 3300049822 Ga0501035_0000016 Ga0501035_0000016_80325_81584 372
227 3300049822 Ga0501035_0000099 Ga0501035_0000099_25865_26995 372
228 3300049823 Ga0501044_0000195 Ga0501044_0000195_49649_50779 372
229 3300049823 Ga0501044_0006383 Ga0501044_0006383_2169_3428 372
230 3300049823 Ga0501044_0030002 Ga0501044_0030002_3222_4352 372
231 3300049823 Ga0501044_0324394 Ga0501044_0324394_172_1302 372
232 3300049823 Ga0501044_0441821 Ga0501044_0441821_20_1150 372
233 3300049824 Ga0501045_0034236 Ga0501045_0034236_311_1570 372
234 3300060353 Ga0501082_0007057 Ga0501082_0007057_854_1984 372
235 iso_pu_bacteria 2513237101 2513696907 372
236 iso_pu_bacteria 2874604998 2874610678 372
237 iso_pu_bacteria 2876808645 2876809479 372
238 iso_pu_bacteria 2879110137 2879118747 372
239 iso_pu_bacteria 2889033259 2889039138 372
240 iso_pu_bacteria 2904690495 2904691603 372
241 iso_pu_bacteria 2908756301 2908761864 372
242 iso_pu_bacteria 2922361189 2922362164 372
243 iso_pu_bacteria 2922386360 2922388077 372
244 iso_pu_bacteria 2935959822 2935963365 372
245 iso_pu_bacteria 8006994254 8006999839 372
246 iso_pu_bacteria 8056673599 8056680258 372
247 3300031616 Ga0307508_10230392 Ga0307508_102303921 373
248 3300046460 Ga0495638_0035929 Ga0495638_0035929_1137_2270 373
249 3300046512 Ga0495610_0008306 Ga0495610_0008306_35_1168 373
250 3300046518 Ga0495631_0022910 Ga0495631_0022910_750_1883 373
251 3300046692 Ga0495671_0091306 Ga0495671_0091306_85_1218 373
252 3300047472 Ga0495686_0010639 Ga0495686_0010639_5303_6436 373
253 3300048919 Ga0496116_0000887 Ga0496116_0000887_4453_5586 373
254 3300048920 Ga0496117_0041120 Ga0496117_0041120_1476_2609 373
255 3300048921 Ga0496118_0117775 Ga0496118_0117775_477_1610 373
256 3300048923 Ga0496120_0022800 Ga0496120_0022800_577_1710 373
257 3300048924 Ga0496121_0002685 Ga0496121_0002685_1557_2690 373
258 3300048925 Ga0496122_0172992 Ga0496122_0172992_106_1239 373
259 3300048926 Ga0496123_0012664 Ga0496123_0012664_5098_6231 373
260 3300048926 Ga0496123_0037135 Ga0496123_0037135_1389_2522 373
261 3300048928 Ga0496125_0000092 Ga0496125_0000092_171503_172636 373
262 3300048928 Ga0496125_0009888 Ga0496125_0009888_4731_5864 373
263 3300050492 nmdc:mga0yw44_5535_c1 nmdc:mga0yw44_5535_c1_3943_5076 373
264 3300050516 nmdc:mga0sz30_24073_c1 nmdc:mga0sz30_24073_c1_1123_2256 373
265 3300053087 Ga0500643_012081 Ga0500643_012081_1430_2563 373
266 3300053093 Ga0500651_0011482 Ga0500651_0011482_3318_4451 373
267 3300053098 Ga0500650_0001416 Ga0500650_0001416_5649_6782 373
268 3300053104 Ga0500556_0000024 Ga0500556_0000024_104454_105587 373
269 3300053116 Ga0500592_000902 Ga0500592_000902_1057_2190 373
270 3300053122 Ga0500608_006275 Ga0500608_006275_1116_2249 373
271 3300053125 Ga0500618_024391 Ga0500618_024391_149_1282 373
272 3300053130 Ga0500642_0000035 Ga0500642_0000035_32225_33358 373
273 3300053131 Ga0500652_000134 Ga0500652_000134_1817_2950 373
274 3300053136 Ga0500559_0001329 Ga0500559_0001329_5485_6618 373
275 3300053139 Ga0500568_0002132 Ga0500568_0002132_7842_8975 373
276 3300053153 Ga0500616_0000122 Ga0500616_0000122_107389_108522 373
277 3300053156 Ga0500622_0001260 Ga0500622_0001260_12284_13417 373
278 3300053158 Ga0500627_0025661 Ga0500627_0025661_567_1700 373
279 3300053161 Ga0500634_0087688 Ga0500634_0087688_182_1315 373
280 3300053177 Ga0500636_0013917 Ga0500636_0013917_2717_3850 373
281 iso_pu_bacteria 2508501128 2509147583 373
282 iso_pu_bacteria 2511231028 2511397558 373
283 iso_pu_bacteria 2513237095 2513652296 373
284 iso_pu_bacteria 2513237096 2513660106 373
285 iso_pu_bacteria 2513237098 2513676406 373
286 iso_pu_bacteria 2513237102 2513700289 373
287 iso_pu_bacteria 2513237104 2513720517 373
288 iso_pu_bacteria 2513237137 2513858283 373
289 iso_pu_bacteria 2513237139 2513878138 373
290 iso_pu_bacteria 2513237141 2513893325 373
291 iso_pu_bacteria 2513237145 2513922084 373
292 iso_pu_bacteria 2513237161 2514012565 373
293 iso_pu_bacteria 2517093001 2517107506 373
294 iso_pu_bacteria 2517572143 2517893828 373
295 iso_pu_bacteria 2524023210 2524469447 373
296 iso_pu_bacteria 2524023228 2524537777 373
297 iso_pu_bacteria 2528768022 2528849581 373
298 iso_pu_bacteria 2617270735 2617353094 373
299 iso_pu_bacteria 2728368998 2728747943 373
300 iso_pu_bacteria 2791355196 2793060010 373
301 iso_pu_bacteria 2791355197 2793072539 373
302 iso_pu_bacteria 2802429603 2805920099 373
303 iso_pu_bacteria 2816332527 2818241570 373
304 iso_pu_bacteria 2824600985 2824605622 373
305 iso_pu_bacteria 2824609381 2824609872 373
306 iso_pu_bacteria 2824617872 2824625342 373
307 iso_pu_bacteria 2824626560 2824633829 373
308 iso_pu_bacteria 2824635225 2824641567 373
309 iso_pu_bacteria 2824644064 2824652067 373
310 iso_pu_bacteria 2824653114 2824655729 373
311 iso_pu_bacteria 2824661429 2824669434 373
312 iso_pu_bacteria 2824671348 2824674184 373
313 iso_pu_bacteria 2824687955 2824693036 373
314 iso_pu_bacteria 2824696289 2824698917 373
315 iso_pu_bacteria 2824704595 2824713810 373
316 iso_pu_bacteria 2824714736 2824722430 373
317 iso_pu_bacteria 2824723954 2824729012 373
318 iso_pu_bacteria 2824753945 2824758051 373
319 iso_pu_bacteria 2824763712 2824766189 373
320 iso_pu_bacteria 2824773399 2824774279 373
321 iso_pu_bacteria 2838122688 2838127549 373
322 iso_pu_bacteria 2841941048 2841941499 373
323 iso_pu_bacteria 2841949485 2841952488 373
324 iso_pu_bacteria 2841957949 2841959510 373
325 iso_pu_bacteria 2841966195 2841967641 373
326 iso_pu_bacteria 2841974524 2841982192 373
327 iso_pu_bacteria 2841983080 2841986510 373
328 iso_pu_bacteria 2847930680 2847934542 373
329 iso_pu_bacteria 2847939898 2847945149 373
330 iso_pu_bacteria 2849076700 2849080669 373
331 iso_pu_bacteria 2857509624 2857509968 373
332 iso_pu_bacteria 2874620515 2874623233 373
333 iso_pu_bacteria 2874628541 2874636019 373
334 iso_pu_bacteria 2876761206 2876766670 373
335 iso_pu_bacteria 2879083081 2879089733 373
336 iso_pu_bacteria 2879099564 2879107751 373
337 iso_pu_bacteria 2881364244 2881365657 373
338 iso_pu_bacteria 2885366525 2885368951 373
339 iso_pu_bacteria 2885374607 2885381582 373
340 iso_pu_bacteria 2885409591 2885414449 373
341 iso_pu_bacteria 2888378607 2888382483 373
342 iso_pu_bacteria 2888388044 2888388210 373
343 iso_pu_bacteria 2888419890 2888423059 373
344 iso_pu_bacteria 2903748898 2903751612 373
345 iso_pu_bacteria 2904666416 2904670053 373
346 iso_pu_bacteria 2904699407 2904705099 373
347 iso_pu_bacteria 2904711408 2904718459 373
348 iso_pu_bacteria 2906610324 2906610708 373
349 iso_pu_bacteria 2906626472 2906633563 373
350 iso_pu_bacteria 2906635258 2906635873 373
351 iso_pu_bacteria 2906643746 2906649936 373
352 iso_pu_bacteria 2906660503 2906664031 373
353 iso_pu_bacteria 2908739725 2908744227 373
354 iso_pu_bacteria 2922368715 2922375483 373
355 iso_pu_bacteria 2922425934 2922428610 373
356 iso_pu_bacteria 2929615660 2929616218 373
357 iso_pu_bacteria 2929624759 2929624962 373
358 iso_pu_bacteria 2932784394 2932787115 373
359 iso_pu_bacteria 2932809354 2932811310 373
360 iso_pu_bacteria 2932818245 2932819817 373
361 iso_pu_bacteria 2932828146 2932832295 373
362 iso_pu_bacteria 2933577622 2933578498 373
363 iso_pu_bacteria 2935616580 2935619005 373
364 iso_pu_bacteria 2935630451 2935634584 373
365 iso_pu_bacteria 2935638405 2935643178 373
366 iso_pu_bacteria 2935665750 2935669804 373
367 iso_pu_bacteria 2935675223 2935677056 373
368 iso_pu_bacteria 2935684952 2935693095 373
369 iso_pu_bacteria 2935694250 2935695414 373
370 iso_pu_bacteria 2935703347 2935709477 373
371 iso_pu_bacteria 2935713505 2935719703 373
372 iso_pu_bacteria 2935722832 2935729530 373
373 iso_pu_bacteria 2935732158 2935739586 373
374 iso_pu_bacteria 2935741537 2935748624 373
375 iso_pu_bacteria 2935750917 2935756789 373
376 iso_pu_bacteria 2935760218 2935761222 373
377 iso_pu_bacteria 2935769743 2935771498 373
378 iso_pu_bacteria 2935777560 2935779187 373
379 iso_pu_bacteria 2935785616 2935790844 373
380 iso_pu_bacteria 2935793552 2935799215 373
381 iso_pu_bacteria 2935801545 2935807322 373
382 iso_pu_bacteria 2935810662 2935812461 373
383 iso_pu_bacteria 2935827899 2935832678 373
384 iso_pu_bacteria 2935837841 2935839243 373
385 iso_pu_bacteria 2935855204 2935857370 373
386 iso_pu_bacteria 2935864058 2935864899 373
387 iso_pu_bacteria 2935873716 2935876677 373
388 iso_pu_bacteria 2935992306 2935998972 373
389 iso_pu_bacteria 2936002035 2936008270 373
390 iso_pu_bacteria 2936037263 2936039054 373
391 iso_pu_bacteria 2940556831 2940562703 373
392 iso_pu_bacteria 2941507105 2941509070 373
393 iso_pu_bacteria 2941515067 2941516899 373
394 iso_pu_bacteria 2941523033 2941525006 373
395 iso_pu_bacteria 2941531003 2941536391 373
396 iso_pu_bacteria 2941538514 2941539933 373
397 iso_pu_bacteria 3005474847 3005478740 373
398 iso_pu_bacteria 3005506211 3005508727 373
399 iso_pu_bacteria 3005710791 3005713522 373
400 iso_pu_bacteria 8006926726 8006928227 373
401 iso_pu_bacteria 8006933436 8006942603 373
402 iso_pu_bacteria 8006973647 8006982331 373
403 iso_pu_bacteria 8016511872 8016515091 373
404 iso_pu_bacteria 8016522445 8016522884 373
405 iso_pu_bacteria 8016530956 8016536341 373
406 iso_pu_bacteria 8016539877 8016540620 373
407 iso_pu_bacteria 8016557553 8016561001 373
408 iso_pu_bacteria 8016566248 8016574706 373
409 iso_pu_bacteria 8016575299 8016578779 373
410 iso_pu_bacteria 8016595262 8016598864 373
411 iso_pu_bacteria 8016603502 8016612213 373
412 iso_pu_bacteria 8016613128 8016621591 373
413 iso_pu_bacteria 8016622563 8016628368 373
414 iso_pu_bacteria 8017057580 8017061362 373
415 iso_pu_bacteria 8019530166 8019536064 373
416 iso_pu_bacteria 8019538911 8019543406 373
417 iso_pu_bacteria 8019555841 8019558375 373
418 iso_pu_bacteria 8019565922 8019566920 373
419 iso_pu_bacteria 8019586578 8019588569 373
420 iso_pu_bacteria 8019597564 8019602768 373
421 iso_pu_bacteria 8019608314 8019615790 373
422 iso_pu_bacteria 8055742211 8055747865 373
423 iso_pu_bacteria 8056689827 8056695915 373
424 3300005985 Ga0081539_10000255 Ga0081539_100002553 374
425 3300009545 Ga0105237_10026955 Ga0105237_100269552 374
426 3300009551 Ga0105238_10007520 Ga0105238_100075204 374
427 3300010375 Ga0105239_10049080 Ga0105239_100490802 374
428 3300025924 Ga0207694_10179544 Ga0207694_101795442 374
429 3300025949 Ga0207667_10256447 Ga0207667_102564472 374
430 3300028800 Ga0265338_10002444 Ga0265338_1000244419 374
431 3300046507 Ga0495606_0006792 Ga0495606_0006792_2406_3530 374
432 3300046512 Ga0495610_0082184 Ga0495610_0082184_127_1251 374
433 3300048915 Ga0496112_0000016 Ga0496112_0000016_53953_55077 374
434 3300005262 Ga0065165_1003794 Ga0065165_10037943 375
435 3300005578 Ga0068854_100049966 Ga0068854_1000499661 375
436 3300006186 Ga0075369_10029967 Ga0075369_100299672 375
437 3300006942 Ga0099824_1016459 Ga0099824_10164592 375
438 3300009093 Ga0105240_10006290 Ga0105240_1000629011 375
439 3300009098 Ga0105245_10057995 Ga0105245_100579952 375
440 3300009545 Ga0105237_10003947 Ga0105237_1000394712 375
441 3300010375 Ga0105239_10082749 Ga0105239_100827491 375
442 3300021320 Ga0214544_1000020 Ga0214544_1000020179 375
443 3300021321 Ga0214542_1000024 Ga0214542_1000024190 375
444 3300021324 Ga0214545_1000011 Ga0214545_1000011190 375
445 3300021327 Ga0214543_1000033 Ga0214543_100003314 375
446 3300025254 Ga0209148_1000574 Ga0209148_10005741 375
447 3300025297 Ga0209758_1002030 Ga0209758_10020308 375
448 3300025913 Ga0207695_10000029 Ga0207695_1000002978 375
449 3300025914 Ga0207671_10002273 Ga0207671_1000227311 375
450 3300026142 Ga0207698_10279093 Ga0207698_102790932 375
451 3300027296 Ga0209389_1000025 Ga0209389_100002585 375
452 3300027357 Ga0209589_1000066 Ga0209589_100006634 375
453 3300027361 Ga0209489_100030 Ga0209489_10003079 375
454 3300037312 Ga0395899_0090148 Ga0395899_0090148_163_1323 375
455 3300044684 Ga0466966_0001391 Ga0466966_0001391_7609_8736 375
456 3300044694 Ga0466963_0085348 Ga0466963_0085348_568_1695 375
457 3300044901 Ga0466960_0001540 Ga0466960_0001540_4835_5962 375
458 3300045049 Ga0466959_0018179 Ga0466959_0018179_1069_2196 375
459 3300045976 Ga0466967_0148362 Ga0466967_0148362_668_1795 375
460 3300046533 Ga0495640_0031782 Ga0495640_0031782_1153_2280 375
461 3300046642 Ga0495634_0190415 Ga0495634_0190415_102_1229 375
462 3300046675 Ga0495657_0027054 Ga0495657_0027054_1650_2777 375
463 3300046690 Ga0495624_0058391 Ga0495624_0058391_235_1362 375
464 3300047317 Ga0495604_0004387 Ga0495604_0004387_2348_3475 375
465 3300048906 Ga0496103_0038793 Ga0496103_0038793_137_1264 375
466 3300048907 Ga0496104_0010576 Ga0496104_0010576_5168_6295 375
467 3300048908 Ga0496105_0004214 Ga0496105_0004214_3821_4948 375
468 3300048918 Ga0496115_0063304 Ga0496115_0063304_117_1244 375
469 3300048923 Ga0496120_0014244 Ga0496120_0014244_3710_4837 375
470 3300048924 Ga0496121_0017799 Ga0496121_0017799_5286_6419 375
471 3300049460 Ga0495682_0016840 Ga0495682_0016840_31_1158 375
472 3300049569 Ga0501032_0078193 Ga0501032_0078193_408_1568 375
473 3300049570 Ga0501033_0041619 Ga0501033_0041619_1756_2916 375
474 3300049571 Ga0501034_0107111 Ga0501034_0107111_244_1404 375
475 3300049823 Ga0501044_0108470 Ga0501044_0108470_1231_2391 375
476 3300050492 nmdc:mga0yw44_151082_c1 nmdc:mga0yw44_151082_c1_346_1479 375
477 3300050516 nmdc:mga0sz30_26276_c1 nmdc:mga0sz30_26276_c1_690_1817 375
478 3300053091 Ga0500647_0069839 Ga0500647_0069839_427_1560 375
479 3300053094 Ga0500566_0000537 Ga0500566_0000537_18574_19707 375
480 3300053105 Ga0500557_000090 Ga0500557_000090_17668_18801 375
481 3300053130 Ga0500642_0000203 Ga0500642_0000203_13678_14811 375
482 3300053729 Ga0500625_000655 Ga0500625_000655_3015_4148 375
483 iso_pu_bacteria 2507262055 2507510012 375
484 iso_pu_bacteria 2508501009 2508544014 375
485 iso_pu_bacteria 2515154112 2515629485 375
486 iso_pu_bacteria 2935608549 2935611084 375
487 iso_pu_bacteria 2935819856 2935820569 375
488 iso_pu_bacteria 2935847175 2935849422 375
489 iso_pu_bacteria 2935908558 2935911803 375
490 iso_pu_bacteria 2935916978 2935919459 375
491 iso_pu_bacteria 2935926038 2935928832 375
492 iso_pu_bacteria 2935934488 2935938477 375
493 iso_pu_bacteria 2935942939 2935945631 375
494 iso_pu_bacteria 2935951376 2935954762 375
495 iso_pu_bacteria 2935967501 2935970649 375
496 iso_pu_bacteria 2935975950 2935979112 375
497 iso_pu_bacteria 8019629233 8019635960 375
498 iso_pu_bacteria 8019668869 8019673357 375
499 iso_pu_bacteria 8019687851 8019688454 375
500 3300005331 Ga0070670_100266966 Ga0070670_1002669662 376
501 3300005334 Ga0068869_100011108 Ga0068869_1000111083 376
502 3300005336 Ga0070680_100162499 Ga0070680_1001624991 376
503 3300005347 Ga0070668_100057426 Ga0070668_1000574263 376
504 3300005366 Ga0070659_100188558 Ga0070659_1001885581 376
505 3300005435 Ga0070714_100045563 Ga0070714_1000455632 376
506 3300005436 Ga0070713_100106690 Ga0070713_1001066902 376
507 3300005437 Ga0070710_10006341 Ga0070710_100063414 376
508 3300005439 Ga0070711_100014959 Ga0070711_1000149591 376
509 3300005455 Ga0070663_100087297 Ga0070663_1000872971 376
510 3300005471 Ga0070698_100066098 Ga0070698_1000660983 376
511 3300005543 Ga0070672_100066915 Ga0070672_1000669154 376
512 3300005547 Ga0070693_100011838 Ga0070693_1000118385 376
513 3300005548 Ga0070665_100013416 Ga0070665_1000134163 376
514 3300005548 Ga0070665_100104399 Ga0070665_1001043992 376
515 3300005548 Ga0070665_100108350 Ga0070665_1001083502 376
516 3300005618 Ga0068864_100025431 Ga0068864_1000254313 376
517 3300005718 Ga0068866_10071860 Ga0068866_100718602 376
518 3300005843 Ga0068860_100102392 Ga0068860_1001023923 376
519 3300005843 Ga0068860_100137338 Ga0068860_1001373382 376
520 3300005937 Ga0081455_10003365 Ga0081455_100033652 376
521 3300005937 Ga0081455_10020871 Ga0081455_100208712 376
522 3300005937 Ga0081455_10141774 Ga0081455_101417741 376
523 3300005983 Ga0081540_1000978 Ga0081540_10009786 376
524 3300005983 Ga0081540_1001241 Ga0081540_100124115 376
525 3300005983 Ga0081540_1001715 Ga0081540_100171517 376
526 3300005983 Ga0081540_1002512 Ga0081540_100251215 376
527 3300005983 Ga0081540_1021387 Ga0081540_10213871 376
528 3300005985 Ga0081539_10020566 Ga0081539_100205663 376
529 3300005985 Ga0081539_10039627 Ga0081539_100396273 376
530 3300006038 Ga0075365_10152551 Ga0075365_101525511 376
531 3300006042 Ga0075368_10012243 Ga0075368_100122434 376
532 3300006048 Ga0075363_100028621 Ga0075363_1000286212 376
533 3300006048 Ga0075363_100032211 Ga0075363_1000322112 376
534 3300006163 Ga0070715_10003359 Ga0070715_100033594 376
535 3300006173 Ga0070716_100014652 Ga0070716_1000146524 376
536 3300006175 Ga0070712_100022313 Ga0070712_1000223132 376
537 3300006178 Ga0075367_10024756 Ga0075367_100247564 376
538 3300006178 Ga0075367_10134631 Ga0075367_101346311 376
539 3300006195 Ga0075366_10040984 Ga0075366_100409842 376
540 3300006237 Ga0097621_100153517 Ga0097621_1001535172 376
541 3300006237 Ga0097621_100204045 Ga0097621_1002040451 376
542 3300006353 Ga0075370_10062976 Ga0075370_100629761 376
543 3300006353 Ga0075370_10104790 Ga0075370_101047902 376
544 3300006844 Ga0075428_100104263 Ga0075428_1001042632 376
545 3300006881 Ga0068865_100136298 Ga0068865_1001362982 376
546 3300007076 Ga0075435_100129072 Ga0075435_1001290722 376
547 3300009092 Ga0105250_10060242 Ga0105250_100602421 376
548 3300009098 Ga0105245_10013251 Ga0105245_100132517 376
549 3300009101 Ga0105247_10098494 Ga0105247_100984941 376
550 3300009545 Ga0105237_10245323 Ga0105237_102453231 376
551 3300009553 Ga0105249_10445100 Ga0105249_104451001 376
552 3300011119 Ga0105246_10056886 Ga0105246_100568863 376
553 3300014325 Ga0163163_10013717 Ga0163163_100137173 376
554 3300014968 Ga0157379_10231584 Ga0157379_102315842 376
555 3300025272 Ga0209455_1004011 Ga0209455_10040112 376
556 3300025297 Ga0209758_1003889 Ga0209758_10038896 376
557 3300025297 Ga0209758_1014715 Ga0209758_10147152 376
558 3300025885 Ga0207653_10011889 Ga0207653_100118891 376
559 3300025898 Ga0207692_10002139 Ga0207692_100021398 376
560 3300025907 Ga0207645_10144063 Ga0207645_101440631 376
561 3300025915 Ga0207693_10000723 Ga0207693_1000072331 376
562 3300025916 Ga0207663_10005442 Ga0207663_100054421 376
563 3300025920 Ga0207649_10090500 Ga0207649_100905001 376
564 3300025927 Ga0207687_10102693 Ga0207687_101026931 376
565 3300025928 Ga0207700_10146908 Ga0207700_101469082 376
566 3300025931 Ga0207644_10106156 Ga0207644_101061561 376
567 3300025933 Ga0207706_10101580 Ga0207706_101015801 376
568 3300025939 Ga0207665_10000064 Ga0207665_100000647 376
569 3300025940 Ga0207691_10167185 Ga0207691_101671851 376
570 3300025942 Ga0207689_10008007 Ga0207689_100080073 376
571 3300025945 Ga0207679_10064328 Ga0207679_100643282 376
572 3300025949 Ga0207667_10013789 Ga0207667_100137895 376
573 3300026035 Ga0207703_10058266 Ga0207703_100582664 376
574 3300026035 Ga0207703_10103579 Ga0207703_101035791 376
575 3300026067 Ga0207678_10021989 Ga0207678_100219895 376
576 3300026067 Ga0207678_10114723 Ga0207678_101147231 376
577 3300026075 Ga0207708_10154231 Ga0207708_101542312 376
578 3300026078 Ga0207702_10290808 Ga0207702_102908081 376
579 3300026095 Ga0207676_10034015 Ga0207676_100340153 376
580 3300026118 Ga0207675_100240003 Ga0207675_1002400031 376
581 3300028379 Ga0268266_10003952 Ga0268266_1000395212 376
582 3300028379 Ga0268266_10013301 Ga0268266_100133015 376
583 3300028379 Ga0268266_10032383 Ga0268266_100323834 376
584 3300028380 Ga0268265_10040545 Ga0268265_100405455 376
585 3300028381 Ga0268264_10187409 Ga0268264_101874092 376
586 3300031730 Ga0307516_10090567 Ga0307516_100905672 376
587 3300031731 Ga0307405_10054277 Ga0307405_100542773 376
588 3300032126 Ga0307415_100070517 Ga0307415_1000705172 376
589 3300033180 Ga0307510_10032671 Ga0307510_100326712 376
590 3300035725 Ga0373947_0150035 Ga0373947_0150035_80_1243 376
591 3300046452 Ga0495617_019755 Ga0495617_019755_847_2010 376
592 3300046460 Ga0495638_0035056 Ga0495638_0035056_1970_3133 376
593 3300046492 Ga0495585_0116110 Ga0495585_0116110_274_1404 376
594 3300046522 Ga0495643_0022609 Ga0495643_0022609_20_1183 376
595 3300046523 Ga0495644_0041560 Ga0495644_0041560_213_1376 376
596 3300046524 Ga0495648_0001784 Ga0495648_0001784_1771_2925 376
597 3300046524 Ga0495648_0067160 Ga0495648_0067160_486_1649 376
598 3300046528 Ga0495642_0081062 Ga0495642_0081062_26_1156 376
599 3300046674 Ga0495588_0009215 Ga0495588_0009215_2008_3171 376
600 3300046680 Ga0495646_0170019 Ga0495646_0170019_33_1166 376
601 3300048905 Ga0496102_0181495 Ga0496102_0181495_251_1414 376
602 3300048907 Ga0496104_0068809 Ga0496104_0068809_1563_2813 376
603 3300048907 Ga0496104_0178470 Ga0496104_0178470_173_1303 376
604 3300048908 Ga0496105_0289013 Ga0496105_0289013_54_1217 376
605 3300048911 Ga0496108_0032155 Ga0496108_0032155_2662_3912 376
606 3300048912 Ga0496109_0037794 Ga0496109_0037794_970_2103 376
607 3300048912 Ga0496109_0127133 Ga0496109_0127133_1072_2235 376
608 3300048913 Ga0496110_0061946 Ga0496110_0061946_1646_2896 376
609 3300048915 Ga0496112_0016187 Ga0496112_0016187_3997_5235 376
610 3300048915 Ga0496112_0120152 Ga0496112_0120152_1252_2502 376
611 3300048916 Ga0496113_0078007 Ga0496113_0078007_1172_2422 376
612 3300048924 Ga0496121_0243521 Ga0496121_0243521_69_1232 376
613 3300048927 Ga0496124_0099057 Ga0496124_0099057_669_1832 376
614 3300048929 Ga0496126_0004798 Ga0496126_0004798_7729_8892 376
615 3300048929 Ga0496126_0066024 Ga0496126_0066024_1330_2460 376
616 3300050490 nmdc:mga03n38_103458_c1 nmdc:mga03n38_103458_c1_62_1225 376
617 3300050491 nmdc:mga00v17_83601_c1 nmdc:mga00v17_83601_c1_91_1254 376
618 3300050492 nmdc:mga0yw44_78912_c1 nmdc:mga0yw44_78912_c1_243_1406 376
619 3300050493 nmdc:mga0k408_95234_c1 nmdc:mga0k408_95234_c1_557_1720 376
620 3300050494 nmdc:mga06z11_111691_c1 nmdc:mga06z11_111691_c1_14_1144 376
621 3300050496 nmdc:mga07m45_137994_c1 nmdc:mga07m45_137994_c1_269_1399 376
622 3300050496 nmdc:mga07m45_67495_c1 nmdc:mga07m45_67495_c1_830_1993 376
623 iso_pu_bacteria 2721755755 2723846357 376
624 iso_pu_bacteria 2791355199 2793081176 376
625 iso_pu_bacteria 2885383462 2885389222 376
626 iso_pu_bacteria 2903768456 2903774533 376
627 iso_pu_bacteria 8006984368 8006991901 376
628 iso_pu_bacteria 8056681323 8056687963 376
629 3300001979 JGI24740J21852_10022084 JGI24740J21852_100220842 377
630 3300001990 JGI24737J22298_10004937 JGI24737J22298_100049373 377
631 3300001990 JGI24737J22298_10037209 JGI24737J22298_100372091 377
632 3300003203 JGI25406J46586_10000700 JGI25406J46586_100007006 377
633 3300003215 JGI25153J46596_10001125 JGI25153J46596_1000112516 377
634 3300003354 JGI25160J50197_1002409 JGI25160J50197_10024098 377
635 3300003752 Ga0055539_1005731 Ga0055539_10057311 377
636 3300003794 Ga0055531_10007045 Ga0055531_100070452 377
637 3300003794 Ga0055531_10009469 Ga0055531_100094695 377
638 3300004625 Ga0055543_1006074 Ga0055543_10060744 377
639 3300005262 Ga0065165_1000278 Ga0065165_100027829 377
640 3300005262 Ga0065165_1002873 Ga0065165_10028738 377
641 3300005329 Ga0070683_100009575 Ga0070683_10000957510 377
642 3300005337 Ga0070682_100005543 Ga0070682_1000055438 377
643 3300005339 Ga0070660_100006525 Ga0070660_1000065258 377
644 3300005341 Ga0070691_10030477 Ga0070691_100304772 377
645 3300005344 Ga0070661_100121025 Ga0070661_1001210251 377
646 3300005353 Ga0070669_100222214 Ga0070669_1002222142 377
647 3300005434 Ga0070709_10000431 Ga0070709_100004317 377
648 3300005434 Ga0070709_10003284 Ga0070709_100032844 377
649 3300005436 Ga0070713_100001721 Ga0070713_10000172111 377
650 3300005437 Ga0070710_10002809 Ga0070710_100028091 377
651 3300005439 Ga0070711_100008795 Ga0070711_1000087956 377
652 3300005445 Ga0070708_100121134 Ga0070708_1001211342 377
653 3300005456 Ga0070678_100009616 Ga0070678_1000096164 377
654 3300005458 Ga0070681_10013583 Ga0070681_100135832 377
655 3300005458 Ga0070681_10099637 Ga0070681_100996372 377
656 3300005459 Ga0068867_100165393 Ga0068867_1001653932 377
657 3300005468 Ga0070707_100133263 Ga0070707_1001332632 377
658 3300005530 Ga0070679_100003512 Ga0070679_10000351214 377
659 3300005530 Ga0070679_100058123 Ga0070679_1000581232 377
660 3300005535 Ga0070684_100017018 Ga0070684_1000170185 377
661 3300005535 Ga0070684_100056264 Ga0070684_1000562643 377
662 3300005539 Ga0068853_100015346 Ga0068853_1000153463 377
663 3300005539 Ga0068853_100018955 Ga0068853_1000189552 377
664 3300005543 Ga0070672_100140484 Ga0070672_1001404842 377
665 3300005547 Ga0070693_100060480 Ga0070693_1000604803 377
666 3300005563 Ga0068855_100012484 Ga0068855_1000124844 377
667 3300005563 Ga0068855_100013959 Ga0068855_1000139595 377
668 3300005563 Ga0068855_100067026 Ga0068855_1000670264 377
669 3300005564 Ga0070664_100171422 Ga0070664_1001714222 377
670 3300005577 Ga0068857_100023185 Ga0068857_1000231852 377
671 3300005578 Ga0068854_100046236 Ga0068854_1000462362 377
672 3300005614 Ga0068856_100021414 Ga0068856_1000214145 377
673 3300005614 Ga0068856_100233861 Ga0068856_1002338611 377
674 3300005616 Ga0068852_100016271 Ga0068852_1000162712 377
675 3300005616 Ga0068852_100025493 Ga0068852_1000254934 377
676 3300005834 Ga0068851_10002991 Ga0068851_100029914 377
677 3300005842 Ga0068858_100152170 Ga0068858_1001521702 377
678 3300005843 Ga0068860_100000240 Ga0068860_10000024012 377
679 3300005937 Ga0081455_10037951 Ga0081455_100379513 377
680 3300005983 Ga0081540_1006586 Ga0081540_10065867 377
681 3300005983 Ga0081540_1037358 Ga0081540_10373582 377
682 3300005985 Ga0081539_10000726 Ga0081539_1000072662 377
683 3300006028 Ga0070717_10002854 Ga0070717_100028548 377
684 3300006028 Ga0070717_10004642 Ga0070717_100046423 377
685 3300006028 Ga0070717_10036271 Ga0070717_100362714 377
686 3300006051 Ga0075364_10031725 Ga0075364_100317253 377
687 3300006051 Ga0075364_10102033 Ga0075364_101020331 377
688 3300006173 Ga0070716_100005655 Ga0070716_1000056554 377
689 3300006175 Ga0070712_100039641 Ga0070712_1000396415 377
690 3300006178 Ga0075367_10004792 Ga0075367_100047922 377
691 3300006186 Ga0075369_10023402 Ga0075369_100234023 377
692 3300006186 Ga0075369_10033346 Ga0075369_100333462 377
693 3300006195 Ga0075366_10008198 Ga0075366_100081982 377
694 3300006353 Ga0075370_10042995 Ga0075370_100429952 377
695 3300006941 Ga0099825_1026880 Ga0099825_10268804 377
696 3300006943 Ga0099822_1002963 Ga0099822_100296313 377
697 3300006944 Ga0099823_1013686 Ga0099823_10136866 377
698 3300009093 Ga0105240_10025799 Ga0105240_100257996 377
699 3300009093 Ga0105240_10032117 Ga0105240_100321175 377
700 3300009101 Ga0105247_10025838 Ga0105247_100258381 377
701 3300009101 Ga0105247_10029784 Ga0105247_100297842 377
702 3300009101 Ga0105247_10084184 Ga0105247_100841842 377
703 3300009174 Ga0105241_10000872 Ga0105241_100008724 377
704 3300009174 Ga0105241_10057806 Ga0105241_100578062 377
705 3300009174 Ga0105241_10299934 Ga0105241_102999342 377
706 3300009176 Ga0105242_10194172 Ga0105242_101941722 377
707 3300009545 Ga0105237_10027826 Ga0105237_100278262 377
708 3300009545 Ga0105237_10030267 Ga0105237_100302674 377
709 3300009545 Ga0105237_10034577 Ga0105237_100345774 377
710 3300009545 Ga0105237_10048829 Ga0105237_100488293 377
711 3300009545 Ga0105237_10196643 Ga0105237_101966432 377
712 3300009551 Ga0105238_10012425 Ga0105238_100124254 377
713 3300009551 Ga0105238_10026555 Ga0105238_100265556 377
714 3300009551 Ga0105238_10049128 Ga0105238_100491282 377
715 3300009553 Ga0105249_10355872 Ga0105249_103558722 377
716 3300010375 Ga0105239_10008436 Ga0105239_100084363 377
717 3300010375 Ga0105239_10014132 Ga0105239_100141322 377
718 3300010375 Ga0105239_10014787 Ga0105239_100147871 377
719 3300010375 Ga0105239_10067898 Ga0105239_100678984 377
720 3300010375 Ga0105239_10086236 Ga0105239_100862365 377
721 3300010375 Ga0105239_10333935 Ga0105239_103339351 377
722 3300010375 Ga0105239_10369734 Ga0105239_103697341 377
723 3300013104 Ga0157370_10036670 Ga0157370_100366705 377
724 3300013104 Ga0157370_10072684 Ga0157370_100726841 377
725 3300013105 Ga0157369_10037411 Ga0157369_100374116 377
726 3300013105 Ga0157369_10114976 Ga0157369_101149762 377
727 3300013105 Ga0157369_10258860 Ga0157369_102588602 377
728 3300013297 Ga0157378_10014368 Ga0157378_100143686 377
729 3300013306 Ga0163162_10535819 Ga0163162_105358191 377
730 3300014325 Ga0163163_10173620 Ga0163163_101736202 377
731 3300014325 Ga0163163_10278843 Ga0163163_102788432 377
732 3300014326 Ga0157380_10134712 Ga0157380_101347121 377
733 3300014968 Ga0157379_10175992 Ga0157379_101759922 377
734 3300014969 Ga0157376_10068292 Ga0157376_100682924 377
735 3300021384 Ga0213876_10023374 Ga0213876_100233742 377
736 3300025253 Ga0209677_102267 Ga0209677_1022674 377
737 3300025261 Ga0209233_1010953 Ga0209233_10109532 377
738 3300025295 Ga0209564_1003632 Ga0209564_10036322 377
739 3300025295 Ga0209564_1004939 Ga0209564_10049392 377
740 3300025297 Ga0209758_1000065 Ga0209758_100006537 377
741 3300025297 Ga0209758_1000498 Ga0209758_100049815 377
742 3300025297 Ga0209758_1005790 Ga0209758_10057902 377
743 3300025297 Ga0209758_1016433 Ga0209758_10164333 377
744 3300025297 Ga0209758_1018995 Ga0209758_10189954 377
745 3300025299 Ga0209256_1006613 Ga0209256_10066134 377
746 3300025302 Ga0207426_1000721 Ga0207426_100072130 377
747 3300025302 Ga0207426_1013877 Ga0207426_10138772 377
748 3300025304 Ga0209257_1001031 Ga0209257_100103120 377
749 3300025304 Ga0209257_1024026 Ga0209257_10240262 377
750 3300025898 Ga0207692_10001280 Ga0207692_100012803 377
751 3300025898 Ga0207692_10007388 Ga0207692_100073886 377
752 3300025903 Ga0207680_10083113 Ga0207680_100831132 377
753 3300025904 Ga0207647_10003213 Ga0207647_100032134 377
754 3300025906 Ga0207699_10002307 Ga0207699_100023075 377
755 3300025906 Ga0207699_10032744 Ga0207699_100327442 377
756 3300025910 Ga0207684_10036712 Ga0207684_100367127 377
757 3300025911 Ga0207654_10127702 Ga0207654_101277022 377
758 3300025912 Ga0207707_10002451 Ga0207707_100024512 377
759 3300025912 Ga0207707_10007228 Ga0207707_100072281 377
760 3300025912 Ga0207707_10101122 Ga0207707_101011222 377
761 3300025912 Ga0207707_10114364 Ga0207707_101143642 377
762 3300025913 Ga0207695_10001543 Ga0207695_1000154338 377
763 3300025913 Ga0207695_10121382 Ga0207695_101213823 377
764 3300025914 Ga0207671_10032059 Ga0207671_100320593 377
765 3300025914 Ga0207671_10086745 Ga0207671_100867452 377
766 3300025914 Ga0207671_10112844 Ga0207671_101128442 377
767 3300025915 Ga0207693_10005552 Ga0207693_100055526 377
768 3300025915 Ga0207693_10125323 Ga0207693_101253232 377
769 3300025916 Ga0207663_10032760 Ga0207663_100327604 377
770 3300025916 Ga0207663_10075087 Ga0207663_100750872 377
771 3300025917 Ga0207660_10006133 Ga0207660_100061336 377
772 3300025917 Ga0207660_10037939 Ga0207660_100379392 377
773 3300025917 Ga0207660_10047545 Ga0207660_100475451 377
774 3300025919 Ga0207657_10005831 Ga0207657_100058313 377
775 3300025921 Ga0207652_10016568 Ga0207652_100165687 377
776 3300025921 Ga0207652_10037786 Ga0207652_100377862 377
777 3300025921 Ga0207652_10047929 Ga0207652_100479295 377
778 3300025923 Ga0207681_10130378 Ga0207681_101303781 377
779 3300025924 Ga0207694_10010545 Ga0207694_100105452 377
780 3300025924 Ga0207694_10038644 Ga0207694_100386442 377
781 3300025924 Ga0207694_10043322 Ga0207694_100433222 377
782 3300025928 Ga0207700_10006043 Ga0207700_100060434 377
783 3300025928 Ga0207700_10020115 Ga0207700_100201155 377
784 3300025928 Ga0207700_10074252 Ga0207700_100742522 377
785 3300025929 Ga0207664_10024588 Ga0207664_100245882 377
786 3300025932 Ga0207690_10090776 Ga0207690_100907761 377
787 3300025934 Ga0207686_10049584 Ga0207686_100495842 377
788 3300025939 Ga0207665_10009565 Ga0207665_100095654 377
789 3300025939 Ga0207665_10022510 Ga0207665_100225101 377
790 3300025939 Ga0207665_10235094 Ga0207665_102350942 377
791 3300025941 Ga0207711_10085541 Ga0207711_100855412 377
792 3300025941 Ga0207711_10179037 Ga0207711_101790372 377
793 3300025944 Ga0207661_10002727 Ga0207661_100027275 377
794 3300025944 Ga0207661_10088353 Ga0207661_100883532 377
795 3300025949 Ga0207667_10011808 Ga0207667_100118082 377
796 3300025949 Ga0207667_10021994 Ga0207667_100219942 377
797 3300025949 Ga0207667_10060535 Ga0207667_100605353 377
798 3300025949 Ga0207667_10110436 Ga0207667_101104362 377
799 3300025981 Ga0207640_10018060 Ga0207640_100180603 377
800 3300026035 Ga0207703_10036553 Ga0207703_100365532 377
801 3300026035 Ga0207703_10051235 Ga0207703_100512352 377
802 3300026035 Ga0207703_10283850 Ga0207703_102838501 377
803 3300026041 Ga0207639_10029262 Ga0207639_100292622 377
804 3300026041 Ga0207639_10063595 Ga0207639_100635952 377
805 3300026067 Ga0207678_10047437 Ga0207678_100474372 377
806 3300026067 Ga0207678_10054204 Ga0207678_100542043 377
807 3300026067 Ga0207678_10071473 Ga0207678_100714734 377
808 3300026078 Ga0207702_10000005 Ga0207702_10000005322 377
809 3300026078 Ga0207702_10184601 Ga0207702_101846012 377
810 3300026078 Ga0207702_10185846 Ga0207702_101858462 377
811 3300026095 Ga0207676_10128855 Ga0207676_101288553 377
812 3300026116 Ga0207674_10007797 Ga0207674_100077972 377
813 3300026116 Ga0207674_10009659 Ga0207674_100096592 377
814 3300026116 Ga0207674_10012698 Ga0207674_100126984 377
815 3300026116 Ga0207674_10022025 Ga0207674_100220256 377
816 3300026116 Ga0207674_10094786 Ga0207674_100947862 377
817 3300026121 Ga0207683_10015940 Ga0207683_100159403 377
818 3300026142 Ga0207698_10103212 Ga0207698_101032122 377
819 3300026142 Ga0207698_10188496 Ga0207698_101884961 377
820 3300027296 Ga0209389_1000011 Ga0209389_100001127 377
821 3300027357 Ga0209589_1000018 Ga0209589_100001813 377
822 3300027361 Ga0209489_100017 Ga0209489_100017207 377
823 3300027361 Ga0209489_100026 Ga0209489_10002613 377
824 3300027363 Ga0209700_100027 Ga0209700_10002727 377
825 3300027363 Ga0209700_100035 Ga0209700_10003513 377
826 3300027866 Ga0209813_10033936 Ga0209813_100339361 377
827 3300028379 Ga0268266_10003137 Ga0268266_1000313710 377
828 3300028379 Ga0268266_10034331 Ga0268266_100343316 377
829 3300028379 Ga0268266_10406073 Ga0268266_104060731 377
830 3300028380 Ga0268265_10343121 Ga0268265_103431211 377
831 3300028381 Ga0268264_10000035 Ga0268264_10000035170 377
832 3300028556 Ga0265337_1031546 Ga0265337_10315461 377
833 3300028573 Ga0265334_10034157 Ga0265334_100341572 377
834 3300028653 Ga0265323_10002189 Ga0265323_100021898 377
835 3300028666 Ga0265336_10006616 Ga0265336_100066161 377
836 3300028786 Ga0307517_10003575 Ga0307517_1000357520 377
837 3300028794 Ga0307515_10066798 Ga0307515_100667985 377
838 3300028800 Ga0265338_10013740 Ga0265338_100137408 377
839 3300031247 Ga0265340_10096641 Ga0265340_100966411 377
840 3300031249 Ga0265339_10001392 Ga0265339_1000139210 377
841 3300031249 Ga0265339_10064560 Ga0265339_100645601 377
842 3300031250 Ga0265331_10070024 Ga0265331_100700242 377
843 3300031616 Ga0307508_10000650 Ga0307508_1000065035 377
844 3300031616 Ga0307508_10004051 Ga0307508_100040512 377
845 3300031616 Ga0307508_10101377 Ga0307508_101013772 377
846 3300031711 Ga0265314_10057962 Ga0265314_100579621 377
847 3300031712 Ga0265342_10058050 Ga0265342_100580503 377
848 3300031730 Ga0307516_10031887 Ga0307516_100318876 377
849 3300031730 Ga0307516_10052030 Ga0307516_100520302 377
850 3300031911 Ga0307412_10261115 Ga0307412_102611151 377
851 3300031995 Ga0307409_100067780 Ga0307409_1000677803 377
852 3300032002 Ga0307416_100076218 Ga0307416_1000762181 377
853 3300033179 Ga0307507_10053828 Ga0307507_100538283 377
854 3300033180 Ga0307510_10025336 Ga0307510_100253363 377
855 3300033180 Ga0307510_10087718 Ga0307510_100877184 377
856 3300033180 Ga0307510_10088432 Ga0307510_100884322 377
857 3300033442 Ga0315911_1000011 Ga0315911_100001114 377
858 3300035083 Ga0373926_0006551 Ga0373926_0006551_596_1861 377
859 3300035083 Ga0373926_0074259 Ga0373926_0074259_73_1206 377
860 3300035086 Ga0373934_0035810 Ga0373934_0035810_59_1192 377
861 3300035086 Ga0373934_0041741 Ga0373934_0041741_477_1610 377
862 3300035088 Ga0373940_0006754 Ga0373940_0006754_179_1312 377
863 3300035111 Ga0373923_0036370 Ga0373923_0036370_528_1793 377
864 3300035113 Ga0373936_0020740 Ga0373936_0020740_663_1928 377
865 3300035116 Ga0373945_0030570 Ga0373945_0030570_663_1796 377
866 3300035117 Ga0373953_0002754 Ga0373953_0002754_647_1780 377
867 3300035118 Ga0373954_0008277 Ga0373954_0008277_2057_3190 377
868 3300035118 Ga0373954_0043259 Ga0373954_0043259_206_1471 377
869 3300035119 Ga0373956_0004160 Ga0373956_0004160_1040_2173 377
870 3300035119 Ga0373956_0011086 Ga0373956_0011086_299_1432 377
871 3300035119 Ga0373956_0039813 Ga0373956_0039813_552_1817 377
872 3300035120 Ga0373957_0002175 Ga0373957_0002175_3632_4765 377
873 3300035121 Ga0373960_0044337 Ga0373960_0044337_57_1190 377
874 3300035171 Ga0373946_0037289 Ga0373946_0037289_420_1685 377
875 3300035172 Ga0373955_0000510 Ga0373955_0000510_1200_2333 377
876 3300035172 Ga0373955_0013167 Ga0373955_0013167_1444_2577 377
877 3300035172 Ga0373955_0014368 Ga0373955_0014368_422_1555 377
878 3300035172 Ga0373955_0030619 Ga0373955_0030619_329_1594 377
879 3300035410 Ga0373924_0011441 Ga0373924_0011441_624_1757 377
880 3300035410 Ga0373924_0038476 Ga0373924_0038476_97_1362 377
881 3300035410 Ga0373924_0070339 Ga0373924_0070339_137_1270 377
882 3300035691 Ga0373931_0002710 Ga0373931_0002710_235_1368 377
883 3300035692 Ga0373935_0007256 Ga0373935_0007256_2043_3209 377
884 3300035692 Ga0373935_0027681 Ga0373935_0027681_1022_2155 377
885 3300035692 Ga0373935_0072367 Ga0373935_0072367_294_1559 377
886 3300035695 Ga0373927_0001621 Ga0373927_0001621_11224_12357 377
887 3300035695 Ga0373927_0060511 Ga0373927_0060511_635_1801 377
888 3300035695 Ga0373927_0065019 Ga0373927_0065019_696_1829 377
889 3300035724 Ga0373933_0006367 Ga0373933_0006367_1212_2345 377
890 3300035724 Ga0373933_0077991 Ga0373933_0077991_384_1517 377
891 3300035724 Ga0373933_0122504 Ga0373933_0122504_478_1611 377
892 3300035725 Ga0373947_0001795 Ga0373947_0001795_5437_6570 377
893 3300035725 Ga0373947_0002633 Ga0373947_0002633_4917_6050 377
894 3300035725 Ga0373947_0015294 Ga0373947_0015294_1304_2569 377
895 3300036401 Ga0373937_0023676 Ga0373937_0023676_3190_4323 377
896 3300036401 Ga0373937_0043679 Ga0373937_0043679_602_1735 377
897 3300036401 Ga0373937_0107071 Ga0373937_0107071_174_1307 377
898 3300036401 Ga0373937_0138283 Ga0373937_0138283_966_2099 377
899 3300036459 Ga0372808_001316 Ga0372808_001316_558_1691 377
900 3300037068 Ga0373925_0006728 Ga0373925_0006728_2509_3642 377
901 3300037068 Ga0373925_0028136 Ga0373925_0028136_1648_2814 377
902 3300037466 Ga0395898_0070289 Ga0395898_0070289_927_2060 377
903 3300037466 Ga0395898_0122783 Ga0395898_0122783_801_1934 377
904 3300037466 Ga0395898_0183238 Ga0395898_0183238_857_1990 377
905 3300037471 Ga0395905_0034044 Ga0395905_0034044_2209_3342 377
906 3300037853 Ga0436364_0662595 Ga0436364_0662595_139_1416 377
907 3300037853 Ga0436364_1342884 Ga0436364_1342884_3088_4221 377
908 3300039437 Ga0436365_0607645 Ga0436365_0607645_2248_3381 377
909 3300039438 Ga0436360_1294928 Ga0436360_1294928_323_1456 377
910 3300044658 Ga0466972_0000648 Ga0466972_0000648_7342_8475 377
911 3300044694 Ga0466963_0234149 Ga0466963_0234149_36_1169 377
912 3300044706 Ga0466964_0087931 Ga0466964_0087931_180_1313 377
913 3300044765 Ga0466970_0030263 Ga0466970_0030263_1578_2711 377
914 3300044842 Ga0466957_0049313 Ga0466957_0049313_672_1805 377
915 3300045049 Ga0466959_0092799 Ga0466959_0092799_643_1776 377
916 3300046454 Ga0495592_0029930 Ga0495592_0029930_2012_3145 377
917 3300046454 Ga0495592_0035643 Ga0495592_0035643_101_1234 377
918 3300046454 Ga0495592_0116152 Ga0495592_0116152_418_1683 377
919 3300046455 Ga0495603_0000094 Ga0495603_0000094_6660_7793 377
920 3300046455 Ga0495603_0012995 Ga0495603_0012995_746_1879 377
921 3300046455 Ga0495603_0018344 Ga0495603_0018344_2443_3576 377
922 3300046459 Ga0495629_0000612 Ga0495629_0000612_1373_2506 377
923 3300046459 Ga0495629_0004307 Ga0495629_0004307_9474_10607 377
924 3300046459 Ga0495629_0109103 Ga0495629_0109103_228_1493 377
925 3300046459 Ga0495629_0121151 Ga0495629_0121151_44_1177 377
926 3300046460 Ga0495638_0001554 Ga0495638_0001554_2323_3456 377
927 3300046460 Ga0495638_0077178 Ga0495638_0077178_388_1521 377
928 3300046461 Ga0495641_0001895 Ga0495641_0001895_9202_10335 377
929 3300046462 Ga0495651_0036353 Ga0495651_0036353_2486_3619 377
930 3300046462 Ga0495651_0117906 Ga0495651_0117906_601_1734 377
931 3300046463 Ga0495653_0000399 Ga0495653_0000399_33237_34370 377
932 3300046463 Ga0495653_0072447 Ga0495653_0072447_1248_2381 377
933 3300046472 Ga0495580_0002744 Ga0495580_0002744_4049_5182 377
934 3300046473 Ga0495582_0001055 Ga0495582_0001055_4429_5562 377
935 3300046474 Ga0495605_0065499 Ga0495605_0065499_382_1515 377
936 3300046475 Ga0495639_0000114 Ga0495639_0000114_32155_33288 377
937 3300046476 Ga0495662_0000093 Ga0495662_0000093_12233_13366 377
938 3300046477 Ga0495664_0006628 Ga0495664_0006628_2106_3371 377
939 3300046477 Ga0495664_0033601 Ga0495664_0033601_228_1361 377
940 3300046511 Ga0495608_0001226 Ga0495608_0001226_16472_17605 377
941 3300046514 Ga0495618_0027537 Ga0495618_0027537_1341_2474 377
942 3300046514 Ga0495618_0176291 Ga0495618_0176291_90_1223 377
943 3300046516 Ga0495628_0082230 Ga0495628_0082230_711_1844 377
944 3300046516 Ga0495628_0084487 Ga0495628_0084487_609_1742 377
945 3300046516 Ga0495628_0112357 Ga0495628_0112357_120_1253 377
946 3300046516 Ga0495628_0171772 Ga0495628_0171772_72_1205 377
947 3300046517 Ga0495630_0000459 Ga0495630_0000459_8218_9351 377
948 3300046517 Ga0495630_0044428 Ga0495630_0044428_537_1802 377
949 3300046522 Ga0495643_0017992 Ga0495643_0017992_1321_2454 377
950 3300046524 Ga0495648_0057247 Ga0495648_0057247_892_2025 377
951 3300046526 Ga0495666_0099665 Ga0495666_0099665_80_1345 377
952 3300046529 Ga0495652_0027433 Ga0495652_0027433_2148_3281 377
953 3300046529 Ga0495652_0028960 Ga0495652_0028960_216_1349 377
954 3300046529 Ga0495652_0111366 Ga0495652_0111366_453_1586 377
955 3300046531 Ga0495665_0000613 Ga0495665_0000613_9960_11093 377
956 3300046531 Ga0495665_0024504 Ga0495665_0024504_454_1719 377
957 3300046533 Ga0495640_0014863 Ga0495640_0014863_1549_2814 377
958 3300046533 Ga0495640_0015770 Ga0495640_0015770_536_1669 377
959 3300046533 Ga0495640_0029758 Ga0495640_0029758_757_1890 377
960 3300046533 Ga0495640_0030534 Ga0495640_0030534_1515_2648 377
961 3300046536 Ga0495587_0001432 Ga0495587_0001432_13978_15111 377
962 3300046538 Ga0495609_0060286 Ga0495609_0060286_381_1526 377
963 3300046542 Ga0495597_0059231 Ga0495597_0059231_293_1426 377
964 3300046543 Ga0495645_0024571 Ga0495645_0024571_2228_3361 377
965 3300046543 Ga0495645_0074327 Ga0495645_0074327_253_1386 377
966 3300046557 Ga0495622_0001333 Ga0495622_0001333_2672_3805 377
967 3300046559 Ga0495667_0001452 Ga0495667_0001452_478_1611 377
968 3300046559 Ga0495667_0030262 Ga0495667_0030262_149_1282 377
969 3300046559 Ga0495667_0120590 Ga0495667_0120590_148_1281 377
970 3300046642 Ga0495634_0001601 Ga0495634_0001601_10209_11342 377
971 3300046642 Ga0495634_0050455 Ga0495634_0050455_930_2063 377
972 3300046642 Ga0495634_0056873 Ga0495634_0056873_199_1332 377
973 3300046663 Ga0495635_0000088 Ga0495635_0000088_51957_53090 377
974 3300046663 Ga0495635_0001000 Ga0495635_0001000_9073_10206 377
975 3300046674 Ga0495588_0038624 Ga0495588_0038624_333_1466 377
976 3300046675 Ga0495657_0001352 Ga0495657_0001352_11223_12356 377
977 3300046675 Ga0495657_0141187 Ga0495657_0141187_140_1273 377
978 3300046678 Ga0495599_0061777 Ga0495599_0061777_216_1349 377
979 3300046678 Ga0495599_0065968 Ga0495599_0065968_544_1677 377
980 3300046679 Ga0495623_0010431 Ga0495623_0010431_477_1610 377
981 3300046679 Ga0495623_0084635 Ga0495623_0084635_350_1615 377
982 3300046680 Ga0495646_0031727 Ga0495646_0031727_790_1923 377
983 3300046680 Ga0495646_0101785 Ga0495646_0101785_79_1212 377
984 3300046681 Ga0495647_0000070 Ga0495647_0000070_21242_22375 377
985 3300046683 Ga0495658_0001004 Ga0495658_0001004_6369_7502 377
986 3300046689 Ga0495613_0003317 Ga0495613_0003317_6599_7732 377
987 3300046689 Ga0495613_0071654 Ga0495613_0071654_481_1614 377
988 3300046690 Ga0495624_0003008 Ga0495624_0003008_8989_10122 377
989 3300046690 Ga0495624_0032884 Ga0495624_0032884_1682_2947 377
990 3300046694 Ga0495649_0058586 Ga0495649_0058586_380_1513 377
991 3300046809 Ga0495600_0000484 Ga0495600_0000484_18822_19955 377
992 3300046809 Ga0495600_0006880 Ga0495600_0006880_683_1816 377
993 3300046809 Ga0495600_0036737 Ga0495600_0036737_871_2004 377
994 3300047315 Ga0495581_0000082 Ga0495581_0000082_15843_16976 377
995 3300047317 Ga0495604_0011766 Ga0495604_0011766_1423_2556 377
996 3300047317 Ga0495604_0027775 Ga0495604_0027775_3212_4345 377
997 3300047319 Ga0495674_0005809 Ga0495674_0005809_10356_11489 377
998 3300047319 Ga0495674_0036094 Ga0495674_0036094_2004_3137 377
999 3300047321 Ga0495676_0021438 Ga0495676_0021438_4342_5475 377
1000 3300047322 Ga0495680_0018227 Ga0495680_0018227_1249_2382 377
1001 3300047322 Ga0495680_0028622 Ga0495680_0028622_350_1483 377
1002 3300047443 Ga0495687_026026 Ga0495687_026026_1091_2224 377
1003 3300047444 Ga0495675_0004649 Ga0495675_0004649_2012_3145 377
1004 3300047469 Ga0495673_0007496 Ga0495673_0007496_3930_5063 377
1005 3300047471 Ga0495684_0001326 Ga0495684_0001326_2317_3450 377
1006 3300047471 Ga0495684_0009235 Ga0495684_0009235_2431_3696 377
1007 3300047471 Ga0495684_0137230 Ga0495684_0137230_458_1591 377
1008 3300047472 Ga0495686_0053042 Ga0495686_0053042_254_1387 377
1009 3300047673 Ga0495593_0000206 Ga0495593_0000206_21319_22452 377
1010 3300047673 Ga0495593_0005786 Ga0495593_0005786_2801_3934 377
1011 3300047673 Ga0495593_0027986 Ga0495593_0027986_92_1357 377
1012 3300048088 Ga0495602_0039586 Ga0495602_0039586_1194_2327 377
1013 3300048089 Ga0495614_0058901 Ga0495614_0058901_302_1435 377
1014 3300048903 Ga0496100_0033039 Ga0496100_0033039_544_1677 377
1015 3300048904 Ga0496101_0034967 Ga0496101_0034967_1824_2957 377
1016 3300048905 Ga0496102_0021781 Ga0496102_0021781_2658_3791 377
1017 3300048905 Ga0496102_0043876 Ga0496102_0043876_14_1147 377
1018 3300048907 Ga0496104_0045505 Ga0496104_0045505_2416_3549 377
1019 3300048907 Ga0496104_0086868 Ga0496104_0086868_14_1147 377
1020 3300048907 Ga0496104_0103275 Ga0496104_0103275_839_1972 377
1021 3300048909 Ga0496106_0001874 Ga0496106_0001874_6609_7775 377
1022 3300048910 Ga0496107_0003415 Ga0496107_0003415_5602_6735 377
1023 3300048911 Ga0496108_0064703 Ga0496108_0064703_1376_2509 377
1024 3300048911 Ga0496108_0094889 Ga0496108_0094889_529_1662 377
1025 3300048912 Ga0496109_0000767 Ga0496109_0000767_11747_12880 377
1026 3300048912 Ga0496109_0060890 Ga0496109_0060890_2175_3308 377
1027 3300048913 Ga0496110_0035417 Ga0496110_0035417_1518_2651 377
1028 3300048913 Ga0496110_0266253 Ga0496110_0266253_23_1168 377
1029 3300048914 Ga0496111_0016531 Ga0496111_0016531_1714_2847 377
1030 3300048914 Ga0496111_0100497 Ga0496111_0100497_146_1279 377
1031 3300048915 Ga0496112_0031588 Ga0496112_0031588_1744_2877 377
1032 3300048915 Ga0496112_0050257 Ga0496112_0050257_364_1497 377
1033 3300048915 Ga0496112_0090064 Ga0496112_0090064_976_2109 377
1034 3300048916 Ga0496113_0010421 Ga0496113_0010421_4118_5251 377
1035 3300048916 Ga0496113_0158758 Ga0496113_0158758_417_1550 377
1036 3300048917 Ga0496114_0029797 Ga0496114_0029797_1502_2635 377
1037 3300048917 Ga0496114_0081236 Ga0496114_0081236_231_1364 377
1038 3300048918 Ga0496115_0028522 Ga0496115_0028522_1454_2587 377
1039 3300048918 Ga0496115_0115411 Ga0496115_0115411_904_2037 377
1040 3300048919 Ga0496116_0079774 Ga0496116_0079774_818_1951 377
1041 3300048920 Ga0496117_0010525 Ga0496117_0010525_4107_5273 377
1042 3300048921 Ga0496118_0002852 Ga0496118_0002852_539_1705 377
1043 3300048922 Ga0496119_0105327 Ga0496119_0105327_373_1506 377
1044 3300048924 Ga0496121_0000041 Ga0496121_0000041_324715_325881 377
1045 3300048924 Ga0496121_0002334 Ga0496121_0002334_22686_23819 377
1046 3300048924 Ga0496121_0013525 Ga0496121_0013525_4350_5483 377
1047 3300048924 Ga0496121_0076211 Ga0496121_0076211_285_1418 377
1048 3300048924 Ga0496121_0087108 Ga0496121_0087108_920_2188 377
1049 3300048928 Ga0496125_0032161 Ga0496125_0032161_2383_3549 377
1050 3300048928 Ga0496125_0050130 Ga0496125_0050130_1593_2726 377
1051 3300048929 Ga0496126_0003893 Ga0496126_0003893_11678_12811 377
1052 3300048929 Ga0496126_0009161 Ga0496126_0009161_8929_10095 377
1053 3300048929 Ga0496126_0009826 Ga0496126_0009826_2654_3787 377
1054 3300048929 Ga0496126_0026815 Ga0496126_0026815_1007_2140 377
1055 3300048929 Ga0496126_0131725 Ga0496126_0131725_305_1438 377
1056 3300048929 Ga0496126_0148217 Ga0496126_0148217_819_1952 377
1057 3300048929 Ga0496126_0213781 Ga0496126_0213781_241_1374 377
1058 3300048929 Ga0496126_0278204 Ga0496126_0278204_145_1278 377
1059 3300049583 Ga0501067_0005167 Ga0501067_0005167_2601_3734 377
1060 3300049586 Ga0501070_0011879 Ga0501070_0011879_231_1364 377
1061 3300049590 Ga0501074_0018352 Ga0501074_0018352_2131_3264 377
1062 3300049742 Ga0501080_0170031 Ga0501080_0170031_800_1933 377
1063 3300049823 Ga0501044_0058173 Ga0501044_0058173_2642_3775 377
1064 3300050496 nmdc:mga07m45_18120_c1 nmdc:mga07m45_18120_c1_1373_2506 377
1065 3300050516 nmdc:mga0sz30_9477_c1 nmdc:mga0sz30_9477_c1_865_1998 377
1066 3300053077 Ga0495601_0023544 Ga0495601_0023544_601_1866 377
1067 3300053077 Ga0495601_0131740 Ga0495601_0131740_365_1498 377
1068 3300053078 Ga0495612_0024682 Ga0495612_0024682_1220_2353 377
1069 3300053084 Ga0495595_0007012 Ga0495595_0007012_1301_2434 377
1070 3300053085 Ga0495619_0000332 Ga0495619_0000332_31360_32493 377
1071 3300053085 Ga0495619_0020566 Ga0495619_0020566_2757_3944 377
1072 3300053085 Ga0495619_0164996 Ga0495619_0164996_61_1194 377
1073 3300053087 Ga0500643_000019 Ga0500643_000019_73250_74383 377
1074 3300053091 Ga0500647_0103879 Ga0500647_0103879_98_1264 377
1075 3300053093 Ga0500651_0073718 Ga0500651_0073718_829_1974 377
1076 3300053094 Ga0500566_0000601 Ga0500566_0000601_9935_11083 377
1077 3300053094 Ga0500566_0001951 Ga0500566_0001951_7334_8467 377
1078 3300053095 Ga0500640_002416 Ga0500640_002416_4113_5261 377
1079 3300053095 Ga0500640_012322 Ga0500640_012322_1320_2465 377
1080 3300053097 Ga0500648_052555 Ga0500648_052555_1126_2292 377
1081 3300053098 Ga0500650_0103427 Ga0500650_0103427_37_1170 377
1082 3300053103 Ga0500555_001381 Ga0500555_001381_2640_3773 377
1083 3300053111 Ga0500572_000758 Ga0500572_000758_3548_4735 377
1084 3300053111 Ga0500572_001291 Ga0500572_001291_4787_5935 377
1085 3300053111 Ga0500572_010449 Ga0500572_010449_107_1252 377
1086 3300053119 Ga0500595_000286 Ga0500595_000286_25207_26340 377
1087 3300053119 Ga0500595_006869 Ga0500595_006869_697_1830 377
1088 3300053119 Ga0500595_025451 Ga0500595_025451_18_1151 377
1089 3300053123 Ga0500614_001807 Ga0500614_001807_2790_3938 377
1090 3300053136 Ga0500559_0001730 Ga0500559_0001730_5172_6320 377
1091 3300053136 Ga0500559_0006207 Ga0500559_0006207_3438_4655 377
1092 3300053136 Ga0500559_0015073 Ga0500559_0015073_1651_2796 377
1093 3300053136 Ga0500559_0044324 Ga0500559_0044324_590_1756 377
1094 3300053138 Ga0500564_049740 Ga0500564_049740_492_1637 377
1095 3300053139 Ga0500568_0009922 Ga0500568_0009922_505_1638 377
1096 3300053139 Ga0500568_0029518 Ga0500568_0029518_960_2093 377
1097 3300053140 Ga0500573_0121613 Ga0500573_0121613_204_1370 377
1098 3300053148 Ga0500590_071244 Ga0500590_071244_115_1260 377
1099 3300053150 Ga0500603_000817 Ga0500603_000817_2740_3888 377
1100 3300053150 Ga0500603_002275 Ga0500603_002275_651_1784 377
1101 3300053150 Ga0500603_005730 Ga0500603_005730_169_1335 377
1102 3300053150 Ga0500603_010343 Ga0500603_010343_515_1648 377
1103 3300053151 Ga0500604_0020517 Ga0500604_0020517_84_1217 377
1104 3300053155 Ga0500620_003161 Ga0500620_003161_1155_2300 377
1105 3300053159 Ga0500630_001904 Ga0500630_001904_4766_5914 377
1106 3300053162 Ga0500638_000361 Ga0500638_000361_4923_6056 377
1107 3300053162 Ga0500638_077418 Ga0500638_077418_302_1435 377
1108 3300053163 Ga0500639_000166 Ga0500639_000166_16575_17723 377
1109 3300053163 Ga0500639_017659 Ga0500639_017659_2359_3576 377
1110 3300053177 Ga0500636_0000076 Ga0500636_0000076_22445_23590 377
1111 3300053177 Ga0500636_0027304 Ga0500636_0027304_2192_3325 377
1112 3300053177 Ga0500636_0090858 Ga0500636_0090858_520_1653 377
1113 3300053178 Ga0500637_0003785 Ga0500637_0003785_2692_3825 377
1114 3300053178 Ga0500637_0017525 Ga0500637_0017525_31_1164 377
1115 3300053730 Ga0500645_006029 Ga0500645_006029_3002_4150 377
1116 3300053731 Ga0500609_005292 Ga0500609_005292_600_1745 377
1117 3300053735 Ga0500596_000099 Ga0500596_000099_8986_10134 377
1118 3300053735 Ga0500596_002257 Ga0500596_002257_1531_2697 377
1119 3300053736 Ga0500599_002472 Ga0500599_002472_476_1609 377
1120 3300053737 Ga0500601_000030 Ga0500601_000030_21832_22977 377
1121 3300055283 Ga0500661_000031 Ga0500661_000031_13036_14169 377
1122 iso_pu_bacteria 2842045827 2842048781 377

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04138

GtrA

GtrA-like protein

331

448

0.97

PF00535

Glycos_transf_2

Glycosyl transferase family 2

96

263

0.96

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

93

271

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qi9-assembly1.cif.gz_A crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.2 in complex with udp 0.7388 14 246
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.738 18 225
3e25-assembly1.cif.gz_A-2 crystal structure of m. tuberculosis glucosyl-3-phosphoglycerate synthase 0.7357 19 251
5jt0-assembly1.cif.gz_A crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and glucosyl-3-phosphoglycerate (gpg) - gpgs*gpg*udp*mn2+ 0.7352 13 246
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7309 18 225
ID Description Score Start End Superfamily
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8983 20 242 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8914 19 202 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8796 20 242 3.90.550.10
af_K7MVE2_46_307_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8788 17 230 3.90.550.10
af_Q9VLQ1_42_326_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.873 17 247 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7Y6CFG3-F1-model_v4 Glycosyltransferase 0.9705 19 116 GO:0005886
GO:0016757
AF-A0A7Y6CFG3-F1-model_v4 Glycosyltransferase 0.9424 19 116 GO:0005886
GO:0016757
AF-A0A7X7EG14-F1-model_v4 deleted 0.9337 20 101
AF-A0A7W1QYZ0-F1-model_v4 Glycosyltransferase family 2 protein 0.9275 20 183 GO:0016757
AF-A0A2G4FMK8-F1-model_v4 Glycosyl transferase 0.925 18 187 GO:0016757

Feature Viewer

pLDDT pTM Quality
81.64 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map