F490416
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1122 | 636 | 896 | 382 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10084184|Ga0105247_100841842 |
| Length | 451 |
| Sequence | LGKDGDVELEGSGIETTTAERLRRMYARPLFVVVGIFGPVIRGGARRHHRQGFLHHPRLPRLAVRDAADIRIRTMNEAIRPAPPVPLQTADIPIVSVVVPTFNERDNVTTLYRRLEAAFKDVSWEVVFVDDNSPDGTWQVVRELSRNDSRVRCIRRIGRRGLSGACIEGILAASAPFAAVIDADLQHDETQLPKMLSLLQSGAAELVVGSRYVEGGSAASFDTKRAGASAFATEIARRALKVEVNDPMSGFFMIRRDRFEQIAPKLSTQGFKILLDIIASAEGGLRTVEVPYTFGSRLHGESKLDSMVALDFLGLVLAKMTNDVVSLRFLMFAMVGGIGLFVHLATLFLGLNLFDMPFAEAQALGAFIAMTSNFILNNFLTYRDQRLKGFAILRGLLAFYLVCSVGLLANVGVAFSVYDQEPIWWLAGAAGALMGVVWNYAMSGLFVWRKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 23 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 24 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 25 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 26 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 27 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 28 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 29 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 30 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 31 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 32 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 33 | 2791355199 | |||
| 34 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 35 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 36 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 37 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 38 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 39 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 40 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 41 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 42 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 43 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 44 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 45 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 46 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 47 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 48 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 49 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 50 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 51 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 52 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 53 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 54 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 55 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 56 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 57 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 58 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 59 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 60 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 61 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 62 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 63 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 64 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 65 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 66 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 67 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 68 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 69 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 70 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 71 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 72 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 73 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 74 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 75 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 76 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 77 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 78 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 79 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 80 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 81 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 82 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 83 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 84 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 85 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 86 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 87 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 88 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 89 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 90 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 91 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 92 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 93 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 94 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 95 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 96 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 97 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 98 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 99 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 100 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 101 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 102 | 2904699407 | |||
| 103 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 104 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 105 | 2906610324 | |||
| 106 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 107 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 108 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 109 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 110 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 111 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 112 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 113 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 114 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 115 | 2922368715 | |||
| 116 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 117 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 118 | 2922425934 | |||
| 119 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 120 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 121 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 122 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 123 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 124 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 125 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 126 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 127 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 128 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 129 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 130 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 131 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 132 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 133 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 134 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 135 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 136 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 137 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 138 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 139 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 140 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 141 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 142 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 143 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 144 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 145 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 146 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 147 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 148 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 149 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 150 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 151 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 152 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 153 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 154 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 155 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 156 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 157 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 158 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 159 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 160 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 161 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 162 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 163 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 164 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 165 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 166 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 167 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 168 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 169 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 170 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 171 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 172 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 173 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 174 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 175 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 176 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 177 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 178 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 179 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 180 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 181 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 182 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 183 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 184 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 185 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 186 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 187 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 188 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 189 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 190 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 191 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 192 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 193 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 194 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 195 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 196 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 197 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 198 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 199 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 200 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 201 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 202 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 204 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 205 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 207 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 208 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 209 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 210 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 212 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 218 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 220 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 221 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 226 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 227 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 228 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 229 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 230 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 231 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 232 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 236 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 238 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 239 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 240 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 241 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 242 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 243 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 244 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 245 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 246 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 247 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 248 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 249 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 250 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 252 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 253 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 254 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 255 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 256 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 257 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 258 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 259 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 260 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 261 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 263 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 264 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 265 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 266 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 267 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 268 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 269 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 270 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 279 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 280 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 281 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 289 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 290 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 292 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 293 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 294 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 295 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 296 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 298 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 300 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 301 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 302 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 303 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 351 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 352 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 353 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 354 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 355 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 356 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 360 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 361 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 362 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 363 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 364 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 365 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 366 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 367 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 368 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 369 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 370 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 371 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 372 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 373 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 374 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 375 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 376 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 377 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 378 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 379 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 380 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 381 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 382 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 383 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 384 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 385 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 386 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 387 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 388 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 389 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 390 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 391 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 392 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 393 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 394 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 395 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 396 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 397 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 398 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 399 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 400 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 401 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 402 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 403 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 404 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 405 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 406 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 407 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 408 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 409 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 410 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 411 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 412 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 413 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 414 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 415 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 416 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 417 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 418 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 419 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 420 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 421 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 422 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 423 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 424 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 425 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 490 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 491 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 492 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 493 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 494 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 495 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 496 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 497 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 498 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 499 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 500 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 501 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 502 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 503 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 504 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 505 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 506 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 507 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 508 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 509 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 510 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 511 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 512 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 513 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 514 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 515 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 516 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 522 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 525 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 526 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 528 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 529 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 530 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 531 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 532 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 533 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 534 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 535 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 536 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 537 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 538 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 539 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 540 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 542 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 543 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 544 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 545 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 546 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 547 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 548 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 549 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 550 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 551 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 553 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 558 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 559 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 560 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 561 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 562 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 563 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 564 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 565 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 566 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 567 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 568 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 569 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 570 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 571 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 572 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 573 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 574 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 575 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 576 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 577 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 578 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 579 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 580 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 581 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 582 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 583 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 584 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 585 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 586 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 587 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 588 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 589 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 590 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 591 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 592 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 593 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 594 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 595 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 596 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 597 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 598 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 599 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 600 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 601 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 602 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 603 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 604 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 605 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 606 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 607 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 608 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 609 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 610 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 611 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 612 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 613 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 614 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 615 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 616 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 617 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 618 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 619 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 620 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 621 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 622 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 623 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 624 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 625 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 626 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 627 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 628 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 629 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 630 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 631 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 632 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 633 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 634 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 635 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 636 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.13 |
| Metatranscriptomes | 0.09 |
| Isolates | 19.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.03 |
| Nodule | 15.86 |
| Rhizoplane | 4.81 |
| Rhizosphere | 56.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10022084 | 3300001979 | Bacteria | 2196 |
| 2 | JGI24737J22298_10004937 | 3300001990 | Bacteria | 4622 |
| 3 | JGI24737J22298_10037209 | 3300001990 | Bacteria | 1500 |
| 4 | JGI25406J46586_10000700 | 3300003203 | Bacteria | 15651 |
| 5 | JGI25153J46596_10001125 | 3300003215 | Bacteria | 16201 |
| 6 | rootH2_10001288 | 3300003320 | Bacteria | 28436 |
| 7 | rootH1_10167409 | 3300003323 | Bacteria | 3072 |
| 8 | JGI25160J50197_1002409 | 3300003354 | Bacteria | 8720 |
| 9 | Ga0055539_1005731 | 3300003752 | Bacteria | 1604 |
| 10 | Ga0055531_10007045 | 3300003794 | Bacteria | 6223 |
| 11 | Ga0055531_10009469 | 3300003794 | Bacteria | 4975 |
| 12 | Ga0055543_1006074 | 3300004625 | Bacteria | 2980 |
| 13 | Ga0065165_1000278 | 3300005262 | Bacteria | 87353 |
| 14 | Ga0065165_1002873 | 3300005262 | Bacteria | 13275 |
| 15 | Ga0065165_1003794 | 3300005262 | Bacteria | 10105 |
| 16 | Ga0070658_10091665 | 3300005327 | Bacteria | 2504 |
| 17 | Ga0070683_100009575 | 3300005329 | Bacteria | 8295 |
| 18 | Ga0070690_100134148 | 3300005330 | Bacteria | 1675 |
| 19 | Ga0070670_100266966 | 3300005331 | Bacteria | 1492 |
| 20 | Ga0068869_100011108 | 3300005334 | Bacteria | 5899 |
| 21 | Ga0070680_100162499 | 3300005336 | Bacteria | 1877 |
| 22 | Ga0070682_100005543 | 3300005337 | Bacteria | 7029 |
| 23 | Ga0068868_100018795 | 3300005338 | Bacteria | 5170 |
| 24 | Ga0068868_100252254 | 3300005338 | Bacteria | 1485 |
| 25 | Ga0070660_100006525 | 3300005339 | Bacteria | 8094 |
| 26 | Ga0070691_10030477 | 3300005341 | Bacteria | 2527 |
| 27 | Ga0070661_100121025 | 3300005344 | Bacteria | 1961 |
| 28 | Ga0070668_100057426 | 3300005347 | Bacteria | 3007 |
| 29 | Ga0070669_100222214 | 3300005353 | Bacteria | 1494 |
| 30 | Ga0070673_100078954 | 3300005364 | Bacteria | 2663 |
| 31 | Ga0070659_100188558 | 3300005366 | Bacteria | 1694 |
| 32 | Ga0070709_10000431 | 3300005434 | Bacteria | 25383 |
| 33 | Ga0070709_10003284 | 3300005434 | Bacteria | 8697 |
| 34 | Ga0070714_100045563 | 3300005435 | Bacteria | 3717 |
| 35 | Ga0070713_100001721 | 3300005436 | Bacteria | 14092 |
| 36 | Ga0070713_100106690 | 3300005436 | Bacteria | 2435 |
| 37 | Ga0070710_10002809 | 3300005437 | Bacteria | 8299 |
| 38 | Ga0070710_10006341 | 3300005437 | Bacteria | 5676 |
| 39 | Ga0070711_100008795 | 3300005439 | Bacteria | 6196 |
| 40 | Ga0070711_100014959 | 3300005439 | Bacteria | 4902 |
| 41 | Ga0070708_100121134 | 3300005445 | Bacteria | 2413 |
| 42 | Ga0070663_100087297 | 3300005455 | Bacteria | 2305 |
| 43 | Ga0070678_100009616 | 3300005456 | Bacteria | 5870 |
| 44 | Ga0070678_100063165 | 3300005456 | Bacteria | 2738 |
| 45 | Ga0070681_10013583 | 3300005458 | Bacteria | 8102 |
| 46 | Ga0070681_10099637 | 3300005458 | Bacteria | 2851 |
| 47 | Ga0068867_100165393 | 3300005459 | Bacteria | 1748 |
| 48 | Ga0070707_100133263 | 3300005468 | Bacteria | 2417 |
| 49 | Ga0070698_100066098 | 3300005471 | Bacteria | 3640 |
| 50 | Ga0070679_100003512 | 3300005530 | Bacteria | 14359 |
| 51 | Ga0070679_100058123 | 3300005530 | Bacteria | 3854 |
| 52 | Ga0070684_100017018 | 3300005535 | Bacteria | 5958 |
| 53 | Ga0070684_100056264 | 3300005535 | Bacteria | 3432 |
| 54 | Ga0070684_100149286 | 3300005535 | Bacteria | 2117 |
| 55 | Ga0068853_100015346 | 3300005539 | Bacteria | 6295 |
| 56 | Ga0068853_100018955 | 3300005539 | Bacteria | 5699 |
| 57 | Ga0070672_100066915 | 3300005543 | Bacteria | 2845 |
| 58 | Ga0070672_100140484 | 3300005543 | Bacteria | 1992 |
| 59 | Ga0070693_100011838 | 3300005547 | Bacteria | 4401 |
| 60 | Ga0070693_100060480 | 3300005547 | Bacteria | 2199 |
| 61 | Ga0070665_100013416 | 3300005548 | Bacteria | 8245 |
| 62 | Ga0070665_100085138 | 3300005548 | Bacteria | 3166 |
| 63 | Ga0070665_100104399 | 3300005548 | Bacteria | 2836 |
| 64 | Ga0070665_100108350 | 3300005548 | Bacteria | 2780 |
| 65 | Ga0068855_100012484 | 3300005563 | Bacteria | 10253 |
| 66 | Ga0068855_100013959 | 3300005563 | Bacteria | 9685 |
| 67 | Ga0068855_100067026 | 3300005563 | Bacteria | 4184 |
| 68 | Ga0068855_100334602 | 3300005563 | Bacteria | 1671 |
| 69 | Ga0070664_100033848 | 3300005564 | Bacteria | 4284 |
| 70 | Ga0070664_100171422 | 3300005564 | Bacteria | 1925 |
| 71 | Ga0068857_100023185 | 3300005577 | Bacteria | 5462 |
| 72 | Ga0068854_100046236 | 3300005578 | Bacteria | 3098 |
| 73 | Ga0068854_100049966 | 3300005578 | Bacteria | 2990 |
| 74 | Ga0068854_100202305 | 3300005578 | Bacteria | 1562 |
| 75 | Ga0068856_100001907 | 3300005614 | Bacteria | 21736 |
| 76 | Ga0068856_100005219 | 3300005614 | Bacteria | 12817 |
| 77 | Ga0068856_100021414 | 3300005614 | Bacteria | 6285 |
| 78 | Ga0068856_100233861 | 3300005614 | Bacteria | 1853 |
| 79 | Ga0068852_100016271 | 3300005616 | Bacteria | 5794 |
| 80 | Ga0068852_100025493 | 3300005616 | Bacteria | 4791 |
| 81 | Ga0068852_100048809 | 3300005616 | Bacteria | 3619 |
| 82 | Ga0068864_100025431 | 3300005618 | Bacteria | 4985 |
| 83 | Ga0068866_10071860 | 3300005718 | Bacteria | 1831 |
| 84 | Ga0068861_100308018 | 3300005719 | Bacteria | 1374 |
| 85 | Ga0068851_10002991 | 3300005834 | Bacteria | 7467 |
| 86 | Ga0068851_10091855 | 3300005834 | Bacteria | 1599 |
| 87 | Ga0068858_100152170 | 3300005842 | Bacteria | 2176 |
| 88 | Ga0068860_100000240 | 3300005843 | Bacteria | 83866 |
| 89 | Ga0068860_100102392 | 3300005843 | Bacteria | 2732 |
| 90 | Ga0068860_100137338 | 3300005843 | Bacteria | 2348 |
| 91 | Ga0068860_100152239 | 3300005843 | Bacteria | 2227 |
| 92 | Ga0081455_10003365 | 3300005937 | Bacteria | 18435 |
| 93 | Ga0081455_10014665 | 3300005937 | Bacteria | 7662 |
| 94 | Ga0081455_10020871 | 3300005937 | Bacteria | 6156 |
| 95 | Ga0081455_10037951 | 3300005937 | Bacteria | 4269 |
| 96 | Ga0081455_10141774 | 3300005937 | Bacteria | 1866 |
| 97 | Ga0081540_1000978 | 3300005983 | Bacteria | 25763 |
| 98 | Ga0081540_1001241 | 3300005983 | Bacteria | 22259 |
| 99 | Ga0081540_1001715 | 3300005983 | Bacteria | 18546 |
| 100 | Ga0081540_1002512 | 3300005983 | Bacteria | 14912 |
| 101 | Ga0081540_1006586 | 3300005983 | Bacteria | 8430 |
| 102 | Ga0081540_1021387 | 3300005983 | Bacteria | 3854 |
| 103 | Ga0081540_1037358 | 3300005983 | Bacteria | 2576 |
| 104 | Ga0081539_10000255 | 3300005985 | Bacteria | 123054 |
| 105 | Ga0081539_10000726 | 3300005985 | Bacteria | 66051 |
| 106 | Ga0081539_10020566 | 3300005985 | Bacteria | 4454 |
| 107 | Ga0081539_10039627 | 3300005985 | Bacteria | 2777 |
| 108 | Ga0070717_10002854 | 3300006028 | Bacteria | 12254 |
| 109 | Ga0070717_10004642 | 3300006028 | Bacteria | 9960 |
| 110 | Ga0070717_10036271 | 3300006028 | Bacteria | 3998 |
| 111 | Ga0075365_10152551 | 3300006038 | Bacteria | 1607 |
| 112 | Ga0075368_10012243 | 3300006042 | Bacteria | 3133 |
| 113 | Ga0075363_100028621 | 3300006048 | Bacteria | 2868 |
| 114 | Ga0075363_100032211 | 3300006048 | Bacteria | 2721 |
| 115 | Ga0075364_10031725 | 3300006051 | Bacteria | 3394 |
| 116 | Ga0075364_10102033 | 3300006051 | Bacteria | 1910 |
| 117 | Ga0070715_10003359 | 3300006163 | Bacteria | 5073 |
| 118 | Ga0070716_100005655 | 3300006173 | Bacteria | 6071 |
| 119 | Ga0070716_100014652 | 3300006173 | Bacteria | 4020 |
| 120 | Ga0070712_100022313 | 3300006175 | Bacteria | 4169 |
| 121 | Ga0070712_100039641 | 3300006175 | Bacteria | 3224 |
| 122 | Ga0075367_10004792 | 3300006178 | Bacteria | 6653 |
| 123 | Ga0075367_10024756 | 3300006178 | Bacteria | 3386 |
| 124 | Ga0075367_10134631 | 3300006178 | Bacteria | 1528 |
| 125 | Ga0075369_10023402 | 3300006186 | Bacteria | 2553 |
| 126 | Ga0075369_10029967 | 3300006186 | Bacteria | 2290 |
| 127 | Ga0075369_10033346 | 3300006186 | Bacteria | 2182 |
| 128 | Ga0075366_10008198 | 3300006195 | Bacteria | 5796 |
| 129 | Ga0075366_10040984 | 3300006195 | Bacteria | 2740 |
| 130 | Ga0097621_100102410 | 3300006237 | Bacteria | 2410 |
| 131 | Ga0097621_100153517 | 3300006237 | Bacteria | 1975 |
| 132 | Ga0097621_100204045 | 3300006237 | Bacteria | 1717 |
| 133 | Ga0075370_10042995 | 3300006353 | Bacteria | 2553 |
| 134 | Ga0075370_10062976 | 3300006353 | Bacteria | 2113 |
| 135 | Ga0075370_10104790 | 3300006353 | Bacteria | 1639 |
| 136 | Ga0075428_100104263 | 3300006844 | Bacteria | 3092 |
| 137 | Ga0068865_100024561 | 3300006881 | Bacteria | 3955 |
| 138 | Ga0068865_100136298 | 3300006881 | Bacteria | 1845 |
| 139 | Ga0099825_1026880 | 3300006941 | Bacteria | 3005 |
| 140 | Ga0099824_1016459 | 3300006942 | Bacteria | 6695 |
| 141 | Ga0099822_1002963 | 3300006943 | Bacteria | 21553 |
| 142 | Ga0099823_1013686 | 3300006944 | Bacteria | 8147 |
| 143 | Ga0075435_100129072 | 3300007076 | Bacteria | 2114 |
| 144 | Ga0105250_10060242 | 3300009092 | Bacteria | 1525 |
| 145 | Ga0105240_10006290 | 3300009093 | Bacteria | 17471 |
| 146 | Ga0105240_10025799 | 3300009093 | Bacteria | 7718 |
| 147 | Ga0105240_10032117 | 3300009093 | Bacteria | 6799 |
| 148 | Ga0105240_10157997 | 3300009093 | Bacteria | 2695 |
| 149 | Ga0105245_10013251 | 3300009098 | Bacteria | 7185 |
| 150 | Ga0105245_10046289 | 3300009098 | Bacteria | 3887 |
| 151 | Ga0105245_10057995 | 3300009098 | Bacteria | 3484 |
| 152 | Ga0105245_10148087 | 3300009098 | Bacteria | 2217 |
| 153 | Ga0105245_10149348 | 3300009098 | Bacteria | 2208 |
| 154 | Ga0105247_10025838 | 3300009101 | Bacteria | 3544 |
| 155 | Ga0105247_10029784 | 3300009101 | Bacteria | 3309 |
| 156 | Ga0105247_10084184 | 3300009101 | Bacteria | 2009 |
| 157 | Ga0105247_10098494 | 3300009101 | Bacteria | 1866 |
| 158 | Ga0105241_10000872 | 3300009174 | Bacteria | 22829 |
| 159 | Ga0105241_10057806 | 3300009174 | Bacteria | 2977 |
| 160 | Ga0105241_10259872 | 3300009174 | Bacteria | 1475 |
| 161 | Ga0105241_10299934 | 3300009174 | Bacteria | 1379 |
| 162 | Ga0105242_10105461 | 3300009176 | Bacteria | 2394 |
| 163 | Ga0105242_10194172 | 3300009176 | Bacteria | 1799 |
| 164 | Ga0105237_10003947 | 3300009545 | Bacteria | 17368 |
| 165 | Ga0105237_10026955 | 3300009545 | Bacteria | 5870 |
| 166 | Ga0105237_10027826 | 3300009545 | Bacteria | 5761 |
| 167 | Ga0105237_10030267 | 3300009545 | Bacteria | 5500 |
| 168 | Ga0105237_10034577 | 3300009545 | Bacteria | 5117 |
| 169 | Ga0105237_10048829 | 3300009545 | Bacteria | 4254 |
| 170 | Ga0105237_10196643 | 3300009545 | Bacteria | 2016 |
| 171 | Ga0105237_10245323 | 3300009545 | Bacteria | 1793 |
| 172 | Ga0105238_10007520 | 3300009551 | Bacteria | 10911 |
| 173 | Ga0105238_10012425 | 3300009551 | Bacteria | 8588 |
| 174 | Ga0105238_10026555 | 3300009551 | Bacteria | 5904 |
| 175 | Ga0105238_10049128 | 3300009551 | Bacteria | 4250 |
| 176 | Ga0105238_10055335 | 3300009551 | Bacteria | 3983 |
| 177 | Ga0105249_10355872 | 3300009553 | Bacteria | 1484 |
| 178 | Ga0105249_10445100 | 3300009553 | Bacteria | 1333 |
| 179 | Ga0105239_10008436 | 3300010375 | Bacteria | 11728 |
| 180 | Ga0105239_10014132 | 3300010375 | Bacteria | 8860 |
| 181 | Ga0105239_10014787 | 3300010375 | Bacteria | 8656 |
| 182 | Ga0105239_10015059 | 3300010375 | Bacteria | 8573 |
| 183 | Ga0105239_10049080 | 3300010375 | Bacteria | 4628 |
| 184 | Ga0105239_10067898 | 3300010375 | Bacteria | 3918 |
| 185 | Ga0105239_10082749 | 3300010375 | Bacteria | 3535 |
| 186 | Ga0105239_10086236 | 3300010375 | Bacteria | 3460 |
| 187 | Ga0105239_10333935 | 3300010375 | Bacteria | 1710 |
| 188 | Ga0105239_10369734 | 3300010375 | Bacteria | 1620 |
| 189 | Ga0105246_10036888 | 3300011119 | Bacteria | 3277 |
| 190 | Ga0105246_10056886 | 3300011119 | Bacteria | 2705 |
| 191 | Ga0157371_10023274 | 3300013102 | Bacteria | 4530 |
| 192 | Ga0157370_10025179 | 3300013104 | Bacteria | 5890 |
| 193 | Ga0157370_10036670 | 3300013104 | Bacteria | 4756 |
| 194 | Ga0157370_10072684 | 3300013104 | Bacteria | 3245 |
| 195 | Ga0157369_10009653 | 3300013105 | Bacteria | 11037 |
| 196 | Ga0157369_10037411 | 3300013105 | Bacteria | 5313 |
| 197 | Ga0157369_10114976 | 3300013105 | Bacteria | 2857 |
| 198 | Ga0157369_10258860 | 3300013105 | Bacteria | 1815 |
| 199 | Ga0157378_10014368 | 3300013297 | Bacteria | 6931 |
| 200 | Ga0163162_10535819 | 3300013306 | Bacteria | 1300 |
| 201 | Ga0157375_10056472 | 3300013308 | Bacteria | 3876 |
| 202 | Ga0163163_10013717 | 3300014325 | Bacteria | 7426 |
| 203 | Ga0163163_10173620 | 3300014325 | Bacteria | 2202 |
| 204 | Ga0163163_10278843 | 3300014325 | Bacteria | 1723 |
| 205 | Ga0157380_10134712 | 3300014326 | Bacteria | 2113 |
| 206 | Ga0157380_10161391 | 3300014326 | Bacteria | 1948 |
| 207 | Ga0157379_10175992 | 3300014968 | Bacteria | 1932 |
| 208 | Ga0157379_10231584 | 3300014968 | Bacteria | 1674 |
| 209 | Ga0157376_10021228 | 3300014969 | Bacteria | 5042 |
| 210 | Ga0157376_10068292 | 3300014969 | Bacteria | 3010 |
| 211 | Ga0157376_10094649 | 3300014969 | Bacteria | 2596 |
| 212 | Ga0214544_1000020 | 3300021320 | Bacteria | 178560 |
| 213 | Ga0214542_1000024 | 3300021321 | Bacteria | 191218 |
| 214 | Ga0214545_1000011 | 3300021324 | Bacteria | 190550 |
| 215 | Ga0214543_1000033 | 3300021327 | Bacteria | 190419 |
| 216 | Ga0213876_10023374 | 3300021384 | Bacteria | 3265 |
| 217 | Ga0209677_102267 | 3300025253 | Bacteria | 7435 |
| 218 | Ga0209148_1000574 | 3300025254 | Bacteria | 34124 |
| 219 | Ga0209233_1010953 | 3300025261 | Bacteria | 2690 |
| 220 | Ga0209455_1004011 | 3300025272 | Bacteria | 4983 |
| 221 | Ga0209564_1000164 | 3300025295 | Bacteria | 160675 |
| 222 | Ga0209564_1003632 | 3300025295 | Bacteria | 10245 |
| 223 | Ga0209564_1004939 | 3300025295 | Bacteria | 7883 |
| 224 | Ga0209758_1000065 | 3300025297 | Bacteria | 306288 |
| 225 | Ga0209758_1000498 | 3300025297 | Bacteria | 64011 |
| 226 | Ga0209758_1002030 | 3300025297 | Bacteria | 21763 |
| 227 | Ga0209758_1003889 | 3300025297 | Bacteria | 13063 |
| 228 | Ga0209758_1005790 | 3300025297 | Bacteria | 9267 |
| 229 | Ga0209758_1014715 | 3300025297 | Bacteria | 4132 |
| 230 | Ga0209758_1016433 | 3300025297 | Bacteria | 3759 |
| 231 | Ga0209758_1018995 | 3300025297 | Bacteria | 3338 |
| 232 | Ga0209256_1006613 | 3300025299 | Bacteria | 6057 |
| 233 | Ga0207426_1000721 | 3300025302 | Bacteria | 38161 |
| 234 | Ga0207426_1013877 | 3300025302 | Bacteria | 2969 |
| 235 | Ga0209257_1001031 | 3300025304 | Bacteria | 37368 |
| 236 | Ga0209257_1024026 | 3300025304 | Bacteria | 2123 |
| 237 | Ga0207653_10011889 | 3300025885 | Bacteria | 2714 |
| 238 | Ga0207692_10001280 | 3300025898 | Bacteria | 9333 |
| 239 | Ga0207692_10002139 | 3300025898 | Bacteria | 7544 |
| 240 | Ga0207692_10007388 | 3300025898 | Bacteria | 4506 |
| 241 | Ga0207680_10083113 | 3300025903 | Bacteria | 2017 |
| 242 | Ga0207647_10000486 | 3300025904 | Bacteria | 31906 |
| 243 | Ga0207647_10003213 | 3300025904 | Bacteria | 12258 |
| 244 | Ga0207699_10002307 | 3300025906 | Bacteria | 9018 |
| 245 | Ga0207699_10032744 | 3300025906 | Bacteria | 2931 |
| 246 | Ga0207645_10144063 | 3300025907 | Bacteria | 1553 |
| 247 | Ga0207684_10036712 | 3300025910 | Bacteria | 4159 |
| 248 | Ga0207654_10127702 | 3300025911 | Bacteria | 1605 |
| 249 | Ga0207654_10158427 | 3300025911 | Bacteria | 1460 |
| 250 | Ga0207707_10002451 | 3300025912 | Bacteria | 16695 |
| 251 | Ga0207707_10007228 | 3300025912 | Bacteria | 9663 |
| 252 | Ga0207707_10101122 | 3300025912 | Bacteria | 2519 |
| 253 | Ga0207707_10114364 | 3300025912 | Bacteria | 2358 |
| 254 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 255 | Ga0207695_10001543 | 3300025913 | Bacteria | 37956 |
| 256 | Ga0207695_10121382 | 3300025913 | Bacteria | 2581 |
| 257 | Ga0207671_10002273 | 3300025914 | Bacteria | 20786 |
| 258 | Ga0207671_10032059 | 3300025914 | Bacteria | 3912 |
| 259 | Ga0207671_10086745 | 3300025914 | Bacteria | 2353 |
| 260 | Ga0207671_10112844 | 3300025914 | Bacteria | 2070 |
| 261 | Ga0207693_10000723 | 3300025915 | Bacteria | 29753 |
| 262 | Ga0207693_10005552 | 3300025915 | Bacteria | 10494 |
| 263 | Ga0207693_10125323 | 3300025915 | Bacteria | 2018 |
| 264 | Ga0207663_10005442 | 3300025916 | Bacteria | 6415 |
| 265 | Ga0207663_10032760 | 3300025916 | Bacteria | 3088 |
| 266 | Ga0207663_10075087 | 3300025916 | Bacteria | 2193 |
| 267 | Ga0207660_10006133 | 3300025917 | Bacteria | 7800 |
| 268 | Ga0207660_10037939 | 3300025917 | Bacteria | 3360 |
| 269 | Ga0207660_10047545 | 3300025917 | Bacteria | 3034 |
| 270 | Ga0207657_10005831 | 3300025919 | Bacteria | 12831 |
| 271 | Ga0207657_10038250 | 3300025919 | Bacteria | 4274 |
| 272 | Ga0207649_10090500 | 3300025920 | Bacteria | 2002 |
| 273 | Ga0207652_10016568 | 3300025921 | Bacteria | 6019 |
| 274 | Ga0207652_10037786 | 3300025921 | Bacteria | 4088 |
| 275 | Ga0207652_10047929 | 3300025921 | Bacteria | 3651 |
| 276 | Ga0207652_10143237 | 3300025921 | Bacteria | 2138 |
| 277 | Ga0207681_10130378 | 3300025923 | Bacteria | 1858 |
| 278 | Ga0207681_10225714 | 3300025923 | Bacteria | 1451 |
| 279 | Ga0207694_10010545 | 3300025924 | Bacteria | 6971 |
| 280 | Ga0207694_10013338 | 3300025924 | Bacteria | 6188 |
| 281 | Ga0207694_10038644 | 3300025924 | Bacteria | 3670 |
| 282 | Ga0207694_10043322 | 3300025924 | Bacteria | 3474 |
| 283 | Ga0207694_10160495 | 3300025924 | Bacteria | 1816 |
| 284 | Ga0207694_10179544 | 3300025924 | Bacteria | 1716 |
| 285 | Ga0207687_10024884 | 3300025927 | Bacteria | 4003 |
| 286 | Ga0207687_10061979 | 3300025927 | Bacteria | 2643 |
| 287 | Ga0207687_10102693 | 3300025927 | Bacteria | 2107 |
| 288 | Ga0207700_10006043 | 3300025928 | Bacteria | 7289 |
| 289 | Ga0207700_10020115 | 3300025928 | Bacteria | 4525 |
| 290 | Ga0207700_10074252 | 3300025928 | Bacteria | 2630 |
| 291 | Ga0207700_10146908 | 3300025928 | Bacteria | 1944 |
| 292 | Ga0207664_10024588 | 3300025929 | Bacteria | 4528 |
| 293 | Ga0207664_10125955 | 3300025929 | Bacteria | 2150 |
| 294 | Ga0207644_10106156 | 3300025931 | Bacteria | 2117 |
| 295 | Ga0207690_10090776 | 3300025932 | Bacteria | 2157 |
| 296 | Ga0207706_10012522 | 3300025933 | Bacteria | 7726 |
| 297 | Ga0207706_10101580 | 3300025933 | Bacteria | 2530 |
| 298 | Ga0207686_10049584 | 3300025934 | Bacteria | 2607 |
| 299 | Ga0207665_10000064 | 3300025939 | Bacteria | 68931 |
| 300 | Ga0207665_10009565 | 3300025939 | Bacteria | 6366 |
| 301 | Ga0207665_10022510 | 3300025939 | Bacteria | 4146 |
| 302 | Ga0207665_10235094 | 3300025939 | Bacteria | 1348 |
| 303 | Ga0207691_10167185 | 3300025940 | Bacteria | 1927 |
| 304 | Ga0207711_10085541 | 3300025941 | Bacteria | 2763 |
| 305 | Ga0207711_10179037 | 3300025941 | Bacteria | 1927 |
| 306 | Ga0207689_10008007 | 3300025942 | Bacteria | 9225 |
| 307 | Ga0207661_10002727 | 3300025944 | Bacteria | 12148 |
| 308 | Ga0207661_10088353 | 3300025944 | Bacteria | 2576 |
| 309 | Ga0207679_10064328 | 3300025945 | Bacteria | 2741 |
| 310 | Ga0207667_10011808 | 3300025949 | Bacteria | 10119 |
| 311 | Ga0207667_10013789 | 3300025949 | Bacteria | 9234 |
| 312 | Ga0207667_10021994 | 3300025949 | Bacteria | 7057 |
| 313 | Ga0207667_10060535 | 3300025949 | Bacteria | 3963 |
| 314 | Ga0207667_10110436 | 3300025949 | Bacteria | 2836 |
| 315 | Ga0207667_10256447 | 3300025949 | Bacteria | 1789 |
| 316 | Ga0207712_10023761 | 3300025961 | Bacteria | 4051 |
| 317 | Ga0207640_10018060 | 3300025981 | Bacteria | 4139 |
| 318 | Ga0207640_10054955 | 3300025981 | Bacteria | 2605 |
| 319 | Ga0207640_10126305 | 3300025981 | Bacteria | 1842 |
| 320 | Ga0207640_10160943 | 3300025981 | Bacteria | 1661 |
| 321 | Ga0207703_10036553 | 3300026035 | Bacteria | 3910 |
| 322 | Ga0207703_10051235 | 3300026035 | Bacteria | 3344 |
| 323 | Ga0207703_10058266 | 3300026035 | Bacteria | 3152 |
| 324 | Ga0207703_10103579 | 3300026035 | Bacteria | 2416 |
| 325 | Ga0207703_10283850 | 3300026035 | Bacteria | 1505 |
| 326 | Ga0207639_10006484 | 3300026041 | Bacteria | 7956 |
| 327 | Ga0207639_10029262 | 3300026041 | Bacteria | 4031 |
| 328 | Ga0207639_10063595 | 3300026041 | Bacteria | 2858 |
| 329 | Ga0207678_10017845 | 3300026067 | Bacteria | 6232 |
| 330 | Ga0207678_10021989 | 3300026067 | Bacteria | 5590 |
| 331 | Ga0207678_10047437 | 3300026067 | Bacteria | 3715 |
| 332 | Ga0207678_10054204 | 3300026067 | Bacteria | 3453 |
| 333 | Ga0207678_10071473 | 3300026067 | Bacteria | 2975 |
| 334 | Ga0207678_10114723 | 3300026067 | Bacteria | 2298 |
| 335 | Ga0207708_10154231 | 3300026075 | Bacteria | 1810 |
| 336 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 337 | Ga0207702_10000403 | 3300026078 | Bacteria | 49280 |
| 338 | Ga0207702_10184601 | 3300026078 | Bacteria | 1923 |
| 339 | Ga0207702_10185846 | 3300026078 | Bacteria | 1916 |
| 340 | Ga0207702_10290808 | 3300026078 | Bacteria | 1548 |
| 341 | Ga0207676_10034015 | 3300026095 | Bacteria | 3856 |
| 342 | Ga0207676_10128855 | 3300026095 | Bacteria | 2148 |
| 343 | Ga0207674_10007797 | 3300026116 | Bacteria | 12452 |
| 344 | Ga0207674_10009659 | 3300026116 | Bacteria | 11000 |
| 345 | Ga0207674_10012698 | 3300026116 | Bacteria | 9412 |
| 346 | Ga0207674_10022025 | 3300026116 | Bacteria | 6853 |
| 347 | Ga0207674_10094786 | 3300026116 | Bacteria | 2971 |
| 348 | Ga0207675_100240003 | 3300026118 | Bacteria | 1751 |
| 349 | Ga0207683_10015940 | 3300026121 | Bacteria | 6396 |
| 350 | Ga0207683_10265774 | 3300026121 | Bacteria | 1567 |
| 351 | Ga0207698_10103212 | 3300026142 | Bacteria | 2369 |
| 352 | Ga0207698_10188496 | 3300026142 | Bacteria | 1834 |
| 353 | Ga0207698_10279093 | 3300026142 | Bacteria | 1544 |
| 354 | Ga0209389_1000011 | 3300027296 | Bacteria | 223265 |
| 355 | Ga0209389_1000025 | 3300027296 | Bacteria | 149588 |
| 356 | Ga0209589_1000018 | 3300027357 | Bacteria | 192614 |
| 357 | Ga0209589_1000066 | 3300027357 | Bacteria | 100795 |
| 358 | Ga0209489_100017 | 3300027361 | Bacteria | 223265 |
| 359 | Ga0209489_100026 | 3300027361 | Bacteria | 192614 |
| 360 | Ga0209489_100030 | 3300027361 | Bacteria | 185999 |
| 361 | Ga0209700_100027 | 3300027363 | Bacteria | 223462 |
| 362 | Ga0209700_100035 | 3300027363 | Bacteria | 192614 |
| 363 | Ga0209813_10033936 | 3300027866 | Bacteria | 1520 |
| 364 | Ga0207428_10090372 | 3300027907 | Bacteria | 2379 |
| 365 | Ga0268266_10003137 | 3300028379 | Bacteria | 16797 |
| 366 | Ga0268266_10003952 | 3300028379 | Bacteria | 14394 |
| 367 | Ga0268266_10013301 | 3300028379 | Bacteria | 7093 |
| 368 | Ga0268266_10032383 | 3300028379 | Bacteria | 4442 |
| 369 | Ga0268266_10034331 | 3300028379 | Bacteria | 4314 |
| 370 | Ga0268266_10406073 | 3300028379 | Bacteria | 1289 |
| 371 | Ga0268265_10040545 | 3300028380 | Bacteria | 3439 |
| 372 | Ga0268265_10343121 | 3300028380 | Bacteria | 1361 |
| 373 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 374 | Ga0268264_10187409 | 3300028381 | Bacteria | 1883 |
| 375 | Ga0265337_1031546 | 3300028556 | Bacteria | 1573 |
| 376 | Ga0265334_10034157 | 3300028573 | Bacteria | 2019 |
| 377 | Ga0265318_10006322 | 3300028577 | Bacteria | 5469 |
| 378 | Ga0265323_10002189 | 3300028653 | Bacteria | 9111 |
| 379 | Ga0265336_10006616 | 3300028666 | Bacteria | 4163 |
| 380 | Ga0307517_10003575 | 3300028786 | Bacteria | 24130 |
| 381 | Ga0307515_10066798 | 3300028794 | Bacteria | 4973 |
| 382 | Ga0265338_10002444 | 3300028800 | Bacteria | 27875 |
| 383 | Ga0265338_10013740 | 3300028800 | Bacteria | 9104 |
| 384 | Ga0265332_10025251 | 3300031238 | Bacteria | 2611 |
| 385 | Ga0265320_10000034 | 3300031240 | Bacteria | 141117 |
| 386 | Ga0265320_10091814 | 3300031240 | Bacteria | 1406 |
| 387 | Ga0265325_10003020 | 3300031241 | Bacteria | 11153 |
| 388 | Ga0265340_10020095 | 3300031247 | Bacteria | 3437 |
| 389 | Ga0265340_10096641 | 3300031247 | Bacteria | 1376 |
| 390 | Ga0265339_10001392 | 3300031249 | Bacteria | 18003 |
| 391 | Ga0265339_10064560 | 3300031249 | Bacteria | 1964 |
| 392 | Ga0265331_10070024 | 3300031250 | Bacteria | 1642 |
| 393 | Ga0265313_10000665 | 3300031595 | Bacteria | 35397 |
| 394 | Ga0307508_10000650 | 3300031616 | Bacteria | 41770 |
| 395 | Ga0307508_10004051 | 3300031616 | Bacteria | 14501 |
| 396 | Ga0307508_10101377 | 3300031616 | Bacteria | 2474 |
| 397 | Ga0307508_10230392 | 3300031616 | Unclassified | 1451 |
| 398 | Ga0265314_10003187 | 3300031711 | Bacteria | 16061 |
| 399 | Ga0265314_10057962 | 3300031711 | Bacteria | 2656 |
| 400 | Ga0265342_10058050 | 3300031712 | Bacteria | 2288 |
| 401 | Ga0307516_10031887 | 3300031730 | Bacteria | 5311 |
| 402 | Ga0307516_10052030 | 3300031730 | Bacteria | 4012 |
| 403 | Ga0307516_10090567 | 3300031730 | Bacteria | 2887 |
| 404 | Ga0307405_10054277 | 3300031731 | Bacteria | 2501 |
| 405 | Ga0307412_10261115 | 3300031911 | Bacteria | 1350 |
| 406 | Ga0307409_100067780 | 3300031995 | Bacteria | 2819 |
| 407 | Ga0307416_100076218 | 3300032002 | Bacteria | 2810 |
| 408 | Ga0307415_100070517 | 3300032126 | Bacteria | 2454 |
| 409 | Ga0307507_10053828 | 3300033179 | Bacteria | 3839 |
| 410 | Ga0307510_10025336 | 3300033180 | Bacteria | 6841 |
| 411 | Ga0307510_10032671 | 3300033180 | Bacteria | 5860 |
| 412 | Ga0307510_10087718 | 3300033180 | Bacteria | 2975 |
| 413 | Ga0307510_10088432 | 3300033180 | Bacteria | 2957 |
| 414 | Ga0315911_1000011 | 3300033442 | Bacteria | 264678 |
| 415 | Ga0373926_0006551 | 3300035083 | Bacteria | 3866 |
| 416 | Ga0373926_0074259 | 3300035083 | Bacteria | 1252 |
| 417 | Ga0373934_0035810 | 3300035086 | Bacteria | 1954 |
| 418 | Ga0373934_0041741 | 3300035086 | Bacteria | 1811 |
| 419 | Ga0373940_0006754 | 3300035088 | Bacteria | 2563 |
| 420 | Ga0373923_0036370 | 3300035111 | Bacteria | 2009 |
| 421 | Ga0373936_0020740 | 3300035113 | Bacteria | 2554 |
| 422 | Ga0373945_0030570 | 3300035116 | Bacteria | 1899 |
| 423 | Ga0373953_0002754 | 3300035117 | Bacteria | 5340 |
| 424 | Ga0373954_0008277 | 3300035118 | Bacteria | 4561 |
| 425 | Ga0373954_0043259 | 3300035118 | Bacteria | 2100 |
| 426 | Ga0373956_0004160 | 3300035119 | Bacteria | 5803 |
| 427 | Ga0373956_0011086 | 3300035119 | Bacteria | 3711 |
| 428 | Ga0373956_0039813 | 3300035119 | Bacteria | 2084 |
| 429 | Ga0373957_0002175 | 3300035120 | Bacteria | 5534 |
| 430 | Ga0373960_0044337 | 3300035121 | Bacteria | 1299 |
| 431 | Ga0373946_0037289 | 3300035171 | Bacteria | 1974 |
| 432 | Ga0373955_0000510 | 3300035172 | Bacteria | 16513 |
| 433 | Ga0373955_0013167 | 3300035172 | Bacteria | 3990 |
| 434 | Ga0373955_0014368 | 3300035172 | Bacteria | 3850 |
| 435 | Ga0373955_0030619 | 3300035172 | Bacteria | 2811 |
| 436 | Ga0373924_0011441 | 3300035410 | Bacteria | 3296 |
| 437 | Ga0373924_0038476 | 3300035410 | Bacteria | 1951 |
| 438 | Ga0373924_0070339 | 3300035410 | Bacteria | 1475 |
| 439 | Ga0373931_0002710 | 3300035691 | Bacteria | 7877 |
| 440 | Ga0373931_0072073 | 3300035691 | Bacteria | 1888 |
| 441 | Ga0373935_0007256 | 3300035692 | Bacteria | 6624 |
| 442 | Ga0373935_0027681 | 3300035692 | Bacteria | 3504 |
| 443 | Ga0373935_0072367 | 3300035692 | Bacteria | 2225 |
| 444 | Ga0373927_0001621 | 3300035695 | Bacteria | 16865 |
| 445 | Ga0373927_0060511 | 3300035695 | Bacteria | 2450 |
| 446 | Ga0373927_0065019 | 3300035695 | Bacteria | 2359 |
| 447 | Ga0373933_0000405 | 3300035724 | Bacteria | 27323 |
| 448 | Ga0373933_0006367 | 3300035724 | Bacteria | 6424 |
| 449 | Ga0373933_0077991 | 3300035724 | Bacteria | 2026 |
| 450 | Ga0373933_0122504 | 3300035724 | Bacteria | 1629 |
| 451 | Ga0373947_0001795 | 3300035725 | Bacteria | 13125 |
| 452 | Ga0373947_0002633 | 3300035725 | Bacteria | 10777 |
| 453 | Ga0373947_0015294 | 3300035725 | Bacteria | 4404 |
| 454 | Ga0373947_0150035 | 3300035725 | Bacteria | 1501 |
| 455 | Ga0373937_0023676 | 3300036401 | Bacteria | 5534 |
| 456 | Ga0373937_0043679 | 3300036401 | Bacteria | 4093 |
| 457 | Ga0373937_0107071 | 3300036401 | Bacteria | 2599 |
| 458 | Ga0373937_0112028 | 3300036401 | Bacteria | 2538 |
| 459 | Ga0373937_0138283 | 3300036401 | Bacteria | 2278 |
| 460 | Ga0372808_001316 | 3300036459 | Bacteria | 2522 |
| 461 | Ga0373925_0006728 | 3300037068 | Bacteria | 8428 |
| 462 | Ga0373925_0028136 | 3300037068 | Bacteria | 4117 |
| 463 | Ga0395899_0090148 | 3300037312 | Bacteria | 2223 |
| 464 | Ga0395898_0070289 | 3300037466 | Bacteria | 3385 |
| 465 | Ga0395898_0122783 | 3300037466 | Bacteria | 2489 |
| 466 | Ga0395898_0183238 | 3300037466 | Bacteria | 2001 |
| 467 | Ga0395905_0034044 | 3300037471 | Bacteria | 4784 |
| 468 | Ga0436364_0662595 | 3300037853 | Bacteria | 1656 |
| 469 | Ga0436364_1342884 | 3300037853 | Bacteria | 15035 |
| 470 | Ga0395901_0007795 | 3300038443 | Bacteria | 10805 |
| 471 | Ga0436365_0607645 | 3300039437 | Bacteria | 7674 |
| 472 | Ga0436360_1294928 | 3300039438 | Bacteria | 3411 |
| 473 | Ga0466972_0000648 | 3300044658 | Bacteria | 16770 |
| 474 | Ga0466966_0000008 | 3300044684 | Bacteria | 155597 |
| 475 | Ga0466966_0001391 | 3300044684 | Bacteria | 15558 |
| 476 | Ga0466961_0000167 | 3300044693 | Bacteria | 44505 |
| 477 | Ga0466963_0085348 | 3300044694 | Bacteria | 2143 |
| 478 | Ga0466963_0234149 | 3300044694 | Bacteria | 1287 |
| 479 | Ga0466964_0087931 | 3300044706 | Bacteria | 1347 |
| 480 | Ga0466970_0030263 | 3300044765 | Bacteria | 2855 |
| 481 | Ga0466957_0049313 | 3300044842 | Bacteria | 2560 |
| 482 | Ga0466960_0001540 | 3300044901 | Bacteria | 8416 |
| 483 | Ga0466959_0000257 | 3300045049 | Bacteria | 32605 |
| 484 | Ga0466959_0018179 | 3300045049 | Bacteria | 5160 |
| 485 | Ga0466959_0092799 | 3300045049 | Bacteria | 2167 |
| 486 | Ga0466967_0148362 | 3300045976 | Bacteria | 2189 |
| 487 | Ga0495617_019755 | 3300046452 | Bacteria | 2277 |
| 488 | Ga0495592_0029930 | 3300046454 | Bacteria | 4118 |
| 489 | Ga0495592_0035643 | 3300046454 | Bacteria | 3749 |
| 490 | Ga0495592_0116152 | 3300046454 | Bacteria | 1889 |
| 491 | Ga0495603_0000094 | 3300046455 | Bacteria | 40636 |
| 492 | Ga0495603_0012995 | 3300046455 | Bacteria | 5033 |
| 493 | Ga0495603_0018344 | 3300046455 | Bacteria | 4233 |
| 494 | Ga0495629_0000612 | 3300046459 | Bacteria | 29083 |
| 495 | Ga0495629_0004307 | 3300046459 | Bacteria | 10669 |
| 496 | Ga0495629_0109103 | 3300046459 | Bacteria | 1930 |
| 497 | Ga0495629_0121151 | 3300046459 | Bacteria | 1822 |
| 498 | Ga0495638_0001554 | 3300046460 | Bacteria | 20587 |
| 499 | Ga0495638_0035056 | 3300046460 | Bacteria | 3199 |
| 500 | Ga0495638_0035929 | 3300046460 | Bacteria | 3156 |
| 501 | Ga0495638_0077178 | 3300046460 | Bacteria | 2029 |
| 502 | Ga0495641_0001895 | 3300046461 | Bacteria | 17085 |
| 503 | Ga0495651_0036353 | 3300046462 | Bacteria | 3834 |
| 504 | Ga0495651_0117906 | 3300046462 | Bacteria | 1953 |
| 505 | Ga0495653_0000399 | 3300046463 | Bacteria | 34847 |
| 506 | Ga0495653_0072447 | 3300046463 | Bacteria | 2572 |
| 507 | Ga0495580_0002744 | 3300046472 | Bacteria | 15166 |
| 508 | Ga0495582_0001055 | 3300046473 | Bacteria | 15486 |
| 509 | Ga0495605_0065499 | 3300046474 | Bacteria | 1728 |
| 510 | Ga0495639_0000114 | 3300046475 | Bacteria | 40307 |
| 511 | Ga0495662_0000093 | 3300046476 | Bacteria | 32243 |
| 512 | Ga0495664_0006628 | 3300046477 | Bacteria | 6403 |
| 513 | Ga0495664_0033601 | 3300046477 | Bacteria | 3014 |
| 514 | Ga0495585_0116110 | 3300046492 | Bacteria | 1419 |
| 515 | Ga0495606_0006792 | 3300046507 | Bacteria | 10457 |
| 516 | Ga0495608_0001226 | 3300046511 | Bacteria | 18178 |
| 517 | Ga0495610_0008306 | 3300046512 | Bacteria | 6741 |
| 518 | Ga0495610_0082184 | 3300046512 | Bacteria | 1477 |
| 519 | Ga0495618_0027537 | 3300046514 | Bacteria | 3537 |
| 520 | Ga0495618_0176291 | 3300046514 | Bacteria | 1359 |
| 521 | Ga0495628_0082230 | 3300046516 | Bacteria | 2501 |
| 522 | Ga0495628_0084487 | 3300046516 | Bacteria | 2463 |
| 523 | Ga0495628_0112357 | 3300046516 | Bacteria | 2094 |
| 524 | Ga0495628_0171772 | 3300046516 | Bacteria | 1643 |
| 525 | Ga0495630_0000459 | 3300046517 | Bacteria | 30805 |
| 526 | Ga0495630_0044428 | 3300046517 | Bacteria | 3320 |
| 527 | Ga0495631_0022910 | 3300046518 | Bacteria | 2901 |
| 528 | Ga0495643_0017992 | 3300046522 | Bacteria | 4116 |
| 529 | Ga0495643_0022609 | 3300046522 | Bacteria | 3586 |
| 530 | Ga0495644_0041560 | 3300046523 | Bacteria | 1731 |
| 531 | Ga0495644_0064788 | 3300046523 | Bacteria | 1373 |
| 532 | Ga0495648_0001784 | 3300046524 | Bacteria | 20695 |
| 533 | Ga0495648_0057247 | 3300046524 | Bacteria | 2340 |
| 534 | Ga0495648_0067160 | 3300046524 | Bacteria | 2098 |
| 535 | Ga0495666_0099665 | 3300046526 | Bacteria | 1369 |
| 536 | Ga0495642_0081062 | 3300046528 | Bacteria | 1366 |
| 537 | Ga0495652_0027433 | 3300046529 | Bacteria | 5018 |
| 538 | Ga0495652_0028960 | 3300046529 | Bacteria | 4865 |
| 539 | Ga0495652_0111366 | 3300046529 | Bacteria | 2201 |
| 540 | Ga0495665_0000613 | 3300046531 | Bacteria | 18131 |
| 541 | Ga0495665_0024504 | 3300046531 | Bacteria | 3241 |
| 542 | Ga0495640_0014863 | 3300046533 | Bacteria | 5872 |
| 543 | Ga0495640_0015770 | 3300046533 | Bacteria | 5671 |
| 544 | Ga0495640_0029758 | 3300046533 | Bacteria | 3916 |
| 545 | Ga0495640_0030534 | 3300046533 | Bacteria | 3857 |
| 546 | Ga0495640_0031782 | 3300046533 | Bacteria | 3766 |
| 547 | Ga0495587_0001432 | 3300046536 | Bacteria | 15878 |
| 548 | Ga0495609_0060286 | 3300046538 | Bacteria | 1678 |
| 549 | Ga0495597_0059231 | 3300046542 | Bacteria | 1672 |
| 550 | Ga0495645_0024571 | 3300046543 | Bacteria | 4373 |
| 551 | Ga0495645_0074327 | 3300046543 | Bacteria | 2448 |
| 552 | Ga0495622_0001333 | 3300046557 | Bacteria | 12627 |
| 553 | Ga0495667_0001452 | 3300046559 | Bacteria | 15607 |
| 554 | Ga0495667_0030262 | 3300046559 | Bacteria | 3640 |
| 555 | Ga0495667_0120590 | 3300046559 | Bacteria | 1693 |
| 556 | Ga0495656_0040131 | 3300046615 | Bacteria | 1949 |
| 557 | Ga0495634_0001601 | 3300046642 | Bacteria | 19807 |
| 558 | Ga0495634_0050455 | 3300046642 | Bacteria | 2794 |
| 559 | Ga0495634_0056873 | 3300046642 | Bacteria | 2612 |
| 560 | Ga0495634_0190415 | 3300046642 | Bacteria | 1280 |
| 561 | Ga0495635_0000088 | 3300046663 | Bacteria | 54355 |
| 562 | Ga0495635_0001000 | 3300046663 | Bacteria | 18675 |
| 563 | Ga0495588_0009215 | 3300046674 | Bacteria | 4558 |
| 564 | Ga0495588_0038624 | 3300046674 | Bacteria | 2429 |
| 565 | Ga0495657_0001352 | 3300046675 | Bacteria | 21318 |
| 566 | Ga0495657_0027054 | 3300046675 | Bacteria | 4053 |
| 567 | Ga0495657_0141187 | 3300046675 | Bacteria | 1501 |
| 568 | Ga0495599_0061777 | 3300046678 | Bacteria | 2340 |
| 569 | Ga0495599_0065968 | 3300046678 | Bacteria | 2261 |
| 570 | Ga0495623_0010431 | 3300046679 | Bacteria | 6014 |
| 571 | Ga0495623_0084635 | 3300046679 | Bacteria | 1957 |
| 572 | Ga0495646_0031727 | 3300046680 | Bacteria | 3291 |
| 573 | Ga0495646_0101785 | 3300046680 | Bacteria | 1646 |
| 574 | Ga0495646_0170019 | 3300046680 | Bacteria | 1202 |
| 575 | Ga0495647_0000070 | 3300046681 | Bacteria | 24847 |
| 576 | Ga0495658_0001004 | 3300046683 | Bacteria | 14900 |
| 577 | Ga0495613_0003317 | 3300046689 | Bacteria | 12056 |
| 578 | Ga0495613_0071654 | 3300046689 | Bacteria | 2526 |
| 579 | Ga0495624_0003008 | 3300046690 | Bacteria | 12614 |
| 580 | Ga0495624_0032884 | 3300046690 | Bacteria | 3361 |
| 581 | Ga0495624_0058391 | 3300046690 | Bacteria | 2423 |
| 582 | Ga0495671_0091306 | 3300046692 | Bacteria | 1490 |
| 583 | Ga0495649_0058586 | 3300046694 | Bacteria | 2075 |
| 584 | Ga0495600_0000484 | 3300046809 | Bacteria | 20528 |
| 585 | Ga0495600_0006880 | 3300046809 | Bacteria | 6935 |
| 586 | Ga0495600_0036737 | 3300046809 | Bacteria | 3183 |
| 587 | Ga0495581_0000082 | 3300047315 | Bacteria | 38294 |
| 588 | Ga0495604_0004387 | 3300047317 | Bacteria | 11167 |
| 589 | Ga0495604_0011766 | 3300047317 | Bacteria | 6956 |
| 590 | Ga0495604_0027775 | 3300047317 | Bacteria | 4500 |
| 591 | Ga0495674_0005809 | 3300047319 | Bacteria | 11832 |
| 592 | Ga0495674_0036094 | 3300047319 | Bacteria | 4452 |
| 593 | Ga0495676_0021438 | 3300047321 | Bacteria | 5642 |
| 594 | Ga0495680_0018227 | 3300047322 | Bacteria | 5968 |
| 595 | Ga0495680_0028622 | 3300047322 | Bacteria | 4567 |
| 596 | Ga0495687_026026 | 3300047443 | Bacteria | 2758 |
| 597 | Ga0495675_0004649 | 3300047444 | Bacteria | 8340 |
| 598 | Ga0495673_0007496 | 3300047469 | Bacteria | 6261 |
| 599 | Ga0495684_0001326 | 3300047471 | Bacteria | 19921 |
| 600 | Ga0495684_0009235 | 3300047471 | Bacteria | 7614 |
| 601 | Ga0495684_0137230 | 3300047471 | Bacteria | 1835 |
| 602 | Ga0495686_0010639 | 3300047472 | Bacteria | 6533 |
| 603 | Ga0495686_0053042 | 3300047472 | Bacteria | 2542 |
| 604 | Ga0495593_0000206 | 3300047673 | Bacteria | 31187 |
| 605 | Ga0495593_0005786 | 3300047673 | Bacteria | 7290 |
| 606 | Ga0495593_0027986 | 3300047673 | Bacteria | 3098 |
| 607 | Ga0495602_0039586 | 3300048088 | Bacteria | 4338 |
| 608 | Ga0495602_0145863 | 3300048088 | Bacteria | 1867 |
| 609 | Ga0495614_0058901 | 3300048089 | Bacteria | 1649 |
| 610 | Ga0496100_0033039 | 3300048903 | Bacteria | 3234 |
| 611 | Ga0496100_0057827 | 3300048903 | Bacteria | 2542 |
| 612 | Ga0496101_0005595 | 3300048904 | Bacteria | 8022 |
| 613 | Ga0496101_0034967 | 3300048904 | Bacteria | 3552 |
| 614 | Ga0496102_0021781 | 3300048905 | Bacteria | 5671 |
| 615 | Ga0496102_0043876 | 3300048905 | Bacteria | 4056 |
| 616 | Ga0496102_0181495 | 3300048905 | Bacteria | 1983 |
| 617 | Ga0496103_0038793 | 3300048906 | Bacteria | 2925 |
| 618 | Ga0496104_0010576 | 3300048907 | Bacteria | 8241 |
| 619 | Ga0496104_0039497 | 3300048907 | Bacteria | 4418 |
| 620 | Ga0496104_0045505 | 3300048907 | Bacteria | 4128 |
| 621 | Ga0496104_0068809 | 3300048907 | Bacteria | 3364 |
| 622 | Ga0496104_0086868 | 3300048907 | Bacteria | 2986 |
| 623 | Ga0496104_0103275 | 3300048907 | Bacteria | 2730 |
| 624 | Ga0496104_0178470 | 3300048907 | Bacteria | 2034 |
| 625 | Ga0496105_0004214 | 3300048908 | Bacteria | 10803 |
| 626 | Ga0496105_0031127 | 3300048908 | Bacteria | 4373 |
| 627 | Ga0496105_0108332 | 3300048908 | Bacteria | 2293 |
| 628 | Ga0496105_0289013 | 3300048908 | Bacteria | 1320 |
| 629 | Ga0496106_0001874 | 3300048909 | Bacteria | 15739 |
| 630 | Ga0496106_0037975 | 3300048909 | Bacteria | 3603 |
| 631 | Ga0496107_0003415 | 3300048910 | Bacteria | 10621 |
| 632 | Ga0496107_0026546 | 3300048910 | Bacteria | 4107 |
| 633 | Ga0496108_0032155 | 3300048911 | Bacteria | 4357 |
| 634 | Ga0496108_0064703 | 3300048911 | Bacteria | 3081 |
| 635 | Ga0496108_0094889 | 3300048911 | Bacteria | 2539 |
| 636 | Ga0496109_0000767 | 3300048912 | Bacteria | 26714 |
| 637 | Ga0496109_0037794 | 3300048912 | Bacteria | 4363 |
| 638 | Ga0496109_0060890 | 3300048912 | Bacteria | 3450 |
| 639 | Ga0496109_0127133 | 3300048912 | Bacteria | 2377 |
| 640 | Ga0496110_0020114 | 3300048913 | Bacteria | 5631 |
| 641 | Ga0496110_0035417 | 3300048913 | Bacteria | 4330 |
| 642 | Ga0496110_0061946 | 3300048913 | Bacteria | 3303 |
| 643 | Ga0496110_0266253 | 3300048913 | Bacteria | 1560 |
| 644 | Ga0496110_0426339 | 3300048913 | Bacteria | 1209 |
| 645 | Ga0496111_0016531 | 3300048914 | Bacteria | 5086 |
| 646 | Ga0496111_0100497 | 3300048914 | Bacteria | 2124 |
| 647 | Ga0496112_0000016 | 3300048915 | Bacteria | 194634 |
| 648 | Ga0496112_0016187 | 3300048915 | Bacteria | 6978 |
| 649 | Ga0496112_0031588 | 3300048915 | Bacteria | 5138 |
| 650 | Ga0496112_0050257 | 3300048915 | Bacteria | 4088 |
| 651 | Ga0496112_0061112 | 3300048915 | Bacteria | 3713 |
| 652 | Ga0496112_0090064 | 3300048915 | Bacteria | 3036 |
| 653 | Ga0496112_0120152 | 3300048915 | Bacteria | 2597 |
| 654 | Ga0496113_0010421 | 3300048916 | Bacteria | 6145 |
| 655 | Ga0496113_0078007 | 3300048916 | Bacteria | 2534 |
| 656 | Ga0496113_0158758 | 3300048916 | Bacteria | 1787 |
| 657 | Ga0496114_0029797 | 3300048917 | Bacteria | 4486 |
| 658 | Ga0496114_0081236 | 3300048917 | Bacteria | 2738 |
| 659 | Ga0496115_0001214 | 3300048918 | Bacteria | 18485 |
| 660 | Ga0496115_0028522 | 3300048918 | Bacteria | 4376 |
| 661 | Ga0496115_0063304 | 3300048918 | Bacteria | 2984 |
| 662 | Ga0496115_0115411 | 3300048918 | Bacteria | 2208 |
| 663 | Ga0496116_0000887 | 3300048919 | Bacteria | 37313 |
| 664 | Ga0496116_0079774 | 3300048919 | Bacteria | 2035 |
| 665 | Ga0496117_0010525 | 3300048920 | Bacteria | 8412 |
| 666 | Ga0496117_0041120 | 3300048920 | Bacteria | 3391 |
| 667 | Ga0496118_0002852 | 3300048921 | Bacteria | 22557 |
| 668 | Ga0496118_0117775 | 3300048921 | Bacteria | 1741 |
| 669 | Ga0496119_0105327 | 3300048922 | Bacteria | 1576 |
| 670 | Ga0496120_0014244 | 3300048923 | Bacteria | 5309 |
| 671 | Ga0496120_0022800 | 3300048923 | Bacteria | 3934 |
| 672 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 673 | Ga0496121_0000744 | 3300048924 | Bacteria | 59867 |
| 674 | Ga0496121_0002334 | 3300048924 | Bacteria | 29308 |
| 675 | Ga0496121_0002685 | 3300048924 | Bacteria | 26602 |
| 676 | Ga0496121_0013525 | 3300048924 | Bacteria | 8756 |
| 677 | Ga0496121_0017799 | 3300048924 | Bacteria | 7219 |
| 678 | Ga0496121_0076211 | 3300048924 | Bacteria | 2675 |
| 679 | Ga0496121_0087108 | 3300048924 | Bacteria | 2452 |
| 680 | Ga0496121_0243521 | 3300048924 | Bacteria | 1251 |
| 681 | Ga0496122_0172992 | 3300048925 | Bacteria | 1298 |
| 682 | Ga0496123_0012664 | 3300048926 | Bacteria | 7162 |
| 683 | Ga0496123_0037135 | 3300048926 | Bacteria | 3444 |
| 684 | Ga0496124_0099057 | 3300048927 | Bacteria | 2364 |
| 685 | Ga0496125_0000092 | 3300048928 | Bacteria | 211050 |
| 686 | Ga0496125_0009888 | 3300048928 | Bacteria | 9704 |
| 687 | Ga0496125_0032161 | 3300048928 | Bacteria | 4664 |
| 688 | Ga0496125_0050130 | 3300048928 | Bacteria | 3460 |
| 689 | Ga0496126_0003893 | 3300048929 | Bacteria | 18354 |
| 690 | Ga0496126_0004798 | 3300048929 | Bacteria | 15887 |
| 691 | Ga0496126_0009161 | 3300048929 | Bacteria | 10564 |
| 692 | Ga0496126_0009826 | 3300048929 | Bacteria | 10129 |
| 693 | Ga0496126_0026815 | 3300048929 | Bacteria | 5516 |
| 694 | Ga0496126_0063952 | 3300048929 | Bacteria | 3296 |
| 695 | Ga0496126_0066024 | 3300048929 | Bacteria | 3236 |
| 696 | Ga0496126_0131725 | 3300048929 | Bacteria | 2160 |
| 697 | Ga0496126_0148217 | 3300048929 | Bacteria | 2013 |
| 698 | Ga0496126_0213781 | 3300048929 | Bacteria | 1622 |
| 699 | Ga0496126_0278204 | 3300048929 | Bacteria | 1387 |
| 700 | Ga0495682_0016840 | 3300049460 | Bacteria | 2764 |
| 701 | Ga0501031_0010093 | 3300049568 | Bacteria | 6154 |
| 702 | Ga0501031_0126629 | 3300049568 | Bacteria | 1668 |
| 703 | Ga0501032_0000107 | 3300049569 | Bacteria | 71122 |
| 704 | Ga0501032_0000318 | 3300049569 | Bacteria | 40445 |
| 705 | Ga0501032_0078193 | 3300049569 | Bacteria | 2202 |
| 706 | Ga0501033_0000144 | 3300049570 | Bacteria | 68553 |
| 707 | Ga0501033_0001175 | 3300049570 | Bacteria | 23612 |
| 708 | Ga0501033_0010540 | 3300049570 | Bacteria | 7087 |
| 709 | Ga0501033_0016116 | 3300049570 | Bacteria | 5658 |
| 710 | Ga0501033_0041619 | 3300049570 | Bacteria | 3427 |
| 711 | Ga0501033_0129906 | 3300049570 | Bacteria | 1825 |
| 712 | Ga0501034_0000061 | 3300049571 | Bacteria | 195178 |
| 713 | Ga0501034_0000412 | 3300049571 | Bacteria | 71925 |
| 714 | Ga0501034_0107111 | 3300049571 | Bacteria | 2788 |
| 715 | Ga0501034_0120666 | 3300049571 | Bacteria | 2608 |
| 716 | Ga0501036_0000007 | 3300049572 | Bacteria | 240500 |
| 717 | Ga0501036_0000387 | 3300049572 | Bacteria | 31150 |
| 718 | Ga0501037_0000066 | 3300049573 | Bacteria | 96723 |
| 719 | Ga0501037_0000104 | 3300049573 | Bacteria | 80204 |
| 720 | Ga0501037_0000457 | 3300049573 | Bacteria | 33231 |
| 721 | Ga0501037_0094501 | 3300049573 | Bacteria | 2162 |
| 722 | Ga0501038_0002223 | 3300049574 | Bacteria | 18059 |
| 723 | Ga0501038_0013623 | 3300049574 | Bacteria | 7409 |
| 724 | Ga0501038_0023857 | 3300049574 | Bacteria | 5461 |
| 725 | Ga0501038_0024872 | 3300049574 | Bacteria | 5337 |
| 726 | Ga0501038_0088993 | 3300049574 | Bacteria | 2590 |
| 727 | Ga0501038_0217028 | 3300049574 | Bacteria | 1528 |
| 728 | Ga0501039_0000005 | 3300049575 | Bacteria | 295471 |
| 729 | Ga0501039_0000536 | 3300049575 | Bacteria | 27529 |
| 730 | Ga0501039_0005841 | 3300049575 | Bacteria | 9322 |
| 731 | Ga0501039_0111908 | 3300049575 | Bacteria | 2134 |
| 732 | Ga0501040_0042235 | 3300049576 | Bacteria | 3105 |
| 733 | Ga0501042_0021996 | 3300049578 | Bacteria | 4451 |
| 734 | Ga0501042_0066707 | 3300049578 | Bacteria | 2573 |
| 735 | Ga0501042_0112695 | 3300049578 | Bacteria | 1958 |
| 736 | Ga0501043_0000036 | 3300049579 | Bacteria | 132959 |
| 737 | Ga0501043_0000161 | 3300049579 | Bacteria | 60738 |
| 738 | Ga0501043_0037811 | 3300049579 | Bacteria | 3796 |
| 739 | Ga0501046_0000032 | 3300049580 | Bacteria | 180265 |
| 740 | Ga0501046_0008502 | 3300049580 | Bacteria | 8938 |
| 741 | Ga0501047_0000077 | 3300049581 | Bacteria | 123480 |
| 742 | Ga0501047_0000122 | 3300049581 | Bacteria | 95307 |
| 743 | Ga0501047_0000815 | 3300049581 | Bacteria | 32451 |
| 744 | Ga0501047_0004734 | 3300049581 | Bacteria | 12797 |
| 745 | Ga0501047_0030093 | 3300049581 | Bacteria | 5234 |
| 746 | Ga0501047_0083576 | 3300049581 | Bacteria | 3068 |
| 747 | Ga0501047_0156510 | 3300049581 | Bacteria | 2152 |
| 748 | Ga0501048_0000053 | 3300049582 | Bacteria | 57136 |
| 749 | Ga0501048_0018667 | 3300049582 | Bacteria | 5098 |
| 750 | Ga0501067_0000194 | 3300049583 | Bacteria | 34364 |
| 751 | Ga0501067_0002271 | 3300049583 | Bacteria | 10608 |
| 752 | Ga0501067_0005167 | 3300049583 | Bacteria | 7256 |
| 753 | Ga0501067_0006064 | 3300049583 | Bacteria | 6701 |
| 754 | Ga0501067_0018088 | 3300049583 | Bacteria | 3902 |
| 755 | Ga0501068_0002401 | 3300049584 | Bacteria | 9949 |
| 756 | Ga0501068_0022723 | 3300049584 | Bacteria | 3670 |
| 757 | Ga0501069_0002581 | 3300049585 | Bacteria | 9247 |
| 758 | Ga0501069_0003508 | 3300049585 | Bacteria | 8075 |
| 759 | Ga0501069_0007163 | 3300049585 | Bacteria | 5846 |
| 760 | Ga0501070_0000070 | 3300049586 | Bacteria | 86706 |
| 761 | Ga0501070_0000659 | 3300049586 | Bacteria | 31835 |
| 762 | Ga0501070_0011879 | 3300049586 | Bacteria | 7354 |
| 763 | Ga0501070_0080943 | 3300049586 | Bacteria | 2687 |
| 764 | Ga0501070_0127243 | 3300049586 | Bacteria | 2105 |
| 765 | Ga0501071_0096680 | 3300049587 | Bacteria | 2174 |
| 766 | Ga0501072_0000606 | 3300049588 | Bacteria | 25831 |
| 767 | Ga0501072_0000739 | 3300049588 | Bacteria | 23844 |
| 768 | Ga0501072_0030322 | 3300049588 | Bacteria | 4229 |
| 769 | Ga0501073_0000233 | 3300049589 | Bacteria | 36619 |
| 770 | Ga0501073_0001231 | 3300049589 | Bacteria | 18682 |
| 771 | Ga0501073_0049354 | 3300049589 | Bacteria | 2951 |
| 772 | Ga0501073_0070215 | 3300049589 | Bacteria | 2440 |
| 773 | Ga0501074_0000656 | 3300049590 | Bacteria | 21579 |
| 774 | Ga0501074_0001541 | 3300049590 | Bacteria | 15580 |
| 775 | Ga0501074_0018352 | 3300049590 | Bacteria | 5081 |
| 776 | Ga0501079_0027792 | 3300049741 | Bacteria | 4339 |
| 777 | Ga0501080_0000132 | 3300049742 | Bacteria | 52967 |
| 778 | Ga0501080_0025776 | 3300049742 | Bacteria | 5461 |
| 779 | Ga0501080_0067266 | 3300049742 | Bacteria | 3332 |
| 780 | Ga0501080_0170031 | 3300049742 | Bacteria | 2010 |
| 781 | Ga0501083_0001610 | 3300049744 | Bacteria | 15439 |
| 782 | Ga0501083_0027555 | 3300049744 | Bacteria | 3920 |
| 783 | Ga0501035_0000016 | 3300049822 | Bacteria | 243412 |
| 784 | Ga0501035_0000099 | 3300049822 | Bacteria | 108224 |
| 785 | Ga0501035_0055062 | 3300049822 | Bacteria | 3552 |
| 786 | Ga0501035_0055812 | 3300049822 | Bacteria | 3526 |
| 787 | Ga0501035_0060678 | 3300049822 | Bacteria | 3366 |
| 788 | Ga0501044_0000195 | 3300049823 | Bacteria | 76643 |
| 789 | Ga0501044_0002688 | 3300049823 | Bacteria | 20220 |
| 790 | Ga0501044_0006383 | 3300049823 | Bacteria | 13039 |
| 791 | Ga0501044_0030002 | 3300049823 | Bacteria | 5733 |
| 792 | Ga0501044_0058173 | 3300049823 | Bacteria | 3965 |
| 793 | Ga0501044_0075919 | 3300049823 | Bacteria | 3412 |
| 794 | Ga0501044_0076035 | 3300049823 | Bacteria | 3409 |
| 795 | Ga0501044_0108470 | 3300049823 | Bacteria | 2786 |
| 796 | Ga0501044_0324394 | 3300049823 | Bacteria | 1463 |
| 797 | Ga0501044_0441821 | 3300049823 | Bacteria | 1208 |
| 798 | Ga0501045_0034236 | 3300049824 | Bacteria | 3686 |
| 799 | nmdc:mga03n38_103458_c1 | 3300050490 | Bacteria | 1377 |
| 800 | nmdc:mga00v17_83601_c1 | 3300050491 | Bacteria | 1997 |
| 801 | nmdc:mga0yw44_151082_c1 | 3300050492 | Bacteria | 1515 |
| 802 | nmdc:mga0yw44_5535_c1 | 3300050492 | Bacteria | 5986 |
| 803 | nmdc:mga0yw44_78912_c1 | 3300050492 | Bacteria | 2059 |
| 804 | nmdc:mga0k408_95234_c1 | 3300050493 | Bacteria | 1752 |
| 805 | nmdc:mga06z11_111691_c1 | 3300050494 | Bacteria | 1514 |
| 806 | nmdc:mga07m45_137994_c1 | 3300050496 | Bacteria | 1412 |
| 807 | nmdc:mga07m45_18120_c1 | 3300050496 | Bacteria | 3795 |
| 808 | nmdc:mga07m45_67495_c1 | 3300050496 | Bacteria | 2033 |
| 809 | nmdc:mga08y16_117307_c1 | 3300050511 | Bacteria | 2771 |
| 810 | nmdc:mga0sz30_24073_c1 | 3300050516 | Bacteria | 2483 |
| 811 | nmdc:mga0sz30_26276_c1 | 3300050516 | Bacteria | 2386 |
| 812 | nmdc:mga0sz30_9477_c1 | 3300050516 | Bacteria | 3392 |
| 813 | Ga0495601_0023544 | 3300053077 | Bacteria | 3785 |
| 814 | Ga0495601_0131740 | 3300053077 | Bacteria | 1629 |
| 815 | Ga0495612_0024682 | 3300053078 | Bacteria | 2413 |
| 816 | Ga0495595_0007012 | 3300053084 | Bacteria | 4602 |
| 817 | Ga0495619_0000332 | 3300053085 | Bacteria | 33066 |
| 818 | Ga0495619_0020566 | 3300053085 | Bacteria | 4206 |
| 819 | Ga0495619_0164996 | 3300053085 | Bacteria | 1530 |
| 820 | Ga0500643_000019 | 3300053087 | Bacteria | 294301 |
| 821 | Ga0500643_012081 | 3300053087 | Bacteria | 3110 |
| 822 | Ga0500647_0069839 | 3300053091 | Bacteria | 1689 |
| 823 | Ga0500647_0103879 | 3300053091 | Bacteria | 1355 |
| 824 | Ga0500651_0011482 | 3300053093 | Bacteria | 5342 |
| 825 | Ga0500651_0073718 | 3300053093 | Bacteria | 2122 |
| 826 | Ga0500566_0000537 | 3300053094 | Bacteria | 21255 |
| 827 | Ga0500566_0000601 | 3300053094 | Bacteria | 20208 |
| 828 | Ga0500566_0001951 | 3300053094 | Bacteria | 12138 |
| 829 | Ga0500640_002416 | 3300053095 | Bacteria | 6166 |
| 830 | Ga0500640_012322 | 3300053095 | Bacteria | 3510 |
| 831 | Ga0500648_052555 | 3300053097 | Bacteria | 2311 |
| 832 | Ga0500650_0001416 | 3300053098 | Bacteria | 7218 |
| 833 | Ga0500650_0103427 | 3300053098 | Bacteria | 1332 |
| 834 | Ga0500555_001381 | 3300053103 | Bacteria | 7493 |
| 835 | Ga0500556_0000024 | 3300053104 | Bacteria | 167556 |
| 836 | Ga0500557_000090 | 3300053105 | Bacteria | 31022 |
| 837 | Ga0500572_000758 | 3300053111 | Bacteria | 10364 |
| 838 | Ga0500572_001291 | 3300053111 | Bacteria | 7010 |
| 839 | Ga0500572_010449 | 3300053111 | Bacteria | 2220 |
| 840 | Ga0500592_000902 | 3300053116 | Bacteria | 4851 |
| 841 | Ga0500595_000286 | 3300053119 | Bacteria | 33353 |
| 842 | Ga0500595_000540 | 3300053119 | Bacteria | 22705 |
| 843 | Ga0500595_005782 | 3300053119 | Bacteria | 5341 |
| 844 | Ga0500595_006869 | 3300053119 | Bacteria | 4785 |
| 845 | Ga0500595_011713 | 3300053119 | Bacteria | 3418 |
| 846 | Ga0500595_025451 | 3300053119 | Bacteria | 2051 |
| 847 | Ga0500608_006275 | 3300053122 | Bacteria | 4825 |
| 848 | Ga0500614_001807 | 3300053123 | Bacteria | 4956 |
| 849 | Ga0500618_024391 | 3300053125 | Bacteria | 1457 |
| 850 | Ga0500642_0000035 | 3300053130 | Bacteria | 106656 |
| 851 | Ga0500642_0000203 | 3300053130 | Bacteria | 24329 |
| 852 | Ga0500652_000134 | 3300053131 | Bacteria | 27819 |
| 853 | Ga0500559_0001329 | 3300053136 | Bacteria | 14235 |
| 854 | Ga0500559_0001730 | 3300053136 | Bacteria | 11975 |
| 855 | Ga0500559_0006207 | 3300053136 | Bacteria | 5410 |
| 856 | Ga0500559_0015073 | 3300053136 | Bacteria | 3267 |
| 857 | Ga0500559_0044324 | 3300053136 | Bacteria | 1945 |
| 858 | Ga0500564_049740 | 3300053138 | Bacteria | 1919 |
| 859 | Ga0500568_0002132 | 3300053139 | Bacteria | 11939 |
| 860 | Ga0500568_0009922 | 3300053139 | Bacteria | 4495 |
| 861 | Ga0500568_0029518 | 3300053139 | Bacteria | 2275 |
| 862 | Ga0500573_0121613 | 3300053140 | Bacteria | 1452 |
| 863 | Ga0500590_071244 | 3300053148 | Bacteria | 1726 |
| 864 | Ga0500603_000817 | 3300053150 | Bacteria | 7433 |
| 865 | Ga0500603_002275 | 3300053150 | Bacteria | 4223 |
| 866 | Ga0500603_005730 | 3300053150 | Bacteria | 2683 |
| 867 | Ga0500603_010343 | 3300053150 | Bacteria | 2105 |
| 868 | Ga0500604_0020517 | 3300053151 | Bacteria | 1861 |
| 869 | Ga0500616_0000084 | 3300053153 | Bacteria | 195562 |
| 870 | Ga0500616_0000122 | 3300053153 | Bacteria | 140228 |
| 871 | Ga0500620_003161 | 3300053155 | Bacteria | 3475 |
| 872 | Ga0500622_0001260 | 3300053156 | Bacteria | 20664 |
| 873 | Ga0500627_0025661 | 3300053158 | Bacteria | 2424 |
| 874 | Ga0500630_001904 | 3300053159 | Bacteria | 10017 |
| 875 | Ga0500634_0087688 | 3300053161 | Bacteria | 1588 |
| 876 | Ga0500638_000361 | 3300053162 | Bacteria | 10532 |
| 877 | Ga0500638_077418 | 3300053162 | Bacteria | 1583 |
| 878 | Ga0500639_000166 | 3300053163 | Bacteria | 32001 |
| 879 | Ga0500639_017659 | 3300053163 | Bacteria | 3766 |
| 880 | Ga0500636_0000076 | 3300053177 | Bacteria | 48321 |
| 881 | Ga0500636_0013917 | 3300053177 | Bacteria | 4729 |
| 882 | Ga0500636_0027304 | 3300053177 | Bacteria | 3372 |
| 883 | Ga0500636_0090858 | 3300053177 | Bacteria | 1748 |
| 884 | Ga0500637_0003785 | 3300053178 | Bacteria | 7033 |
| 885 | Ga0500637_0017525 | 3300053178 | Bacteria | 3835 |
| 886 | Ga0500625_000655 | 3300053729 | Bacteria | 10043 |
| 887 | Ga0500645_006029 | 3300053730 | Bacteria | 4374 |
| 888 | Ga0500609_005292 | 3300053731 | Bacteria | 1763 |
| 889 | Ga0500609_006430 | 3300053731 | Bacteria | 1601 |
| 890 | Ga0500596_000099 | 3300053735 | Bacteria | 11805 |
| 891 | Ga0500596_002257 | 3300053735 | Bacteria | 3822 |
| 892 | Ga0500599_002472 | 3300053736 | Bacteria | 2216 |
| 893 | Ga0500601_000030 | 3300053737 | Bacteria | 31644 |
| 894 | Ga0501084_0054780 | 3300054114 | Bacteria | 3336 |
| 895 | Ga0500661_000031 | 3300055283 | Bacteria | 21207 |
| 896 | Ga0501082_0007057 | 3300060353 | Bacteria | 9698 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005338 | Ga0068868_100252254 | Ga0068868_1002522541 | 348 |
| 2 | 3300005719 | Ga0068861_100308018 | Ga0068861_1003080181 | 348 |
| 3 | 3300014326 | Ga0157380_10161391 | Ga0157380_101613912 | 348 |
| 4 | 3300025923 | Ga0207681_10225714 | Ga0207681_102257142 | 348 |
| 5 | 3300027907 | Ga0207428_10090372 | Ga0207428_100903722 | 348 |
| 6 | 3300050511 | nmdc:mga08y16_117307_c1 | nmdc:mga08y16_117307_c1_712_1911 | 348 |
| 7 | 3300005548 | Ga0070665_100085138 | Ga0070665_1000851386 | 353 |
| 8 | 3300053119 | Ga0500595_011713 | Ga0500595_011713_278_1342 | 354 |
| 9 | 3300003323 | rootH1_10167409 | rootH1_101674093 | 359 |
| 10 | 3300009098 | Ga0105245_10148087 | Ga0105245_101480873 | 359 |
| 11 | 3300009098 | Ga0105245_10149348 | Ga0105245_101493482 | 359 |
| 12 | 3300009174 | Ga0105241_10259872 | Ga0105241_102598722 | 359 |
| 13 | 3300014969 | Ga0157376_10094649 | Ga0157376_100946491 | 359 |
| 14 | 3300025927 | Ga0207687_10024884 | Ga0207687_100248845 | 359 |
| 15 | 3300028577 | Ga0265318_10006322 | Ga0265318_100063226 | 359 |
| 16 | 3300031238 | Ga0265332_10025251 | Ga0265332_100252512 | 359 |
| 17 | 3300031240 | Ga0265320_10091814 | Ga0265320_100918142 | 359 |
| 18 | 3300031595 | Ga0265313_10000665 | Ga0265313_1000066513 | 359 |
| 19 | 3300031711 | Ga0265314_10003187 | Ga0265314_100031879 | 359 |
| 20 | 3300049570 | Ga0501033_0016116 | Ga0501033_0016116_2957_4036 | 359 |
| 21 | 3300049570 | Ga0501033_0129906 | Ga0501033_0129906_496_1575 | 359 |
| 22 | 3300049573 | Ga0501037_0094501 | Ga0501037_0094501_450_1529 | 359 |
| 23 | 3300049574 | Ga0501038_0217028 | Ga0501038_0217028_57_1136 | 359 |
| 24 | 3300049580 | Ga0501046_0008502 | Ga0501046_0008502_5918_6997 | 359 |
| 25 | 3300049581 | Ga0501047_0004734 | Ga0501047_0004734_5313_6392 | 359 |
| 26 | 3300049581 | Ga0501047_0156510 | Ga0501047_0156510_796_1875 | 359 |
| 27 | 3300049586 | Ga0501070_0080943 | Ga0501070_0080943_1085_2164 | 359 |
| 28 | 3300049589 | Ga0501073_0070215 | Ga0501073_0070215_756_1835 | 359 |
| 29 | 3300049822 | Ga0501035_0055062 | Ga0501035_0055062_616_1695 | 359 |
| 30 | 3300049823 | Ga0501044_0076035 | Ga0501044_0076035_460_1539 | 359 |
| 31 | 3300053119 | Ga0500595_005782 | Ga0500595_005782_149_1291 | 360 |
| 32 | 3300053731 | Ga0500609_006430 | Ga0500609_006430_107_1249 | 360 |
| 33 | 3300005364 | Ga0070673_100078954 | Ga0070673_1000789542 | 361 |
| 34 | 3300005843 | Ga0068860_100152239 | Ga0068860_1001522393 | 361 |
| 35 | 3300006881 | Ga0068865_100024561 | Ga0068865_1000245612 | 361 |
| 36 | 3300009176 | Ga0105242_10105461 | Ga0105242_101054613 | 361 |
| 37 | 3300025933 | Ga0207706_10012522 | Ga0207706_100125221 | 361 |
| 38 | 3300025961 | Ga0207712_10023761 | Ga0207712_100237611 | 361 |
| 39 | 3300046523 | Ga0495644_0064788 | Ga0495644_0064788_32_1231 | 361 |
| 40 | 3300046615 | Ga0495656_0040131 | Ga0495656_0040131_43_1242 | 361 |
| 41 | 3300025924 | Ga0207694_10160495 | Ga0207694_101604951 | 362 |
| 42 | 3300044684 | Ga0466966_0000008 | Ga0466966_0000008_8363_9472 | 362 |
| 43 | 3300044693 | Ga0466961_0000167 | Ga0466961_0000167_8474_9583 | 362 |
| 44 | 3300045049 | Ga0466959_0000257 | Ga0466959_0000257_23063_24172 | 362 |
| 45 | iso_pu_bacteria | 2933594066 | 2933597161 | 362 |
| 46 | 3300005937 | Ga0081455_10014665 | Ga0081455_100146653 | 364 |
| 47 | 3300031240 | Ga0265320_10000034 | Ga0265320_1000003456 | 364 |
| 48 | 3300031241 | Ga0265325_10003020 | Ga0265325_1000302011 | 364 |
| 49 | 3300005563 | Ga0068855_100334602 | Ga0068855_1003346022 | 365 |
| 50 | 3300053119 | Ga0500595_000540 | Ga0500595_000540_11818_12951 | 365 |
| 51 | 3300006237 | Ga0097621_100102410 | Ga0097621_1001024102 | 366 |
| 52 | 3300025911 | Ga0207654_10158427 | Ga0207654_101584272 | 366 |
| 53 | iso_pu_bacteria | 2643221651 | 2644287834 | 366 |
| 54 | 3300036401 | Ga0373937_0112028 | Ga0373937_0112028_1403_2527 | 367 |
| 55 | iso_pu_bacteria | 642555112 | 642594086 | 367 |
| 56 | 3300013105 | Ga0157369_10009653 | Ga0157369_100096534 | 368 |
| 57 | 3300048088 | Ga0495602_0145863 | Ga0495602_0145863_740_1846 | 368 |
| 58 | 3300048907 | Ga0496104_0039497 | Ga0496104_0039497_2577_3707 | 368 |
| 59 | 3300048908 | Ga0496105_0031127 | Ga0496105_0031127_661_1791 | 368 |
| 60 | 3300049568 | Ga0501031_0126629 | Ga0501031_0126629_522_1640 | 368 |
| 61 | 3300049570 | Ga0501033_0010540 | Ga0501033_0010540_2508_3626 | 368 |
| 62 | 3300049573 | Ga0501037_0000457 | Ga0501037_0000457_26734_27852 | 368 |
| 63 | 3300049574 | Ga0501038_0023857 | Ga0501038_0023857_1685_2803 | 368 |
| 64 | 3300049575 | Ga0501039_0005841 | Ga0501039_0005841_3156_4274 | 368 |
| 65 | 3300049578 | Ga0501042_0112695 | Ga0501042_0112695_573_1691 | 368 |
| 66 | 3300049579 | Ga0501043_0037811 | Ga0501043_0037811_258_1376 | 368 |
| 67 | 3300049581 | Ga0501047_0000815 | Ga0501047_0000815_16349_17464 | 368 |
| 68 | 3300049583 | Ga0501067_0006064 | Ga0501067_0006064_4756_5871 | 368 |
| 69 | 3300049588 | Ga0501072_0000739 | Ga0501072_0000739_905_2020 | 368 |
| 70 | 3300049741 | Ga0501079_0027792 | Ga0501079_0027792_2807_3922 | 368 |
| 71 | 3300049742 | Ga0501080_0067266 | Ga0501080_0067266_428_1543 | 368 |
| 72 | 3300049822 | Ga0501035_0060678 | Ga0501035_0060678_1075_2193 | 368 |
| 73 | 3300054114 | Ga0501084_0054780 | Ga0501084_0054780_1256_2371 | 368 |
| 74 | 3300005338 | Ga0068868_100018795 | Ga0068868_1000187955 | 369 |
| 75 | 3300005456 | Ga0070678_100063165 | Ga0070678_1000631654 | 369 |
| 76 | 3300005535 | Ga0070684_100149286 | Ga0070684_1001492862 | 369 |
| 77 | 3300005564 | Ga0070664_100033848 | Ga0070664_1000338482 | 369 |
| 78 | 3300005834 | Ga0068851_10091855 | Ga0068851_100918551 | 369 |
| 79 | 3300009098 | Ga0105245_10046289 | Ga0105245_100462892 | 369 |
| 80 | 3300011119 | Ga0105246_10036888 | Ga0105246_100368882 | 369 |
| 81 | 3300013308 | Ga0157375_10056472 | Ga0157375_100564722 | 369 |
| 82 | 3300014969 | Ga0157376_10021228 | Ga0157376_100212284 | 369 |
| 83 | 3300025927 | Ga0207687_10061979 | Ga0207687_100619793 | 369 |
| 84 | 3300025981 | Ga0207640_10126305 | Ga0207640_101263052 | 369 |
| 85 | 3300026067 | Ga0207678_10017845 | Ga0207678_100178455 | 369 |
| 86 | 3300026121 | Ga0207683_10265774 | Ga0207683_102657741 | 369 |
| 87 | 3300048903 | Ga0496100_0057827 | Ga0496100_0057827_230_1507 | 369 |
| 88 | 3300048904 | Ga0496101_0005595 | Ga0496101_0005595_4999_6276 | 369 |
| 89 | 3300048909 | Ga0496106_0037975 | Ga0496106_0037975_1701_2978 | 369 |
| 90 | 3300048913 | Ga0496110_0020114 | Ga0496110_0020114_2294_3571 | 369 |
| 91 | 3300048915 | Ga0496112_0061112 | Ga0496112_0061112_1727_3004 | 369 |
| 92 | 3300048918 | Ga0496115_0001214 | Ga0496115_0001214_2801_4078 | 369 |
| 93 | 3300049823 | Ga0501044_0002688 | Ga0501044_0002688_6954_8075 | 369 |
| 94 | iso_pu_bacteria | 2602042107 | 2603861069 | 369 |
| 95 | iso_pu_bacteria | 2857524615 | 2857528804 | 369 |
| 96 | iso_pu_bacteria | 2893066018 | 2893068998 | 369 |
| 97 | iso_pu_bacteria | 2919073203 | 2919079231 | 369 |
| 98 | 3300005327 | Ga0070658_10091665 | Ga0070658_100916652 | 370 |
| 99 | 3300025929 | Ga0207664_10125955 | Ga0207664_101259554 | 370 |
| 100 | 3300038443 | Ga0395901_0007795 | Ga0395901_0007795_6738_7901 | 370 |
| 101 | 3300048910 | Ga0496107_0026546 | Ga0496107_0026546_1627_2739 | 370 |
| 102 | 3300048924 | Ga0496121_0000744 | Ga0496121_0000744_18906_20018 | 370 |
| 103 | 3300048929 | Ga0496126_0063952 | Ga0496126_0063952_1935_3047 | 370 |
| 104 | 3300049571 | Ga0501034_0120666 | Ga0501034_0120666_609_1874 | 370 |
| 105 | 3300049581 | Ga0501047_0030093 | Ga0501047_0030093_2045_3157 | 370 |
| 106 | 3300049581 | Ga0501047_0083576 | Ga0501047_0083576_1470_2582 | 370 |
| 107 | 3300049586 | Ga0501070_0127243 | Ga0501070_0127243_944_2056 | 370 |
| 108 | 3300049822 | Ga0501035_0055812 | Ga0501035_0055812_1392_2504 | 370 |
| 109 | 3300049823 | Ga0501044_0075919 | Ga0501044_0075919_2130_3242 | 370 |
| 110 | 3300053153 | Ga0500616_0000084 | Ga0500616_0000084_191995_193107 | 370 |
| 111 | 3300003320 | rootH2_10001288 | rootH2_1000128817 | 371 |
| 112 | 3300005614 | Ga0068856_100001907 | Ga0068856_10000190720 | 371 |
| 113 | 3300026078 | Ga0207702_10000403 | Ga0207702_100004038 | 371 |
| 114 | 3300031247 | Ga0265340_10020095 | Ga0265340_100200952 | 371 |
| 115 | 3300035724 | Ga0373933_0000405 | Ga0373933_0000405_4258_5436 | 371 |
| 116 | iso_pu_bacteria | 2508501042 | 2508698054 | 371 |
| 117 | iso_pu_bacteria | 2513237092 | 2513628169 | 371 |
| 118 | iso_pu_bacteria | 2513237094 | 2513643539 | 371 |
| 119 | iso_pu_bacteria | 2617270741 | 2617378935 | 371 |
| 120 | iso_pu_bacteria | 2824679649 | 2824684219 | 371 |
| 121 | iso_pu_bacteria | 2824732956 | 2824740549 | 371 |
| 122 | iso_pu_bacteria | 2824746037 | 2824752374 | 371 |
| 123 | iso_pu_bacteria | 2844315083 | 2844317758 | 371 |
| 124 | iso_pu_bacteria | 2874590934 | 2874596756 | 371 |
| 125 | iso_pu_bacteria | 2874612657 | 2874618240 | 371 |
| 126 | iso_pu_bacteria | 2874645413 | 2874653014 | 371 |
| 127 | iso_pu_bacteria | 2876771140 | 2876776948 | 371 |
| 128 | iso_pu_bacteria | 2876818435 | 2876825302 | 371 |
| 129 | iso_pu_bacteria | 2879074833 | 2879081085 | 371 |
| 130 | iso_pu_bacteria | 2879127579 | 2879130823 | 371 |
| 131 | iso_pu_bacteria | 2879142872 | 2879147587 | 371 |
| 132 | iso_pu_bacteria | 2881665667 | 2881671743 | 371 |
| 133 | iso_pu_bacteria | 2903727486 | 2903735436 | 371 |
| 134 | iso_pu_bacteria | 2906602504 | 2906608645 | 371 |
| 135 | iso_pu_bacteria | 2908775508 | 2908778727 | 371 |
| 136 | iso_pu_bacteria | 2922393267 | 2922395000 | 371 |
| 137 | iso_pu_bacteria | 2932794094 | 2932797342 | 371 |
| 138 | iso_pu_bacteria | 2932801729 | 2932804773 | 371 |
| 139 | iso_pu_bacteria | 2935648319 | 2935648522 | 371 |
| 140 | iso_pu_bacteria | 2935656913 | 2935657490 | 371 |
| 141 | iso_pu_bacteria | 2935883170 | 2935884991 | 371 |
| 142 | iso_pu_bacteria | 2935984226 | 2935987878 | 371 |
| 143 | iso_pu_bacteria | 2936011229 | 2936011432 | 371 |
| 144 | iso_pu_bacteria | 2936019824 | 2936020027 | 371 |
| 145 | iso_pu_bacteria | 2936028420 | 2936028623 | 371 |
| 146 | iso_pu_bacteria | 2936046547 | 2936046750 | 371 |
| 147 | iso_pu_bacteria | 2936055302 | 2936058375 | 371 |
| 148 | iso_pu_bacteria | 3005483717 | 3005487952 | 371 |
| 149 | iso_pu_bacteria | 3005587118 | 3005589459 | 371 |
| 150 | iso_pu_bacteria | 3005594810 | 3005597498 | 371 |
| 151 | iso_pu_bacteria | 3005718088 | 3005720926 | 371 |
| 152 | iso_pu_bacteria | 8016630954 | 8016632564 | 371 |
| 153 | iso_pu_bacteria | 8019648815 | 8019656488 | 371 |
| 154 | iso_pu_bacteria | 8019678201 | 8019682769 | 371 |
| 155 | iso_pu_bacteria | 8056967851 | 8056969556 | 371 |
| 156 | 3300005330 | Ga0070690_100134148 | Ga0070690_1001341482 | 372 |
| 157 | 3300005578 | Ga0068854_100202305 | Ga0068854_1002023052 | 372 |
| 158 | 3300005614 | Ga0068856_100005219 | Ga0068856_1000052196 | 372 |
| 159 | 3300005616 | Ga0068852_100048809 | Ga0068852_1000488092 | 372 |
| 160 | 3300009093 | Ga0105240_10157997 | Ga0105240_101579972 | 372 |
| 161 | 3300009551 | Ga0105238_10055335 | Ga0105238_100553352 | 372 |
| 162 | 3300010375 | Ga0105239_10015059 | Ga0105239_100150596 | 372 |
| 163 | 3300013102 | Ga0157371_10023274 | Ga0157371_100232742 | 372 |
| 164 | 3300013104 | Ga0157370_10025179 | Ga0157370_100251792 | 372 |
| 165 | 3300025295 | Ga0209564_1000164 | Ga0209564_1000164137 | 372 |
| 166 | 3300025904 | Ga0207647_10000486 | Ga0207647_1000048621 | 372 |
| 167 | 3300025919 | Ga0207657_10038250 | Ga0207657_100382504 | 372 |
| 168 | 3300025921 | Ga0207652_10143237 | Ga0207652_101432372 | 372 |
| 169 | 3300025924 | Ga0207694_10013338 | Ga0207694_100133385 | 372 |
| 170 | 3300025981 | Ga0207640_10054955 | Ga0207640_100549552 | 372 |
| 171 | 3300025981 | Ga0207640_10160943 | Ga0207640_101609431 | 372 |
| 172 | 3300026041 | Ga0207639_10006484 | Ga0207639_100064846 | 372 |
| 173 | 3300035691 | Ga0373931_0072073 | Ga0373931_0072073_418_1566 | 372 |
| 174 | 3300048908 | Ga0496105_0108332 | Ga0496105_0108332_1091_2233 | 372 |
| 175 | 3300048913 | Ga0496110_0426339 | Ga0496110_0426339_39_1181 | 372 |
| 176 | 3300049568 | Ga0501031_0010093 | Ga0501031_0010093_1205_2335 | 372 |
| 177 | 3300049569 | Ga0501032_0000107 | Ga0501032_0000107_15517_16776 | 372 |
| 178 | 3300049569 | Ga0501032_0000318 | Ga0501032_0000318_3336_4466 | 372 |
| 179 | 3300049570 | Ga0501033_0000144 | Ga0501033_0000144_2297_3556 | 372 |
| 180 | 3300049570 | Ga0501033_0001175 | Ga0501033_0001175_2756_3886 | 372 |
| 181 | 3300049571 | Ga0501034_0000061 | Ga0501034_0000061_47606_48736 | 372 |
| 182 | 3300049571 | Ga0501034_0000412 | Ga0501034_0000412_63670_64929 | 372 |
| 183 | 3300049572 | Ga0501036_0000007 | Ga0501036_0000007_112590_113849 | 372 |
| 184 | 3300049572 | Ga0501036_0000387 | Ga0501036_0000387_21146_22276 | 372 |
| 185 | 3300049573 | Ga0501037_0000066 | Ga0501037_0000066_6829_8088 | 372 |
| 186 | 3300049573 | Ga0501037_0000104 | Ga0501037_0000104_70263_71393 | 372 |
| 187 | 3300049574 | Ga0501038_0002223 | Ga0501038_0002223_2169_3428 | 372 |
| 188 | 3300049574 | Ga0501038_0013623 | Ga0501038_0013623_1012_2142 | 372 |
| 189 | 3300049574 | Ga0501038_0024872 | Ga0501038_0024872_3029_4159 | 372 |
| 190 | 3300049574 | Ga0501038_0088993 | Ga0501038_0088993_870_2000 | 372 |
| 191 | 3300049575 | Ga0501039_0000005 | Ga0501039_0000005_138342_139601 | 372 |
| 192 | 3300049575 | Ga0501039_0000536 | Ga0501039_0000536_8280_9410 | 372 |
| 193 | 3300049575 | Ga0501039_0111908 | Ga0501039_0111908_414_1544 | 372 |
| 194 | 3300049576 | Ga0501040_0042235 | Ga0501040_0042235_1355_2485 | 372 |
| 195 | 3300049578 | Ga0501042_0021996 | Ga0501042_0021996_1669_2799 | 372 |
| 196 | 3300049578 | Ga0501042_0066707 | Ga0501042_0066707_893_2152 | 372 |
| 197 | 3300049579 | Ga0501043_0000036 | Ga0501043_0000036_16768_18027 | 372 |
| 198 | 3300049579 | Ga0501043_0000161 | Ga0501043_0000161_28188_29318 | 372 |
| 199 | 3300049580 | Ga0501046_0000032 | Ga0501046_0000032_155423_156682 | 372 |
| 200 | 3300049581 | Ga0501047_0000077 | Ga0501047_0000077_112482_113741 | 372 |
| 201 | 3300049581 | Ga0501047_0000122 | Ga0501047_0000122_41373_42503 | 372 |
| 202 | 3300049582 | Ga0501048_0000053 | Ga0501048_0000053_5318_6448 | 372 |
| 203 | 3300049582 | Ga0501048_0018667 | Ga0501048_0018667_1534_2664 | 372 |
| 204 | 3300049583 | Ga0501067_0000194 | Ga0501067_0000194_22623_23753 | 372 |
| 205 | 3300049583 | Ga0501067_0002271 | Ga0501067_0002271_7432_8691 | 372 |
| 206 | 3300049583 | Ga0501067_0018088 | Ga0501067_0018088_1387_2517 | 372 |
| 207 | 3300049584 | Ga0501068_0002401 | Ga0501068_0002401_7245_8504 | 372 |
| 208 | 3300049584 | Ga0501068_0022723 | Ga0501068_0022723_585_1715 | 372 |
| 209 | 3300049585 | Ga0501069_0002581 | Ga0501069_0002581_1956_3215 | 372 |
| 210 | 3300049585 | Ga0501069_0003508 | Ga0501069_0003508_3007_4137 | 372 |
| 211 | 3300049585 | Ga0501069_0007163 | Ga0501069_0007163_3184_4314 | 372 |
| 212 | 3300049586 | Ga0501070_0000070 | Ga0501070_0000070_55754_57013 | 372 |
| 213 | 3300049586 | Ga0501070_0000659 | Ga0501070_0000659_13869_14999 | 372 |
| 214 | 3300049587 | Ga0501071_0096680 | Ga0501071_0096680_161_1291 | 372 |
| 215 | 3300049588 | Ga0501072_0000606 | Ga0501072_0000606_8363_9493 | 372 |
| 216 | 3300049588 | Ga0501072_0030322 | Ga0501072_0030322_1344_2474 | 372 |
| 217 | 3300049589 | Ga0501073_0000233 | Ga0501073_0000233_28736_29995 | 372 |
| 218 | 3300049589 | Ga0501073_0001231 | Ga0501073_0001231_2805_3935 | 372 |
| 219 | 3300049589 | Ga0501073_0049354 | Ga0501073_0049354_1335_2465 | 372 |
| 220 | 3300049590 | Ga0501074_0000656 | Ga0501074_0000656_5528_6658 | 372 |
| 221 | 3300049590 | Ga0501074_0001541 | Ga0501074_0001541_8682_9941 | 372 |
| 222 | 3300049742 | Ga0501080_0000132 | Ga0501080_0000132_36316_37575 | 372 |
| 223 | 3300049742 | Ga0501080_0025776 | Ga0501080_0025776_4157_5287 | 372 |
| 224 | 3300049744 | Ga0501083_0001610 | Ga0501083_0001610_3562_4692 | 372 |
| 225 | 3300049744 | Ga0501083_0027555 | Ga0501083_0027555_1457_2587 | 372 |
| 226 | 3300049822 | Ga0501035_0000016 | Ga0501035_0000016_80325_81584 | 372 |
| 227 | 3300049822 | Ga0501035_0000099 | Ga0501035_0000099_25865_26995 | 372 |
| 228 | 3300049823 | Ga0501044_0000195 | Ga0501044_0000195_49649_50779 | 372 |
| 229 | 3300049823 | Ga0501044_0006383 | Ga0501044_0006383_2169_3428 | 372 |
| 230 | 3300049823 | Ga0501044_0030002 | Ga0501044_0030002_3222_4352 | 372 |
| 231 | 3300049823 | Ga0501044_0324394 | Ga0501044_0324394_172_1302 | 372 |
| 232 | 3300049823 | Ga0501044_0441821 | Ga0501044_0441821_20_1150 | 372 |
| 233 | 3300049824 | Ga0501045_0034236 | Ga0501045_0034236_311_1570 | 372 |
| 234 | 3300060353 | Ga0501082_0007057 | Ga0501082_0007057_854_1984 | 372 |
| 235 | iso_pu_bacteria | 2513237101 | 2513696907 | 372 |
| 236 | iso_pu_bacteria | 2874604998 | 2874610678 | 372 |
| 237 | iso_pu_bacteria | 2876808645 | 2876809479 | 372 |
| 238 | iso_pu_bacteria | 2879110137 | 2879118747 | 372 |
| 239 | iso_pu_bacteria | 2889033259 | 2889039138 | 372 |
| 240 | iso_pu_bacteria | 2904690495 | 2904691603 | 372 |
| 241 | iso_pu_bacteria | 2908756301 | 2908761864 | 372 |
| 242 | iso_pu_bacteria | 2922361189 | 2922362164 | 372 |
| 243 | iso_pu_bacteria | 2922386360 | 2922388077 | 372 |
| 244 | iso_pu_bacteria | 2935959822 | 2935963365 | 372 |
| 245 | iso_pu_bacteria | 8006994254 | 8006999839 | 372 |
| 246 | iso_pu_bacteria | 8056673599 | 8056680258 | 372 |
| 247 | 3300031616 | Ga0307508_10230392 | Ga0307508_102303921 | 373 |
| 248 | 3300046460 | Ga0495638_0035929 | Ga0495638_0035929_1137_2270 | 373 |
| 249 | 3300046512 | Ga0495610_0008306 | Ga0495610_0008306_35_1168 | 373 |
| 250 | 3300046518 | Ga0495631_0022910 | Ga0495631_0022910_750_1883 | 373 |
| 251 | 3300046692 | Ga0495671_0091306 | Ga0495671_0091306_85_1218 | 373 |
| 252 | 3300047472 | Ga0495686_0010639 | Ga0495686_0010639_5303_6436 | 373 |
| 253 | 3300048919 | Ga0496116_0000887 | Ga0496116_0000887_4453_5586 | 373 |
| 254 | 3300048920 | Ga0496117_0041120 | Ga0496117_0041120_1476_2609 | 373 |
| 255 | 3300048921 | Ga0496118_0117775 | Ga0496118_0117775_477_1610 | 373 |
| 256 | 3300048923 | Ga0496120_0022800 | Ga0496120_0022800_577_1710 | 373 |
| 257 | 3300048924 | Ga0496121_0002685 | Ga0496121_0002685_1557_2690 | 373 |
| 258 | 3300048925 | Ga0496122_0172992 | Ga0496122_0172992_106_1239 | 373 |
| 259 | 3300048926 | Ga0496123_0012664 | Ga0496123_0012664_5098_6231 | 373 |
| 260 | 3300048926 | Ga0496123_0037135 | Ga0496123_0037135_1389_2522 | 373 |
| 261 | 3300048928 | Ga0496125_0000092 | Ga0496125_0000092_171503_172636 | 373 |
| 262 | 3300048928 | Ga0496125_0009888 | Ga0496125_0009888_4731_5864 | 373 |
| 263 | 3300050492 | nmdc:mga0yw44_5535_c1 | nmdc:mga0yw44_5535_c1_3943_5076 | 373 |
| 264 | 3300050516 | nmdc:mga0sz30_24073_c1 | nmdc:mga0sz30_24073_c1_1123_2256 | 373 |
| 265 | 3300053087 | Ga0500643_012081 | Ga0500643_012081_1430_2563 | 373 |
| 266 | 3300053093 | Ga0500651_0011482 | Ga0500651_0011482_3318_4451 | 373 |
| 267 | 3300053098 | Ga0500650_0001416 | Ga0500650_0001416_5649_6782 | 373 |
| 268 | 3300053104 | Ga0500556_0000024 | Ga0500556_0000024_104454_105587 | 373 |
| 269 | 3300053116 | Ga0500592_000902 | Ga0500592_000902_1057_2190 | 373 |
| 270 | 3300053122 | Ga0500608_006275 | Ga0500608_006275_1116_2249 | 373 |
| 271 | 3300053125 | Ga0500618_024391 | Ga0500618_024391_149_1282 | 373 |
| 272 | 3300053130 | Ga0500642_0000035 | Ga0500642_0000035_32225_33358 | 373 |
| 273 | 3300053131 | Ga0500652_000134 | Ga0500652_000134_1817_2950 | 373 |
| 274 | 3300053136 | Ga0500559_0001329 | Ga0500559_0001329_5485_6618 | 373 |
| 275 | 3300053139 | Ga0500568_0002132 | Ga0500568_0002132_7842_8975 | 373 |
| 276 | 3300053153 | Ga0500616_0000122 | Ga0500616_0000122_107389_108522 | 373 |
| 277 | 3300053156 | Ga0500622_0001260 | Ga0500622_0001260_12284_13417 | 373 |
| 278 | 3300053158 | Ga0500627_0025661 | Ga0500627_0025661_567_1700 | 373 |
| 279 | 3300053161 | Ga0500634_0087688 | Ga0500634_0087688_182_1315 | 373 |
| 280 | 3300053177 | Ga0500636_0013917 | Ga0500636_0013917_2717_3850 | 373 |
| 281 | iso_pu_bacteria | 2508501128 | 2509147583 | 373 |
| 282 | iso_pu_bacteria | 2511231028 | 2511397558 | 373 |
| 283 | iso_pu_bacteria | 2513237095 | 2513652296 | 373 |
| 284 | iso_pu_bacteria | 2513237096 | 2513660106 | 373 |
| 285 | iso_pu_bacteria | 2513237098 | 2513676406 | 373 |
| 286 | iso_pu_bacteria | 2513237102 | 2513700289 | 373 |
| 287 | iso_pu_bacteria | 2513237104 | 2513720517 | 373 |
| 288 | iso_pu_bacteria | 2513237137 | 2513858283 | 373 |
| 289 | iso_pu_bacteria | 2513237139 | 2513878138 | 373 |
| 290 | iso_pu_bacteria | 2513237141 | 2513893325 | 373 |
| 291 | iso_pu_bacteria | 2513237145 | 2513922084 | 373 |
| 292 | iso_pu_bacteria | 2513237161 | 2514012565 | 373 |
| 293 | iso_pu_bacteria | 2517093001 | 2517107506 | 373 |
| 294 | iso_pu_bacteria | 2517572143 | 2517893828 | 373 |
| 295 | iso_pu_bacteria | 2524023210 | 2524469447 | 373 |
| 296 | iso_pu_bacteria | 2524023228 | 2524537777 | 373 |
| 297 | iso_pu_bacteria | 2528768022 | 2528849581 | 373 |
| 298 | iso_pu_bacteria | 2617270735 | 2617353094 | 373 |
| 299 | iso_pu_bacteria | 2728368998 | 2728747943 | 373 |
| 300 | iso_pu_bacteria | 2791355196 | 2793060010 | 373 |
| 301 | iso_pu_bacteria | 2791355197 | 2793072539 | 373 |
| 302 | iso_pu_bacteria | 2802429603 | 2805920099 | 373 |
| 303 | iso_pu_bacteria | 2816332527 | 2818241570 | 373 |
| 304 | iso_pu_bacteria | 2824600985 | 2824605622 | 373 |
| 305 | iso_pu_bacteria | 2824609381 | 2824609872 | 373 |
| 306 | iso_pu_bacteria | 2824617872 | 2824625342 | 373 |
| 307 | iso_pu_bacteria | 2824626560 | 2824633829 | 373 |
| 308 | iso_pu_bacteria | 2824635225 | 2824641567 | 373 |
| 309 | iso_pu_bacteria | 2824644064 | 2824652067 | 373 |
| 310 | iso_pu_bacteria | 2824653114 | 2824655729 | 373 |
| 311 | iso_pu_bacteria | 2824661429 | 2824669434 | 373 |
| 312 | iso_pu_bacteria | 2824671348 | 2824674184 | 373 |
| 313 | iso_pu_bacteria | 2824687955 | 2824693036 | 373 |
| 314 | iso_pu_bacteria | 2824696289 | 2824698917 | 373 |
| 315 | iso_pu_bacteria | 2824704595 | 2824713810 | 373 |
| 316 | iso_pu_bacteria | 2824714736 | 2824722430 | 373 |
| 317 | iso_pu_bacteria | 2824723954 | 2824729012 | 373 |
| 318 | iso_pu_bacteria | 2824753945 | 2824758051 | 373 |
| 319 | iso_pu_bacteria | 2824763712 | 2824766189 | 373 |
| 320 | iso_pu_bacteria | 2824773399 | 2824774279 | 373 |
| 321 | iso_pu_bacteria | 2838122688 | 2838127549 | 373 |
| 322 | iso_pu_bacteria | 2841941048 | 2841941499 | 373 |
| 323 | iso_pu_bacteria | 2841949485 | 2841952488 | 373 |
| 324 | iso_pu_bacteria | 2841957949 | 2841959510 | 373 |
| 325 | iso_pu_bacteria | 2841966195 | 2841967641 | 373 |
| 326 | iso_pu_bacteria | 2841974524 | 2841982192 | 373 |
| 327 | iso_pu_bacteria | 2841983080 | 2841986510 | 373 |
| 328 | iso_pu_bacteria | 2847930680 | 2847934542 | 373 |
| 329 | iso_pu_bacteria | 2847939898 | 2847945149 | 373 |
| 330 | iso_pu_bacteria | 2849076700 | 2849080669 | 373 |
| 331 | iso_pu_bacteria | 2857509624 | 2857509968 | 373 |
| 332 | iso_pu_bacteria | 2874620515 | 2874623233 | 373 |
| 333 | iso_pu_bacteria | 2874628541 | 2874636019 | 373 |
| 334 | iso_pu_bacteria | 2876761206 | 2876766670 | 373 |
| 335 | iso_pu_bacteria | 2879083081 | 2879089733 | 373 |
| 336 | iso_pu_bacteria | 2879099564 | 2879107751 | 373 |
| 337 | iso_pu_bacteria | 2881364244 | 2881365657 | 373 |
| 338 | iso_pu_bacteria | 2885366525 | 2885368951 | 373 |
| 339 | iso_pu_bacteria | 2885374607 | 2885381582 | 373 |
| 340 | iso_pu_bacteria | 2885409591 | 2885414449 | 373 |
| 341 | iso_pu_bacteria | 2888378607 | 2888382483 | 373 |
| 342 | iso_pu_bacteria | 2888388044 | 2888388210 | 373 |
| 343 | iso_pu_bacteria | 2888419890 | 2888423059 | 373 |
| 344 | iso_pu_bacteria | 2903748898 | 2903751612 | 373 |
| 345 | iso_pu_bacteria | 2904666416 | 2904670053 | 373 |
| 346 | iso_pu_bacteria | 2904699407 | 2904705099 | 373 |
| 347 | iso_pu_bacteria | 2904711408 | 2904718459 | 373 |
| 348 | iso_pu_bacteria | 2906610324 | 2906610708 | 373 |
| 349 | iso_pu_bacteria | 2906626472 | 2906633563 | 373 |
| 350 | iso_pu_bacteria | 2906635258 | 2906635873 | 373 |
| 351 | iso_pu_bacteria | 2906643746 | 2906649936 | 373 |
| 352 | iso_pu_bacteria | 2906660503 | 2906664031 | 373 |
| 353 | iso_pu_bacteria | 2908739725 | 2908744227 | 373 |
| 354 | iso_pu_bacteria | 2922368715 | 2922375483 | 373 |
| 355 | iso_pu_bacteria | 2922425934 | 2922428610 | 373 |
| 356 | iso_pu_bacteria | 2929615660 | 2929616218 | 373 |
| 357 | iso_pu_bacteria | 2929624759 | 2929624962 | 373 |
| 358 | iso_pu_bacteria | 2932784394 | 2932787115 | 373 |
| 359 | iso_pu_bacteria | 2932809354 | 2932811310 | 373 |
| 360 | iso_pu_bacteria | 2932818245 | 2932819817 | 373 |
| 361 | iso_pu_bacteria | 2932828146 | 2932832295 | 373 |
| 362 | iso_pu_bacteria | 2933577622 | 2933578498 | 373 |
| 363 | iso_pu_bacteria | 2935616580 | 2935619005 | 373 |
| 364 | iso_pu_bacteria | 2935630451 | 2935634584 | 373 |
| 365 | iso_pu_bacteria | 2935638405 | 2935643178 | 373 |
| 366 | iso_pu_bacteria | 2935665750 | 2935669804 | 373 |
| 367 | iso_pu_bacteria | 2935675223 | 2935677056 | 373 |
| 368 | iso_pu_bacteria | 2935684952 | 2935693095 | 373 |
| 369 | iso_pu_bacteria | 2935694250 | 2935695414 | 373 |
| 370 | iso_pu_bacteria | 2935703347 | 2935709477 | 373 |
| 371 | iso_pu_bacteria | 2935713505 | 2935719703 | 373 |
| 372 | iso_pu_bacteria | 2935722832 | 2935729530 | 373 |
| 373 | iso_pu_bacteria | 2935732158 | 2935739586 | 373 |
| 374 | iso_pu_bacteria | 2935741537 | 2935748624 | 373 |
| 375 | iso_pu_bacteria | 2935750917 | 2935756789 | 373 |
| 376 | iso_pu_bacteria | 2935760218 | 2935761222 | 373 |
| 377 | iso_pu_bacteria | 2935769743 | 2935771498 | 373 |
| 378 | iso_pu_bacteria | 2935777560 | 2935779187 | 373 |
| 379 | iso_pu_bacteria | 2935785616 | 2935790844 | 373 |
| 380 | iso_pu_bacteria | 2935793552 | 2935799215 | 373 |
| 381 | iso_pu_bacteria | 2935801545 | 2935807322 | 373 |
| 382 | iso_pu_bacteria | 2935810662 | 2935812461 | 373 |
| 383 | iso_pu_bacteria | 2935827899 | 2935832678 | 373 |
| 384 | iso_pu_bacteria | 2935837841 | 2935839243 | 373 |
| 385 | iso_pu_bacteria | 2935855204 | 2935857370 | 373 |
| 386 | iso_pu_bacteria | 2935864058 | 2935864899 | 373 |
| 387 | iso_pu_bacteria | 2935873716 | 2935876677 | 373 |
| 388 | iso_pu_bacteria | 2935992306 | 2935998972 | 373 |
| 389 | iso_pu_bacteria | 2936002035 | 2936008270 | 373 |
| 390 | iso_pu_bacteria | 2936037263 | 2936039054 | 373 |
| 391 | iso_pu_bacteria | 2940556831 | 2940562703 | 373 |
| 392 | iso_pu_bacteria | 2941507105 | 2941509070 | 373 |
| 393 | iso_pu_bacteria | 2941515067 | 2941516899 | 373 |
| 394 | iso_pu_bacteria | 2941523033 | 2941525006 | 373 |
| 395 | iso_pu_bacteria | 2941531003 | 2941536391 | 373 |
| 396 | iso_pu_bacteria | 2941538514 | 2941539933 | 373 |
| 397 | iso_pu_bacteria | 3005474847 | 3005478740 | 373 |
| 398 | iso_pu_bacteria | 3005506211 | 3005508727 | 373 |
| 399 | iso_pu_bacteria | 3005710791 | 3005713522 | 373 |
| 400 | iso_pu_bacteria | 8006926726 | 8006928227 | 373 |
| 401 | iso_pu_bacteria | 8006933436 | 8006942603 | 373 |
| 402 | iso_pu_bacteria | 8006973647 | 8006982331 | 373 |
| 403 | iso_pu_bacteria | 8016511872 | 8016515091 | 373 |
| 404 | iso_pu_bacteria | 8016522445 | 8016522884 | 373 |
| 405 | iso_pu_bacteria | 8016530956 | 8016536341 | 373 |
| 406 | iso_pu_bacteria | 8016539877 | 8016540620 | 373 |
| 407 | iso_pu_bacteria | 8016557553 | 8016561001 | 373 |
| 408 | iso_pu_bacteria | 8016566248 | 8016574706 | 373 |
| 409 | iso_pu_bacteria | 8016575299 | 8016578779 | 373 |
| 410 | iso_pu_bacteria | 8016595262 | 8016598864 | 373 |
| 411 | iso_pu_bacteria | 8016603502 | 8016612213 | 373 |
| 412 | iso_pu_bacteria | 8016613128 | 8016621591 | 373 |
| 413 | iso_pu_bacteria | 8016622563 | 8016628368 | 373 |
| 414 | iso_pu_bacteria | 8017057580 | 8017061362 | 373 |
| 415 | iso_pu_bacteria | 8019530166 | 8019536064 | 373 |
| 416 | iso_pu_bacteria | 8019538911 | 8019543406 | 373 |
| 417 | iso_pu_bacteria | 8019555841 | 8019558375 | 373 |
| 418 | iso_pu_bacteria | 8019565922 | 8019566920 | 373 |
| 419 | iso_pu_bacteria | 8019586578 | 8019588569 | 373 |
| 420 | iso_pu_bacteria | 8019597564 | 8019602768 | 373 |
| 421 | iso_pu_bacteria | 8019608314 | 8019615790 | 373 |
| 422 | iso_pu_bacteria | 8055742211 | 8055747865 | 373 |
| 423 | iso_pu_bacteria | 8056689827 | 8056695915 | 373 |
| 424 | 3300005985 | Ga0081539_10000255 | Ga0081539_100002553 | 374 |
| 425 | 3300009545 | Ga0105237_10026955 | Ga0105237_100269552 | 374 |
| 426 | 3300009551 | Ga0105238_10007520 | Ga0105238_100075204 | 374 |
| 427 | 3300010375 | Ga0105239_10049080 | Ga0105239_100490802 | 374 |
| 428 | 3300025924 | Ga0207694_10179544 | Ga0207694_101795442 | 374 |
| 429 | 3300025949 | Ga0207667_10256447 | Ga0207667_102564472 | 374 |
| 430 | 3300028800 | Ga0265338_10002444 | Ga0265338_1000244419 | 374 |
| 431 | 3300046507 | Ga0495606_0006792 | Ga0495606_0006792_2406_3530 | 374 |
| 432 | 3300046512 | Ga0495610_0082184 | Ga0495610_0082184_127_1251 | 374 |
| 433 | 3300048915 | Ga0496112_0000016 | Ga0496112_0000016_53953_55077 | 374 |
| 434 | 3300005262 | Ga0065165_1003794 | Ga0065165_10037943 | 375 |
| 435 | 3300005578 | Ga0068854_100049966 | Ga0068854_1000499661 | 375 |
| 436 | 3300006186 | Ga0075369_10029967 | Ga0075369_100299672 | 375 |
| 437 | 3300006942 | Ga0099824_1016459 | Ga0099824_10164592 | 375 |
| 438 | 3300009093 | Ga0105240_10006290 | Ga0105240_1000629011 | 375 |
| 439 | 3300009098 | Ga0105245_10057995 | Ga0105245_100579952 | 375 |
| 440 | 3300009545 | Ga0105237_10003947 | Ga0105237_1000394712 | 375 |
| 441 | 3300010375 | Ga0105239_10082749 | Ga0105239_100827491 | 375 |
| 442 | 3300021320 | Ga0214544_1000020 | Ga0214544_1000020179 | 375 |
| 443 | 3300021321 | Ga0214542_1000024 | Ga0214542_1000024190 | 375 |
| 444 | 3300021324 | Ga0214545_1000011 | Ga0214545_1000011190 | 375 |
| 445 | 3300021327 | Ga0214543_1000033 | Ga0214543_100003314 | 375 |
| 446 | 3300025254 | Ga0209148_1000574 | Ga0209148_10005741 | 375 |
| 447 | 3300025297 | Ga0209758_1002030 | Ga0209758_10020308 | 375 |
| 448 | 3300025913 | Ga0207695_10000029 | Ga0207695_1000002978 | 375 |
| 449 | 3300025914 | Ga0207671_10002273 | Ga0207671_1000227311 | 375 |
| 450 | 3300026142 | Ga0207698_10279093 | Ga0207698_102790932 | 375 |
| 451 | 3300027296 | Ga0209389_1000025 | Ga0209389_100002585 | 375 |
| 452 | 3300027357 | Ga0209589_1000066 | Ga0209589_100006634 | 375 |
| 453 | 3300027361 | Ga0209489_100030 | Ga0209489_10003079 | 375 |
| 454 | 3300037312 | Ga0395899_0090148 | Ga0395899_0090148_163_1323 | 375 |
| 455 | 3300044684 | Ga0466966_0001391 | Ga0466966_0001391_7609_8736 | 375 |
| 456 | 3300044694 | Ga0466963_0085348 | Ga0466963_0085348_568_1695 | 375 |
| 457 | 3300044901 | Ga0466960_0001540 | Ga0466960_0001540_4835_5962 | 375 |
| 458 | 3300045049 | Ga0466959_0018179 | Ga0466959_0018179_1069_2196 | 375 |
| 459 | 3300045976 | Ga0466967_0148362 | Ga0466967_0148362_668_1795 | 375 |
| 460 | 3300046533 | Ga0495640_0031782 | Ga0495640_0031782_1153_2280 | 375 |
| 461 | 3300046642 | Ga0495634_0190415 | Ga0495634_0190415_102_1229 | 375 |
| 462 | 3300046675 | Ga0495657_0027054 | Ga0495657_0027054_1650_2777 | 375 |
| 463 | 3300046690 | Ga0495624_0058391 | Ga0495624_0058391_235_1362 | 375 |
| 464 | 3300047317 | Ga0495604_0004387 | Ga0495604_0004387_2348_3475 | 375 |
| 465 | 3300048906 | Ga0496103_0038793 | Ga0496103_0038793_137_1264 | 375 |
| 466 | 3300048907 | Ga0496104_0010576 | Ga0496104_0010576_5168_6295 | 375 |
| 467 | 3300048908 | Ga0496105_0004214 | Ga0496105_0004214_3821_4948 | 375 |
| 468 | 3300048918 | Ga0496115_0063304 | Ga0496115_0063304_117_1244 | 375 |
| 469 | 3300048923 | Ga0496120_0014244 | Ga0496120_0014244_3710_4837 | 375 |
| 470 | 3300048924 | Ga0496121_0017799 | Ga0496121_0017799_5286_6419 | 375 |
| 471 | 3300049460 | Ga0495682_0016840 | Ga0495682_0016840_31_1158 | 375 |
| 472 | 3300049569 | Ga0501032_0078193 | Ga0501032_0078193_408_1568 | 375 |
| 473 | 3300049570 | Ga0501033_0041619 | Ga0501033_0041619_1756_2916 | 375 |
| 474 | 3300049571 | Ga0501034_0107111 | Ga0501034_0107111_244_1404 | 375 |
| 475 | 3300049823 | Ga0501044_0108470 | Ga0501044_0108470_1231_2391 | 375 |
| 476 | 3300050492 | nmdc:mga0yw44_151082_c1 | nmdc:mga0yw44_151082_c1_346_1479 | 375 |
| 477 | 3300050516 | nmdc:mga0sz30_26276_c1 | nmdc:mga0sz30_26276_c1_690_1817 | 375 |
| 478 | 3300053091 | Ga0500647_0069839 | Ga0500647_0069839_427_1560 | 375 |
| 479 | 3300053094 | Ga0500566_0000537 | Ga0500566_0000537_18574_19707 | 375 |
| 480 | 3300053105 | Ga0500557_000090 | Ga0500557_000090_17668_18801 | 375 |
| 481 | 3300053130 | Ga0500642_0000203 | Ga0500642_0000203_13678_14811 | 375 |
| 482 | 3300053729 | Ga0500625_000655 | Ga0500625_000655_3015_4148 | 375 |
| 483 | iso_pu_bacteria | 2507262055 | 2507510012 | 375 |
| 484 | iso_pu_bacteria | 2508501009 | 2508544014 | 375 |
| 485 | iso_pu_bacteria | 2515154112 | 2515629485 | 375 |
| 486 | iso_pu_bacteria | 2935608549 | 2935611084 | 375 |
| 487 | iso_pu_bacteria | 2935819856 | 2935820569 | 375 |
| 488 | iso_pu_bacteria | 2935847175 | 2935849422 | 375 |
| 489 | iso_pu_bacteria | 2935908558 | 2935911803 | 375 |
| 490 | iso_pu_bacteria | 2935916978 | 2935919459 | 375 |
| 491 | iso_pu_bacteria | 2935926038 | 2935928832 | 375 |
| 492 | iso_pu_bacteria | 2935934488 | 2935938477 | 375 |
| 493 | iso_pu_bacteria | 2935942939 | 2935945631 | 375 |
| 494 | iso_pu_bacteria | 2935951376 | 2935954762 | 375 |
| 495 | iso_pu_bacteria | 2935967501 | 2935970649 | 375 |
| 496 | iso_pu_bacteria | 2935975950 | 2935979112 | 375 |
| 497 | iso_pu_bacteria | 8019629233 | 8019635960 | 375 |
| 498 | iso_pu_bacteria | 8019668869 | 8019673357 | 375 |
| 499 | iso_pu_bacteria | 8019687851 | 8019688454 | 375 |
| 500 | 3300005331 | Ga0070670_100266966 | Ga0070670_1002669662 | 376 |
| 501 | 3300005334 | Ga0068869_100011108 | Ga0068869_1000111083 | 376 |
| 502 | 3300005336 | Ga0070680_100162499 | Ga0070680_1001624991 | 376 |
| 503 | 3300005347 | Ga0070668_100057426 | Ga0070668_1000574263 | 376 |
| 504 | 3300005366 | Ga0070659_100188558 | Ga0070659_1001885581 | 376 |
| 505 | 3300005435 | Ga0070714_100045563 | Ga0070714_1000455632 | 376 |
| 506 | 3300005436 | Ga0070713_100106690 | Ga0070713_1001066902 | 376 |
| 507 | 3300005437 | Ga0070710_10006341 | Ga0070710_100063414 | 376 |
| 508 | 3300005439 | Ga0070711_100014959 | Ga0070711_1000149591 | 376 |
| 509 | 3300005455 | Ga0070663_100087297 | Ga0070663_1000872971 | 376 |
| 510 | 3300005471 | Ga0070698_100066098 | Ga0070698_1000660983 | 376 |
| 511 | 3300005543 | Ga0070672_100066915 | Ga0070672_1000669154 | 376 |
| 512 | 3300005547 | Ga0070693_100011838 | Ga0070693_1000118385 | 376 |
| 513 | 3300005548 | Ga0070665_100013416 | Ga0070665_1000134163 | 376 |
| 514 | 3300005548 | Ga0070665_100104399 | Ga0070665_1001043992 | 376 |
| 515 | 3300005548 | Ga0070665_100108350 | Ga0070665_1001083502 | 376 |
| 516 | 3300005618 | Ga0068864_100025431 | Ga0068864_1000254313 | 376 |
| 517 | 3300005718 | Ga0068866_10071860 | Ga0068866_100718602 | 376 |
| 518 | 3300005843 | Ga0068860_100102392 | Ga0068860_1001023923 | 376 |
| 519 | 3300005843 | Ga0068860_100137338 | Ga0068860_1001373382 | 376 |
| 520 | 3300005937 | Ga0081455_10003365 | Ga0081455_100033652 | 376 |
| 521 | 3300005937 | Ga0081455_10020871 | Ga0081455_100208712 | 376 |
| 522 | 3300005937 | Ga0081455_10141774 | Ga0081455_101417741 | 376 |
| 523 | 3300005983 | Ga0081540_1000978 | Ga0081540_10009786 | 376 |
| 524 | 3300005983 | Ga0081540_1001241 | Ga0081540_100124115 | 376 |
| 525 | 3300005983 | Ga0081540_1001715 | Ga0081540_100171517 | 376 |
| 526 | 3300005983 | Ga0081540_1002512 | Ga0081540_100251215 | 376 |
| 527 | 3300005983 | Ga0081540_1021387 | Ga0081540_10213871 | 376 |
| 528 | 3300005985 | Ga0081539_10020566 | Ga0081539_100205663 | 376 |
| 529 | 3300005985 | Ga0081539_10039627 | Ga0081539_100396273 | 376 |
| 530 | 3300006038 | Ga0075365_10152551 | Ga0075365_101525511 | 376 |
| 531 | 3300006042 | Ga0075368_10012243 | Ga0075368_100122434 | 376 |
| 532 | 3300006048 | Ga0075363_100028621 | Ga0075363_1000286212 | 376 |
| 533 | 3300006048 | Ga0075363_100032211 | Ga0075363_1000322112 | 376 |
| 534 | 3300006163 | Ga0070715_10003359 | Ga0070715_100033594 | 376 |
| 535 | 3300006173 | Ga0070716_100014652 | Ga0070716_1000146524 | 376 |
| 536 | 3300006175 | Ga0070712_100022313 | Ga0070712_1000223132 | 376 |
| 537 | 3300006178 | Ga0075367_10024756 | Ga0075367_100247564 | 376 |
| 538 | 3300006178 | Ga0075367_10134631 | Ga0075367_101346311 | 376 |
| 539 | 3300006195 | Ga0075366_10040984 | Ga0075366_100409842 | 376 |
| 540 | 3300006237 | Ga0097621_100153517 | Ga0097621_1001535172 | 376 |
| 541 | 3300006237 | Ga0097621_100204045 | Ga0097621_1002040451 | 376 |
| 542 | 3300006353 | Ga0075370_10062976 | Ga0075370_100629761 | 376 |
| 543 | 3300006353 | Ga0075370_10104790 | Ga0075370_101047902 | 376 |
| 544 | 3300006844 | Ga0075428_100104263 | Ga0075428_1001042632 | 376 |
| 545 | 3300006881 | Ga0068865_100136298 | Ga0068865_1001362982 | 376 |
| 546 | 3300007076 | Ga0075435_100129072 | Ga0075435_1001290722 | 376 |
| 547 | 3300009092 | Ga0105250_10060242 | Ga0105250_100602421 | 376 |
| 548 | 3300009098 | Ga0105245_10013251 | Ga0105245_100132517 | 376 |
| 549 | 3300009101 | Ga0105247_10098494 | Ga0105247_100984941 | 376 |
| 550 | 3300009545 | Ga0105237_10245323 | Ga0105237_102453231 | 376 |
| 551 | 3300009553 | Ga0105249_10445100 | Ga0105249_104451001 | 376 |
| 552 | 3300011119 | Ga0105246_10056886 | Ga0105246_100568863 | 376 |
| 553 | 3300014325 | Ga0163163_10013717 | Ga0163163_100137173 | 376 |
| 554 | 3300014968 | Ga0157379_10231584 | Ga0157379_102315842 | 376 |
| 555 | 3300025272 | Ga0209455_1004011 | Ga0209455_10040112 | 376 |
| 556 | 3300025297 | Ga0209758_1003889 | Ga0209758_10038896 | 376 |
| 557 | 3300025297 | Ga0209758_1014715 | Ga0209758_10147152 | 376 |
| 558 | 3300025885 | Ga0207653_10011889 | Ga0207653_100118891 | 376 |
| 559 | 3300025898 | Ga0207692_10002139 | Ga0207692_100021398 | 376 |
| 560 | 3300025907 | Ga0207645_10144063 | Ga0207645_101440631 | 376 |
| 561 | 3300025915 | Ga0207693_10000723 | Ga0207693_1000072331 | 376 |
| 562 | 3300025916 | Ga0207663_10005442 | Ga0207663_100054421 | 376 |
| 563 | 3300025920 | Ga0207649_10090500 | Ga0207649_100905001 | 376 |
| 564 | 3300025927 | Ga0207687_10102693 | Ga0207687_101026931 | 376 |
| 565 | 3300025928 | Ga0207700_10146908 | Ga0207700_101469082 | 376 |
| 566 | 3300025931 | Ga0207644_10106156 | Ga0207644_101061561 | 376 |
| 567 | 3300025933 | Ga0207706_10101580 | Ga0207706_101015801 | 376 |
| 568 | 3300025939 | Ga0207665_10000064 | Ga0207665_100000647 | 376 |
| 569 | 3300025940 | Ga0207691_10167185 | Ga0207691_101671851 | 376 |
| 570 | 3300025942 | Ga0207689_10008007 | Ga0207689_100080073 | 376 |
| 571 | 3300025945 | Ga0207679_10064328 | Ga0207679_100643282 | 376 |
| 572 | 3300025949 | Ga0207667_10013789 | Ga0207667_100137895 | 376 |
| 573 | 3300026035 | Ga0207703_10058266 | Ga0207703_100582664 | 376 |
| 574 | 3300026035 | Ga0207703_10103579 | Ga0207703_101035791 | 376 |
| 575 | 3300026067 | Ga0207678_10021989 | Ga0207678_100219895 | 376 |
| 576 | 3300026067 | Ga0207678_10114723 | Ga0207678_101147231 | 376 |
| 577 | 3300026075 | Ga0207708_10154231 | Ga0207708_101542312 | 376 |
| 578 | 3300026078 | Ga0207702_10290808 | Ga0207702_102908081 | 376 |
| 579 | 3300026095 | Ga0207676_10034015 | Ga0207676_100340153 | 376 |
| 580 | 3300026118 | Ga0207675_100240003 | Ga0207675_1002400031 | 376 |
| 581 | 3300028379 | Ga0268266_10003952 | Ga0268266_1000395212 | 376 |
| 582 | 3300028379 | Ga0268266_10013301 | Ga0268266_100133015 | 376 |
| 583 | 3300028379 | Ga0268266_10032383 | Ga0268266_100323834 | 376 |
| 584 | 3300028380 | Ga0268265_10040545 | Ga0268265_100405455 | 376 |
| 585 | 3300028381 | Ga0268264_10187409 | Ga0268264_101874092 | 376 |
| 586 | 3300031730 | Ga0307516_10090567 | Ga0307516_100905672 | 376 |
| 587 | 3300031731 | Ga0307405_10054277 | Ga0307405_100542773 | 376 |
| 588 | 3300032126 | Ga0307415_100070517 | Ga0307415_1000705172 | 376 |
| 589 | 3300033180 | Ga0307510_10032671 | Ga0307510_100326712 | 376 |
| 590 | 3300035725 | Ga0373947_0150035 | Ga0373947_0150035_80_1243 | 376 |
| 591 | 3300046452 | Ga0495617_019755 | Ga0495617_019755_847_2010 | 376 |
| 592 | 3300046460 | Ga0495638_0035056 | Ga0495638_0035056_1970_3133 | 376 |
| 593 | 3300046492 | Ga0495585_0116110 | Ga0495585_0116110_274_1404 | 376 |
| 594 | 3300046522 | Ga0495643_0022609 | Ga0495643_0022609_20_1183 | 376 |
| 595 | 3300046523 | Ga0495644_0041560 | Ga0495644_0041560_213_1376 | 376 |
| 596 | 3300046524 | Ga0495648_0001784 | Ga0495648_0001784_1771_2925 | 376 |
| 597 | 3300046524 | Ga0495648_0067160 | Ga0495648_0067160_486_1649 | 376 |
| 598 | 3300046528 | Ga0495642_0081062 | Ga0495642_0081062_26_1156 | 376 |
| 599 | 3300046674 | Ga0495588_0009215 | Ga0495588_0009215_2008_3171 | 376 |
| 600 | 3300046680 | Ga0495646_0170019 | Ga0495646_0170019_33_1166 | 376 |
| 601 | 3300048905 | Ga0496102_0181495 | Ga0496102_0181495_251_1414 | 376 |
| 602 | 3300048907 | Ga0496104_0068809 | Ga0496104_0068809_1563_2813 | 376 |
| 603 | 3300048907 | Ga0496104_0178470 | Ga0496104_0178470_173_1303 | 376 |
| 604 | 3300048908 | Ga0496105_0289013 | Ga0496105_0289013_54_1217 | 376 |
| 605 | 3300048911 | Ga0496108_0032155 | Ga0496108_0032155_2662_3912 | 376 |
| 606 | 3300048912 | Ga0496109_0037794 | Ga0496109_0037794_970_2103 | 376 |
| 607 | 3300048912 | Ga0496109_0127133 | Ga0496109_0127133_1072_2235 | 376 |
| 608 | 3300048913 | Ga0496110_0061946 | Ga0496110_0061946_1646_2896 | 376 |
| 609 | 3300048915 | Ga0496112_0016187 | Ga0496112_0016187_3997_5235 | 376 |
| 610 | 3300048915 | Ga0496112_0120152 | Ga0496112_0120152_1252_2502 | 376 |
| 611 | 3300048916 | Ga0496113_0078007 | Ga0496113_0078007_1172_2422 | 376 |
| 612 | 3300048924 | Ga0496121_0243521 | Ga0496121_0243521_69_1232 | 376 |
| 613 | 3300048927 | Ga0496124_0099057 | Ga0496124_0099057_669_1832 | 376 |
| 614 | 3300048929 | Ga0496126_0004798 | Ga0496126_0004798_7729_8892 | 376 |
| 615 | 3300048929 | Ga0496126_0066024 | Ga0496126_0066024_1330_2460 | 376 |
| 616 | 3300050490 | nmdc:mga03n38_103458_c1 | nmdc:mga03n38_103458_c1_62_1225 | 376 |
| 617 | 3300050491 | nmdc:mga00v17_83601_c1 | nmdc:mga00v17_83601_c1_91_1254 | 376 |
| 618 | 3300050492 | nmdc:mga0yw44_78912_c1 | nmdc:mga0yw44_78912_c1_243_1406 | 376 |
| 619 | 3300050493 | nmdc:mga0k408_95234_c1 | nmdc:mga0k408_95234_c1_557_1720 | 376 |
| 620 | 3300050494 | nmdc:mga06z11_111691_c1 | nmdc:mga06z11_111691_c1_14_1144 | 376 |
| 621 | 3300050496 | nmdc:mga07m45_137994_c1 | nmdc:mga07m45_137994_c1_269_1399 | 376 |
| 622 | 3300050496 | nmdc:mga07m45_67495_c1 | nmdc:mga07m45_67495_c1_830_1993 | 376 |
| 623 | iso_pu_bacteria | 2721755755 | 2723846357 | 376 |
| 624 | iso_pu_bacteria | 2791355199 | 2793081176 | 376 |
| 625 | iso_pu_bacteria | 2885383462 | 2885389222 | 376 |
| 626 | iso_pu_bacteria | 2903768456 | 2903774533 | 376 |
| 627 | iso_pu_bacteria | 8006984368 | 8006991901 | 376 |
| 628 | iso_pu_bacteria | 8056681323 | 8056687963 | 376 |
| 629 | 3300001979 | JGI24740J21852_10022084 | JGI24740J21852_100220842 | 377 |
| 630 | 3300001990 | JGI24737J22298_10004937 | JGI24737J22298_100049373 | 377 |
| 631 | 3300001990 | JGI24737J22298_10037209 | JGI24737J22298_100372091 | 377 |
| 632 | 3300003203 | JGI25406J46586_10000700 | JGI25406J46586_100007006 | 377 |
| 633 | 3300003215 | JGI25153J46596_10001125 | JGI25153J46596_1000112516 | 377 |
| 634 | 3300003354 | JGI25160J50197_1002409 | JGI25160J50197_10024098 | 377 |
| 635 | 3300003752 | Ga0055539_1005731 | Ga0055539_10057311 | 377 |
| 636 | 3300003794 | Ga0055531_10007045 | Ga0055531_100070452 | 377 |
| 637 | 3300003794 | Ga0055531_10009469 | Ga0055531_100094695 | 377 |
| 638 | 3300004625 | Ga0055543_1006074 | Ga0055543_10060744 | 377 |
| 639 | 3300005262 | Ga0065165_1000278 | Ga0065165_100027829 | 377 |
| 640 | 3300005262 | Ga0065165_1002873 | Ga0065165_10028738 | 377 |
| 641 | 3300005329 | Ga0070683_100009575 | Ga0070683_10000957510 | 377 |
| 642 | 3300005337 | Ga0070682_100005543 | Ga0070682_1000055438 | 377 |
| 643 | 3300005339 | Ga0070660_100006525 | Ga0070660_1000065258 | 377 |
| 644 | 3300005341 | Ga0070691_10030477 | Ga0070691_100304772 | 377 |
| 645 | 3300005344 | Ga0070661_100121025 | Ga0070661_1001210251 | 377 |
| 646 | 3300005353 | Ga0070669_100222214 | Ga0070669_1002222142 | 377 |
| 647 | 3300005434 | Ga0070709_10000431 | Ga0070709_100004317 | 377 |
| 648 | 3300005434 | Ga0070709_10003284 | Ga0070709_100032844 | 377 |
| 649 | 3300005436 | Ga0070713_100001721 | Ga0070713_10000172111 | 377 |
| 650 | 3300005437 | Ga0070710_10002809 | Ga0070710_100028091 | 377 |
| 651 | 3300005439 | Ga0070711_100008795 | Ga0070711_1000087956 | 377 |
| 652 | 3300005445 | Ga0070708_100121134 | Ga0070708_1001211342 | 377 |
| 653 | 3300005456 | Ga0070678_100009616 | Ga0070678_1000096164 | 377 |
| 654 | 3300005458 | Ga0070681_10013583 | Ga0070681_100135832 | 377 |
| 655 | 3300005458 | Ga0070681_10099637 | Ga0070681_100996372 | 377 |
| 656 | 3300005459 | Ga0068867_100165393 | Ga0068867_1001653932 | 377 |
| 657 | 3300005468 | Ga0070707_100133263 | Ga0070707_1001332632 | 377 |
| 658 | 3300005530 | Ga0070679_100003512 | Ga0070679_10000351214 | 377 |
| 659 | 3300005530 | Ga0070679_100058123 | Ga0070679_1000581232 | 377 |
| 660 | 3300005535 | Ga0070684_100017018 | Ga0070684_1000170185 | 377 |
| 661 | 3300005535 | Ga0070684_100056264 | Ga0070684_1000562643 | 377 |
| 662 | 3300005539 | Ga0068853_100015346 | Ga0068853_1000153463 | 377 |
| 663 | 3300005539 | Ga0068853_100018955 | Ga0068853_1000189552 | 377 |
| 664 | 3300005543 | Ga0070672_100140484 | Ga0070672_1001404842 | 377 |
| 665 | 3300005547 | Ga0070693_100060480 | Ga0070693_1000604803 | 377 |
| 666 | 3300005563 | Ga0068855_100012484 | Ga0068855_1000124844 | 377 |
| 667 | 3300005563 | Ga0068855_100013959 | Ga0068855_1000139595 | 377 |
| 668 | 3300005563 | Ga0068855_100067026 | Ga0068855_1000670264 | 377 |
| 669 | 3300005564 | Ga0070664_100171422 | Ga0070664_1001714222 | 377 |
| 670 | 3300005577 | Ga0068857_100023185 | Ga0068857_1000231852 | 377 |
| 671 | 3300005578 | Ga0068854_100046236 | Ga0068854_1000462362 | 377 |
| 672 | 3300005614 | Ga0068856_100021414 | Ga0068856_1000214145 | 377 |
| 673 | 3300005614 | Ga0068856_100233861 | Ga0068856_1002338611 | 377 |
| 674 | 3300005616 | Ga0068852_100016271 | Ga0068852_1000162712 | 377 |
| 675 | 3300005616 | Ga0068852_100025493 | Ga0068852_1000254934 | 377 |
| 676 | 3300005834 | Ga0068851_10002991 | Ga0068851_100029914 | 377 |
| 677 | 3300005842 | Ga0068858_100152170 | Ga0068858_1001521702 | 377 |
| 678 | 3300005843 | Ga0068860_100000240 | Ga0068860_10000024012 | 377 |
| 679 | 3300005937 | Ga0081455_10037951 | Ga0081455_100379513 | 377 |
| 680 | 3300005983 | Ga0081540_1006586 | Ga0081540_10065867 | 377 |
| 681 | 3300005983 | Ga0081540_1037358 | Ga0081540_10373582 | 377 |
| 682 | 3300005985 | Ga0081539_10000726 | Ga0081539_1000072662 | 377 |
| 683 | 3300006028 | Ga0070717_10002854 | Ga0070717_100028548 | 377 |
| 684 | 3300006028 | Ga0070717_10004642 | Ga0070717_100046423 | 377 |
| 685 | 3300006028 | Ga0070717_10036271 | Ga0070717_100362714 | 377 |
| 686 | 3300006051 | Ga0075364_10031725 | Ga0075364_100317253 | 377 |
| 687 | 3300006051 | Ga0075364_10102033 | Ga0075364_101020331 | 377 |
| 688 | 3300006173 | Ga0070716_100005655 | Ga0070716_1000056554 | 377 |
| 689 | 3300006175 | Ga0070712_100039641 | Ga0070712_1000396415 | 377 |
| 690 | 3300006178 | Ga0075367_10004792 | Ga0075367_100047922 | 377 |
| 691 | 3300006186 | Ga0075369_10023402 | Ga0075369_100234023 | 377 |
| 692 | 3300006186 | Ga0075369_10033346 | Ga0075369_100333462 | 377 |
| 693 | 3300006195 | Ga0075366_10008198 | Ga0075366_100081982 | 377 |
| 694 | 3300006353 | Ga0075370_10042995 | Ga0075370_100429952 | 377 |
| 695 | 3300006941 | Ga0099825_1026880 | Ga0099825_10268804 | 377 |
| 696 | 3300006943 | Ga0099822_1002963 | Ga0099822_100296313 | 377 |
| 697 | 3300006944 | Ga0099823_1013686 | Ga0099823_10136866 | 377 |
| 698 | 3300009093 | Ga0105240_10025799 | Ga0105240_100257996 | 377 |
| 699 | 3300009093 | Ga0105240_10032117 | Ga0105240_100321175 | 377 |
| 700 | 3300009101 | Ga0105247_10025838 | Ga0105247_100258381 | 377 |
| 701 | 3300009101 | Ga0105247_10029784 | Ga0105247_100297842 | 377 |
| 702 | 3300009101 | Ga0105247_10084184 | Ga0105247_100841842 | 377 |
| 703 | 3300009174 | Ga0105241_10000872 | Ga0105241_100008724 | 377 |
| 704 | 3300009174 | Ga0105241_10057806 | Ga0105241_100578062 | 377 |
| 705 | 3300009174 | Ga0105241_10299934 | Ga0105241_102999342 | 377 |
| 706 | 3300009176 | Ga0105242_10194172 | Ga0105242_101941722 | 377 |
| 707 | 3300009545 | Ga0105237_10027826 | Ga0105237_100278262 | 377 |
| 708 | 3300009545 | Ga0105237_10030267 | Ga0105237_100302674 | 377 |
| 709 | 3300009545 | Ga0105237_10034577 | Ga0105237_100345774 | 377 |
| 710 | 3300009545 | Ga0105237_10048829 | Ga0105237_100488293 | 377 |
| 711 | 3300009545 | Ga0105237_10196643 | Ga0105237_101966432 | 377 |
| 712 | 3300009551 | Ga0105238_10012425 | Ga0105238_100124254 | 377 |
| 713 | 3300009551 | Ga0105238_10026555 | Ga0105238_100265556 | 377 |
| 714 | 3300009551 | Ga0105238_10049128 | Ga0105238_100491282 | 377 |
| 715 | 3300009553 | Ga0105249_10355872 | Ga0105249_103558722 | 377 |
| 716 | 3300010375 | Ga0105239_10008436 | Ga0105239_100084363 | 377 |
| 717 | 3300010375 | Ga0105239_10014132 | Ga0105239_100141322 | 377 |
| 718 | 3300010375 | Ga0105239_10014787 | Ga0105239_100147871 | 377 |
| 719 | 3300010375 | Ga0105239_10067898 | Ga0105239_100678984 | 377 |
| 720 | 3300010375 | Ga0105239_10086236 | Ga0105239_100862365 | 377 |
| 721 | 3300010375 | Ga0105239_10333935 | Ga0105239_103339351 | 377 |
| 722 | 3300010375 | Ga0105239_10369734 | Ga0105239_103697341 | 377 |
| 723 | 3300013104 | Ga0157370_10036670 | Ga0157370_100366705 | 377 |
| 724 | 3300013104 | Ga0157370_10072684 | Ga0157370_100726841 | 377 |
| 725 | 3300013105 | Ga0157369_10037411 | Ga0157369_100374116 | 377 |
| 726 | 3300013105 | Ga0157369_10114976 | Ga0157369_101149762 | 377 |
| 727 | 3300013105 | Ga0157369_10258860 | Ga0157369_102588602 | 377 |
| 728 | 3300013297 | Ga0157378_10014368 | Ga0157378_100143686 | 377 |
| 729 | 3300013306 | Ga0163162_10535819 | Ga0163162_105358191 | 377 |
| 730 | 3300014325 | Ga0163163_10173620 | Ga0163163_101736202 | 377 |
| 731 | 3300014325 | Ga0163163_10278843 | Ga0163163_102788432 | 377 |
| 732 | 3300014326 | Ga0157380_10134712 | Ga0157380_101347121 | 377 |
| 733 | 3300014968 | Ga0157379_10175992 | Ga0157379_101759922 | 377 |
| 734 | 3300014969 | Ga0157376_10068292 | Ga0157376_100682924 | 377 |
| 735 | 3300021384 | Ga0213876_10023374 | Ga0213876_100233742 | 377 |
| 736 | 3300025253 | Ga0209677_102267 | Ga0209677_1022674 | 377 |
| 737 | 3300025261 | Ga0209233_1010953 | Ga0209233_10109532 | 377 |
| 738 | 3300025295 | Ga0209564_1003632 | Ga0209564_10036322 | 377 |
| 739 | 3300025295 | Ga0209564_1004939 | Ga0209564_10049392 | 377 |
| 740 | 3300025297 | Ga0209758_1000065 | Ga0209758_100006537 | 377 |
| 741 | 3300025297 | Ga0209758_1000498 | Ga0209758_100049815 | 377 |
| 742 | 3300025297 | Ga0209758_1005790 | Ga0209758_10057902 | 377 |
| 743 | 3300025297 | Ga0209758_1016433 | Ga0209758_10164333 | 377 |
| 744 | 3300025297 | Ga0209758_1018995 | Ga0209758_10189954 | 377 |
| 745 | 3300025299 | Ga0209256_1006613 | Ga0209256_10066134 | 377 |
| 746 | 3300025302 | Ga0207426_1000721 | Ga0207426_100072130 | 377 |
| 747 | 3300025302 | Ga0207426_1013877 | Ga0207426_10138772 | 377 |
| 748 | 3300025304 | Ga0209257_1001031 | Ga0209257_100103120 | 377 |
| 749 | 3300025304 | Ga0209257_1024026 | Ga0209257_10240262 | 377 |
| 750 | 3300025898 | Ga0207692_10001280 | Ga0207692_100012803 | 377 |
| 751 | 3300025898 | Ga0207692_10007388 | Ga0207692_100073886 | 377 |
| 752 | 3300025903 | Ga0207680_10083113 | Ga0207680_100831132 | 377 |
| 753 | 3300025904 | Ga0207647_10003213 | Ga0207647_100032134 | 377 |
| 754 | 3300025906 | Ga0207699_10002307 | Ga0207699_100023075 | 377 |
| 755 | 3300025906 | Ga0207699_10032744 | Ga0207699_100327442 | 377 |
| 756 | 3300025910 | Ga0207684_10036712 | Ga0207684_100367127 | 377 |
| 757 | 3300025911 | Ga0207654_10127702 | Ga0207654_101277022 | 377 |
| 758 | 3300025912 | Ga0207707_10002451 | Ga0207707_100024512 | 377 |
| 759 | 3300025912 | Ga0207707_10007228 | Ga0207707_100072281 | 377 |
| 760 | 3300025912 | Ga0207707_10101122 | Ga0207707_101011222 | 377 |
| 761 | 3300025912 | Ga0207707_10114364 | Ga0207707_101143642 | 377 |
| 762 | 3300025913 | Ga0207695_10001543 | Ga0207695_1000154338 | 377 |
| 763 | 3300025913 | Ga0207695_10121382 | Ga0207695_101213823 | 377 |
| 764 | 3300025914 | Ga0207671_10032059 | Ga0207671_100320593 | 377 |
| 765 | 3300025914 | Ga0207671_10086745 | Ga0207671_100867452 | 377 |
| 766 | 3300025914 | Ga0207671_10112844 | Ga0207671_101128442 | 377 |
| 767 | 3300025915 | Ga0207693_10005552 | Ga0207693_100055526 | 377 |
| 768 | 3300025915 | Ga0207693_10125323 | Ga0207693_101253232 | 377 |
| 769 | 3300025916 | Ga0207663_10032760 | Ga0207663_100327604 | 377 |
| 770 | 3300025916 | Ga0207663_10075087 | Ga0207663_100750872 | 377 |
| 771 | 3300025917 | Ga0207660_10006133 | Ga0207660_100061336 | 377 |
| 772 | 3300025917 | Ga0207660_10037939 | Ga0207660_100379392 | 377 |
| 773 | 3300025917 | Ga0207660_10047545 | Ga0207660_100475451 | 377 |
| 774 | 3300025919 | Ga0207657_10005831 | Ga0207657_100058313 | 377 |
| 775 | 3300025921 | Ga0207652_10016568 | Ga0207652_100165687 | 377 |
| 776 | 3300025921 | Ga0207652_10037786 | Ga0207652_100377862 | 377 |
| 777 | 3300025921 | Ga0207652_10047929 | Ga0207652_100479295 | 377 |
| 778 | 3300025923 | Ga0207681_10130378 | Ga0207681_101303781 | 377 |
| 779 | 3300025924 | Ga0207694_10010545 | Ga0207694_100105452 | 377 |
| 780 | 3300025924 | Ga0207694_10038644 | Ga0207694_100386442 | 377 |
| 781 | 3300025924 | Ga0207694_10043322 | Ga0207694_100433222 | 377 |
| 782 | 3300025928 | Ga0207700_10006043 | Ga0207700_100060434 | 377 |
| 783 | 3300025928 | Ga0207700_10020115 | Ga0207700_100201155 | 377 |
| 784 | 3300025928 | Ga0207700_10074252 | Ga0207700_100742522 | 377 |
| 785 | 3300025929 | Ga0207664_10024588 | Ga0207664_100245882 | 377 |
| 786 | 3300025932 | Ga0207690_10090776 | Ga0207690_100907761 | 377 |
| 787 | 3300025934 | Ga0207686_10049584 | Ga0207686_100495842 | 377 |
| 788 | 3300025939 | Ga0207665_10009565 | Ga0207665_100095654 | 377 |
| 789 | 3300025939 | Ga0207665_10022510 | Ga0207665_100225101 | 377 |
| 790 | 3300025939 | Ga0207665_10235094 | Ga0207665_102350942 | 377 |
| 791 | 3300025941 | Ga0207711_10085541 | Ga0207711_100855412 | 377 |
| 792 | 3300025941 | Ga0207711_10179037 | Ga0207711_101790372 | 377 |
| 793 | 3300025944 | Ga0207661_10002727 | Ga0207661_100027275 | 377 |
| 794 | 3300025944 | Ga0207661_10088353 | Ga0207661_100883532 | 377 |
| 795 | 3300025949 | Ga0207667_10011808 | Ga0207667_100118082 | 377 |
| 796 | 3300025949 | Ga0207667_10021994 | Ga0207667_100219942 | 377 |
| 797 | 3300025949 | Ga0207667_10060535 | Ga0207667_100605353 | 377 |
| 798 | 3300025949 | Ga0207667_10110436 | Ga0207667_101104362 | 377 |
| 799 | 3300025981 | Ga0207640_10018060 | Ga0207640_100180603 | 377 |
| 800 | 3300026035 | Ga0207703_10036553 | Ga0207703_100365532 | 377 |
| 801 | 3300026035 | Ga0207703_10051235 | Ga0207703_100512352 | 377 |
| 802 | 3300026035 | Ga0207703_10283850 | Ga0207703_102838501 | 377 |
| 803 | 3300026041 | Ga0207639_10029262 | Ga0207639_100292622 | 377 |
| 804 | 3300026041 | Ga0207639_10063595 | Ga0207639_100635952 | 377 |
| 805 | 3300026067 | Ga0207678_10047437 | Ga0207678_100474372 | 377 |
| 806 | 3300026067 | Ga0207678_10054204 | Ga0207678_100542043 | 377 |
| 807 | 3300026067 | Ga0207678_10071473 | Ga0207678_100714734 | 377 |
| 808 | 3300026078 | Ga0207702_10000005 | Ga0207702_10000005322 | 377 |
| 809 | 3300026078 | Ga0207702_10184601 | Ga0207702_101846012 | 377 |
| 810 | 3300026078 | Ga0207702_10185846 | Ga0207702_101858462 | 377 |
| 811 | 3300026095 | Ga0207676_10128855 | Ga0207676_101288553 | 377 |
| 812 | 3300026116 | Ga0207674_10007797 | Ga0207674_100077972 | 377 |
| 813 | 3300026116 | Ga0207674_10009659 | Ga0207674_100096592 | 377 |
| 814 | 3300026116 | Ga0207674_10012698 | Ga0207674_100126984 | 377 |
| 815 | 3300026116 | Ga0207674_10022025 | Ga0207674_100220256 | 377 |
| 816 | 3300026116 | Ga0207674_10094786 | Ga0207674_100947862 | 377 |
| 817 | 3300026121 | Ga0207683_10015940 | Ga0207683_100159403 | 377 |
| 818 | 3300026142 | Ga0207698_10103212 | Ga0207698_101032122 | 377 |
| 819 | 3300026142 | Ga0207698_10188496 | Ga0207698_101884961 | 377 |
| 820 | 3300027296 | Ga0209389_1000011 | Ga0209389_100001127 | 377 |
| 821 | 3300027357 | Ga0209589_1000018 | Ga0209589_100001813 | 377 |
| 822 | 3300027361 | Ga0209489_100017 | Ga0209489_100017207 | 377 |
| 823 | 3300027361 | Ga0209489_100026 | Ga0209489_10002613 | 377 |
| 824 | 3300027363 | Ga0209700_100027 | Ga0209700_10002727 | 377 |
| 825 | 3300027363 | Ga0209700_100035 | Ga0209700_10003513 | 377 |
| 826 | 3300027866 | Ga0209813_10033936 | Ga0209813_100339361 | 377 |
| 827 | 3300028379 | Ga0268266_10003137 | Ga0268266_1000313710 | 377 |
| 828 | 3300028379 | Ga0268266_10034331 | Ga0268266_100343316 | 377 |
| 829 | 3300028379 | Ga0268266_10406073 | Ga0268266_104060731 | 377 |
| 830 | 3300028380 | Ga0268265_10343121 | Ga0268265_103431211 | 377 |
| 831 | 3300028381 | Ga0268264_10000035 | Ga0268264_10000035170 | 377 |
| 832 | 3300028556 | Ga0265337_1031546 | Ga0265337_10315461 | 377 |
| 833 | 3300028573 | Ga0265334_10034157 | Ga0265334_100341572 | 377 |
| 834 | 3300028653 | Ga0265323_10002189 | Ga0265323_100021898 | 377 |
| 835 | 3300028666 | Ga0265336_10006616 | Ga0265336_100066161 | 377 |
| 836 | 3300028786 | Ga0307517_10003575 | Ga0307517_1000357520 | 377 |
| 837 | 3300028794 | Ga0307515_10066798 | Ga0307515_100667985 | 377 |
| 838 | 3300028800 | Ga0265338_10013740 | Ga0265338_100137408 | 377 |
| 839 | 3300031247 | Ga0265340_10096641 | Ga0265340_100966411 | 377 |
| 840 | 3300031249 | Ga0265339_10001392 | Ga0265339_1000139210 | 377 |
| 841 | 3300031249 | Ga0265339_10064560 | Ga0265339_100645601 | 377 |
| 842 | 3300031250 | Ga0265331_10070024 | Ga0265331_100700242 | 377 |
| 843 | 3300031616 | Ga0307508_10000650 | Ga0307508_1000065035 | 377 |
| 844 | 3300031616 | Ga0307508_10004051 | Ga0307508_100040512 | 377 |
| 845 | 3300031616 | Ga0307508_10101377 | Ga0307508_101013772 | 377 |
| 846 | 3300031711 | Ga0265314_10057962 | Ga0265314_100579621 | 377 |
| 847 | 3300031712 | Ga0265342_10058050 | Ga0265342_100580503 | 377 |
| 848 | 3300031730 | Ga0307516_10031887 | Ga0307516_100318876 | 377 |
| 849 | 3300031730 | Ga0307516_10052030 | Ga0307516_100520302 | 377 |
| 850 | 3300031911 | Ga0307412_10261115 | Ga0307412_102611151 | 377 |
| 851 | 3300031995 | Ga0307409_100067780 | Ga0307409_1000677803 | 377 |
| 852 | 3300032002 | Ga0307416_100076218 | Ga0307416_1000762181 | 377 |
| 853 | 3300033179 | Ga0307507_10053828 | Ga0307507_100538283 | 377 |
| 854 | 3300033180 | Ga0307510_10025336 | Ga0307510_100253363 | 377 |
| 855 | 3300033180 | Ga0307510_10087718 | Ga0307510_100877184 | 377 |
| 856 | 3300033180 | Ga0307510_10088432 | Ga0307510_100884322 | 377 |
| 857 | 3300033442 | Ga0315911_1000011 | Ga0315911_100001114 | 377 |
| 858 | 3300035083 | Ga0373926_0006551 | Ga0373926_0006551_596_1861 | 377 |
| 859 | 3300035083 | Ga0373926_0074259 | Ga0373926_0074259_73_1206 | 377 |
| 860 | 3300035086 | Ga0373934_0035810 | Ga0373934_0035810_59_1192 | 377 |
| 861 | 3300035086 | Ga0373934_0041741 | Ga0373934_0041741_477_1610 | 377 |
| 862 | 3300035088 | Ga0373940_0006754 | Ga0373940_0006754_179_1312 | 377 |
| 863 | 3300035111 | Ga0373923_0036370 | Ga0373923_0036370_528_1793 | 377 |
| 864 | 3300035113 | Ga0373936_0020740 | Ga0373936_0020740_663_1928 | 377 |
| 865 | 3300035116 | Ga0373945_0030570 | Ga0373945_0030570_663_1796 | 377 |
| 866 | 3300035117 | Ga0373953_0002754 | Ga0373953_0002754_647_1780 | 377 |
| 867 | 3300035118 | Ga0373954_0008277 | Ga0373954_0008277_2057_3190 | 377 |
| 868 | 3300035118 | Ga0373954_0043259 | Ga0373954_0043259_206_1471 | 377 |
| 869 | 3300035119 | Ga0373956_0004160 | Ga0373956_0004160_1040_2173 | 377 |
| 870 | 3300035119 | Ga0373956_0011086 | Ga0373956_0011086_299_1432 | 377 |
| 871 | 3300035119 | Ga0373956_0039813 | Ga0373956_0039813_552_1817 | 377 |
| 872 | 3300035120 | Ga0373957_0002175 | Ga0373957_0002175_3632_4765 | 377 |
| 873 | 3300035121 | Ga0373960_0044337 | Ga0373960_0044337_57_1190 | 377 |
| 874 | 3300035171 | Ga0373946_0037289 | Ga0373946_0037289_420_1685 | 377 |
| 875 | 3300035172 | Ga0373955_0000510 | Ga0373955_0000510_1200_2333 | 377 |
| 876 | 3300035172 | Ga0373955_0013167 | Ga0373955_0013167_1444_2577 | 377 |
| 877 | 3300035172 | Ga0373955_0014368 | Ga0373955_0014368_422_1555 | 377 |
| 878 | 3300035172 | Ga0373955_0030619 | Ga0373955_0030619_329_1594 | 377 |
| 879 | 3300035410 | Ga0373924_0011441 | Ga0373924_0011441_624_1757 | 377 |
| 880 | 3300035410 | Ga0373924_0038476 | Ga0373924_0038476_97_1362 | 377 |
| 881 | 3300035410 | Ga0373924_0070339 | Ga0373924_0070339_137_1270 | 377 |
| 882 | 3300035691 | Ga0373931_0002710 | Ga0373931_0002710_235_1368 | 377 |
| 883 | 3300035692 | Ga0373935_0007256 | Ga0373935_0007256_2043_3209 | 377 |
| 884 | 3300035692 | Ga0373935_0027681 | Ga0373935_0027681_1022_2155 | 377 |
| 885 | 3300035692 | Ga0373935_0072367 | Ga0373935_0072367_294_1559 | 377 |
| 886 | 3300035695 | Ga0373927_0001621 | Ga0373927_0001621_11224_12357 | 377 |
| 887 | 3300035695 | Ga0373927_0060511 | Ga0373927_0060511_635_1801 | 377 |
| 888 | 3300035695 | Ga0373927_0065019 | Ga0373927_0065019_696_1829 | 377 |
| 889 | 3300035724 | Ga0373933_0006367 | Ga0373933_0006367_1212_2345 | 377 |
| 890 | 3300035724 | Ga0373933_0077991 | Ga0373933_0077991_384_1517 | 377 |
| 891 | 3300035724 | Ga0373933_0122504 | Ga0373933_0122504_478_1611 | 377 |
| 892 | 3300035725 | Ga0373947_0001795 | Ga0373947_0001795_5437_6570 | 377 |
| 893 | 3300035725 | Ga0373947_0002633 | Ga0373947_0002633_4917_6050 | 377 |
| 894 | 3300035725 | Ga0373947_0015294 | Ga0373947_0015294_1304_2569 | 377 |
| 895 | 3300036401 | Ga0373937_0023676 | Ga0373937_0023676_3190_4323 | 377 |
| 896 | 3300036401 | Ga0373937_0043679 | Ga0373937_0043679_602_1735 | 377 |
| 897 | 3300036401 | Ga0373937_0107071 | Ga0373937_0107071_174_1307 | 377 |
| 898 | 3300036401 | Ga0373937_0138283 | Ga0373937_0138283_966_2099 | 377 |
| 899 | 3300036459 | Ga0372808_001316 | Ga0372808_001316_558_1691 | 377 |
| 900 | 3300037068 | Ga0373925_0006728 | Ga0373925_0006728_2509_3642 | 377 |
| 901 | 3300037068 | Ga0373925_0028136 | Ga0373925_0028136_1648_2814 | 377 |
| 902 | 3300037466 | Ga0395898_0070289 | Ga0395898_0070289_927_2060 | 377 |
| 903 | 3300037466 | Ga0395898_0122783 | Ga0395898_0122783_801_1934 | 377 |
| 904 | 3300037466 | Ga0395898_0183238 | Ga0395898_0183238_857_1990 | 377 |
| 905 | 3300037471 | Ga0395905_0034044 | Ga0395905_0034044_2209_3342 | 377 |
| 906 | 3300037853 | Ga0436364_0662595 | Ga0436364_0662595_139_1416 | 377 |
| 907 | 3300037853 | Ga0436364_1342884 | Ga0436364_1342884_3088_4221 | 377 |
| 908 | 3300039437 | Ga0436365_0607645 | Ga0436365_0607645_2248_3381 | 377 |
| 909 | 3300039438 | Ga0436360_1294928 | Ga0436360_1294928_323_1456 | 377 |
| 910 | 3300044658 | Ga0466972_0000648 | Ga0466972_0000648_7342_8475 | 377 |
| 911 | 3300044694 | Ga0466963_0234149 | Ga0466963_0234149_36_1169 | 377 |
| 912 | 3300044706 | Ga0466964_0087931 | Ga0466964_0087931_180_1313 | 377 |
| 913 | 3300044765 | Ga0466970_0030263 | Ga0466970_0030263_1578_2711 | 377 |
| 914 | 3300044842 | Ga0466957_0049313 | Ga0466957_0049313_672_1805 | 377 |
| 915 | 3300045049 | Ga0466959_0092799 | Ga0466959_0092799_643_1776 | 377 |
| 916 | 3300046454 | Ga0495592_0029930 | Ga0495592_0029930_2012_3145 | 377 |
| 917 | 3300046454 | Ga0495592_0035643 | Ga0495592_0035643_101_1234 | 377 |
| 918 | 3300046454 | Ga0495592_0116152 | Ga0495592_0116152_418_1683 | 377 |
| 919 | 3300046455 | Ga0495603_0000094 | Ga0495603_0000094_6660_7793 | 377 |
| 920 | 3300046455 | Ga0495603_0012995 | Ga0495603_0012995_746_1879 | 377 |
| 921 | 3300046455 | Ga0495603_0018344 | Ga0495603_0018344_2443_3576 | 377 |
| 922 | 3300046459 | Ga0495629_0000612 | Ga0495629_0000612_1373_2506 | 377 |
| 923 | 3300046459 | Ga0495629_0004307 | Ga0495629_0004307_9474_10607 | 377 |
| 924 | 3300046459 | Ga0495629_0109103 | Ga0495629_0109103_228_1493 | 377 |
| 925 | 3300046459 | Ga0495629_0121151 | Ga0495629_0121151_44_1177 | 377 |
| 926 | 3300046460 | Ga0495638_0001554 | Ga0495638_0001554_2323_3456 | 377 |
| 927 | 3300046460 | Ga0495638_0077178 | Ga0495638_0077178_388_1521 | 377 |
| 928 | 3300046461 | Ga0495641_0001895 | Ga0495641_0001895_9202_10335 | 377 |
| 929 | 3300046462 | Ga0495651_0036353 | Ga0495651_0036353_2486_3619 | 377 |
| 930 | 3300046462 | Ga0495651_0117906 | Ga0495651_0117906_601_1734 | 377 |
| 931 | 3300046463 | Ga0495653_0000399 | Ga0495653_0000399_33237_34370 | 377 |
| 932 | 3300046463 | Ga0495653_0072447 | Ga0495653_0072447_1248_2381 | 377 |
| 933 | 3300046472 | Ga0495580_0002744 | Ga0495580_0002744_4049_5182 | 377 |
| 934 | 3300046473 | Ga0495582_0001055 | Ga0495582_0001055_4429_5562 | 377 |
| 935 | 3300046474 | Ga0495605_0065499 | Ga0495605_0065499_382_1515 | 377 |
| 936 | 3300046475 | Ga0495639_0000114 | Ga0495639_0000114_32155_33288 | 377 |
| 937 | 3300046476 | Ga0495662_0000093 | Ga0495662_0000093_12233_13366 | 377 |
| 938 | 3300046477 | Ga0495664_0006628 | Ga0495664_0006628_2106_3371 | 377 |
| 939 | 3300046477 | Ga0495664_0033601 | Ga0495664_0033601_228_1361 | 377 |
| 940 | 3300046511 | Ga0495608_0001226 | Ga0495608_0001226_16472_17605 | 377 |
| 941 | 3300046514 | Ga0495618_0027537 | Ga0495618_0027537_1341_2474 | 377 |
| 942 | 3300046514 | Ga0495618_0176291 | Ga0495618_0176291_90_1223 | 377 |
| 943 | 3300046516 | Ga0495628_0082230 | Ga0495628_0082230_711_1844 | 377 |
| 944 | 3300046516 | Ga0495628_0084487 | Ga0495628_0084487_609_1742 | 377 |
| 945 | 3300046516 | Ga0495628_0112357 | Ga0495628_0112357_120_1253 | 377 |
| 946 | 3300046516 | Ga0495628_0171772 | Ga0495628_0171772_72_1205 | 377 |
| 947 | 3300046517 | Ga0495630_0000459 | Ga0495630_0000459_8218_9351 | 377 |
| 948 | 3300046517 | Ga0495630_0044428 | Ga0495630_0044428_537_1802 | 377 |
| 949 | 3300046522 | Ga0495643_0017992 | Ga0495643_0017992_1321_2454 | 377 |
| 950 | 3300046524 | Ga0495648_0057247 | Ga0495648_0057247_892_2025 | 377 |
| 951 | 3300046526 | Ga0495666_0099665 | Ga0495666_0099665_80_1345 | 377 |
| 952 | 3300046529 | Ga0495652_0027433 | Ga0495652_0027433_2148_3281 | 377 |
| 953 | 3300046529 | Ga0495652_0028960 | Ga0495652_0028960_216_1349 | 377 |
| 954 | 3300046529 | Ga0495652_0111366 | Ga0495652_0111366_453_1586 | 377 |
| 955 | 3300046531 | Ga0495665_0000613 | Ga0495665_0000613_9960_11093 | 377 |
| 956 | 3300046531 | Ga0495665_0024504 | Ga0495665_0024504_454_1719 | 377 |
| 957 | 3300046533 | Ga0495640_0014863 | Ga0495640_0014863_1549_2814 | 377 |
| 958 | 3300046533 | Ga0495640_0015770 | Ga0495640_0015770_536_1669 | 377 |
| 959 | 3300046533 | Ga0495640_0029758 | Ga0495640_0029758_757_1890 | 377 |
| 960 | 3300046533 | Ga0495640_0030534 | Ga0495640_0030534_1515_2648 | 377 |
| 961 | 3300046536 | Ga0495587_0001432 | Ga0495587_0001432_13978_15111 | 377 |
| 962 | 3300046538 | Ga0495609_0060286 | Ga0495609_0060286_381_1526 | 377 |
| 963 | 3300046542 | Ga0495597_0059231 | Ga0495597_0059231_293_1426 | 377 |
| 964 | 3300046543 | Ga0495645_0024571 | Ga0495645_0024571_2228_3361 | 377 |
| 965 | 3300046543 | Ga0495645_0074327 | Ga0495645_0074327_253_1386 | 377 |
| 966 | 3300046557 | Ga0495622_0001333 | Ga0495622_0001333_2672_3805 | 377 |
| 967 | 3300046559 | Ga0495667_0001452 | Ga0495667_0001452_478_1611 | 377 |
| 968 | 3300046559 | Ga0495667_0030262 | Ga0495667_0030262_149_1282 | 377 |
| 969 | 3300046559 | Ga0495667_0120590 | Ga0495667_0120590_148_1281 | 377 |
| 970 | 3300046642 | Ga0495634_0001601 | Ga0495634_0001601_10209_11342 | 377 |
| 971 | 3300046642 | Ga0495634_0050455 | Ga0495634_0050455_930_2063 | 377 |
| 972 | 3300046642 | Ga0495634_0056873 | Ga0495634_0056873_199_1332 | 377 |
| 973 | 3300046663 | Ga0495635_0000088 | Ga0495635_0000088_51957_53090 | 377 |
| 974 | 3300046663 | Ga0495635_0001000 | Ga0495635_0001000_9073_10206 | 377 |
| 975 | 3300046674 | Ga0495588_0038624 | Ga0495588_0038624_333_1466 | 377 |
| 976 | 3300046675 | Ga0495657_0001352 | Ga0495657_0001352_11223_12356 | 377 |
| 977 | 3300046675 | Ga0495657_0141187 | Ga0495657_0141187_140_1273 | 377 |
| 978 | 3300046678 | Ga0495599_0061777 | Ga0495599_0061777_216_1349 | 377 |
| 979 | 3300046678 | Ga0495599_0065968 | Ga0495599_0065968_544_1677 | 377 |
| 980 | 3300046679 | Ga0495623_0010431 | Ga0495623_0010431_477_1610 | 377 |
| 981 | 3300046679 | Ga0495623_0084635 | Ga0495623_0084635_350_1615 | 377 |
| 982 | 3300046680 | Ga0495646_0031727 | Ga0495646_0031727_790_1923 | 377 |
| 983 | 3300046680 | Ga0495646_0101785 | Ga0495646_0101785_79_1212 | 377 |
| 984 | 3300046681 | Ga0495647_0000070 | Ga0495647_0000070_21242_22375 | 377 |
| 985 | 3300046683 | Ga0495658_0001004 | Ga0495658_0001004_6369_7502 | 377 |
| 986 | 3300046689 | Ga0495613_0003317 | Ga0495613_0003317_6599_7732 | 377 |
| 987 | 3300046689 | Ga0495613_0071654 | Ga0495613_0071654_481_1614 | 377 |
| 988 | 3300046690 | Ga0495624_0003008 | Ga0495624_0003008_8989_10122 | 377 |
| 989 | 3300046690 | Ga0495624_0032884 | Ga0495624_0032884_1682_2947 | 377 |
| 990 | 3300046694 | Ga0495649_0058586 | Ga0495649_0058586_380_1513 | 377 |
| 991 | 3300046809 | Ga0495600_0000484 | Ga0495600_0000484_18822_19955 | 377 |
| 992 | 3300046809 | Ga0495600_0006880 | Ga0495600_0006880_683_1816 | 377 |
| 993 | 3300046809 | Ga0495600_0036737 | Ga0495600_0036737_871_2004 | 377 |
| 994 | 3300047315 | Ga0495581_0000082 | Ga0495581_0000082_15843_16976 | 377 |
| 995 | 3300047317 | Ga0495604_0011766 | Ga0495604_0011766_1423_2556 | 377 |
| 996 | 3300047317 | Ga0495604_0027775 | Ga0495604_0027775_3212_4345 | 377 |
| 997 | 3300047319 | Ga0495674_0005809 | Ga0495674_0005809_10356_11489 | 377 |
| 998 | 3300047319 | Ga0495674_0036094 | Ga0495674_0036094_2004_3137 | 377 |
| 999 | 3300047321 | Ga0495676_0021438 | Ga0495676_0021438_4342_5475 | 377 |
| 1000 | 3300047322 | Ga0495680_0018227 | Ga0495680_0018227_1249_2382 | 377 |
| 1001 | 3300047322 | Ga0495680_0028622 | Ga0495680_0028622_350_1483 | 377 |
| 1002 | 3300047443 | Ga0495687_026026 | Ga0495687_026026_1091_2224 | 377 |
| 1003 | 3300047444 | Ga0495675_0004649 | Ga0495675_0004649_2012_3145 | 377 |
| 1004 | 3300047469 | Ga0495673_0007496 | Ga0495673_0007496_3930_5063 | 377 |
| 1005 | 3300047471 | Ga0495684_0001326 | Ga0495684_0001326_2317_3450 | 377 |
| 1006 | 3300047471 | Ga0495684_0009235 | Ga0495684_0009235_2431_3696 | 377 |
| 1007 | 3300047471 | Ga0495684_0137230 | Ga0495684_0137230_458_1591 | 377 |
| 1008 | 3300047472 | Ga0495686_0053042 | Ga0495686_0053042_254_1387 | 377 |
| 1009 | 3300047673 | Ga0495593_0000206 | Ga0495593_0000206_21319_22452 | 377 |
| 1010 | 3300047673 | Ga0495593_0005786 | Ga0495593_0005786_2801_3934 | 377 |
| 1011 | 3300047673 | Ga0495593_0027986 | Ga0495593_0027986_92_1357 | 377 |
| 1012 | 3300048088 | Ga0495602_0039586 | Ga0495602_0039586_1194_2327 | 377 |
| 1013 | 3300048089 | Ga0495614_0058901 | Ga0495614_0058901_302_1435 | 377 |
| 1014 | 3300048903 | Ga0496100_0033039 | Ga0496100_0033039_544_1677 | 377 |
| 1015 | 3300048904 | Ga0496101_0034967 | Ga0496101_0034967_1824_2957 | 377 |
| 1016 | 3300048905 | Ga0496102_0021781 | Ga0496102_0021781_2658_3791 | 377 |
| 1017 | 3300048905 | Ga0496102_0043876 | Ga0496102_0043876_14_1147 | 377 |
| 1018 | 3300048907 | Ga0496104_0045505 | Ga0496104_0045505_2416_3549 | 377 |
| 1019 | 3300048907 | Ga0496104_0086868 | Ga0496104_0086868_14_1147 | 377 |
| 1020 | 3300048907 | Ga0496104_0103275 | Ga0496104_0103275_839_1972 | 377 |
| 1021 | 3300048909 | Ga0496106_0001874 | Ga0496106_0001874_6609_7775 | 377 |
| 1022 | 3300048910 | Ga0496107_0003415 | Ga0496107_0003415_5602_6735 | 377 |
| 1023 | 3300048911 | Ga0496108_0064703 | Ga0496108_0064703_1376_2509 | 377 |
| 1024 | 3300048911 | Ga0496108_0094889 | Ga0496108_0094889_529_1662 | 377 |
| 1025 | 3300048912 | Ga0496109_0000767 | Ga0496109_0000767_11747_12880 | 377 |
| 1026 | 3300048912 | Ga0496109_0060890 | Ga0496109_0060890_2175_3308 | 377 |
| 1027 | 3300048913 | Ga0496110_0035417 | Ga0496110_0035417_1518_2651 | 377 |
| 1028 | 3300048913 | Ga0496110_0266253 | Ga0496110_0266253_23_1168 | 377 |
| 1029 | 3300048914 | Ga0496111_0016531 | Ga0496111_0016531_1714_2847 | 377 |
| 1030 | 3300048914 | Ga0496111_0100497 | Ga0496111_0100497_146_1279 | 377 |
| 1031 | 3300048915 | Ga0496112_0031588 | Ga0496112_0031588_1744_2877 | 377 |
| 1032 | 3300048915 | Ga0496112_0050257 | Ga0496112_0050257_364_1497 | 377 |
| 1033 | 3300048915 | Ga0496112_0090064 | Ga0496112_0090064_976_2109 | 377 |
| 1034 | 3300048916 | Ga0496113_0010421 | Ga0496113_0010421_4118_5251 | 377 |
| 1035 | 3300048916 | Ga0496113_0158758 | Ga0496113_0158758_417_1550 | 377 |
| 1036 | 3300048917 | Ga0496114_0029797 | Ga0496114_0029797_1502_2635 | 377 |
| 1037 | 3300048917 | Ga0496114_0081236 | Ga0496114_0081236_231_1364 | 377 |
| 1038 | 3300048918 | Ga0496115_0028522 | Ga0496115_0028522_1454_2587 | 377 |
| 1039 | 3300048918 | Ga0496115_0115411 | Ga0496115_0115411_904_2037 | 377 |
| 1040 | 3300048919 | Ga0496116_0079774 | Ga0496116_0079774_818_1951 | 377 |
| 1041 | 3300048920 | Ga0496117_0010525 | Ga0496117_0010525_4107_5273 | 377 |
| 1042 | 3300048921 | Ga0496118_0002852 | Ga0496118_0002852_539_1705 | 377 |
| 1043 | 3300048922 | Ga0496119_0105327 | Ga0496119_0105327_373_1506 | 377 |
| 1044 | 3300048924 | Ga0496121_0000041 | Ga0496121_0000041_324715_325881 | 377 |
| 1045 | 3300048924 | Ga0496121_0002334 | Ga0496121_0002334_22686_23819 | 377 |
| 1046 | 3300048924 | Ga0496121_0013525 | Ga0496121_0013525_4350_5483 | 377 |
| 1047 | 3300048924 | Ga0496121_0076211 | Ga0496121_0076211_285_1418 | 377 |
| 1048 | 3300048924 | Ga0496121_0087108 | Ga0496121_0087108_920_2188 | 377 |
| 1049 | 3300048928 | Ga0496125_0032161 | Ga0496125_0032161_2383_3549 | 377 |
| 1050 | 3300048928 | Ga0496125_0050130 | Ga0496125_0050130_1593_2726 | 377 |
| 1051 | 3300048929 | Ga0496126_0003893 | Ga0496126_0003893_11678_12811 | 377 |
| 1052 | 3300048929 | Ga0496126_0009161 | Ga0496126_0009161_8929_10095 | 377 |
| 1053 | 3300048929 | Ga0496126_0009826 | Ga0496126_0009826_2654_3787 | 377 |
| 1054 | 3300048929 | Ga0496126_0026815 | Ga0496126_0026815_1007_2140 | 377 |
| 1055 | 3300048929 | Ga0496126_0131725 | Ga0496126_0131725_305_1438 | 377 |
| 1056 | 3300048929 | Ga0496126_0148217 | Ga0496126_0148217_819_1952 | 377 |
| 1057 | 3300048929 | Ga0496126_0213781 | Ga0496126_0213781_241_1374 | 377 |
| 1058 | 3300048929 | Ga0496126_0278204 | Ga0496126_0278204_145_1278 | 377 |
| 1059 | 3300049583 | Ga0501067_0005167 | Ga0501067_0005167_2601_3734 | 377 |
| 1060 | 3300049586 | Ga0501070_0011879 | Ga0501070_0011879_231_1364 | 377 |
| 1061 | 3300049590 | Ga0501074_0018352 | Ga0501074_0018352_2131_3264 | 377 |
| 1062 | 3300049742 | Ga0501080_0170031 | Ga0501080_0170031_800_1933 | 377 |
| 1063 | 3300049823 | Ga0501044_0058173 | Ga0501044_0058173_2642_3775 | 377 |
| 1064 | 3300050496 | nmdc:mga07m45_18120_c1 | nmdc:mga07m45_18120_c1_1373_2506 | 377 |
| 1065 | 3300050516 | nmdc:mga0sz30_9477_c1 | nmdc:mga0sz30_9477_c1_865_1998 | 377 |
| 1066 | 3300053077 | Ga0495601_0023544 | Ga0495601_0023544_601_1866 | 377 |
| 1067 | 3300053077 | Ga0495601_0131740 | Ga0495601_0131740_365_1498 | 377 |
| 1068 | 3300053078 | Ga0495612_0024682 | Ga0495612_0024682_1220_2353 | 377 |
| 1069 | 3300053084 | Ga0495595_0007012 | Ga0495595_0007012_1301_2434 | 377 |
| 1070 | 3300053085 | Ga0495619_0000332 | Ga0495619_0000332_31360_32493 | 377 |
| 1071 | 3300053085 | Ga0495619_0020566 | Ga0495619_0020566_2757_3944 | 377 |
| 1072 | 3300053085 | Ga0495619_0164996 | Ga0495619_0164996_61_1194 | 377 |
| 1073 | 3300053087 | Ga0500643_000019 | Ga0500643_000019_73250_74383 | 377 |
| 1074 | 3300053091 | Ga0500647_0103879 | Ga0500647_0103879_98_1264 | 377 |
| 1075 | 3300053093 | Ga0500651_0073718 | Ga0500651_0073718_829_1974 | 377 |
| 1076 | 3300053094 | Ga0500566_0000601 | Ga0500566_0000601_9935_11083 | 377 |
| 1077 | 3300053094 | Ga0500566_0001951 | Ga0500566_0001951_7334_8467 | 377 |
| 1078 | 3300053095 | Ga0500640_002416 | Ga0500640_002416_4113_5261 | 377 |
| 1079 | 3300053095 | Ga0500640_012322 | Ga0500640_012322_1320_2465 | 377 |
| 1080 | 3300053097 | Ga0500648_052555 | Ga0500648_052555_1126_2292 | 377 |
| 1081 | 3300053098 | Ga0500650_0103427 | Ga0500650_0103427_37_1170 | 377 |
| 1082 | 3300053103 | Ga0500555_001381 | Ga0500555_001381_2640_3773 | 377 |
| 1083 | 3300053111 | Ga0500572_000758 | Ga0500572_000758_3548_4735 | 377 |
| 1084 | 3300053111 | Ga0500572_001291 | Ga0500572_001291_4787_5935 | 377 |
| 1085 | 3300053111 | Ga0500572_010449 | Ga0500572_010449_107_1252 | 377 |
| 1086 | 3300053119 | Ga0500595_000286 | Ga0500595_000286_25207_26340 | 377 |
| 1087 | 3300053119 | Ga0500595_006869 | Ga0500595_006869_697_1830 | 377 |
| 1088 | 3300053119 | Ga0500595_025451 | Ga0500595_025451_18_1151 | 377 |
| 1089 | 3300053123 | Ga0500614_001807 | Ga0500614_001807_2790_3938 | 377 |
| 1090 | 3300053136 | Ga0500559_0001730 | Ga0500559_0001730_5172_6320 | 377 |
| 1091 | 3300053136 | Ga0500559_0006207 | Ga0500559_0006207_3438_4655 | 377 |
| 1092 | 3300053136 | Ga0500559_0015073 | Ga0500559_0015073_1651_2796 | 377 |
| 1093 | 3300053136 | Ga0500559_0044324 | Ga0500559_0044324_590_1756 | 377 |
| 1094 | 3300053138 | Ga0500564_049740 | Ga0500564_049740_492_1637 | 377 |
| 1095 | 3300053139 | Ga0500568_0009922 | Ga0500568_0009922_505_1638 | 377 |
| 1096 | 3300053139 | Ga0500568_0029518 | Ga0500568_0029518_960_2093 | 377 |
| 1097 | 3300053140 | Ga0500573_0121613 | Ga0500573_0121613_204_1370 | 377 |
| 1098 | 3300053148 | Ga0500590_071244 | Ga0500590_071244_115_1260 | 377 |
| 1099 | 3300053150 | Ga0500603_000817 | Ga0500603_000817_2740_3888 | 377 |
| 1100 | 3300053150 | Ga0500603_002275 | Ga0500603_002275_651_1784 | 377 |
| 1101 | 3300053150 | Ga0500603_005730 | Ga0500603_005730_169_1335 | 377 |
| 1102 | 3300053150 | Ga0500603_010343 | Ga0500603_010343_515_1648 | 377 |
| 1103 | 3300053151 | Ga0500604_0020517 | Ga0500604_0020517_84_1217 | 377 |
| 1104 | 3300053155 | Ga0500620_003161 | Ga0500620_003161_1155_2300 | 377 |
| 1105 | 3300053159 | Ga0500630_001904 | Ga0500630_001904_4766_5914 | 377 |
| 1106 | 3300053162 | Ga0500638_000361 | Ga0500638_000361_4923_6056 | 377 |
| 1107 | 3300053162 | Ga0500638_077418 | Ga0500638_077418_302_1435 | 377 |
| 1108 | 3300053163 | Ga0500639_000166 | Ga0500639_000166_16575_17723 | 377 |
| 1109 | 3300053163 | Ga0500639_017659 | Ga0500639_017659_2359_3576 | 377 |
| 1110 | 3300053177 | Ga0500636_0000076 | Ga0500636_0000076_22445_23590 | 377 |
| 1111 | 3300053177 | Ga0500636_0027304 | Ga0500636_0027304_2192_3325 | 377 |
| 1112 | 3300053177 | Ga0500636_0090858 | Ga0500636_0090858_520_1653 | 377 |
| 1113 | 3300053178 | Ga0500637_0003785 | Ga0500637_0003785_2692_3825 | 377 |
| 1114 | 3300053178 | Ga0500637_0017525 | Ga0500637_0017525_31_1164 | 377 |
| 1115 | 3300053730 | Ga0500645_006029 | Ga0500645_006029_3002_4150 | 377 |
| 1116 | 3300053731 | Ga0500609_005292 | Ga0500609_005292_600_1745 | 377 |
| 1117 | 3300053735 | Ga0500596_000099 | Ga0500596_000099_8986_10134 | 377 |
| 1118 | 3300053735 | Ga0500596_002257 | Ga0500596_002257_1531_2697 | 377 |
| 1119 | 3300053736 | Ga0500599_002472 | Ga0500599_002472_476_1609 | 377 |
| 1120 | 3300053737 | Ga0500601_000030 | Ga0500601_000030_21832_22977 | 377 |
| 1121 | 3300055283 | Ga0500661_000031 | Ga0500661_000031_13036_14169 | 377 |
| 1122 | iso_pu_bacteria | 2842045827 | 2842048781 | 377 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qi9-assembly1.cif.gz_A | crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.2 in complex with udp | 0.7388 | 14 | 246 |
| 6p61-assembly3.cif.gz_C | structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) | 0.738 | 18 | 225 |
| 3e25-assembly1.cif.gz_A-2 | crystal structure of m. tuberculosis glucosyl-3-phosphoglycerate synthase | 0.7357 | 19 | 251 |
| 5jt0-assembly1.cif.gz_A | crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and glucosyl-3-phosphoglycerate (gpg) - gpgs*gpg*udp*mn2+ | 0.7352 | 13 | 246 |
| 6p61-assembly3.cif.gz_C | structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) | 0.7309 | 18 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4ICW5_2_228_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8983 | 20 | 242 | 3.90.550.10 |
| af_P77293_1_188_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8914 | 19 | 202 | 3.90.550.10 |
| af_A4ICW5_2_228_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8796 | 20 | 242 | 3.90.550.10 |
| af_K7MVE2_46_307_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8788 | 17 | 230 | 3.90.550.10 |
| af_Q9VLQ1_42_326_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.873 | 17 | 247 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y6CFG3-F1-model_v4 | Glycosyltransferase | 0.9705 | 19 | 116 |
GO:0005886
GO:0016757 |
| AF-A0A7Y6CFG3-F1-model_v4 | Glycosyltransferase | 0.9424 | 19 | 116 |
GO:0005886
GO:0016757 |
| AF-A0A7X7EG14-F1-model_v4 | deleted | 0.9337 | 20 | 101 |
|
| AF-A0A7W1QYZ0-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9275 | 20 | 183 |
GO:0016757
|
| AF-A0A2G4FMK8-F1-model_v4 | Glycosyl transferase | 0.925 | 18 | 187 |
GO:0016757
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar