F490403

General Info

Members Datasets Scaffolds Average Seq Length
1121 362 2242 205

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10055466|Ga0075368_100554662
Length 234
Sequence MIPIRVMTADSMTAETTPTPRGRTVTLAITGASGALYATRTLAALMARGCRVELVISDYGRRLLRDELGDEAAVDKLPAFLARYGEDISRGSYVLHSNRDLGARIASGSQGAEAMAIVPCSMKTLAGVAHGLSRNLIERAADVMLKEGRKLILVPRETPMSLPQLKNMVACAEAGAIVLPAMPAFYQMPKTLDDLGAFMAGKILSAMGFEHDLYPAWKPDDQGVQADAKSDWDS

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
182 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
198 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
199 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
203 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
206 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
212 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
221 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
222 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
234 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
235 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
236 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
237 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
238 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
239 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
240 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
241 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
242 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
318 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
319 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
344 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
345 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
346 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
349 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
350 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
351 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
352 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
353 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
354 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
359 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
360 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
362 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.08
Nodule 0
Rhizoplane 4.55
Rhizosphere 90.01
Stem 0
Stem Tuber 0
Unclassified 5.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10055466 3300006042 Bacteria 1579
2 MBSR1b_contig_3797481 2162886012 Unclassified 1052
3 Ga0065712_10099069 3300005290 Bacteria 2096
4 Ga0065712_10102744 3300005290 Bacteria 1959
5 Ga0065712_10114854 3300005290 Bacteria 1760
6 Ga0065712_10146743 3300005290 Bacteria 1402
7 Ga0065715_10023619 3300005293 Bacteria 1566
8 Ga0065715_10031263 3300005293 Bacteria 2819
9 Ga0065715_10172453 3300005293 Bacteria 1536
10 Ga0065715_10272354 3300005293 Bacteria 1107
11 Ga0065707_10146029 3300005295 Bacteria 1713
12 Ga0065707_10229141 3300005295 Bacteria 1195
13 Ga0070683_100009233 3300005329 Bacteria 8424
14 Ga0070683_100046792 3300005329 Bacteria 3997
15 Ga0070690_100092412 3300005330 Bacteria 1995
16 Ga0070690_100165903 3300005330 Bacteria 1517
17 Ga0070690_100402526 3300005330 Bacteria 1005
18 Ga0070670_100015094 3300005331 Bacteria 6630
19 Ga0070670_100093231 3300005331 Bacteria 2590
20 Ga0070670_100112701 3300005331 Bacteria 2344
21 Ga0070677_10036427 3300005333 Bacteria 1914
22 Ga0068869_100023698 3300005334 Bacteria 4245
23 Ga0068869_100497278 3300005334 Bacteria 1017
24 Ga0070666_10008944 3300005335 Bacteria 6236
25 Ga0070666_10045661 3300005335 Bacteria 2937
26 Ga0070666_10071958 3300005335 Bacteria 2354
27 Ga0070666_10093189 3300005335 Bacteria 2071
28 Ga0070666_10323810 3300005335 Bacteria 1100
29 Ga0070680_100227523 3300005336 Bacteria 1575
30 Ga0070680_100590472 3300005336 Unclassified 953
31 Ga0070682_100713779 3300005337 Bacteria 805
32 Ga0068868_100015569 3300005338 Bacteria 5629
33 Ga0068868_100054258 3300005338 Bacteria 3158
34 Ga0068868_100554813 3300005338 Bacteria 1013
35 Ga0070660_100155845 3300005339 Bacteria 1838
36 Ga0070660_100504376 3300005339 Bacteria 1007
37 Ga0070689_100021551 3300005340 Bacteria 4800
38 Ga0070689_100050114 3300005340 Bacteria 3225
39 Ga0070689_100584597 3300005340 Bacteria 966
40 Ga0070689_101070458 3300005340 Bacteria 720
41 Ga0070691_10000205 3300005341 Bacteria 19816
42 Ga0070661_100019334 3300005344 Bacteria 4855
43 Ga0070661_100165004 3300005344 Bacteria 1679
44 Ga0070668_100112954 3300005347 Bacteria 2164
45 Ga0070668_100133128 3300005347 Bacteria 1997
46 Ga0070669_100006383 3300005353 Bacteria 8492
47 Ga0070669_100013978 3300005353 Bacteria 5708
48 Ga0070669_100037570 3300005353 Bacteria 3513
49 Ga0070669_100539382 3300005353 Bacteria 971
50 Ga0070675_100000079 3300005354 Bacteria 56265
51 Ga0070675_100158316 3300005354 Bacteria 1946
52 Ga0070675_100179936 3300005354 Bacteria 1828
53 Ga0070675_100184127 3300005354 Bacteria 1807
54 Ga0070675_100205354 3300005354 Bacteria 1711
55 Ga0070675_100315336 3300005354 Bacteria 1380
56 Ga0070675_100345748 3300005354 Bacteria 1318
57 Ga0070675_100592536 3300005354 Bacteria 1005
58 Ga0070671_100048761 3300005355 Bacteria 3522
59 Ga0070671_100143579 3300005355 Bacteria 2015
60 Ga0070671_100483684 3300005355 Unclassified 1064
61 Ga0070674_100008928 3300005356 Bacteria 5987
62 Ga0070674_100103803 3300005356 Bacteria 2076
63 Ga0070674_100830675 3300005356 Unclassified 800
64 Ga0070673_100103247 3300005364 Bacteria 2352
65 Ga0070673_100492362 3300005364 Unclassified 1108
66 Ga0070673_100500237 3300005364 Bacteria 1099
67 Ga0070673_100678275 3300005364 Bacteria 945
68 Ga0070688_100020475 3300005365 Bacteria 3848
69 Ga0070688_100038750 3300005365 Bacteria 2913
70 Ga0070688_100087852 3300005365 Bacteria 2026
71 Ga0070667_100058754 3300005367 Bacteria 3252
72 Ga0070667_100338142 3300005367 Bacteria 1361
73 Ga0070667_100388443 3300005367 Bacteria 1269
74 Ga0070667_101251262 3300005367 Bacteria 695
75 Ga0070709_10624846 3300005434 Bacteria 832
76 Ga0070701_10003547 3300005438 Bacteria 6191
77 Ga0070701_10079270 3300005438 Bacteria 1774
78 Ga0070711_100061174 3300005439 Unclassified 2620
79 Ga0070711_100257661 3300005439 Bacteria 1371
80 Ga0070711_100619374 3300005439 Bacteria 905
81 Ga0070705_100238006 3300005440 Bacteria 1271
82 Ga0070700_100017254 3300005441 Bacteria 4124
83 Ga0070700_100037897 3300005441 Bacteria 2934
84 Ga0070700_100251824 3300005441 Bacteria 1267
85 Ga0070700_100330767 3300005441 Bacteria 1123
86 Ga0070700_100332472 3300005441 Bacteria 1120
87 Ga0070700_100383669 3300005441 Bacteria 1052
88 Ga0070694_100010273 3300005444 Bacteria 5768
89 Ga0070694_100921257 3300005444 Bacteria 722
90 Ga0070708_100608923 3300005445 Bacteria 1030
91 Ga0070663_100011303 3300005455 Bacteria 5598
92 Ga0070678_100101160 3300005456 Bacteria 2234
93 Ga0070678_100166799 3300005456 Bacteria 1790
94 Ga0070678_100962894 3300005456 Bacteria 783
95 Ga0070662_100114150 3300005457 Bacteria 2062
96 Ga0070662_100836798 3300005457 Bacteria 783
97 Ga0070681_10369348 3300005458 Bacteria 1345
98 Ga0070681_10425995 3300005458 Bacteria 1239
99 Ga0068867_100016355 3300005459 Bacteria 5266
100 Ga0068867_100081154 3300005459 Bacteria 2444
101 Ga0068867_100451391 3300005459 Bacteria 1095
102 Ga0068867_101094377 3300005459 Unclassified 727
103 Ga0070685_10616322 3300005466 Bacteria 783
104 Ga0070707_100428016 3300005468 Bacteria 1284
105 Ga0070698_100956597 3300005471 Bacteria 803
106 Ga0070699_100130944 3300005518 Bacteria 2211
107 Ga0070699_100443840 3300005518 Bacteria 1176
108 Ga0070679_100024711 3300005530 Bacteria 5888
109 Ga0070679_100385541 3300005530 Bacteria 1348
110 Ga0070684_100003202 3300005535 Bacteria 12240
111 Ga0070684_100020841 3300005535 Bacteria 5440
112 Ga0070684_100246677 3300005535 Bacteria 1632
113 Ga0070684_100371343 3300005535 Bacteria 1317
114 Ga0070684_100988037 3300005535 Bacteria 790
115 Ga0068853_100983945 3300005539 Bacteria 812
116 Ga0070672_100017844 3300005543 Bacteria 5116
117 Ga0070672_100072251 3300005543 Bacteria 2747
118 Ga0070672_100098751 3300005543 Bacteria 2365
119 Ga0070672_100772937 3300005543 Bacteria 844
120 Ga0070686_100070795 3300005544 Bacteria 2281
121 Ga0070686_100185865 3300005544 Bacteria 1480
122 Ga0070686_100262832 3300005544 Bacteria 1266
123 Ga0070686_100708098 3300005544 Bacteria 804
124 Ga0070686_100764388 3300005544 Bacteria 776
125 Ga0070695_100166150 3300005545 Bacteria 1553
126 Ga0070695_100850294 3300005545 Bacteria 734
127 Ga0070696_100020430 3300005546 Bacteria 4489
128 Ga0070696_100024142 3300005546 Bacteria 4132
129 Ga0070696_100103997 3300005546 Bacteria 2038
130 Ga0070696_100263225 3300005546 Bacteria 1308
131 Ga0070696_100570787 3300005546 Bacteria 909
132 Ga0070693_100052821 3300005547 Unclassified 2331
133 Ga0070693_100162449 3300005547 Bacteria 1424
134 Ga0070665_100001511 3300005548 Bacteria 27024
135 Ga0070665_100003106 3300005548 Bacteria 17884
136 Ga0070665_100010290 3300005548 Bacteria 9465
137 Ga0070665_100070519 3300005548 Bacteria 3502
138 Ga0070665_100097496 3300005548 Bacteria 2945
139 Ga0070665_100207009 3300005548 Bacteria 1962
140 Ga0070665_100461839 3300005548 Bacteria 1280
141 Ga0070665_100707463 3300005548 Bacteria 1020
142 Ga0070704_100015360 3300005549 Bacteria 4809
143 Ga0070704_100240967 3300005549 Bacteria 1480
144 Ga0070704_100279421 3300005549 Bacteria 1383
145 Ga0070704_100283451 3300005549 Bacteria 1374
146 Ga0070704_100466682 3300005549 Bacteria 1090
147 Ga0068855_100361702 3300005563 Bacteria 1597
148 Ga0070664_100002901 3300005564 Bacteria 13874
149 Ga0070664_100106291 3300005564 Bacteria 2445
150 Ga0070664_100148542 3300005564 Bacteria 2068
151 Ga0070664_100166207 3300005564 Bacteria 1955
152 Ga0070664_100403166 3300005564 Bacteria 1251
153 Ga0070664_100858770 3300005564 Bacteria 850
154 Ga0068857_100032282 3300005577 Bacteria 4630
155 Ga0068854_100241204 3300005578 Bacteria 1439
156 Ga0068854_100498549 3300005578 Bacteria 1025
157 Ga0068856_100014941 3300005614 Bacteria 7498
158 Ga0068856_100517786 3300005614 Bacteria 1214
159 Ga0070702_100006773 3300005615 Bacteria 5447
160 Ga0070702_100020742 3300005615 Bacteria 3447
161 Ga0068852_100168778 3300005616 Bacteria 2049
162 Ga0068852_100606915 3300005616 Bacteria 1099
163 Ga0068859_100385718 3300005617 Bacteria 1497
164 Ga0068859_100787303 3300005617 Bacteria 1039
165 Ga0068859_100927593 3300005617 Bacteria 955
166 Ga0068864_100019648 3300005618 Bacteria 5650
167 Ga0068864_100118517 3300005618 Bacteria 2364
168 Ga0068864_100201336 3300005618 Bacteria 1829
169 Ga0068864_100759569 3300005618 Bacteria 951
170 Ga0068864_100782602 3300005618 Bacteria 937
171 Ga0068864_100834736 3300005618 Bacteria 907
172 Ga0068866_10014486 3300005718 Bacteria 3484
173 Ga0068866_10274906 3300005718 Bacteria 1041
174 Ga0068861_100004810 3300005719 Bacteria 9079
175 Ga0068861_100016822 3300005719 Bacteria 5182
176 Ga0068861_100031339 3300005719 Bacteria 3905
177 Ga0068861_100038142 3300005719 Bacteria 3575
178 Ga0068861_100082239 3300005719 Bacteria 2523
179 Ga0068851_10152992 3300005834 Bacteria 1262
180 Ga0068870_10050145 3300005840 Bacteria 2205
181 Ga0068870_10676265 3300005840 Bacteria 710
182 Ga0068863_100049221 3300005841 Bacteria 3996
183 Ga0068863_100067111 3300005841 Bacteria 3394
184 Ga0068863_100974586 3300005841 Bacteria 850
185 Ga0068858_100003783 3300005842 Bacteria 14961
186 Ga0068858_100213088 3300005842 Bacteria 1828
187 Ga0068858_100220802 3300005842 Bacteria 1795
188 Ga0068858_100273120 3300005842 Bacteria 1609
189 Ga0068860_100014536 3300005843 Bacteria 7702
190 Ga0068860_100508099 3300005843 Bacteria 1204
191 Ga0068860_100825476 3300005843 Bacteria 941
192 Ga0068862_100009679 3300005844 Bacteria 7966
193 Ga0068862_100017064 3300005844 Bacteria 6041
194 Ga0068862_100122266 3300005844 Bacteria 2295
195 Ga0068862_100318034 3300005844 Bacteria 1436
196 Ga0068862_100438865 3300005844 Bacteria 1228
197 Ga0081455_10068462 3300005937 Bacteria 2954
198 Ga0081455_10072702 3300005937 Bacteria 2846
199 Ga0081455_10224062 3300005937 Bacteria 1392
200 Ga0081539_10014209 3300005985 Bacteria 5911
201 Ga0070717_10091629 3300006028 Unclassified 2567
202 Ga0075365_10011187 3300006038 Bacteria 5267
203 Ga0075365_10054546 3300006038 Bacteria 2651
204 Ga0075368_10013207 3300006042 Bacteria 3030
205 Ga0075368_10023974 3300006042 Bacteria 2334
206 Ga0075363_100055138 3300006048 Bacteria 2128
207 Ga0075363_100110612 3300006048 Bacteria 1527
208 Ga0075363_100418220 3300006048 Bacteria 789
209 Ga0075364_10004297 3300006051 Bacteria 8181
210 Ga0075364_10045616 3300006051 Bacteria 2852
211 Ga0075364_10089576 3300006051 Unclassified 2040
212 Ga0075364_10294741 3300006051 Bacteria 1104
213 Ga0075364_10478015 3300006051 Bacteria 852
214 Ga0070716_100217180 3300006173 Bacteria 1282
215 Ga0075362_10024862 3300006177 Bacteria 2543
216 Ga0075367_10154268 3300006178 Bacteria 1426
217 Ga0075367_10163298 3300006178 Bacteria 1385
218 Ga0075366_10008006 3300006195 Bacteria 5856
219 Ga0075366_10023601 3300006195 Bacteria 3584
220 Ga0075366_10025301 3300006195 Bacteria 3466
221 Ga0075366_10062141 3300006195 Bacteria 2220
222 Ga0075366_10093954 3300006195 Bacteria 1797
223 Ga0075366_10293249 3300006195 Bacteria 995
224 Ga0097621_100011246 3300006237 Bacteria 6589
225 Ga0097621_100026607 3300006237 Bacteria 4540
226 Ga0097621_100093539 3300006237 Bacteria 2519
227 Ga0097621_100109177 3300006237 Unclassified 2337
228 Ga0097621_100174452 3300006237 Bacteria 1855
229 Ga0097621_100306581 3300006237 Unclassified 1404
230 Ga0097621_100418966 3300006237 Unclassified 1202
231 Ga0075370_10013314 3300006353 Bacteria 4368
232 Ga0075370_10044791 3300006353 Bacteria 2501
233 Ga0068871_100006379 3300006358 Bacteria 8339
234 Ga0068871_100006536 3300006358 Bacteria 8258
235 Ga0068871_100015641 3300006358 Bacteria 5686
236 Ga0068871_100217139 3300006358 Bacteria 1655
237 Ga0068871_100231954 3300006358 Bacteria 1602
238 Ga0068871_100266720 3300006358 Bacteria 1495
239 Ga0068871_100959316 3300006358 Bacteria 795
240 Ga0068871_101207523 3300006358 Bacteria 709
241 Ga0075428_100005950 3300006844 Bacteria 13556
242 Ga0075428_100039614 3300006844 Bacteria 5186
243 Ga0075428_100108179 3300006844 Bacteria 3030
244 Ga0075428_100120829 3300006844 Bacteria 2852
245 Ga0075428_100809399 3300006844 Bacteria 996
246 Ga0075428_101116437 3300006844 Bacteria 832
247 Ga0075430_100017232 3300006846 Bacteria 6152
248 Ga0075430_100028894 3300006846 Bacteria 4708
249 Ga0075430_100093086 3300006846 Bacteria 2520
250 Ga0075431_100004102 3300006847 Bacteria 14228
251 Ga0075431_100018285 3300006847 Bacteria 7131
252 Ga0075431_100029812 3300006847 Bacteria 5618
253 Ga0075431_100040075 3300006847 Bacteria 4827
254 Ga0075431_100412176 3300006847 Bacteria 1351
255 Ga0075431_101214622 3300006847 Unclassified 716
256 Ga0075433_10027410 3300006852 Bacteria 4832
257 Ga0075433_10050721 3300006852 Bacteria 3613
258 Ga0075433_10103048 3300006852 Bacteria 2527
259 Ga0075433_10126567 3300006852 Unclassified 2269
260 Ga0075433_10227755 3300006852 Bacteria 1655
261 Ga0075433_10343140 3300006852 Bacteria 1320
262 Ga0075433_10355704 3300006852 Bacteria 1294
263 Ga0075433_10375149 3300006852 Bacteria 1256
264 Ga0075433_10810818 3300006852 Bacteria 818
265 Ga0075434_100001079 3300006871 Bacteria 22322
266 Ga0075434_100006547 3300006871 Bacteria 10682
267 Ga0075434_100007593 3300006871 Bacteria 10040
268 Ga0075434_100011037 3300006871 Bacteria 8499
269 Ga0075434_100233264 3300006871 Bacteria 1860
270 Ga0075434_100351164 3300006871 Unclassified 1496
271 Ga0075434_100400284 3300006871 Bacteria 1394
272 Ga0075434_100940169 3300006871 Bacteria 879
273 Ga0075429_100002617 3300006880 Bacteria 15180
274 Ga0075429_100012495 3300006880 Bacteria 7365
275 Ga0075429_100040889 3300006880 Bacteria 4037
276 Ga0075429_100142167 3300006880 Bacteria 2101
277 Ga0075429_100370561 3300006880 Bacteria 1254
278 Ga0075429_100442675 3300006880 Bacteria 1139
279 Ga0075429_100501545 3300006880 Bacteria 1064
280 Ga0068865_100005679 3300006881 Bacteria 7578
281 Ga0068865_100022011 3300006881 Bacteria 4151
282 Ga0068865_100187752 3300006881 Bacteria 1596
283 Ga0068865_100272820 3300006881 Bacteria 1344
284 Ga0068865_100339631 3300006881 Bacteria 1213
285 Ga0075436_100007129 3300006914 Bacteria 7650
286 Ga0097620_100385740 3300006931 Bacteria 1497
287 Ga0097620_100787382 3300006931 Bacteria 1039
288 Ga0097620_100927555 3300006931 Bacteria 955
289 Ga0097620_101114524 3300006931 Bacteria 868
290 Ga0075435_100000213 3300007076 Bacteria 35518
291 Ga0075435_100000297 3300007076 Bacteria 30737
292 Ga0075435_100004639 3300007076 Bacteria 9468
293 Ga0075435_100012707 3300007076 Bacteria 6237
294 Ga0075435_100046860 3300007076 Bacteria 3469
295 Ga0075435_100056798 3300007076 Bacteria 3165
296 Ga0075435_100195601 3300007076 Bacteria 1712
297 Ga0075435_100895409 3300007076 Bacteria 774
298 Ga0075435_101080590 3300007076 Bacteria 701
299 Ga0099794_10307351 3300007265 Bacteria 821
300 Ga0105240_10148295 3300009093 Bacteria 2796
301 Ga0105240_10209184 3300009093 Bacteria 2281
302 Ga0105240_10705429 3300009093 Bacteria 1101
303 Ga0111539_10001074 3300009094 Bacteria 36076
304 Ga0111539_10001475 3300009094 Bacteria 31424
305 Ga0111539_10003731 3300009094 Bacteria 20043
306 Ga0111539_10023912 3300009094 Bacteria 7507
307 Ga0111539_10026508 3300009094 Bacteria 7085
308 Ga0111539_10044979 3300009094 Bacteria 5286
309 Ga0111539_10076506 3300009094 Bacteria 3940
310 Ga0111539_10130634 3300009094 Bacteria 2941
311 Ga0111539_10170809 3300009094 Bacteria 2540
312 Ga0111539_10199850 3300009094 Bacteria 2331
313 Ga0111539_10390873 3300009094 Bacteria 1620
314 Ga0111539_10404239 3300009094 Bacteria 1590
315 Ga0111539_10468102 3300009094 Bacteria 1467
316 Ga0111539_10618082 3300009094 Bacteria 1262
317 Ga0111539_11252287 3300009094 Unclassified 861
318 Ga0105245_10011811 3300009098 Bacteria 7596
319 Ga0105245_10350289 3300009098 Unclassified 1463
320 Ga0105245_10373576 3300009098 Bacteria 1418
321 Ga0105245_10944843 3300009098 Bacteria 905
322 Ga0114129_10000006 3300009147 Bacteria 157531
323 Ga0114129_10000086 3300009147 Bacteria 86772
324 Ga0114129_10002018 3300009147 Bacteria 27827
325 Ga0114129_10002028 3300009147 Bacteria 27757
326 Ga0114129_10002788 3300009147 Bacteria 24360
327 Ga0114129_10016405 3300009147 Bacteria 10541
328 Ga0114129_10023419 3300009147 Bacteria 8755
329 Ga0114129_10027315 3300009147 Bacteria 8081
330 Ga0114129_10029872 3300009147 Bacteria 7718
331 Ga0114129_10038108 3300009147 Bacteria 6783
332 Ga0114129_10039036 3300009147 Bacteria 6694
333 Ga0114129_10077320 3300009147 Bacteria 4629
334 Ga0114129_10294556 3300009147 Bacteria 2164
335 Ga0114129_10483406 3300009147 Bacteria 1620
336 Ga0114129_11244828 3300009147 Bacteria 925
337 Ga0114129_11305098 3300009147 Bacteria 899
338 Ga0105243_10075791 3300009148 Bacteria 2731
339 Ga0105243_10094127 3300009148 Bacteria 2474
340 Ga0105243_10097580 3300009148 Bacteria 2432
341 Ga0105243_10834822 3300009148 Bacteria 911
342 Ga0105241_10085733 3300009174 Bacteria 2476
343 Ga0105242_10011789 3300009176 Bacteria 6728
344 Ga0105242_10035951 3300009176 Bacteria 3972
345 Ga0105242_10039808 3300009176 Bacteria 3784
346 Ga0105242_10051191 3300009176 Bacteria 3365
347 Ga0105242_10151936 3300009176 Bacteria 2020
348 Ga0105242_10183918 3300009176 Bacteria 1845
349 Ga0105242_10551795 3300009176 Bacteria 1105
350 Ga0105242_11187153 3300009176 Bacteria 782
351 Ga0105248_10003314 3300009177 Bacteria 17875
352 Ga0105248_10010492 3300009177 Bacteria 10204
353 Ga0105248_10016498 3300009177 Bacteria 8131
354 Ga0105248_10031464 3300009177 Bacteria 5931
355 Ga0105248_10042926 3300009177 Bacteria 5070
356 Ga0105248_10060438 3300009177 Bacteria 4254
357 Ga0105248_10131193 3300009177 Bacteria 2827
358 Ga0105248_10154235 3300009177 Bacteria 2591
359 Ga0105248_10176686 3300009177 Bacteria 2406
360 Ga0105248_10245518 3300009177 Bacteria 2015
361 Ga0105248_10268802 3300009177 Bacteria 1920
362 Ga0105248_10278400 3300009177 Bacteria 1883
363 Ga0105248_10377505 3300009177 Bacteria 1596
364 Ga0105248_10610217 3300009177 Bacteria 1231
365 Ga0105248_10660917 3300009177 Bacteria 1179
366 Ga0105248_10671501 3300009177 Bacteria 1169
367 Ga0105248_10914537 3300009177 Bacteria 991
368 Ga0105248_11719394 3300009177 Bacteria 711
369 Ga0105237_10281788 3300009545 Bacteria 1664
370 Ga0105238_10165183 3300009551 Bacteria 2189
371 Ga0105238_11215685 3300009551 Bacteria 778
372 Ga0105249_10001775 3300009553 Bacteria 18798
373 Ga0105249_10930781 3300009553 Bacteria 937
374 Ga0105239_10195476 3300010375 Bacteria 2265
375 Ga0105239_10885263 3300010375 Bacteria 1025
376 Ga0105246_10030539 3300011119 Bacteria 3560
377 Ga0105246_10303567 3300011119 Bacteria 1290
378 Ga0105246_11011069 3300011119 Bacteria 753
379 Ga0157369_10623783 3300013105 Bacteria 1112
380 Ga0157374_10065505 3300013296 Bacteria 3412
381 Ga0157378_10028962 3300013297 Bacteria 4888
382 Ga0157378_10621722 3300013297 Unclassified 1093
383 Ga0163162_10135935 3300013306 Bacteria 2569
384 Ga0163162_10178050 3300013306 Bacteria 2252
385 Ga0163162_11217559 3300013306 Bacteria 855
386 Ga0157372_10127046 3300013307 Unclassified 2932
387 Ga0157375_10208983 3300013308 Bacteria 2109
388 Ga0157375_10279778 3300013308 Bacteria 1832
389 Ga0157375_10793963 3300013308 Bacteria 1096
390 Ga0157375_11063343 3300013308 Bacteria 946
391 Ga0163163_10000022 3300014325 Bacteria 187289
392 Ga0163163_10072561 3300014325 Bacteria 3432
393 Ga0163163_10082589 3300014325 Bacteria 3217
394 Ga0163163_10146753 3300014325 Bacteria 2403
395 Ga0163163_10156123 3300014325 Bacteria 2326
396 Ga0163163_10158128 3300014325 Bacteria 2311
397 Ga0163163_10436104 3300014325 Bacteria 1369
398 Ga0163163_10463011 3300014325 Bacteria 1328
399 Ga0163163_10648581 3300014325 Bacteria 1119
400 Ga0157380_10007449 3300014326 Bacteria 7771
401 Ga0157380_10181729 3300014326 Bacteria 1849
402 Ga0157380_10552949 3300014326 Bacteria 1129
403 Ga0157380_10610716 3300014326 Bacteria 1081
404 Ga0157380_10814190 3300014326 Bacteria 952
405 Ga0157380_10924626 3300014326 Bacteria 900
406 Ga0157380_11257101 3300014326 Bacteria 786
407 Ga0157377_10010181 3300014745 Bacteria 4642
408 Ga0157379_10005030 3300014968 Bacteria 11340
409 Ga0157379_10105928 3300014968 Bacteria 2524
410 Ga0157379_10440013 3300014968 Bacteria 1202
411 Ga0157379_10588652 3300014968 Bacteria 1038
412 Ga0157376_10003567 3300014969 Bacteria 10724
413 Ga0157376_10111784 3300014969 Bacteria 2406
414 Ga0157376_10119541 3300014969 Bacteria 2333
415 Ga0157376_10203649 3300014969 Bacteria 1823
416 Ga0157376_10233327 3300014969 Bacteria 1710
417 Ga0157376_10250097 3300014969 Unclassified 1655
418 Ga0157376_10586257 3300014969 Bacteria 1108
419 Ga0163161_10278239 3300017792 Bacteria 1312
420 Ga0207697_10000983 3300025315 Bacteria 15969
421 Ga0207697_10051107 3300025315 Bacteria 1708
422 Ga0207697_10128822 3300025315 Bacteria 1093
423 Ga0207653_10038211 3300025885 Bacteria 1568
424 Ga0207682_10018255 3300025893 Bacteria 2743
425 Ga0207682_10032524 3300025893 Bacteria 2097
426 Ga0207682_10102310 3300025893 Bacteria 1253
427 Ga0207642_10046132 3300025899 Bacteria 1939
428 Ga0207680_10009146 3300025903 Bacteria 4899
429 Ga0207680_10058304 3300025903 Bacteria 2340
430 Ga0207680_10100469 3300025903 Bacteria 1858
431 Ga0207680_10217854 3300025903 Bacteria 1307
432 Ga0207680_10381425 3300025903 Bacteria 994
433 Ga0207680_10543394 3300025903 Bacteria 829
434 Ga0207699_10481745 3300025906 Bacteria 894
435 Ga0207645_10026612 3300025907 Bacteria 3737
436 Ga0207643_10221708 3300025908 Bacteria 1158
437 Ga0207684_10702843 3300025910 Bacteria 859
438 Ga0207654_10083502 3300025911 Bacteria 1929
439 Ga0207707_10351628 3300025912 Bacteria 1270
440 Ga0207707_10359006 3300025912 Bacteria 1255
441 Ga0207695_10424797 3300025913 Bacteria 1213
442 Ga0207671_10453959 3300025914 Bacteria 1021
443 Ga0207663_10033987 3300025916 Bacteria 3044
444 Ga0207660_10829456 3300025917 Bacteria 755
445 Ga0207662_10003979 3300025918 Bacteria 7699
446 Ga0207662_10127341 3300025918 Bacteria 1602
447 Ga0207662_10315470 3300025918 Bacteria 1043
448 Ga0207662_10637032 3300025918 Bacteria 744
449 Ga0207657_10146609 3300025919 Bacteria 1925
450 Ga0207657_10221352 3300025919 Unclassified 1516
451 Ga0207657_10439153 3300025919 Bacteria 1025
452 Ga0207649_10021903 3300025920 Bacteria 3688
453 Ga0207649_10072393 3300025920 Unclassified 2205
454 Ga0207652_10210268 3300025921 Unclassified 1752
455 Ga0207652_10335837 3300025921 Bacteria 1364
456 Ga0207646_10153211 3300025922 Bacteria 2079
457 Ga0207646_10850251 3300025922 Bacteria 811
458 Ga0207681_10013051 3300025923 Bacteria 5136
459 Ga0207650_10005304 3300025925 Bacteria 8795
460 Ga0207650_10053082 3300025925 Bacteria 3004
461 Ga0207659_10004827 3300025926 Bacteria 8171
462 Ga0207659_10078562 3300025926 Bacteria 2432
463 Ga0207659_10130105 3300025926 Bacteria 1941
464 Ga0207659_10380491 3300025926 Bacteria 1177
465 Ga0207687_10013508 3300025927 Bacteria 5332
466 Ga0207687_10092242 3300025927 Bacteria 2211
467 Ga0207687_10216754 3300025927 Bacteria 1505
468 Ga0207644_10019590 3300025931 Bacteria 4592
469 Ga0207644_10111533 3300025931 Bacteria 2069
470 Ga0207644_10295905 3300025931 Bacteria 1303
471 Ga0207690_10185255 3300025932 Unclassified 1570
472 Ga0207706_10248705 3300025933 Bacteria 1553
473 Ga0207706_10398007 3300025933 Bacteria 1194
474 Ga0207706_10840818 3300025933 Bacteria 778
475 Ga0207686_10022777 3300025934 Bacteria 3610
476 Ga0207686_10039215 3300025934 Bacteria 2873
477 Ga0207686_10127685 3300025934 Bacteria 1740
478 Ga0207686_10280839 3300025934 Bacteria 1229
479 Ga0207709_10201278 3300025935 Bacteria 1422
480 Ga0207709_10782571 3300025935 Bacteria 769
481 Ga0207670_10024252 3300025936 Bacteria 3789
482 Ga0207670_10046371 3300025936 Bacteria 2887
483 Ga0207670_10170044 3300025936 Bacteria 1633
484 Ga0207670_10302516 3300025936 Bacteria 1253
485 Ga0207669_10008211 3300025937 Bacteria 4891
486 Ga0207669_10021308 3300025937 Bacteria 3419
487 Ga0207669_10205796 3300025937 Bacteria 1432
488 Ga0207669_10484617 3300025937 Bacteria 986
489 Ga0207704_10009863 3300025938 Bacteria 4628
490 Ga0207704_10051648 3300025938 Bacteria 2488
491 Ga0207704_10152167 3300025938 Bacteria 1634
492 Ga0207704_10261914 3300025938 Bacteria 1304
493 Ga0207704_10755705 3300025938 Bacteria 809
494 Ga0207704_10965865 3300025938 Bacteria 719
495 Ga0207665_10267947 3300025939 Bacteria 1267
496 Ga0207691_10019770 3300025940 Bacteria 6369
497 Ga0207691_10025808 3300025940 Bacteria 5514
498 Ga0207691_10116256 3300025940 Bacteria 2374
499 Ga0207691_10202523 3300025940 Bacteria 1727
500 Ga0207691_10257073 3300025940 Bacteria 1506
501 Ga0207691_10299386 3300025940 Bacteria 1382
502 Ga0207691_10348126 3300025940 Bacteria 1268
503 Ga0207711_10012090 3300025941 Bacteria 7174
504 Ga0207711_10050449 3300025941 Bacteria 3562
505 Ga0207711_10054049 3300025941 Bacteria 3444
506 Ga0207711_10090103 3300025941 Bacteria 2696
507 Ga0207711_10091452 3300025941 Bacteria 2676
508 Ga0207711_10097278 3300025941 Bacteria 2599
509 Ga0207711_10123564 3300025941 Bacteria 2313
510 Ga0207711_10169492 3300025941 Bacteria 1980
511 Ga0207711_10343493 3300025941 Bacteria 1382
512 Ga0207711_10415425 3300025941 Bacteria 1251
513 Ga0207711_10686504 3300025941 Bacteria 955
514 Ga0207689_10034918 3300025942 Bacteria 4177
515 Ga0207689_10039600 3300025942 Bacteria 3901
516 Ga0207689_10163384 3300025942 Bacteria 1835
517 Ga0207661_10003180 3300025944 Bacteria 11387
518 Ga0207661_10214035 3300025944 Bacteria 1700
519 Ga0207661_10501614 3300025944 Bacteria 1109
520 Ga0207679_10001534 3300025945 Bacteria 14424
521 Ga0207679_10088217 3300025945 Bacteria 2391
522 Ga0207679_10114251 3300025945 Bacteria 2137
523 Ga0207679_10501870 3300025945 Bacteria 1083
524 Ga0207679_11003807 3300025945 Bacteria 765
525 Ga0207667_10354962 3300025949 Unclassified 1495
526 Ga0207667_10547581 3300025949 Bacteria 1170
527 Ga0207651_10009303 3300025960 Bacteria 5368
528 Ga0207651_10204752 3300025960 Bacteria 1584
529 Ga0207651_10229817 3300025960 Bacteria 1505
530 Ga0207651_10295544 3300025960 Bacteria 1345
531 Ga0207651_10632751 3300025960 Unclassified 938
532 Ga0207668_10043350 3300025972 Bacteria 3053
533 Ga0207668_10096842 3300025972 Bacteria 2182
534 Ga0207668_10325917 3300025972 Bacteria 1276
535 Ga0207640_10104128 3300025981 Bacteria 1997
536 Ga0207640_10346454 3300025981 Bacteria 1192
537 Ga0207658_10140778 3300025986 Bacteria 1952
538 Ga0207658_10229237 3300025986 Bacteria 1567
539 Ga0207658_10309426 3300025986 Bacteria 1364
540 Ga0207677_10149270 3300026023 Bacteria 1801
541 Ga0207703_10011640 3300026035 Bacteria 6841
542 Ga0207703_10018091 3300026035 Bacteria 5504
543 Ga0207703_10053128 3300026035 Bacteria 3293
544 Ga0207703_10062082 3300026035 Bacteria 3061
545 Ga0207703_10082112 3300026035 Bacteria 2689
546 Ga0207703_10133180 3300026035 Bacteria 2149
547 Ga0207639_10731267 3300026041 Bacteria 919
548 Ga0207678_10034334 3300026067 Bacteria 4418
549 Ga0207678_10210692 3300026067 Bacteria 1662
550 Ga0207678_10404807 3300026067 Bacteria 1182
551 Ga0207678_10411586 3300026067 Bacteria 1172
552 Ga0207708_10002632 3300026075 Bacteria 13204
553 Ga0207708_10002942 3300026075 Bacteria 12562
554 Ga0207708_10113985 3300026075 Bacteria 2101
555 Ga0207708_10195287 3300026075 Bacteria 1613
556 Ga0207708_10299576 3300026075 Bacteria 1307
557 Ga0207708_10455678 3300026075 Bacteria 1066
558 Ga0207702_10032798 3300026078 Bacteria 4334
559 Ga0207702_10462124 3300026078 Bacteria 1233
560 Ga0207641_10014455 3300026088 Bacteria 6466
561 Ga0207641_10043445 3300026088 Bacteria 3775
562 Ga0207641_10179359 3300026088 Bacteria 1939
563 Ga0207641_10349532 3300026088 Bacteria 1409
564 Ga0207648_10030023 3300026089 Bacteria 4820
565 Ga0207648_10033038 3300026089 Bacteria 4565
566 Ga0207648_10148362 3300026089 Bacteria 2069
567 Ga0207648_10151974 3300026089 Bacteria 2043
568 Ga0207648_10155081 3300026089 Bacteria 2021
569 Ga0207648_10432226 3300026089 Bacteria 1197
570 Ga0207648_10883449 3300026089 Bacteria 834
571 Ga0207676_10016740 3300026095 Bacteria 5307
572 Ga0207676_10083045 3300026095 Bacteria 2608
573 Ga0207676_10094394 3300026095 Bacteria 2465
574 Ga0207676_10228414 3300026095 Bacteria 1662
575 Ga0207674_10043147 3300026116 Bacteria 4652
576 Ga0207674_10071855 3300026116 Bacteria 3476
577 Ga0207674_10507062 3300026116 Bacteria 1166
578 Ga0207675_100002221 3300026118 Bacteria 19290
579 Ga0207675_100023585 3300026118 Bacteria 5725
580 Ga0207675_100035787 3300026118 Bacteria 4631
581 Ga0207675_100137459 3300026118 Bacteria 2320
582 Ga0207675_100174025 3300026118 Bacteria 2059
583 Ga0207675_100255685 3300026118 Bacteria 1696
584 Ga0207675_100443511 3300026118 Bacteria 1285
585 Ga0207675_100517876 3300026118 Bacteria 1189
586 Ga0207675_100678251 3300026118 Bacteria 1038
587 Ga0207675_101325515 3300026118 Bacteria 740
588 Ga0207683_10017391 3300026121 Bacteria 6128
589 Ga0207683_10020843 3300026121 Bacteria 5608
590 Ga0207683_10036707 3300026121 Bacteria 4268
591 Ga0207683_10118989 3300026121 Bacteria 2370
592 Ga0207683_10327727 3300026121 Bacteria 1403
593 Ga0207683_10509873 3300026121 Bacteria 1111
594 Ga0207683_10725488 3300026121 Bacteria 922
595 Ga0207698_10106979 3300026142 Unclassified 2334
596 Ga0207698_10544388 3300026142 Bacteria 1137
597 Ga0207698_11130681 3300026142 Unclassified 796
598 Ga0209971_1010203 3300027682 Unclassified 2224
599 Ga0209813_10001496 3300027866 Bacteria 5255
600 Ga0209813_10029512 3300027866 Bacteria 1606
601 Ga0209813_10104653 3300027866 Bacteria 967
602 Ga0207428_10001565 3300027907 Bacteria 23885
603 Ga0207428_10008715 3300027907 Bacteria 9153
604 Ga0207428_10010221 3300027907 Bacteria 8389
605 Ga0207428_10096297 3300027907 Bacteria 2292
606 Ga0207428_10194055 3300027907 Bacteria 1530
607 Ga0207428_10225295 3300027907 Bacteria 1404
608 Ga0268266_10011481 3300028379 Bacteria 7694
609 Ga0268266_10015827 3300028379 Bacteria 6458
610 Ga0268266_10237564 3300028379 Bacteria 1680
611 Ga0268266_10282942 3300028379 Bacteria 1543
612 Ga0268266_10399565 3300028379 Bacteria 1299
613 Ga0268266_10844039 3300028379 Bacteria 885
614 Ga0268265_10004027 3300028380 Bacteria 10350
615 Ga0268265_10130186 3300028380 Bacteria 2089
616 Ga0268265_10228513 3300028380 Bacteria 1633
617 Ga0268265_10268157 3300028380 Bacteria 1521
618 Ga0268265_10639768 3300028380 Bacteria 1021
619 Ga0268265_10733080 3300028380 Bacteria 958
620 Ga0268264_10062945 3300028381 Bacteria 3117
621 Ga0268264_10097489 3300028381 Bacteria 2548
622 Ga0265328_10000696 3300031239 Bacteria 15563
623 Ga0265328_10003652 3300031239 Bacteria 6779
624 Ga0265331_10000144 3300031250 Bacteria 92791
625 Ga0265331_10007210 3300031250 Bacteria 6457
626 Ga0265327_10000314 3300031251 Bacteria 92783
627 Ga0265327_10005872 3300031251 Bacteria 10033
628 Ga0307408_100032108 3300031548 Bacteria 3660
629 Ga0307408_100121472 3300031548 Unclassified 2024
630 Ga0307408_100285089 3300031548 Bacteria 1377
631 Ga0307408_100428797 3300031548 Bacteria 1142
632 Ga0307408_100456111 3300031548 Bacteria 1110
633 Ga0307408_100581505 3300031548 Bacteria 992
634 Ga0307408_100659406 3300031548 Bacteria 936
635 Ga0265314_10066943 3300031711 Bacteria 2421
636 Ga0265314_10096482 3300031711 Bacteria 1912
637 Ga0307405_10030931 3300031731 Bacteria 3145
638 Ga0307405_10173845 3300031731 Unclassified 1539
639 Ga0307413_10132702 3300031824 Unclassified 1707
640 Ga0307413_10459677 3300031824 Bacteria 1012
641 Ga0307410_10068698 3300031852 Bacteria 2448
642 Ga0307406_10009340 3300031901 Bacteria 5497
643 Ga0307406_10088899 3300031901 Bacteria 2074
644 Ga0307406_10300937 3300031901 Bacteria 1232
645 Ga0307406_10905287 3300031901 Bacteria 751
646 Ga0307407_10079080 3300031903 Unclassified 1983
647 Ga0307412_10040938 3300031911 Bacteria 3000
648 Ga0307412_10221562 3300031911 Bacteria 1450
649 Ga0307412_10277613 3300031911 Bacteria 1314
650 Ga0307412_10404584 3300031911 Bacteria 1112
651 Ga0307409_100070830 3300031995 Unclassified 2769
652 Ga0307416_100009707 3300032002 Bacteria 6319
653 Ga0307416_100039356 3300032002 Bacteria 3659
654 Ga0307416_100081280 3300032002 Unclassified 2739
655 Ga0307416_100413447 3300032002 Bacteria 1390
656 Ga0307416_100495496 3300032002 Bacteria 1285
657 Ga0307416_101345537 3300032002 Bacteria 820
658 Ga0307414_10018051 3300032004 Bacteria 4332
659 Ga0307414_10140669 3300032004 Bacteria 1889
660 Ga0307411_10067842 3300032005 Unclassified 2402
661 Ga0307411_10116426 3300032005 Bacteria 1924
662 Ga0307411_10224396 3300032005 Bacteria 1460
663 Ga0307411_11095202 3300032005 Bacteria 718
664 Ga0307415_100165847 3300032126 Unclassified 1717
665 Ga0307415_100500020 3300032126 Bacteria 1063
666 Ga0307415_100501877 3300032126 Bacteria 1061
667 Ga0316583_10103756 3300032133 Bacteria 991
668 Ga0373930_0006718 3300034816 Bacteria 1956
669 Ga0373948_0001093 3300034817 Bacteria 3666
670 Ga0373959_0005393 3300034820 Bacteria 2095
671 Ga0373926_0154492 3300035083 Bacteria 874
672 Ga0373928_0005185 3300035084 Bacteria 2486
673 Ga0373929_0000765 3300035085 Bacteria 6259
674 Ga0373934_0006394 3300035086 Bacteria 4371
675 Ga0373934_0031692 3300035086 Unclassified 2071
676 Ga0373949_0005372 3300035090 Bacteria 2859
677 Ga0373951_0000250 3300035091 Bacteria 17855
678 Ga0373952_0000930 3300035092 Bacteria 5320
679 Ga0373923_0165049 3300035111 Bacteria 1012
680 Ga0373932_0001640 3300035112 Bacteria 6136
681 Ga0373936_0009425 3300035113 Unclassified 3681
682 Ga0373939_0000330 3300035114 Bacteria 12172
683 Ga0373939_0084749 3300035114 Bacteria 1060
684 Ga0373941_0004661 3300035115 Bacteria 3180
685 Ga0373953_0032696 3300035117 Bacteria 2031
686 Ga0373954_0114015 3300035118 Bacteria 1309
687 Ga0373956_0038711 3300035119 Bacteria 2110
688 Ga0373956_0089809 3300035119 Bacteria 1417
689 Ga0373960_0000553 3300035121 Bacteria 7559
690 Ga0373960_0031229 3300035121 Bacteria 1489
691 Ga0373943_0030790 3300035170 Unclassified 2542
692 Ga0373943_0063154 3300035170 Bacteria 1856
693 Ga0373943_0390142 3300035170 Bacteria 803
694 Ga0373943_0433428 3300035170 Bacteria 762
695 Ga0373946_0002282 3300035171 Bacteria 6778
696 Ga0373946_0162450 3300035171 Bacteria 1050
697 Ga0373955_0007237 3300035172 Bacteria 5092
698 Ga0373955_0039805 3300035172 Unclassified 2511
699 Ga0373955_0199294 3300035172 Bacteria 1192
700 Ga0373942_0000461 3300035207 Bacteria 11493
701 Ga0373961_0002363 3300035241 Bacteria 4923
702 Ga0373961_0011802 3300035241 Bacteria 2175
703 Ga0373962_0002576 3300035242 Bacteria 4306
704 Ga0373924_0004143 3300035410 Bacteria 5043
705 Ga0373931_0029932 3300035691 Bacteria 2799
706 Ga0373935_0243488 3300035692 Unclassified 1256
707 Ga0373935_0277215 3300035692 Bacteria 1180
708 Ga0373935_0545570 3300035692 Bacteria 845
709 Ga0373927_0179417 3300035695 Unclassified 1389
710 Ga0373933_0072767 3300035724 Bacteria 2093
711 Ga0373947_0014749 3300035725 Bacteria 4483
712 Ga0373947_0050681 3300035725 Unclassified 2496
713 Ga0373947_0194115 3300035725 Bacteria 1326
714 Ga0373947_0359219 3300035725 Bacteria 978
715 Ga0373937_0000607 3300036401 Bacteria 31660
716 Ga0373937_0039178 3300036401 Bacteria 4319
717 Ga0373937_0233844 3300036401 Bacteria 1731
718 Ga0373937_0253125 3300036401 Bacteria 1660
719 Ga0373925_0029867 3300037068 Unclassified 3999
720 Ga0373925_0113036 3300037068 Bacteria 2100
721 Ga0373925_0545154 3300037068 Bacteria 954
722 Ga0373925_0655177 3300037068 Bacteria 865
723 Ga0395905_0268804 3300037471 Bacteria 1591
724 Ga0436365_0463108 3300039437 Bacteria 886
725 Ga0439453_0013083 3300041408 Bacteria 1407
726 Ga0451855_0486301 3300041511 Bacteria 757
727 Ga0451853_2605379 3300041512 Bacteria 908
728 Ga0451853_3688615 3300041512 Bacteria 1256
729 Ga0439433_0040803 3300041999 Bacteria 1080
730 Ga0439445_0138463 3300042004 Bacteria 705
731 Ga0439456_052339 3300042013 Bacteria 893
732 Ga0439446_0021300 3300042156 Bacteria 1832
733 Ga0450908_001093 3300042184 Bacteria 5266
734 Ga0439464_0002574 3300042439 Bacteria 4482
735 Ga0439464_0038338 3300042439 Bacteria 1361
736 Ga0439460_0021216 3300042461 Bacteria 1773
737 Ga0451577_0001754 3300042876 Bacteria 27939
738 Ga0451577_0089925 3300042876 Bacteria 2740
739 Ga0451577_0090164 3300042876 Bacteria 2736
740 Ga0453683_0000299 3300044673 Bacteria 63066
741 Ga0453683_0009456 3300044673 Bacteria 6505
742 Ga0453684_0000776 3300044712 Bacteria 110037
743 Ga0453684_0377821 3300044712 Bacteria 1592
744 Ga0453684_0509563 3300044712 Bacteria 1331
745 Ga0451576_0012498 3300045051 Bacteria 9533
746 Ga0451576_0137329 3300045051 Bacteria 2550
747 Ga0451576_0166688 3300045051 Bacteria 2299
748 Ga0451576_0209401 3300045051 Bacteria 2036
749 Ga0451576_0244641 3300045051 Bacteria 1874
750 Ga0451576_0307726 3300045051 Bacteria 1658
751 Ga0451576_0611125 3300045051 Bacteria 1146
752 Ga0451576_1416646 3300045051 Bacteria 723
753 Ga0495592_0053608 3300046454 Bacteria 2991
754 Ga0495592_0244964 3300046454 Bacteria 1188
755 Ga0495603_0067575 3300046455 Bacteria 2104
756 Ga0495629_0150781 3300046459 Bacteria 1616
757 Ga0495629_0179752 3300046459 Bacteria 1466
758 Ga0495638_0009000 3300046460 Bacteria 7038
759 Ga0495638_0236921 3300046460 Bacteria 1012
760 Ga0495580_0369647 3300046472 Bacteria 970
761 Ga0495580_0468233 3300046472 Bacteria 844
762 Ga0495639_0079094 3300046475 Bacteria 1529
763 Ga0495594_0142804 3300046499 Bacteria 1358
764 Ga0495628_0234384 3300046516 Unclassified 1375
765 Ga0495652_0324201 3300046529 Bacteria 1112
766 Ga0495640_0170943 3300046533 Bacteria 1389
767 Ga0495640_0528569 3300046533 Bacteria 716
768 Ga0495586_0073553 3300046535 Bacteria 1870
769 Ga0495586_0139534 3300046535 Bacteria 1360
770 Ga0495587_0036067 3300046536 Bacteria 2976
771 Ga0495645_0014263 3300046543 Bacteria 5635
772 Ga0495645_0245238 3300046543 Unclassified 1193
773 Ga0495667_0080232 3300046559 Bacteria 2121
774 Ga0495656_0130332 3300046615 Bacteria 1196
775 Ga0495634_0038277 3300046642 Unclassified 3271
776 Ga0495634_0397200 3300046642 Bacteria 819
777 Ga0495657_0296012 3300046675 Bacteria 966
778 Ga0495599_0175790 3300046678 Bacteria 1320
779 Ga0495647_0014335 3300046681 Bacteria 2761
780 Ga0495658_0215221 3300046683 Bacteria 1201
781 Ga0495658_0245162 3300046683 Bacteria 1126
782 Ga0495613_0005107 3300046689 Bacteria 9843
783 Ga0495613_0039963 3300046689 Bacteria 3476
784 Ga0495613_0453480 3300046689 Bacteria 869
785 Ga0495670_0215095 3300046691 Bacteria 1020
786 Ga0495581_0338990 3300047315 Bacteria 878
787 Ga0495604_0068602 3300047317 Bacteria 2691
788 Ga0495674_0022038 3300047319 Bacteria 5879
789 Ga0495674_0356334 3300047319 Bacteria 1187
790 Ga0495674_0469254 3300047319 Unclassified 1010
791 Ga0495672_0056825 3300047320 Bacteria 2275
792 Ga0495680_0219512 3300047322 Bacteria 1358
793 Ga0495680_0220530 3300047322 Bacteria 1354
794 Ga0495684_0001265 3300047471 Bacteria 20345
795 Ga0495684_0162463 3300047471 Bacteria 1665
796 Ga0496100_0013954 3300048903 Bacteria 4651
797 Ga0496101_0000804 3300048904 Bacteria 18549
798 Ga0496102_0021352 3300048905 Bacteria 5726
799 Ga0496102_0476476 3300048905 Bacteria 1169
800 Ga0496102_0588263 3300048905 Unclassified 1036
801 Ga0496103_0181280 3300048906 Bacteria 1354
802 Ga0496104_0003935 3300048907 Bacteria 12850
803 Ga0496104_0019706 3300048907 Bacteria 6176
804 Ga0496104_0048944 3300048907 Bacteria 3986
805 Ga0496104_0769379 3300048907 Bacteria 869
806 Ga0496104_0933613 3300048907 Bacteria 772
807 Ga0496105_0078946 3300048908 Bacteria 2718
808 Ga0496105_0249331 3300048908 Bacteria 1439
809 Ga0496105_0625934 3300048908 Bacteria 833
810 Ga0496105_0711254 3300048908 Bacteria 770
811 Ga0496106_0096782 3300048909 Bacteria 2285
812 Ga0496106_0140118 3300048909 Bacteria 1902
813 Ga0496106_0279814 3300048909 Bacteria 1337
814 Ga0496106_0383759 3300048909 Bacteria 1129
815 Ga0496106_0396600 3300048909 Bacteria 1109
816 Ga0496106_0592258 3300048909 Bacteria 888
817 Ga0496107_0049721 3300048910 Bacteria 3022
818 Ga0496107_0233052 3300048910 Bacteria 1370
819 Ga0496108_0001909 3300048911 Bacteria 16668
820 Ga0496108_0079658 3300048911 Bacteria 2774
821 Ga0496108_0381263 3300048911 Bacteria 1231
822 Ga0496108_0469836 3300048911 Bacteria 1099
823 Ga0496108_0856312 3300048911 Bacteria 782
824 Ga0496109_0008025 3300048912 Bacteria 8949
825 Ga0496109_0082810 3300048912 Bacteria 2958
826 Ga0496109_0170117 3300048912 Bacteria 2044
827 Ga0496109_0241847 3300048912 Bacteria 1699
828 Ga0496109_0879431 3300048912 Bacteria 834
829 Ga0496110_0032847 3300048913 Bacteria 4486
830 Ga0496110_0081328 3300048913 Bacteria 2888
831 Ga0496110_0198044 3300048913 Bacteria 1825
832 Ga0496111_0057673 3300048914 Bacteria 2811
833 Ga0496112_0001309 3300048915 Bacteria 18920
834 Ga0496112_0051591 3300048915 Bacteria 4035
835 Ga0496112_0076181 3300048915 Bacteria 3318
836 Ga0496112_0183842 3300048915 Bacteria 2054
837 Ga0496112_0540286 3300048915 Bacteria 1100
838 Ga0496112_0679259 3300048915 Bacteria 958
839 Ga0496113_0376882 3300048916 Bacteria 1139
840 Ga0496114_0001096 3300048917 Bacteria 20425
841 Ga0496114_0107825 3300048917 Bacteria 2384
842 Ga0496114_0179102 3300048917 Bacteria 1850
843 Ga0496114_0520454 3300048917 Bacteria 1052
844 Ga0496114_0958185 3300048917 Bacteria 738
845 Ga0496115_0050956 3300048918 Bacteria 3319
846 Ga0496115_0235913 3300048918 Bacteria 1508
847 Ga0501031_0014712 3300049568 Bacteria 5085
848 Ga0501031_0140287 3300049568 Bacteria 1579
849 Ga0501031_0621869 3300049568 Bacteria 694
850 Ga0501032_0027161 3300049569 Bacteria 3934
851 Ga0501032_0076932 3300049569 Bacteria 2221
852 Ga0501032_0082807 3300049569 Bacteria 2134
853 Ga0501033_0004346 3300049570 Bacteria 11364
854 Ga0501033_0065995 3300049570 Bacteria 2661
855 Ga0501033_0165022 3300049570 Bacteria 1592
856 Ga0501034_0015356 3300049571 Bacteria 7870
857 Ga0501034_0015564 3300049571 Bacteria 7812
858 Ga0501034_0079966 3300049571 Bacteria 3272
859 Ga0501034_0281363 3300049571 Bacteria 1603
860 Ga0501036_0003637 3300049572 Bacteria 12326
861 Ga0501036_0007369 3300049572 Bacteria 8963
862 Ga0501036_0281489 3300049572 Bacteria 1392
863 Ga0501037_0004816 3300049573 Bacteria 9813
864 Ga0501037_0018423 3300049573 Bacteria 5146
865 Ga0501037_0041311 3300049573 Bacteria 3391
866 Ga0501038_0067189 3300049574 Bacteria 3050
867 Ga0501038_0292560 3300049574 Bacteria 1279
868 Ga0501039_0035069 3300049575 Bacteria 3872
869 Ga0501039_0072126 3300049575 Bacteria 2684
870 Ga0501039_0387770 3300049575 Bacteria 1097
871 Ga0501040_0034280 3300049576 Bacteria 3440
872 Ga0501040_0034330 3300049576 Bacteria 3437
873 Ga0501040_0049058 3300049576 Bacteria 2886
874 Ga0501040_0064031 3300049576 Bacteria 2531
875 Ga0501040_0110524 3300049576 Bacteria 1922
876 Ga0501040_0124693 3300049576 Bacteria 1809
877 Ga0501041_0104556 3300049577 Bacteria 1754
878 Ga0501041_0412452 3300049577 Bacteria 856
879 Ga0501042_0015775 3300049578 Bacteria 5176
880 Ga0501042_0137368 3300049578 Bacteria 1762
881 Ga0501042_0184888 3300049578 Bacteria 1503
882 Ga0501042_0558657 3300049578 Bacteria 832
883 Ga0501043_0003042 3300049579 Bacteria 13932
884 Ga0501043_0101728 3300049579 Bacteria 2258
885 Ga0501043_0166612 3300049579 Bacteria 1720
886 Ga0501043_0265550 3300049579 Bacteria 1319
887 Ga0501046_0037427 3300049580 Bacteria 3898
888 Ga0501046_0133261 3300049580 Bacteria 1883
889 Ga0501046_0242987 3300049580 Bacteria 1327
890 Ga0501047_0074802 3300049581 Bacteria 3260
891 Ga0501047_0153812 3300049581 Bacteria 2174
892 Ga0501047_0394301 3300049581 Bacteria 1217
893 Ga0501048_0000844 3300049582 Bacteria 22558
894 Ga0501048_0002446 3300049582 Bacteria 14175
895 Ga0501048_0018383 3300049582 Bacteria 5141
896 Ga0501048_0110496 3300049582 Bacteria 1941
897 Ga0501048_0214985 3300049582 Unclassified 1363
898 Ga0501048_0364367 3300049582 Bacteria 1031
899 Ga0501048_0426929 3300049582 Bacteria 948
900 Ga0501048_0546183 3300049582 Bacteria 831
901 Ga0501067_0003828 3300049583 Bacteria 8303
902 Ga0501067_0156289 3300049583 Bacteria 1270
903 Ga0501067_0192887 3300049583 Bacteria 1135
904 Ga0501068_0003872 3300049584 Bacteria 8123
905 Ga0501068_0008404 3300049584 Bacteria 5743
906 Ga0501068_0034972 3300049584 Bacteria 2998
907 Ga0501068_0157572 3300049584 Bacteria 1430
908 Ga0501069_0011000 3300049585 Bacteria 4799
909 Ga0501069_0032137 3300049585 Bacteria 2888
910 Ga0501069_0108059 3300049585 Bacteria 1583
911 Ga0501069_0641125 3300049585 Bacteria 639
912 Ga0501070_0044660 3300049586 Bacteria 3685
913 Ga0501070_0186386 3300049586 Unclassified 1707
914 Ga0501070_0334430 3300049586 Bacteria 1230
915 Ga0501071_0005749 3300049587 Bacteria 8001
916 Ga0501071_0005906 3300049587 Bacteria 7919
917 Ga0501071_0005952 3300049587 Bacteria 7893
918 Ga0501071_0011655 3300049587 Bacteria 5934
919 Ga0501071_0073661 3300049587 Bacteria 2491
920 Ga0501071_0098417 3300049587 Bacteria 2155
921 Ga0501071_0522262 3300049587 Bacteria 911
922 Ga0501072_0014268 3300049588 Bacteria 6088
923 Ga0501072_0025306 3300049588 Bacteria 4623
924 Ga0501072_0085099 3300049588 Bacteria 2508
925 Ga0501072_0536092 3300049588 Bacteria 925
926 Ga0501073_0081132 3300049589 Bacteria 2256
927 Ga0501073_0193426 3300049589 Bacteria 1407
928 Ga0501073_0238648 3300049589 Bacteria 1255
929 Ga0501074_0001906 3300049590 Bacteria 14324
930 Ga0501074_0006382 3300049590 Bacteria 8514
931 Ga0501074_0161785 3300049590 Bacteria 1599
932 Ga0501074_0462193 3300049590 Bacteria 899
933 Ga0501075_0136713 3300049591 Bacteria 1867
934 Ga0501075_0152469 3300049591 Bacteria 1761
935 Ga0501075_0240452 3300049591 Bacteria 1380
936 Ga0501075_0254547 3300049591 Bacteria 1338
937 Ga0501075_0406995 3300049591 Bacteria 1037
938 Ga0501075_0754150 3300049591 Bacteria 741
939 Ga0501076_0004336 3300049592 Bacteria 10068
940 Ga0501076_0020226 3300049592 Bacteria 5094
941 Ga0501076_0027950 3300049592 Bacteria 4376
942 Ga0501076_0054441 3300049592 Bacteria 3171
943 Ga0501076_0057677 3300049592 Bacteria 3084
944 Ga0501076_0101278 3300049592 Bacteria 2322
945 Ga0501076_0160534 3300049592 Bacteria 1831
946 Ga0501076_0174590 3300049592 Unclassified 1751
947 Ga0501076_0193335 3300049592 Bacteria 1661
948 Ga0501076_0588389 3300049592 Bacteria 918
949 Ga0501077_0052680 3300049593 Unclassified 2584
950 Ga0501077_0073812 3300049593 Bacteria 2161
951 Ga0501077_0098642 3300049593 Bacteria 1852
952 Ga0501077_0283479 3300049593 Bacteria 1055
953 Ga0501235_120465 3300049669 Bacteria 656
954 Ga0501259_088890 3300049688 Bacteria 691
955 Ga0501221_095366 3300049704 Bacteria 732
956 Ga0501079_0005421 3300049741 Bacteria 9503
957 Ga0501079_0009775 3300049741 Bacteria 7272
958 Ga0501079_0083118 3300049741 Bacteria 2477
959 Ga0501079_0163753 3300049741 Unclassified 1734
960 Ga0501079_0171009 3300049741 Bacteria 1694
961 Ga0501079_0611969 3300049741 Bacteria 857
962 Ga0501079_0816365 3300049741 Bacteria 734
963 Ga0501080_0029992 3300049742 Bacteria 5064
964 Ga0501080_0105511 3300049742 Bacteria 2612
965 Ga0501080_0181276 3300049742 Bacteria 1938
966 Ga0501080_0196059 3300049742 Bacteria 1855
967 Ga0501080_0197171 3300049742 Bacteria 1849
968 Ga0501080_0278948 3300049742 Bacteria 1520
969 Ga0501080_0403495 3300049742 Bacteria 1229
970 Ga0501080_0564087 3300049742 Bacteria 1013
971 Ga0501080_0690721 3300049742 Bacteria 901
972 Ga0501080_1151173 3300049742 Bacteria 668
973 Ga0501081_0026605 3300049743 Bacteria 3902
974 Ga0501081_0044823 3300049743 Bacteria 3037
975 Ga0501081_0195436 3300049743 Bacteria 1466
976 Ga0501081_0531002 3300049743 Bacteria 878
977 Ga0501083_0008276 3300049744 Bacteria 7353
978 Ga0501083_0382778 3300049744 Bacteria 915
979 Ga0501278_008693 3300049774 Bacteria 787
980 Ga0501035_0014330 3300049822 Bacteria 7318
981 Ga0501035_0150802 3300049822 Bacteria 2017
982 Ga0501044_0014883 3300049823 Bacteria 8386
983 Ga0501044_0015396 3300049823 Bacteria 8237
984 Ga0501045_0006810 3300049824 Bacteria 7918
985 Ga0501045_0026034 3300049824 Bacteria 4205
986 Ga0501045_0037893 3300049824 Bacteria 3506
987 Ga0501045_0490316 3300049824 Bacteria 913
988 Ga0501045_0617912 3300049824 Bacteria 802
989 nmdc:mga03683_66305_c1 3300050489 Bacteria 1017
990 nmdc:mga03n38_27472_c1 3300050490 Bacteria 2361
991 nmdc:mga00v17_188326_c1 3300050491 Bacteria 1332
992 nmdc:mga00v17_364264_c1 3300050491 Bacteria 940
993 nmdc:mga00v17_3665_c1 3300050491 Bacteria 7936
994 nmdc:mga00v17_44919_c1 3300050491 Bacteria 2667
995 nmdc:mga00v17_67001_c1 3300050491 Bacteria 2218
996 nmdc:mga0yw44_10417_c1 3300050492 Bacteria 4749
997 nmdc:mga0yw44_331252_c1 3300050492 Bacteria 1023
998 nmdc:mga0yw44_60560_c1 3300050492 Bacteria 2319
999 nmdc:mga0k408_28230_c2 3300050493 Bacteria 2984
1000 nmdc:mga0k408_4972_c1 3300050493 Bacteria 7044
1001 nmdc:mga0k408_57883_c1 3300050493 Bacteria 2251
1002 nmdc:mga0k408_86235_c1 3300050493 Bacteria 1843
1003 nmdc:mga06z11_31504_c1 3300050494 Bacteria 2577
1004 nmdc:mga06z11_33719_c1 3300050494 Unclassified 2507
1005 nmdc:mga06z11_36568_c1 3300050494 Bacteria 2425
1006 nmdc:mga06z11_7137_c1 3300050494 Bacteria 3776
1007 nmdc:mga04h51_28911_c1 3300050495 Bacteria 1732
1008 nmdc:mga04h51_29719_c1 3300050495 Bacteria 1714
1009 nmdc:mga04h51_4035_c1 3300050495 Bacteria 3619
1010 nmdc:mga04h51_46066_c1 3300050495 Bacteria 1444
1011 nmdc:mga07m45_37262_c1 3300050496 Bacteria 2712
1012 nmdc:mga05p37_1017962_c1 3300050507 Bacteria 878
1013 nmdc:mga05p37_15661_c1 3300050507 Bacteria 9114
1014 nmdc:mga05p37_2308_c1 3300050507 Bacteria 22237
1015 nmdc:mga05p37_28047_c1 3300050507 Bacteria 6861
1016 nmdc:mga05p37_322065_c1 3300050507 Bacteria 1829
1017 nmdc:mga05p37_3422_c1 3300050507 Bacteria 18519
1018 nmdc:mga05p37_454532_c1 3300050507 Bacteria 1481
1019 nmdc:mga05p37_48559_c1 3300050507 Bacteria 5219
1020 nmdc:mga05p37_495_c1 3300050507 Bacteria 43222
1021 nmdc:mga05p37_5252_c1 3300050507 Bacteria 15201
1022 nmdc:mga05p37_61122_c1 3300050507 Bacteria 4638
1023 nmdc:mga05p37_6503_c2 3300050507 Bacteria 11287
1024 nmdc:mga05p37_899411_c1 3300050507 Bacteria 955
1025 nmdc:mga05p37_961_c1 3300050507 Bacteria 32612
1026 nmdc:mga09592_131487_c1 3300050508 Bacteria 2153
1027 nmdc:mga09592_2031_c1 3300050508 Bacteria 16324
1028 nmdc:mga09592_99095_c1 3300050508 Bacteria 2495
1029 nmdc:mga0qj67_159597_c1 3300050509 Bacteria 1830
1030 nmdc:mga0qj67_2135_c1 3300050509 Bacteria 14068
1031 nmdc:mga0qj67_234355_c1 3300050509 Bacteria 1489
1032 nmdc:mga0qj67_297361_c1 3300050509 Bacteria 1308
1033 nmdc:mga0qj67_65383_c1 3300050509 Bacteria 2895
1034 nmdc:mga06r32_163680_c1 3300050510 Bacteria 2207
1035 nmdc:mga06r32_16856_c1 3300050510 Bacteria 6663
1036 nmdc:mga06r32_271365_c1 3300050510 Bacteria 1684
1037 nmdc:mga06r32_344720_c1 3300050510 Bacteria 1474
1038 nmdc:mga06r32_371308_c1 3300050510 Bacteria 1414
1039 nmdc:mga06r32_503015_c1 3300050510 Bacteria 1189
1040 nmdc:mga06r32_9229_c1 3300050510 Bacteria 8892
1041 nmdc:mga08y16_11518_c1 3300050511 Bacteria 9292
1042 nmdc:mga08y16_170329_c1 3300050511 Bacteria 2262
1043 nmdc:mga08y16_323343_c1 3300050511 Bacteria 1588
1044 nmdc:mga08y16_32515_c1 3300050511 Bacteria 5483
1045 nmdc:mga08y16_512334_c1 3300050511 Bacteria 1218
1046 nmdc:mga08y16_632_c1 3300050511 Bacteria 33000
1047 nmdc:mga08y16_7439_c1 3300050511 Bacteria 11469
1048 nmdc:mga08y16_9169_c1 3300050511 Bacteria 10387
1049 nmdc:mga0n895_10454_c1 3300050512 Bacteria 8201
1050 nmdc:mga0n895_173_c1 3300050512 Bacteria 39986
1051 nmdc:mga0n895_319314_c1 3300050512 Unclassified 1574
1052 nmdc:mga0n895_35741_c1 3300050512 Bacteria 4792
1053 nmdc:mga0n895_360095_c1 3300050512 Bacteria 1473
1054 nmdc:mga0n895_421259_c1 3300050512 Bacteria 1349
1055 nmdc:mga0n895_498164_c1 3300050512 Bacteria 1227
1056 nmdc:mga0n895_503093_c1 3300050512 Bacteria 1220
1057 nmdc:mga0n895_5460_c1 3300050512 Bacteria 10633
1058 nmdc:mga0n895_63628_c1 3300050512 Bacteria 3647
1059 nmdc:mga0rr50_1088_c1 3300050513 Bacteria 14763
1060 nmdc:mga0rr50_149140_c1 3300050513 Bacteria 1888
1061 nmdc:mga0rr50_15225_c1 3300050513 Bacteria 5072
1062 nmdc:mga0rr50_16018_c1 3300050513 Bacteria 4965
1063 nmdc:mga0rr50_254783_c1 3300050513 Bacteria 1458
1064 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
1065 nmdc:mga0rr50_669765_c1 3300050513 Bacteria 885
1066 nmdc:mga0rr50_936844_c1 3300050513 Bacteria 738
1067 nmdc:mga08x19_124252_c1 3300050514 Bacteria 1732
1068 nmdc:mga08x19_16760_c1 3300050514 Bacteria 4474
1069 nmdc:mga08x19_206531_c1 3300050514 Bacteria 1347
1070 nmdc:mga08x19_452_c1 3300050514 Bacteria 27982
1071 nmdc:mga0a205_191513_c1 3300050515 Bacteria 1937
1072 nmdc:mga0a205_195000_c1 3300050515 Bacteria 1916
1073 nmdc:mga0a205_204918_c1 3300050515 Unclassified 1862
1074 nmdc:mga0a205_205321_c1 3300050515 Bacteria 1860
1075 nmdc:mga0a205_242877_c1 3300050515 Bacteria 1681
1076 nmdc:mga0a205_340991_c1 3300050515 Bacteria 1367
1077 nmdc:mga0a205_607807_c1 3300050515 Bacteria 946
1078 nmdc:mga0a205_67600_c1 3300050515 Bacteria 3452
1079 nmdc:mga0a205_68431_c2 3300050515 Bacteria 2505
1080 Ga0495601_0005785 3300053077 Bacteria 7211
1081 Ga0495601_0068397 3300053077 Bacteria 2264
1082 Ga0495601_0292208 3300053077 Bacteria 1062
1083 Ga0495601_0437199 3300053077 Bacteria 847
1084 Ga0495595_0064560 3300053084 Bacteria 1721
1085 Ga0495595_0094457 3300053084 Bacteria 1438
1086 Ga0495619_0001690 3300053085 Bacteria 14594
1087 Ga0495619_0019556 3300053085 Unclassified 4307
1088 Ga0495619_0025709 3300053085 Bacteria 3783
1089 Ga0495619_0055391 3300053085 Bacteria 2626
1090 Ga0495619_0117732 3300053085 Bacteria 1820
1091 Ga0495619_0633412 3300053085 Bacteria 730
1092 Ga0500555_000789 3300053103 Bacteria 11496
1093 Ga0500658_0205735 3300053134 Bacteria 901
1094 Ga0500568_0003557 3300053139 Bacteria 8617
1095 Ga0500616_0000358 3300053153 Bacteria 64893
1096 Ga0500611_002098 3300053727 Bacteria 2329
1097 Ga0500645_000794 3300053730 Bacteria 18915
1098 Ga0500599_015796 3300053736 Bacteria 1038
1099 Ga0501084_0029152 3300054114 Bacteria 4616
1100 Ga0501084_0039490 3300054114 Bacteria 3948
1101 Ga0501084_0040126 3300054114 Bacteria 3915
1102 Ga0501084_0075103 3300054114 Bacteria 2832
1103 Ga0501084_0118672 3300054114 Bacteria 2224
1104 Ga0501084_0617211 3300054114 Bacteria 916
1105 Ga0501084_0968599 3300054114 Bacteria 715
1106 Ga0590071_000433 3300059421 Bacteria 12153
1107 Ga0590071_069306 3300059421 Bacteria 868
1108 Ga0590074_005771 3300059423 Bacteria 2054
1109 Ga0590075_009402 3300059424 Unclassified 2341
1110 Ga0590077_009724 3300059426 Bacteria 1976
1111 Ga0501082_0028616 3300060353 Bacteria 4800
1112 Ga0501082_0118209 3300060353 Bacteria 2296
1113 Ga0501082_0188690 3300060353 Bacteria 1793
1114 Ga0501082_0310021 3300060353 Bacteria 1374
1115 Ga0501082_0476324 3300060353 Bacteria 1091
1116 Ga0501082_0481311 3300060353 Bacteria 1085
1117 Ga0501082_0537225 3300060353 Bacteria 1022
1118 Ga0501082_0677936 3300060353 Bacteria 902
1119 Ga0530510_0036790 3300061734 Bacteria 3527
1120 Ga0530510_0224940 3300061734 Unclassified 1395
1121 2964377183 2964375228 Bacteria 4909004
1122 Ga0075368_10055466
1123 MBSR1b_contig_3797481
1124 Ga0065712_10099069
1125 Ga0065712_10102744
1126 Ga0065712_10114854
1127 Ga0065712_10146743
1128 Ga0065715_10023619
1129 Ga0065715_10031263
1130 Ga0065715_10172453
1131 Ga0065715_10272354
1132 Ga0065707_10146029
1133 Ga0065707_10229141
1134 Ga0070683_100009233
1135 Ga0070683_100046792
1136 Ga0070690_100092412
1137 Ga0070690_100165903
1138 Ga0070690_100402526
1139 Ga0070670_100015094
1140 Ga0070670_100093231
1141 Ga0070670_100112701
1142 Ga0070677_10036427
1143 Ga0068869_100023698
1144 Ga0068869_100497278
1145 Ga0070666_10008944
1146 Ga0070666_10045661
1147 Ga0070666_10071958
1148 Ga0070666_10093189
1149 Ga0070666_10323810
1150 Ga0070680_100227523
1151 Ga0070680_100590472
1152 Ga0070682_100713779
1153 Ga0068868_100015569
1154 Ga0068868_100054258
1155 Ga0068868_100554813
1156 Ga0070660_100155845
1157 Ga0070660_100504376
1158 Ga0070689_100021551
1159 Ga0070689_100050114
1160 Ga0070689_100584597
1161 Ga0070689_101070458
1162 Ga0070691_10000205
1163 Ga0070661_100019334
1164 Ga0070661_100165004
1165 Ga0070668_100112954
1166 Ga0070668_100133128
1167 Ga0070669_100006383
1168 Ga0070669_100013978
1169 Ga0070669_100037570
1170 Ga0070669_100539382
1171 Ga0070675_100000079
1172 Ga0070675_100158316
1173 Ga0070675_100179936
1174 Ga0070675_100184127
1175 Ga0070675_100205354
1176 Ga0070675_100315336
1177 Ga0070675_100345748
1178 Ga0070675_100592536
1179 Ga0070671_100048761
1180 Ga0070671_100143579
1181 Ga0070671_100483684
1182 Ga0070674_100008928
1183 Ga0070674_100103803
1184 Ga0070674_100830675
1185 Ga0070673_100103247
1186 Ga0070673_100492362
1187 Ga0070673_100500237
1188 Ga0070673_100678275
1189 Ga0070688_100020475
1190 Ga0070688_100038750
1191 Ga0070688_100087852
1192 Ga0070667_100058754
1193 Ga0070667_100338142
1194 Ga0070667_100388443
1195 Ga0070667_101251262
1196 Ga0070709_10624846
1197 Ga0070701_10003547
1198 Ga0070701_10079270
1199 Ga0070711_100061174
1200 Ga0070711_100257661
1201 Ga0070711_100619374
1202 Ga0070705_100238006
1203 Ga0070700_100017254
1204 Ga0070700_100037897
1205 Ga0070700_100251824
1206 Ga0070700_100330767
1207 Ga0070700_100332472
1208 Ga0070700_100383669
1209 Ga0070694_100010273
1210 Ga0070694_100921257
1211 Ga0070708_100608923
1212 Ga0070663_100011303
1213 Ga0070678_100101160
1214 Ga0070678_100166799
1215 Ga0070678_100962894
1216 Ga0070662_100114150
1217 Ga0070662_100836798
1218 Ga0070681_10369348
1219 Ga0070681_10425995
1220 Ga0068867_100016355
1221 Ga0068867_100081154
1222 Ga0068867_100451391
1223 Ga0068867_101094377
1224 Ga0070685_10616322
1225 Ga0070707_100428016
1226 Ga0070698_100956597
1227 Ga0070699_100130944
1228 Ga0070699_100443840
1229 Ga0070679_100024711
1230 Ga0070679_100385541
1231 Ga0070684_100003202
1232 Ga0070684_100020841
1233 Ga0070684_100246677
1234 Ga0070684_100371343
1235 Ga0070684_100988037
1236 Ga0068853_100983945
1237 Ga0070672_100017844
1238 Ga0070672_100072251
1239 Ga0070672_100098751
1240 Ga0070672_100772937
1241 Ga0070686_100070795
1242 Ga0070686_100185865
1243 Ga0070686_100262832
1244 Ga0070686_100708098
1245 Ga0070686_100764388
1246 Ga0070695_100166150
1247 Ga0070695_100850294
1248 Ga0070696_100020430
1249 Ga0070696_100024142
1250 Ga0070696_100103997
1251 Ga0070696_100263225
1252 Ga0070696_100570787
1253 Ga0070693_100052821
1254 Ga0070693_100162449
1255 Ga0070665_100001511
1256 Ga0070665_100003106
1257 Ga0070665_100010290
1258 Ga0070665_100070519
1259 Ga0070665_100097496
1260 Ga0070665_100207009
1261 Ga0070665_100461839
1262 Ga0070665_100707463
1263 Ga0070704_100015360
1264 Ga0070704_100240967
1265 Ga0070704_100279421
1266 Ga0070704_100283451
1267 Ga0070704_100466682
1268 Ga0068855_100361702
1269 Ga0070664_100002901
1270 Ga0070664_100106291
1271 Ga0070664_100148542
1272 Ga0070664_100166207
1273 Ga0070664_100403166
1274 Ga0070664_100858770
1275 Ga0068857_100032282
1276 Ga0068854_100241204
1277 Ga0068854_100498549
1278 Ga0068856_100014941
1279 Ga0068856_100517786
1280 Ga0070702_100006773
1281 Ga0070702_100020742
1282 Ga0068852_100168778
1283 Ga0068852_100606915
1284 Ga0068859_100385718
1285 Ga0068859_100787303
1286 Ga0068859_100927593
1287 Ga0068864_100019648
1288 Ga0068864_100118517
1289 Ga0068864_100201336
1290 Ga0068864_100759569
1291 Ga0068864_100782602
1292 Ga0068864_100834736
1293 Ga0068866_10014486
1294 Ga0068866_10274906
1295 Ga0068861_100004810
1296 Ga0068861_100016822
1297 Ga0068861_100031339
1298 Ga0068861_100038142
1299 Ga0068861_100082239
1300 Ga0068851_10152992
1301 Ga0068870_10050145
1302 Ga0068870_10676265
1303 Ga0068863_100049221
1304 Ga0068863_100067111
1305 Ga0068863_100974586
1306 Ga0068858_100003783
1307 Ga0068858_100213088
1308 Ga0068858_100220802
1309 Ga0068858_100273120
1310 Ga0068860_100014536
1311 Ga0068860_100508099
1312 Ga0068860_100825476
1313 Ga0068862_100009679
1314 Ga0068862_100017064
1315 Ga0068862_100122266
1316 Ga0068862_100318034
1317 Ga0068862_100438865
1318 Ga0081455_10068462
1319 Ga0081455_10072702
1320 Ga0081455_10224062
1321 Ga0081539_10014209
1322 Ga0070717_10091629
1323 Ga0075365_10011187
1324 Ga0075365_10054546
1325 Ga0075368_10013207
1326 Ga0075368_10023974
1327 Ga0075363_100055138
1328 Ga0075363_100110612
1329 Ga0075363_100418220
1330 Ga0075364_10004297
1331 Ga0075364_10045616
1332 Ga0075364_10089576
1333 Ga0075364_10294741
1334 Ga0075364_10478015
1335 Ga0070716_100217180
1336 Ga0075362_10024862
1337 Ga0075367_10154268
1338 Ga0075367_10163298
1339 Ga0075366_10008006
1340 Ga0075366_10023601
1341 Ga0075366_10025301
1342 Ga0075366_10062141
1343 Ga0075366_10093954
1344 Ga0075366_10293249
1345 Ga0097621_100011246
1346 Ga0097621_100026607
1347 Ga0097621_100093539
1348 Ga0097621_100109177
1349 Ga0097621_100174452
1350 Ga0097621_100306581
1351 Ga0097621_100418966
1352 Ga0075370_10013314
1353 Ga0075370_10044791
1354 Ga0068871_100006379
1355 Ga0068871_100006536
1356 Ga0068871_100015641
1357 Ga0068871_100217139
1358 Ga0068871_100231954
1359 Ga0068871_100266720
1360 Ga0068871_100959316
1361 Ga0068871_101207523
1362 Ga0075428_100005950
1363 Ga0075428_100039614
1364 Ga0075428_100108179
1365 Ga0075428_100120829
1366 Ga0075428_100809399
1367 Ga0075428_101116437
1368 Ga0075430_100017232
1369 Ga0075430_100028894
1370 Ga0075430_100093086
1371 Ga0075431_100004102
1372 Ga0075431_100018285
1373 Ga0075431_100029812
1374 Ga0075431_100040075
1375 Ga0075431_100412176
1376 Ga0075431_101214622
1377 Ga0075433_10027410
1378 Ga0075433_10050721
1379 Ga0075433_10103048
1380 Ga0075433_10126567
1381 Ga0075433_10227755
1382 Ga0075433_10343140
1383 Ga0075433_10355704
1384 Ga0075433_10375149
1385 Ga0075433_10810818
1386 Ga0075434_100001079
1387 Ga0075434_100006547
1388 Ga0075434_100007593
1389 Ga0075434_100011037
1390 Ga0075434_100233264
1391 Ga0075434_100351164
1392 Ga0075434_100400284
1393 Ga0075434_100940169
1394 Ga0075429_100002617
1395 Ga0075429_100012495
1396 Ga0075429_100040889
1397 Ga0075429_100142167
1398 Ga0075429_100370561
1399 Ga0075429_100442675
1400 Ga0075429_100501545
1401 Ga0068865_100005679
1402 Ga0068865_100022011
1403 Ga0068865_100187752
1404 Ga0068865_100272820
1405 Ga0068865_100339631
1406 Ga0075436_100007129
1407 Ga0097620_100385740
1408 Ga0097620_100787382
1409 Ga0097620_100927555
1410 Ga0097620_101114524
1411 Ga0075435_100000213
1412 Ga0075435_100000297
1413 Ga0075435_100004639
1414 Ga0075435_100012707
1415 Ga0075435_100046860
1416 Ga0075435_100056798
1417 Ga0075435_100195601
1418 Ga0075435_100895409
1419 Ga0075435_101080590
1420 Ga0099794_10307351
1421 Ga0105240_10148295
1422 Ga0105240_10209184
1423 Ga0105240_10705429
1424 Ga0111539_10001074
1425 Ga0111539_10001475
1426 Ga0111539_10003731
1427 Ga0111539_10023912
1428 Ga0111539_10026508
1429 Ga0111539_10044979
1430 Ga0111539_10076506
1431 Ga0111539_10130634
1432 Ga0111539_10170809
1433 Ga0111539_10199850
1434 Ga0111539_10390873
1435 Ga0111539_10404239
1436 Ga0111539_10468102
1437 Ga0111539_10618082
1438 Ga0111539_11252287
1439 Ga0105245_10011811
1440 Ga0105245_10350289
1441 Ga0105245_10373576
1442 Ga0105245_10944843
1443 Ga0114129_10000006
1444 Ga0114129_10000086
1445 Ga0114129_10002018
1446 Ga0114129_10002028
1447 Ga0114129_10002788
1448 Ga0114129_10016405
1449 Ga0114129_10023419
1450 Ga0114129_10027315
1451 Ga0114129_10029872
1452 Ga0114129_10038108
1453 Ga0114129_10039036
1454 Ga0114129_10077320
1455 Ga0114129_10294556
1456 Ga0114129_10483406
1457 Ga0114129_11244828
1458 Ga0114129_11305098
1459 Ga0105243_10075791
1460 Ga0105243_10094127
1461 Ga0105243_10097580
1462 Ga0105243_10834822
1463 Ga0105241_10085733
1464 Ga0105242_10011789
1465 Ga0105242_10035951
1466 Ga0105242_10039808
1467 Ga0105242_10051191
1468 Ga0105242_10151936
1469 Ga0105242_10183918
1470 Ga0105242_10551795
1471 Ga0105242_11187153
1472 Ga0105248_10003314
1473 Ga0105248_10010492
1474 Ga0105248_10016498
1475 Ga0105248_10031464
1476 Ga0105248_10042926
1477 Ga0105248_10060438
1478 Ga0105248_10131193
1479 Ga0105248_10154235
1480 Ga0105248_10176686
1481 Ga0105248_10245518
1482 Ga0105248_10268802
1483 Ga0105248_10278400
1484 Ga0105248_10377505
1485 Ga0105248_10610217
1486 Ga0105248_10660917
1487 Ga0105248_10671501
1488 Ga0105248_10914537
1489 Ga0105248_11719394
1490 Ga0105237_10281788
1491 Ga0105238_10165183
1492 Ga0105238_11215685
1493 Ga0105249_10001775
1494 Ga0105249_10930781
1495 Ga0105239_10195476
1496 Ga0105239_10885263
1497 Ga0105246_10030539
1498 Ga0105246_10303567
1499 Ga0105246_11011069
1500 Ga0157369_10623783
1501 Ga0157374_10065505
1502 Ga0157378_10028962
1503 Ga0157378_10621722
1504 Ga0163162_10135935
1505 Ga0163162_10178050
1506 Ga0163162_11217559
1507 Ga0157372_10127046
1508 Ga0157375_10208983
1509 Ga0157375_10279778
1510 Ga0157375_10793963
1511 Ga0157375_11063343
1512 Ga0163163_10000022
1513 Ga0163163_10072561
1514 Ga0163163_10082589
1515 Ga0163163_10146753
1516 Ga0163163_10156123
1517 Ga0163163_10158128
1518 Ga0163163_10436104
1519 Ga0163163_10463011
1520 Ga0163163_10648581
1521 Ga0157380_10007449
1522 Ga0157380_10181729
1523 Ga0157380_10552949
1524 Ga0157380_10610716
1525 Ga0157380_10814190
1526 Ga0157380_10924626
1527 Ga0157380_11257101
1528 Ga0157377_10010181
1529 Ga0157379_10005030
1530 Ga0157379_10105928
1531 Ga0157379_10440013
1532 Ga0157379_10588652
1533 Ga0157376_10003567
1534 Ga0157376_10111784
1535 Ga0157376_10119541
1536 Ga0157376_10203649
1537 Ga0157376_10233327
1538 Ga0157376_10250097
1539 Ga0157376_10586257
1540 Ga0163161_10278239
1541 Ga0207697_10000983
1542 Ga0207697_10051107
1543 Ga0207697_10128822
1544 Ga0207653_10038211
1545 Ga0207682_10018255
1546 Ga0207682_10032524
1547 Ga0207682_10102310
1548 Ga0207642_10046132
1549 Ga0207680_10009146
1550 Ga0207680_10058304
1551 Ga0207680_10100469
1552 Ga0207680_10217854
1553 Ga0207680_10381425
1554 Ga0207680_10543394
1555 Ga0207699_10481745
1556 Ga0207645_10026612
1557 Ga0207643_10221708
1558 Ga0207684_10702843
1559 Ga0207654_10083502
1560 Ga0207707_10351628
1561 Ga0207707_10359006
1562 Ga0207695_10424797
1563 Ga0207671_10453959
1564 Ga0207663_10033987
1565 Ga0207660_10829456
1566 Ga0207662_10003979
1567 Ga0207662_10127341
1568 Ga0207662_10315470
1569 Ga0207662_10637032
1570 Ga0207657_10146609
1571 Ga0207657_10221352
1572 Ga0207657_10439153
1573 Ga0207649_10021903
1574 Ga0207649_10072393
1575 Ga0207652_10210268
1576 Ga0207652_10335837
1577 Ga0207646_10153211
1578 Ga0207646_10850251
1579 Ga0207681_10013051
1580 Ga0207650_10005304
1581 Ga0207650_10053082
1582 Ga0207659_10004827
1583 Ga0207659_10078562
1584 Ga0207659_10130105
1585 Ga0207659_10380491
1586 Ga0207687_10013508
1587 Ga0207687_10092242
1588 Ga0207687_10216754
1589 Ga0207644_10019590
1590 Ga0207644_10111533
1591 Ga0207644_10295905
1592 Ga0207690_10185255
1593 Ga0207706_10248705
1594 Ga0207706_10398007
1595 Ga0207706_10840818
1596 Ga0207686_10022777
1597 Ga0207686_10039215
1598 Ga0207686_10127685
1599 Ga0207686_10280839
1600 Ga0207709_10201278
1601 Ga0207709_10782571
1602 Ga0207670_10024252
1603 Ga0207670_10046371
1604 Ga0207670_10170044
1605 Ga0207670_10302516
1606 Ga0207669_10008211
1607 Ga0207669_10021308
1608 Ga0207669_10205796
1609 Ga0207669_10484617
1610 Ga0207704_10009863
1611 Ga0207704_10051648
1612 Ga0207704_10152167
1613 Ga0207704_10261914
1614 Ga0207704_10755705
1615 Ga0207704_10965865
1616 Ga0207665_10267947
1617 Ga0207691_10019770
1618 Ga0207691_10025808
1619 Ga0207691_10116256
1620 Ga0207691_10202523
1621 Ga0207691_10257073
1622 Ga0207691_10299386
1623 Ga0207691_10348126
1624 Ga0207711_10012090
1625 Ga0207711_10050449
1626 Ga0207711_10054049
1627 Ga0207711_10090103
1628 Ga0207711_10091452
1629 Ga0207711_10097278
1630 Ga0207711_10123564
1631 Ga0207711_10169492
1632 Ga0207711_10343493
1633 Ga0207711_10415425
1634 Ga0207711_10686504
1635 Ga0207689_10034918
1636 Ga0207689_10039600
1637 Ga0207689_10163384
1638 Ga0207661_10003180
1639 Ga0207661_10214035
1640 Ga0207661_10501614
1641 Ga0207679_10001534
1642 Ga0207679_10088217
1643 Ga0207679_10114251
1644 Ga0207679_10501870
1645 Ga0207679_11003807
1646 Ga0207667_10354962
1647 Ga0207667_10547581
1648 Ga0207651_10009303
1649 Ga0207651_10204752
1650 Ga0207651_10229817
1651 Ga0207651_10295544
1652 Ga0207651_10632751
1653 Ga0207668_10043350
1654 Ga0207668_10096842
1655 Ga0207668_10325917
1656 Ga0207640_10104128
1657 Ga0207640_10346454
1658 Ga0207658_10140778
1659 Ga0207658_10229237
1660 Ga0207658_10309426
1661 Ga0207677_10149270
1662 Ga0207703_10011640
1663 Ga0207703_10018091
1664 Ga0207703_10053128
1665 Ga0207703_10062082
1666 Ga0207703_10082112
1667 Ga0207703_10133180
1668 Ga0207639_10731267
1669 Ga0207678_10034334
1670 Ga0207678_10210692
1671 Ga0207678_10404807
1672 Ga0207678_10411586
1673 Ga0207708_10002632
1674 Ga0207708_10002942
1675 Ga0207708_10113985
1676 Ga0207708_10195287
1677 Ga0207708_10299576
1678 Ga0207708_10455678
1679 Ga0207702_10032798
1680 Ga0207702_10462124
1681 Ga0207641_10014455
1682 Ga0207641_10043445
1683 Ga0207641_10179359
1684 Ga0207641_10349532
1685 Ga0207648_10030023
1686 Ga0207648_10033038
1687 Ga0207648_10148362
1688 Ga0207648_10151974
1689 Ga0207648_10155081
1690 Ga0207648_10432226
1691 Ga0207648_10883449
1692 Ga0207676_10016740
1693 Ga0207676_10083045
1694 Ga0207676_10094394
1695 Ga0207676_10228414
1696 Ga0207674_10043147
1697 Ga0207674_10071855
1698 Ga0207674_10507062
1699 Ga0207675_100002221
1700 Ga0207675_100023585
1701 Ga0207675_100035787
1702 Ga0207675_100137459
1703 Ga0207675_100174025
1704 Ga0207675_100255685
1705 Ga0207675_100443511
1706 Ga0207675_100517876
1707 Ga0207675_100678251
1708 Ga0207675_101325515
1709 Ga0207683_10017391
1710 Ga0207683_10020843
1711 Ga0207683_10036707
1712 Ga0207683_10118989
1713 Ga0207683_10327727
1714 Ga0207683_10509873
1715 Ga0207683_10725488
1716 Ga0207698_10106979
1717 Ga0207698_10544388
1718 Ga0207698_11130681
1719 Ga0209971_1010203
1720 Ga0209813_10001496
1721 Ga0209813_10029512
1722 Ga0209813_10104653
1723 Ga0207428_10001565
1724 Ga0207428_10008715
1725 Ga0207428_10010221
1726 Ga0207428_10096297
1727 Ga0207428_10194055
1728 Ga0207428_10225295
1729 Ga0268266_10011481
1730 Ga0268266_10015827
1731 Ga0268266_10237564
1732 Ga0268266_10282942
1733 Ga0268266_10399565
1734 Ga0268266_10844039
1735 Ga0268265_10004027
1736 Ga0268265_10130186
1737 Ga0268265_10228513
1738 Ga0268265_10268157
1739 Ga0268265_10639768
1740 Ga0268265_10733080
1741 Ga0268264_10062945
1742 Ga0268264_10097489
1743 Ga0265328_10000696
1744 Ga0265328_10003652
1745 Ga0265331_10000144
1746 Ga0265331_10007210
1747 Ga0265327_10000314
1748 Ga0265327_10005872
1749 Ga0307408_100032108
1750 Ga0307408_100121472
1751 Ga0307408_100285089
1752 Ga0307408_100428797
1753 Ga0307408_100456111
1754 Ga0307408_100581505
1755 Ga0307408_100659406
1756 Ga0265314_10066943
1757 Ga0265314_10096482
1758 Ga0307405_10030931
1759 Ga0307405_10173845
1760 Ga0307413_10132702
1761 Ga0307413_10459677
1762 Ga0307410_10068698
1763 Ga0307406_10009340
1764 Ga0307406_10088899
1765 Ga0307406_10300937
1766 Ga0307406_10905287
1767 Ga0307407_10079080
1768 Ga0307412_10040938
1769 Ga0307412_10221562
1770 Ga0307412_10277613
1771 Ga0307412_10404584
1772 Ga0307409_100070830
1773 Ga0307416_100009707
1774 Ga0307416_100039356
1775 Ga0307416_100081280
1776 Ga0307416_100413447
1777 Ga0307416_100495496
1778 Ga0307416_101345537
1779 Ga0307414_10018051
1780 Ga0307414_10140669
1781 Ga0307411_10067842
1782 Ga0307411_10116426
1783 Ga0307411_10224396
1784 Ga0307411_11095202
1785 Ga0307415_100165847
1786 Ga0307415_100500020
1787 Ga0307415_100501877
1788 Ga0316583_10103756
1789 Ga0373930_0006718
1790 Ga0373948_0001093
1791 Ga0373959_0005393
1792 Ga0373926_0154492
1793 Ga0373928_0005185
1794 Ga0373929_0000765
1795 Ga0373934_0006394
1796 Ga0373934_0031692
1797 Ga0373949_0005372
1798 Ga0373951_0000250
1799 Ga0373952_0000930
1800 Ga0373923_0165049
1801 Ga0373932_0001640
1802 Ga0373936_0009425
1803 Ga0373939_0000330
1804 Ga0373939_0084749
1805 Ga0373941_0004661
1806 Ga0373953_0032696
1807 Ga0373954_0114015
1808 Ga0373956_0038711
1809 Ga0373956_0089809
1810 Ga0373960_0000553
1811 Ga0373960_0031229
1812 Ga0373943_0030790
1813 Ga0373943_0063154
1814 Ga0373943_0390142
1815 Ga0373943_0433428
1816 Ga0373946_0002282
1817 Ga0373946_0162450
1818 Ga0373955_0007237
1819 Ga0373955_0039805
1820 Ga0373955_0199294
1821 Ga0373942_0000461
1822 Ga0373961_0002363
1823 Ga0373961_0011802
1824 Ga0373962_0002576
1825 Ga0373924_0004143
1826 Ga0373931_0029932
1827 Ga0373935_0243488
1828 Ga0373935_0277215
1829 Ga0373935_0545570
1830 Ga0373927_0179417
1831 Ga0373933_0072767
1832 Ga0373947_0014749
1833 Ga0373947_0050681
1834 Ga0373947_0194115
1835 Ga0373947_0359219
1836 Ga0373937_0000607
1837 Ga0373937_0039178
1838 Ga0373937_0233844
1839 Ga0373937_0253125
1840 Ga0373925_0029867
1841 Ga0373925_0113036
1842 Ga0373925_0545154
1843 Ga0373925_0655177
1844 Ga0395905_0268804
1845 Ga0436365_0463108
1846 Ga0439453_0013083
1847 Ga0451855_0486301
1848 Ga0451853_2605379
1849 Ga0451853_3688615
1850 Ga0439433_0040803
1851 Ga0439445_0138463
1852 Ga0439456_052339
1853 Ga0439446_0021300
1854 Ga0450908_001093
1855 Ga0439464_0002574
1856 Ga0439464_0038338
1857 Ga0439460_0021216
1858 Ga0451577_0001754
1859 Ga0451577_0089925
1860 Ga0451577_0090164
1861 Ga0453683_0000299
1862 Ga0453683_0009456
1863 Ga0453684_0000776
1864 Ga0453684_0377821
1865 Ga0453684_0509563
1866 Ga0451576_0012498
1867 Ga0451576_0137329
1868 Ga0451576_0166688
1869 Ga0451576_0209401
1870 Ga0451576_0244641
1871 Ga0451576_0307726
1872 Ga0451576_0611125
1873 Ga0451576_1416646
1874 Ga0495592_0053608
1875 Ga0495592_0244964
1876 Ga0495603_0067575
1877 Ga0495629_0150781
1878 Ga0495629_0179752
1879 Ga0495638_0009000
1880 Ga0495638_0236921
1881 Ga0495580_0369647
1882 Ga0495580_0468233
1883 Ga0495639_0079094
1884 Ga0495594_0142804
1885 Ga0495628_0234384
1886 Ga0495652_0324201
1887 Ga0495640_0170943
1888 Ga0495640_0528569
1889 Ga0495586_0073553
1890 Ga0495586_0139534
1891 Ga0495587_0036067
1892 Ga0495645_0014263
1893 Ga0495645_0245238
1894 Ga0495667_0080232
1895 Ga0495656_0130332
1896 Ga0495634_0038277
1897 Ga0495634_0397200
1898 Ga0495657_0296012
1899 Ga0495599_0175790
1900 Ga0495647_0014335
1901 Ga0495658_0215221
1902 Ga0495658_0245162
1903 Ga0495613_0005107
1904 Ga0495613_0039963
1905 Ga0495613_0453480
1906 Ga0495670_0215095
1907 Ga0495581_0338990
1908 Ga0495604_0068602
1909 Ga0495674_0022038
1910 Ga0495674_0356334
1911 Ga0495674_0469254
1912 Ga0495672_0056825
1913 Ga0495680_0219512
1914 Ga0495680_0220530
1915 Ga0495684_0001265
1916 Ga0495684_0162463
1917 Ga0496100_0013954
1918 Ga0496101_0000804
1919 Ga0496102_0021352
1920 Ga0496102_0476476
1921 Ga0496102_0588263
1922 Ga0496103_0181280
1923 Ga0496104_0003935
1924 Ga0496104_0019706
1925 Ga0496104_0048944
1926 Ga0496104_0769379
1927 Ga0496104_0933613
1928 Ga0496105_0078946
1929 Ga0496105_0249331
1930 Ga0496105_0625934
1931 Ga0496105_0711254
1932 Ga0496106_0096782
1933 Ga0496106_0140118
1934 Ga0496106_0279814
1935 Ga0496106_0383759
1936 Ga0496106_0396600
1937 Ga0496106_0592258
1938 Ga0496107_0049721
1939 Ga0496107_0233052
1940 Ga0496108_0001909
1941 Ga0496108_0079658
1942 Ga0496108_0381263
1943 Ga0496108_0469836
1944 Ga0496108_0856312
1945 Ga0496109_0008025
1946 Ga0496109_0082810
1947 Ga0496109_0170117
1948 Ga0496109_0241847
1949 Ga0496109_0879431
1950 Ga0496110_0032847
1951 Ga0496110_0081328
1952 Ga0496110_0198044
1953 Ga0496111_0057673
1954 Ga0496112_0001309
1955 Ga0496112_0051591
1956 Ga0496112_0076181
1957 Ga0496112_0183842
1958 Ga0496112_0540286
1959 Ga0496112_0679259
1960 Ga0496113_0376882
1961 Ga0496114_0001096
1962 Ga0496114_0107825
1963 Ga0496114_0179102
1964 Ga0496114_0520454
1965 Ga0496114_0958185
1966 Ga0496115_0050956
1967 Ga0496115_0235913
1968 Ga0501031_0014712
1969 Ga0501031_0140287
1970 Ga0501031_0621869
1971 Ga0501032_0027161
1972 Ga0501032_0076932
1973 Ga0501032_0082807
1974 Ga0501033_0004346
1975 Ga0501033_0065995
1976 Ga0501033_0165022
1977 Ga0501034_0015356
1978 Ga0501034_0015564
1979 Ga0501034_0079966
1980 Ga0501034_0281363
1981 Ga0501036_0003637
1982 Ga0501036_0007369
1983 Ga0501036_0281489
1984 Ga0501037_0004816
1985 Ga0501037_0018423
1986 Ga0501037_0041311
1987 Ga0501038_0067189
1988 Ga0501038_0292560
1989 Ga0501039_0035069
1990 Ga0501039_0072126
1991 Ga0501039_0387770
1992 Ga0501040_0034280
1993 Ga0501040_0034330
1994 Ga0501040_0049058
1995 Ga0501040_0064031
1996 Ga0501040_0110524
1997 Ga0501040_0124693
1998 Ga0501041_0104556
1999 Ga0501041_0412452
2000 Ga0501042_0015775
2001 Ga0501042_0137368
2002 Ga0501042_0184888
2003 Ga0501042_0558657
2004 Ga0501043_0003042
2005 Ga0501043_0101728
2006 Ga0501043_0166612
2007 Ga0501043_0265550
2008 Ga0501046_0037427
2009 Ga0501046_0133261
2010 Ga0501046_0242987
2011 Ga0501047_0074802
2012 Ga0501047_0153812
2013 Ga0501047_0394301
2014 Ga0501048_0000844
2015 Ga0501048_0002446
2016 Ga0501048_0018383
2017 Ga0501048_0110496
2018 Ga0501048_0214985
2019 Ga0501048_0364367
2020 Ga0501048_0426929
2021 Ga0501048_0546183
2022 Ga0501067_0003828
2023 Ga0501067_0156289
2024 Ga0501067_0192887
2025 Ga0501068_0003872
2026 Ga0501068_0008404
2027 Ga0501068_0034972
2028 Ga0501068_0157572
2029 Ga0501069_0011000
2030 Ga0501069_0032137
2031 Ga0501069_0108059
2032 Ga0501069_0641125
2033 Ga0501070_0044660
2034 Ga0501070_0186386
2035 Ga0501070_0334430
2036 Ga0501071_0005749
2037 Ga0501071_0005906
2038 Ga0501071_0005952
2039 Ga0501071_0011655
2040 Ga0501071_0073661
2041 Ga0501071_0098417
2042 Ga0501071_0522262
2043 Ga0501072_0014268
2044 Ga0501072_0025306
2045 Ga0501072_0085099
2046 Ga0501072_0536092
2047 Ga0501073_0081132
2048 Ga0501073_0193426
2049 Ga0501073_0238648
2050 Ga0501074_0001906
2051 Ga0501074_0006382
2052 Ga0501074_0161785
2053 Ga0501074_0462193
2054 Ga0501075_0136713
2055 Ga0501075_0152469
2056 Ga0501075_0240452
2057 Ga0501075_0254547
2058 Ga0501075_0406995
2059 Ga0501075_0754150
2060 Ga0501076_0004336
2061 Ga0501076_0020226
2062 Ga0501076_0027950
2063 Ga0501076_0054441
2064 Ga0501076_0057677
2065 Ga0501076_0101278
2066 Ga0501076_0160534
2067 Ga0501076_0174590
2068 Ga0501076_0193335
2069 Ga0501076_0588389
2070 Ga0501077_0052680
2071 Ga0501077_0073812
2072 Ga0501077_0098642
2073 Ga0501077_0283479
2074 Ga0501235_120465
2075 Ga0501259_088890
2076 Ga0501221_095366
2077 Ga0501079_0005421
2078 Ga0501079_0009775
2079 Ga0501079_0083118
2080 Ga0501079_0163753
2081 Ga0501079_0171009
2082 Ga0501079_0611969
2083 Ga0501079_0816365
2084 Ga0501080_0029992
2085 Ga0501080_0105511
2086 Ga0501080_0181276
2087 Ga0501080_0196059
2088 Ga0501080_0197171
2089 Ga0501080_0278948
2090 Ga0501080_0403495
2091 Ga0501080_0564087
2092 Ga0501080_0690721
2093 Ga0501080_1151173
2094 Ga0501081_0026605
2095 Ga0501081_0044823
2096 Ga0501081_0195436
2097 Ga0501081_0531002
2098 Ga0501083_0008276
2099 Ga0501083_0382778
2100 Ga0501278_008693
2101 Ga0501035_0014330
2102 Ga0501035_0150802
2103 Ga0501044_0014883
2104 Ga0501044_0015396
2105 Ga0501045_0006810
2106 Ga0501045_0026034
2107 Ga0501045_0037893
2108 Ga0501045_0490316
2109 Ga0501045_0617912
2110 nmdc:mga03683_66305_c1
2111 nmdc:mga03n38_27472_c1
2112 nmdc:mga00v17_188326_c1
2113 nmdc:mga00v17_364264_c1
2114 nmdc:mga00v17_3665_c1
2115 nmdc:mga00v17_44919_c1
2116 nmdc:mga00v17_67001_c1
2117 nmdc:mga0yw44_10417_c1
2118 nmdc:mga0yw44_331252_c1
2119 nmdc:mga0yw44_60560_c1
2120 nmdc:mga0k408_28230_c2
2121 nmdc:mga0k408_4972_c1
2122 nmdc:mga0k408_57883_c1
2123 nmdc:mga0k408_86235_c1
2124 nmdc:mga06z11_31504_c1
2125 nmdc:mga06z11_33719_c1
2126 nmdc:mga06z11_36568_c1
2127 nmdc:mga06z11_7137_c1
2128 nmdc:mga04h51_28911_c1
2129 nmdc:mga04h51_29719_c1
2130 nmdc:mga04h51_4035_c1
2131 nmdc:mga04h51_46066_c1
2132 nmdc:mga07m45_37262_c1
2133 nmdc:mga05p37_1017962_c1
2134 nmdc:mga05p37_15661_c1
2135 nmdc:mga05p37_2308_c1
2136 nmdc:mga05p37_28047_c1
2137 nmdc:mga05p37_322065_c1
2138 nmdc:mga05p37_3422_c1
2139 nmdc:mga05p37_454532_c1
2140 nmdc:mga05p37_48559_c1
2141 nmdc:mga05p37_495_c1
2142 nmdc:mga05p37_5252_c1
2143 nmdc:mga05p37_61122_c1
2144 nmdc:mga05p37_6503_c2
2145 nmdc:mga05p37_899411_c1
2146 nmdc:mga05p37_961_c1
2147 nmdc:mga09592_131487_c1
2148 nmdc:mga09592_2031_c1
2149 nmdc:mga09592_99095_c1
2150 nmdc:mga0qj67_159597_c1
2151 nmdc:mga0qj67_2135_c1
2152 nmdc:mga0qj67_234355_c1
2153 nmdc:mga0qj67_297361_c1
2154 nmdc:mga0qj67_65383_c1
2155 nmdc:mga06r32_163680_c1
2156 nmdc:mga06r32_16856_c1
2157 nmdc:mga06r32_271365_c1
2158 nmdc:mga06r32_344720_c1
2159 nmdc:mga06r32_371308_c1
2160 nmdc:mga06r32_503015_c1
2161 nmdc:mga06r32_9229_c1
2162 nmdc:mga08y16_11518_c1
2163 nmdc:mga08y16_170329_c1
2164 nmdc:mga08y16_323343_c1
2165 nmdc:mga08y16_32515_c1
2166 nmdc:mga08y16_512334_c1
2167 nmdc:mga08y16_632_c1
2168 nmdc:mga08y16_7439_c1
2169 nmdc:mga08y16_9169_c1
2170 nmdc:mga0n895_10454_c1
2171 nmdc:mga0n895_173_c1
2172 nmdc:mga0n895_319314_c1
2173 nmdc:mga0n895_35741_c1
2174 nmdc:mga0n895_360095_c1
2175 nmdc:mga0n895_421259_c1
2176 nmdc:mga0n895_498164_c1
2177 nmdc:mga0n895_503093_c1
2178 nmdc:mga0n895_5460_c1
2179 nmdc:mga0n895_63628_c1
2180 nmdc:mga0rr50_1088_c1
2181 nmdc:mga0rr50_149140_c1
2182 nmdc:mga0rr50_15225_c1
2183 nmdc:mga0rr50_16018_c1
2184 nmdc:mga0rr50_254783_c1
2185 nmdc:mga0rr50_2_c1
2186 nmdc:mga0rr50_669765_c1
2187 nmdc:mga0rr50_936844_c1
2188 nmdc:mga08x19_124252_c1
2189 nmdc:mga08x19_16760_c1
2190 nmdc:mga08x19_206531_c1
2191 nmdc:mga08x19_452_c1
2192 nmdc:mga0a205_191513_c1
2193 nmdc:mga0a205_195000_c1
2194 nmdc:mga0a205_204918_c1
2195 nmdc:mga0a205_205321_c1
2196 nmdc:mga0a205_242877_c1
2197 nmdc:mga0a205_340991_c1
2198 nmdc:mga0a205_607807_c1
2199 nmdc:mga0a205_67600_c1
2200 nmdc:mga0a205_68431_c2
2201 Ga0495601_0005785
2202 Ga0495601_0068397
2203 Ga0495601_0292208
2204 Ga0495601_0437199
2205 Ga0495595_0064560
2206 Ga0495595_0094457
2207 Ga0495619_0001690
2208 Ga0495619_0019556
2209 Ga0495619_0025709
2210 Ga0495619_0055391
2211 Ga0495619_0117732
2212 Ga0495619_0633412
2213 Ga0500555_000789
2214 Ga0500658_0205735
2215 Ga0500568_0003557
2216 Ga0500616_0000358
2217 Ga0500611_002098
2218 Ga0500645_000794
2219 Ga0500599_015796
2220 Ga0501084_0029152
2221 Ga0501084_0039490
2222 Ga0501084_0040126
2223 Ga0501084_0075103
2224 Ga0501084_0118672
2225 Ga0501084_0617211
2226 Ga0501084_0968599
2227 Ga0590071_000433
2228 Ga0590071_069306
2229 Ga0590074_005771
2230 Ga0590075_009402
2231 Ga0590077_009724
2232 Ga0501082_0028616
2233 Ga0501082_0118209
2234 Ga0501082_0188690
2235 Ga0501082_0310021
2236 Ga0501082_0476324
2237 Ga0501082_0481311
2238 Ga0501082_0537225
2239 Ga0501082_0677936
2240 Ga0530510_0036790
2241 Ga0530510_0224940
2242 2964377183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02441

Flavoprotein

Flavoprotein

23

207

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qlg-assembly1.cif.gz_A crystal structure of anubix (pada1) in complex with fmn and dimethylallyl pyrophosphate 0.9406 9 207
7km3-assembly1.cif.gz_L dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap 0.9398 10 201
7km2-assembly1.cif.gz_D dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn 0.9393 10 205
7km3-assembly1.cif.gz_A dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap 0.9387 10 203
7km2-assembly1.cif.gz_K dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn 0.9379 10 205
ID Description Score Start End Superfamily
af_P33751_55_242_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9423 10 207 3.40.50.1950
2ejbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9201 10 200 3.40.50.1950
af_P33751_55_242_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.918 10 207 3.40.50.1950
2ejbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9049 10 200 3.40.50.1950
1sbzC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.8909 13 198 3.40.50.1950
ID Description Score Start End GO Terms
AF-A0A521THN1-F1-model_v4 Aromatic acid decarboxylase 0.991 8 128 GO:0003824
AF-A0A381NJ76-F1-model_v4 Flavoprotein domain-containing protein 0.9896 10 207 GO:0004659
GO:0016831
AF-A0A381NJ76-F1-model_v4 Flavoprotein domain-containing protein 0.9798 10 207 GO:0004659
GO:0016831
AF-A0A2V8DVQ1-F1-model_v4 Flavoprotein domain-containing protein 0.9738 87 205 GO:0004659
GO:0016831
AF-A0A843HJY7-F1-model_v4 UbiX family flavin prenyltransferase 0.9718 82 207 GO:0004659

Map