F490393
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1120 | 444 | 1085 | 352 |
Family's Representative Sequence
| Representative Sequence | 3300046492|Ga0495585_0004431|Ga0495585_0004431_3923_5149 |
| Length | 408 |
| Sequence | MAGAGRLLSRRKLLKAVAALPLAYAAPLCAEPPPAQAITPALIAAATKEGQLTWYTSADSQLAEKVGKAFEQKFRGVRVRVERAGGERIFARVAQEYASGLHVADAVSTGDAAQFLAWKRQELLAPYVPEDVARYIPPEHRDPDGFYASVRSSLCVIAYNTAMVKREDAPKSFANLLDLKWKGKIVKAHPSYSGTIMTSTYQMVRELSWSYLEQLARQQVLQVQSATDTPKKVVLGERPVMADGNESNVLLLKEAGGPIEVVYAAEGTPSIVQPSAIFVAAPHPNAARLFQNYLFGVEGQELFVNLGGLRSLHALVKDKPGRTPLSAIKVWKDDPAAVETQGEDIKRRYSLWCLITRSRGSTPRLHMKQLKQVLLSVSWVHDCRYKPSAGQPLPRFDLSRSQLVSGLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 3 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 4 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 5 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 6 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 7 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 8 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 9 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 10 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 11 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 12 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 13 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 14 | 2904699407 | |||
| 15 | 2906610324 | |||
| 16 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 17 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 18 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 19 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 20 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 21 | 2922425934 | |||
| 22 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 23 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 24 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 25 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 26 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 27 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 28 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 29 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 30 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 31 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 32 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 33 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 34 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 35 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 36 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 37 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 38 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 42 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 84 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 107 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 108 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 109 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 110 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 111 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 112 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 113 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 114 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 115 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 117 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 118 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 119 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 122 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 123 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 124 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 125 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 127 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 128 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 129 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 130 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 131 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 132 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 133 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 134 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 135 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 136 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 138 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 139 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 241 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 246 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 248 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 249 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 250 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 251 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 253 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 254 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 255 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 256 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 258 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 260 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 261 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 262 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 263 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 264 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 265 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 266 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 267 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 268 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 269 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 270 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 271 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 274 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 276 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 279 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 281 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 282 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 283 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 284 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 286 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 287 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 289 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 290 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 291 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 292 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 295 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 296 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 297 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 298 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 299 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 300 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 301 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 302 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 303 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 368 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 369 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 370 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 371 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 372 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 373 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 376 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 377 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 378 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 379 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 380 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 381 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 382 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 383 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 384 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 385 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 386 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 387 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 388 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 389 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 405 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 407 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 408 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 409 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 423 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 424 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 425 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 426 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 427 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 428 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 429 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 430 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 431 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 432 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 433 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 434 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 435 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 436 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 437 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 438 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 439 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 441 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 442 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 443 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 444 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.58 |
| Metatranscriptomes | 0 |
| Isolates | 2.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.02 |
| Nodule | 1.96 |
| Rhizoplane | 8.75 |
| Rhizosphere | 81.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1004478 | 3300001977 | Bacteria | 2202 |
| 2 | JGI24739J22299_10004105 | 3300001989 | Bacteria | 5568 |
| 3 | JGI24737J22298_10002708 | 3300001990 | Bacteria | 6265 |
| 4 | JGI24750J21931_1000175 | 3300002070 | Bacteria | 10684 |
| 5 | JGI24748J21848_1000514 | 3300002074 | Bacteria | 4251 |
| 6 | JGI24738J21930_10001046 | 3300002075 | Bacteria | 7887 |
| 7 | JGI24749J21850_1001064 | 3300002076 | Bacteria | 3908 |
| 8 | JGI24744J21845_10000566 | 3300002077 | Bacteria | 6684 |
| 9 | JGI24034J26672_10000462 | 3300002239 | Bacteria | 5246 |
| 10 | JGI24742J22300_10000420 | 3300002244 | Bacteria | 6269 |
| 11 | JGI24751J29686_10016485 | 3300002459 | Bacteria | 1523 |
| 12 | JGI25406J46586_10000028 | 3300003203 | Bacteria | 70247 |
| 13 | JGI25404J52841_10015339 | 3300003659 | Bacteria | 1662 |
| 14 | JGI25405J52794_10009101 | 3300003911 | Bacteria | 1869 |
| 15 | Ga0065712_10029709 | 3300005290 | Bacteria | 1233 |
| 16 | Ga0065712_10113471 | 3300005290 | Bacteria | 1782 |
| 17 | Ga0065712_10135995 | 3300005290 | Bacteria | 1489 |
| 18 | Ga0065715_10037919 | 3300005293 | Bacteria | 1156 |
| 19 | Ga0065715_10137549 | 3300005293 | Bacteria | 1903 |
| 20 | Ga0070658_10101559 | 3300005327 | Bacteria | 2378 |
| 21 | Ga0070676_10006058 | 3300005328 | Bacteria | 6455 |
| 22 | Ga0070676_10024678 | 3300005328 | Bacteria | 3390 |
| 23 | Ga0070676_10088731 | 3300005328 | Bacteria | 1890 |
| 24 | Ga0070676_10131041 | 3300005328 | Bacteria | 1585 |
| 25 | Ga0070683_100000836 | 3300005329 | Bacteria | 22825 |
| 26 | Ga0070683_100011738 | 3300005329 | Bacteria | 7585 |
| 27 | Ga0070683_100067592 | 3300005329 | Bacteria | 3329 |
| 28 | Ga0070683_100075014 | 3300005329 | Bacteria | 3159 |
| 29 | Ga0070690_100000700 | 3300005330 | Bacteria | 17192 |
| 30 | Ga0070690_100063572 | 3300005330 | Bacteria | 2382 |
| 31 | Ga0070690_100171286 | 3300005330 | Bacteria | 1494 |
| 32 | Ga0070670_100006794 | 3300005331 | Bacteria | 9685 |
| 33 | Ga0070670_100031028 | 3300005331 | Bacteria | 4602 |
| 34 | Ga0070670_100046472 | 3300005331 | Bacteria | 3733 |
| 35 | Ga0070670_100086754 | 3300005331 | Bacteria | 2689 |
| 36 | Ga0070677_10000406 | 3300005333 | Bacteria | 14999 |
| 37 | Ga0070677_10002338 | 3300005333 | Bacteria | 6059 |
| 38 | Ga0070677_10028755 | 3300005333 | Bacteria | 2102 |
| 39 | Ga0070677_10036854 | 3300005333 | Bacteria | 1905 |
| 40 | Ga0070677_10037432 | 3300005333 | Bacteria | 1892 |
| 41 | Ga0068869_100000653 | 3300005334 | Bacteria | 19619 |
| 42 | Ga0068869_100106003 | 3300005334 | Bacteria | 2132 |
| 43 | Ga0070666_10005529 | 3300005335 | Bacteria | 7752 |
| 44 | Ga0070666_10031827 | 3300005335 | Bacteria | 3483 |
| 45 | Ga0070680_100005042 | 3300005336 | Bacteria | 9963 |
| 46 | Ga0070680_100043949 | 3300005336 | Bacteria | 3630 |
| 47 | Ga0070680_100069523 | 3300005336 | Bacteria | 2891 |
| 48 | Ga0070680_100073871 | 3300005336 | Bacteria | 2805 |
| 49 | Ga0070682_100005253 | 3300005337 | Bacteria | 7206 |
| 50 | Ga0070682_100020427 | 3300005337 | Bacteria | 3895 |
| 51 | Ga0070682_100090951 | 3300005337 | Bacteria | 1997 |
| 52 | Ga0068868_100005815 | 3300005338 | Bacteria | 8692 |
| 53 | Ga0068868_100010958 | 3300005338 | Bacteria | 6584 |
| 54 | Ga0068868_100097041 | 3300005338 | Bacteria | 2381 |
| 55 | Ga0068868_100114377 | 3300005338 | Bacteria | 2195 |
| 56 | Ga0070660_100023548 | 3300005339 | Bacteria | 4562 |
| 57 | Ga0070660_100214228 | 3300005339 | Bacteria | 1564 |
| 58 | Ga0070689_100010029 | 3300005340 | Bacteria | 6743 |
| 59 | Ga0070689_100045887 | 3300005340 | Bacteria | 3366 |
| 60 | Ga0070691_10004006 | 3300005341 | Bacteria | 6669 |
| 61 | Ga0070687_100000387 | 3300005343 | Bacteria | 14981 |
| 62 | Ga0070661_100001217 | 3300005344 | Bacteria | 18141 |
| 63 | Ga0070692_10003662 | 3300005345 | Bacteria | 6283 |
| 64 | Ga0070668_100019465 | 3300005347 | Bacteria | 5109 |
| 65 | Ga0070668_100093673 | 3300005347 | Bacteria | 2371 |
| 66 | Ga0070669_100009354 | 3300005353 | Bacteria | 6980 |
| 67 | Ga0070675_100021874 | 3300005354 | Bacteria | 5109 |
| 68 | Ga0070675_100125571 | 3300005354 | Bacteria | 2182 |
| 69 | Ga0070671_100005891 | 3300005355 | Bacteria | 9767 |
| 70 | Ga0070671_100020315 | 3300005355 | Bacteria | 5415 |
| 71 | Ga0070671_100031898 | 3300005355 | Bacteria | 4355 |
| 72 | Ga0070671_100172306 | 3300005355 | Bacteria | 1831 |
| 73 | Ga0070671_100202708 | 3300005355 | Bacteria | 1683 |
| 74 | Ga0070671_100288270 | 3300005355 | Bacteria | 1397 |
| 75 | Ga0070674_100001918 | 3300005356 | Bacteria | 11324 |
| 76 | Ga0070674_100003371 | 3300005356 | Bacteria | 8951 |
| 77 | Ga0070674_100011258 | 3300005356 | Bacteria | 5439 |
| 78 | Ga0070674_100074811 | 3300005356 | Bacteria | 2404 |
| 79 | Ga0070674_100358750 | 3300005356 | Bacteria | 1179 |
| 80 | Ga0070674_100374632 | 3300005356 | Bacteria | 1156 |
| 81 | Ga0070673_100001086 | 3300005364 | Bacteria | 15555 |
| 82 | Ga0070673_100122369 | 3300005364 | Bacteria | 2173 |
| 83 | Ga0070673_100262418 | 3300005364 | Bacteria | 1509 |
| 84 | Ga0070688_100034076 | 3300005365 | Bacteria | 3081 |
| 85 | Ga0070688_100054495 | 3300005365 | Bacteria | 2505 |
| 86 | Ga0070688_100097415 | 3300005365 | Bacteria | 1933 |
| 87 | Ga0070688_100154625 | 3300005365 | Bacteria | 1570 |
| 88 | Ga0070659_100006583 | 3300005366 | Bacteria | 8390 |
| 89 | Ga0070667_100002687 | 3300005367 | Bacteria | 15394 |
| 90 | Ga0070667_100122297 | 3300005367 | Bacteria | 2265 |
| 91 | Ga0070667_100139796 | 3300005367 | Bacteria | 2119 |
| 92 | Ga0070667_100327348 | 3300005367 | Bacteria | 1384 |
| 93 | Ga0070709_10001257 | 3300005434 | Bacteria | 13866 |
| 94 | Ga0070709_10006522 | 3300005434 | Bacteria | 6362 |
| 95 | Ga0070709_10009430 | 3300005434 | Bacteria | 5386 |
| 96 | Ga0070714_100141720 | 3300005435 | Bacteria | 2159 |
| 97 | Ga0070714_100175934 | 3300005435 | Bacteria | 1945 |
| 98 | Ga0070713_100000374 | 3300005436 | Bacteria | 28680 |
| 99 | Ga0070713_100020428 | 3300005436 | Bacteria | 5078 |
| 100 | Ga0070713_100028156 | 3300005436 | Bacteria | 4434 |
| 101 | Ga0070710_10091766 | 3300005437 | Bacteria | 1793 |
| 102 | Ga0070701_10002820 | 3300005438 | Bacteria | 6767 |
| 103 | Ga0070701_10099733 | 3300005438 | Bacteria | 1607 |
| 104 | Ga0070701_10141958 | 3300005438 | Unclassified | 1374 |
| 105 | Ga0070711_100023758 | 3300005439 | Bacteria | 3991 |
| 106 | Ga0070711_100033722 | 3300005439 | Bacteria | 3410 |
| 107 | Ga0070711_100035137 | 3300005439 | Bacteria | 3348 |
| 108 | Ga0070711_100221046 | 3300005439 | Bacteria | 1472 |
| 109 | Ga0070705_100001711 | 3300005440 | Bacteria | 11431 |
| 110 | Ga0070705_100158085 | 3300005440 | Bacteria | 1512 |
| 111 | Ga0070700_100016369 | 3300005441 | Bacteria | 4223 |
| 112 | Ga0070694_100007442 | 3300005444 | Bacteria | 6676 |
| 113 | Ga0070708_100104737 | 3300005445 | Bacteria | 2594 |
| 114 | Ga0070708_100209862 | 3300005445 | Bacteria | 1825 |
| 115 | Ga0070663_100021845 | 3300005455 | Bacteria | 4264 |
| 116 | Ga0070663_100025326 | 3300005455 | Bacteria | 4004 |
| 117 | Ga0070663_100064000 | 3300005455 | Bacteria | 2657 |
| 118 | Ga0070663_100093309 | 3300005455 | Bacteria | 2233 |
| 119 | Ga0070678_100001680 | 3300005456 | Bacteria | 11863 |
| 120 | Ga0070678_100028582 | 3300005456 | Bacteria | 3805 |
| 121 | Ga0070678_100031777 | 3300005456 | Bacteria | 3647 |
| 122 | Ga0070678_100056209 | 3300005456 | Bacteria | 2877 |
| 123 | Ga0070678_100061286 | 3300005456 | Bacteria | 2772 |
| 124 | Ga0070678_100089587 | 3300005456 | Bacteria | 2355 |
| 125 | Ga0070678_100139062 | 3300005456 | Bacteria | 1940 |
| 126 | Ga0070662_100009816 | 3300005457 | Bacteria | 6271 |
| 127 | Ga0070662_100012878 | 3300005457 | Bacteria | 5557 |
| 128 | Ga0070662_100176492 | 3300005457 | Bacteria | 1682 |
| 129 | Ga0070662_100178517 | 3300005457 | Bacteria | 1672 |
| 130 | Ga0070681_10015832 | 3300005458 | Bacteria | 7517 |
| 131 | Ga0070681_10050414 | 3300005458 | Bacteria | 4153 |
| 132 | Ga0070681_10061500 | 3300005458 | Bacteria | 3729 |
| 133 | Ga0070681_10220683 | 3300005458 | Bacteria | 1811 |
| 134 | Ga0070681_10325796 | 3300005458 | Bacteria | 1446 |
| 135 | Ga0068867_100000874 | 3300005459 | Bacteria | 20341 |
| 136 | Ga0068867_100031810 | 3300005459 | Bacteria | 3812 |
| 137 | Ga0068867_100050648 | 3300005459 | Bacteria | 3062 |
| 138 | Ga0070685_10003079 | 3300005466 | Bacteria | 8488 |
| 139 | Ga0070685_10246411 | 3300005466 | Bacteria | 1182 |
| 140 | Ga0070707_100099390 | 3300005468 | Bacteria | 2819 |
| 141 | Ga0070679_100040768 | 3300005530 | Bacteria | 4619 |
| 142 | Ga0070679_100151164 | 3300005530 | Bacteria | 2298 |
| 143 | Ga0070679_100210850 | 3300005530 | Bacteria | 1906 |
| 144 | Ga0070684_100004467 | 3300005535 | Bacteria | 10651 |
| 145 | Ga0070684_100016286 | 3300005535 | Bacteria | 6074 |
| 146 | Ga0070684_100171967 | 3300005535 | Bacteria | 1968 |
| 147 | Ga0070697_100002564 | 3300005536 | Bacteria | 13978 |
| 148 | Ga0068853_100003110 | 3300005539 | Bacteria | 12691 |
| 149 | Ga0068853_100069092 | 3300005539 | Bacteria | 3072 |
| 150 | Ga0068853_100093456 | 3300005539 | Bacteria | 2648 |
| 151 | Ga0068853_100098738 | 3300005539 | Bacteria | 2579 |
| 152 | Ga0068853_100175699 | 3300005539 | Bacteria | 1940 |
| 153 | Ga0068853_100253732 | 3300005539 | Bacteria | 1615 |
| 154 | Ga0068853_100330674 | 3300005539 | Bacteria | 1414 |
| 155 | Ga0070672_100005379 | 3300005543 | Bacteria | 8483 |
| 156 | Ga0070672_100005531 | 3300005543 | Bacteria | 8389 |
| 157 | Ga0070672_100053092 | 3300005543 | Bacteria | 3167 |
| 158 | Ga0070672_100131220 | 3300005543 | Bacteria | 2059 |
| 159 | Ga0070672_100262842 | 3300005543 | Bacteria | 1456 |
| 160 | Ga0070686_100004079 | 3300005544 | Bacteria | 8032 |
| 161 | Ga0070695_100012339 | 3300005545 | Bacteria | 5123 |
| 162 | Ga0070695_100026443 | 3300005545 | Bacteria | 3590 |
| 163 | Ga0070695_100135344 | 3300005545 | Bacteria | 1703 |
| 164 | Ga0070696_100008243 | 3300005546 | Bacteria | 6975 |
| 165 | Ga0070696_100039848 | 3300005546 | Bacteria | 3244 |
| 166 | Ga0070693_100072635 | 3300005547 | Bacteria | 2030 |
| 167 | Ga0070693_100168400 | 3300005547 | Bacteria | 1401 |
| 168 | Ga0070665_100023550 | 3300005548 | Bacteria | 6200 |
| 169 | Ga0070665_100203213 | 3300005548 | Bacteria | 1982 |
| 170 | Ga0070665_100234436 | 3300005548 | Bacteria | 1836 |
| 171 | Ga0070665_100350418 | 3300005548 | Bacteria | 1482 |
| 172 | Ga0070704_100065568 | 3300005549 | Bacteria | 2615 |
| 173 | Ga0068855_100072645 | 3300005563 | Bacteria | 3998 |
| 174 | Ga0068855_100082241 | 3300005563 | Bacteria | 3732 |
| 175 | Ga0068855_100098486 | 3300005563 | Bacteria | 3368 |
| 176 | Ga0068855_100108293 | 3300005563 | Bacteria | 3192 |
| 177 | Ga0068855_100235299 | 3300005563 | Bacteria | 2049 |
| 178 | Ga0070664_100027792 | 3300005564 | Bacteria | 4703 |
| 179 | Ga0068857_100025732 | 3300005577 | Bacteria | 5181 |
| 180 | Ga0068857_100069181 | 3300005577 | Bacteria | 3143 |
| 181 | Ga0068854_100002509 | 3300005578 | Bacteria | 11386 |
| 182 | Ga0068854_100106576 | 3300005578 | Bacteria | 2109 |
| 183 | Ga0068856_100007430 | 3300005614 | Bacteria | 10692 |
| 184 | Ga0068856_100061086 | 3300005614 | Bacteria | 3722 |
| 185 | Ga0068856_100085445 | 3300005614 | Bacteria | 3134 |
| 186 | Ga0068856_100119327 | 3300005614 | Bacteria | 2638 |
| 187 | Ga0070702_100003283 | 3300005615 | Bacteria | 7206 |
| 188 | Ga0068852_100006607 | 3300005616 | Bacteria | 8398 |
| 189 | Ga0068852_100093916 | 3300005616 | Bacteria | 2689 |
| 190 | Ga0068852_100366140 | 3300005616 | Bacteria | 1411 |
| 191 | Ga0068859_100038170 | 3300005617 | Bacteria | 4819 |
| 192 | Ga0068859_100069054 | 3300005617 | Bacteria | 3568 |
| 193 | Ga0068859_100122021 | 3300005617 | Bacteria | 2672 |
| 194 | Ga0068859_100276898 | 3300005617 | Bacteria | 1770 |
| 195 | Ga0068864_100001321 | 3300005618 | Bacteria | 20620 |
| 196 | Ga0068864_100087223 | 3300005618 | Bacteria | 2747 |
| 197 | Ga0068864_100099414 | 3300005618 | Bacteria | 2577 |
| 198 | Ga0068864_100195682 | 3300005618 | Bacteria | 1855 |
| 199 | Ga0068866_10002168 | 3300005718 | Bacteria | 8173 |
| 200 | Ga0068866_10037249 | 3300005718 | Bacteria | 2388 |
| 201 | Ga0068866_10096173 | 3300005718 | Bacteria | 1624 |
| 202 | Ga0068870_10000716 | 3300005840 | Bacteria | 12739 |
| 203 | Ga0068863_100000965 | 3300005841 | Bacteria | 28914 |
| 204 | Ga0068863_100107159 | 3300005841 | Bacteria | 2659 |
| 205 | Ga0068863_100120246 | 3300005841 | Bacteria | 2504 |
| 206 | Ga0068858_100003017 | 3300005842 | Bacteria | 16885 |
| 207 | Ga0068858_100064343 | 3300005842 | Bacteria | 3394 |
| 208 | Ga0068858_100065499 | 3300005842 | Bacteria | 3362 |
| 209 | Ga0068858_100222549 | 3300005842 | Bacteria | 1788 |
| 210 | Ga0068860_100000577 | 3300005843 | Bacteria | 44036 |
| 211 | Ga0068860_100014200 | 3300005843 | Bacteria | 7808 |
| 212 | Ga0068860_100041961 | 3300005843 | Bacteria | 4371 |
| 213 | Ga0068860_100276217 | 3300005843 | Bacteria | 1641 |
| 214 | Ga0068860_100304064 | 3300005843 | Bacteria | 1563 |
| 215 | Ga0068862_100003246 | 3300005844 | Bacteria | 14077 |
| 216 | Ga0068862_100019155 | 3300005844 | Bacteria | 5706 |
| 217 | Ga0068862_100234364 | 3300005844 | Bacteria | 1666 |
| 218 | Ga0081455_10000327 | 3300005937 | Bacteria | 62253 |
| 219 | Ga0081455_10003093 | 3300005937 | Bacteria | 19378 |
| 220 | Ga0081455_10006033 | 3300005937 | Bacteria | 13120 |
| 221 | Ga0081455_10011459 | 3300005937 | Bacteria | 8907 |
| 222 | Ga0081455_10053413 | 3300005937 | Bacteria | 3451 |
| 223 | Ga0081455_10103105 | 3300005937 | Bacteria | 2286 |
| 224 | Ga0081455_10158909 | 3300005937 | Bacteria | 1735 |
| 225 | Ga0081455_10215824 | 3300005937 | Bacteria | 1426 |
| 226 | Ga0081540_1000102 | 3300005983 | Bacteria | 91311 |
| 227 | Ga0081540_1001430 | 3300005983 | Bacteria | 20638 |
| 228 | Ga0081540_1003410 | 3300005983 | Bacteria | 12579 |
| 229 | Ga0081540_1003755 | 3300005983 | Bacteria | 11903 |
| 230 | Ga0081540_1009790 | 3300005983 | Bacteria | 6562 |
| 231 | Ga0081540_1014713 | 3300005983 | Bacteria | 4996 |
| 232 | Ga0081540_1017229 | 3300005983 | Bacteria | 4479 |
| 233 | Ga0081540_1063111 | 3300005983 | Bacteria | 1755 |
| 234 | Ga0081539_10000048 | 3300005985 | Bacteria | 272906 |
| 235 | Ga0081539_10058707 | 3300005985 | Bacteria | 2122 |
| 236 | Ga0081539_10072824 | 3300005985 | Bacteria | 1835 |
| 237 | Ga0070717_10007141 | 3300006028 | Bacteria | 8277 |
| 238 | Ga0070717_10010868 | 3300006028 | Bacteria | 6891 |
| 239 | Ga0070717_10013303 | 3300006028 | Bacteria | 6301 |
| 240 | Ga0070717_10059267 | 3300006028 | Bacteria | 3167 |
| 241 | Ga0075365_10018199 | 3300006038 | Bacteria | 4315 |
| 242 | Ga0075365_10099182 | 3300006038 | Bacteria | 1993 |
| 243 | Ga0075363_100008259 | 3300006048 | Bacteria | 4839 |
| 244 | Ga0075363_100023705 | 3300006048 | Bacteria | 3114 |
| 245 | Ga0075432_10000765 | 3300006058 | Bacteria | 9994 |
| 246 | Ga0070716_100006717 | 3300006173 | Bacteria | 5634 |
| 247 | Ga0070712_100024348 | 3300006175 | Bacteria | 4011 |
| 248 | Ga0070712_100106270 | 3300006175 | Bacteria | 2086 |
| 249 | Ga0075362_10045225 | 3300006177 | Bacteria | 1954 |
| 250 | Ga0075367_10039381 | 3300006178 | Bacteria | 2756 |
| 251 | Ga0075367_10045981 | 3300006178 | Bacteria | 2563 |
| 252 | Ga0075367_10048843 | 3300006178 | Bacteria | 2494 |
| 253 | Ga0075369_10026031 | 3300006186 | Bacteria | 2436 |
| 254 | Ga0075366_10002375 | 3300006195 | Bacteria | 9645 |
| 255 | Ga0097621_100034122 | 3300006237 | Bacteria | 4057 |
| 256 | Ga0075370_10026132 | 3300006353 | Bacteria | 3232 |
| 257 | Ga0068871_100001025 | 3300006358 | Bacteria | 18716 |
| 258 | Ga0068871_100005428 | 3300006358 | Bacteria | 8937 |
| 259 | Ga0068871_100027579 | 3300006358 | Bacteria | 4443 |
| 260 | Ga0068871_100073854 | 3300006358 | Bacteria | 2812 |
| 261 | Ga0068871_100195067 | 3300006358 | Bacteria | 1746 |
| 262 | Ga0068871_100292928 | 3300006358 | Bacteria | 1427 |
| 263 | Ga0075428_100020912 | 3300006844 | Bacteria | 7246 |
| 264 | Ga0075428_100131629 | 3300006844 | Bacteria | 2720 |
| 265 | Ga0075428_100135424 | 3300006844 | Bacteria | 2679 |
| 266 | Ga0075430_100000026 | 3300006846 | Bacteria | 78833 |
| 267 | Ga0075430_100000222 | 3300006846 | Bacteria | 39248 |
| 268 | Ga0075430_100012924 | 3300006846 | Bacteria | 7115 |
| 269 | Ga0075431_100000451 | 3300006847 | Bacteria | 33773 |
| 270 | Ga0075431_100032904 | 3300006847 | Bacteria | 5343 |
| 271 | Ga0075433_10002991 | 3300006852 | Bacteria | 12983 |
| 272 | Ga0075433_10016718 | 3300006852 | Bacteria | 6056 |
| 273 | Ga0075434_100000110 | 3300006871 | Bacteria | 46873 |
| 274 | Ga0075434_100001174 | 3300006871 | Bacteria | 21706 |
| 275 | Ga0075429_100000247 | 3300006880 | Bacteria | 37266 |
| 276 | Ga0075429_100009429 | 3300006880 | Bacteria | 8475 |
| 277 | Ga0075429_100030873 | 3300006880 | Bacteria | 4657 |
| 278 | Ga0068865_100005281 | 3300006881 | Bacteria | 7815 |
| 279 | Ga0068865_100013742 | 3300006881 | Bacteria | 5127 |
| 280 | Ga0068865_100103441 | 3300006881 | Bacteria | 2089 |
| 281 | Ga0075436_100004698 | 3300006914 | Bacteria | 9369 |
| 282 | Ga0075436_100089836 | 3300006914 | Bacteria | 2135 |
| 283 | Ga0097620_100038166 | 3300006931 | Bacteria | 4819 |
| 284 | Ga0097620_100069047 | 3300006931 | Bacteria | 3568 |
| 285 | Ga0097620_100122027 | 3300006931 | Bacteria | 2672 |
| 286 | Ga0097620_100276897 | 3300006931 | Bacteria | 1770 |
| 287 | Ga0075435_100016201 | 3300007076 | Bacteria | 5618 |
| 288 | Ga0075435_100110089 | 3300007076 | Bacteria | 2290 |
| 289 | Ga0075435_100266357 | 3300007076 | Bacteria | 1461 |
| 290 | Ga0099794_10015687 | 3300007265 | Bacteria | 3349 |
| 291 | Ga0105251_10077573 | 3300009011 | Bacteria | 1540 |
| 292 | Ga0105240_10121284 | 3300009093 | Bacteria | 3147 |
| 293 | Ga0111539_10000337 | 3300009094 | Bacteria | 57733 |
| 294 | Ga0111539_10014415 | 3300009094 | Bacteria | 9866 |
| 295 | Ga0111539_10150346 | 3300009094 | Bacteria | 2726 |
| 296 | Ga0105245_10000380 | 3300009098 | Bacteria | 41293 |
| 297 | Ga0105245_10060762 | 3300009098 | Bacteria | 3404 |
| 298 | Ga0105245_10070201 | 3300009098 | Bacteria | 3178 |
| 299 | Ga0105245_10111892 | 3300009098 | Bacteria | 2540 |
| 300 | Ga0105245_10114924 | 3300009098 | Bacteria | 2507 |
| 301 | Ga0105247_10001411 | 3300009101 | Bacteria | 17428 |
| 302 | Ga0105247_10006423 | 3300009101 | Bacteria | 7280 |
| 303 | Ga0105247_10016700 | 3300009101 | Bacteria | 4401 |
| 304 | Ga0105247_10025590 | 3300009101 | Bacteria | 3561 |
| 305 | Ga0105247_10048427 | 3300009101 | Bacteria | 2610 |
| 306 | Ga0105247_10062814 | 3300009101 | Bacteria | 2304 |
| 307 | Ga0114129_10053822 | 3300009147 | Bacteria | 5645 |
| 308 | Ga0114129_10097181 | 3300009147 | Bacteria | 4077 |
| 309 | Ga0114129_10229244 | 3300009147 | Bacteria | 2502 |
| 310 | Ga0114129_10652340 | 3300009147 | Bacteria | 1358 |
| 311 | Ga0105243_10008080 | 3300009148 | Bacteria | 8076 |
| 312 | Ga0105243_10031539 | 3300009148 | Bacteria | 4087 |
| 313 | Ga0105243_10230951 | 3300009148 | Bacteria | 1641 |
| 314 | Ga0105243_10283021 | 3300009148 | Bacteria | 1494 |
| 315 | Ga0105241_10027743 | 3300009174 | Bacteria | 4215 |
| 316 | Ga0105241_10128056 | 3300009174 | Bacteria | 2052 |
| 317 | Ga0105241_10159805 | 3300009174 | Bacteria | 1851 |
| 318 | Ga0105242_10000350 | 3300009176 | Bacteria | 37047 |
| 319 | Ga0105242_10035266 | 3300009176 | Bacteria | 4012 |
| 320 | Ga0105242_10078490 | 3300009176 | Bacteria | 2756 |
| 321 | Ga0105242_10131844 | 3300009176 | Bacteria | 2158 |
| 322 | Ga0105248_10013825 | 3300009177 | Bacteria | 8882 |
| 323 | Ga0105248_10015595 | 3300009177 | Bacteria | 8376 |
| 324 | Ga0105248_10019063 | 3300009177 | Bacteria | 7586 |
| 325 | Ga0105248_10037197 | 3300009177 | Bacteria | 5445 |
| 326 | Ga0105248_10080964 | 3300009177 | Bacteria | 3651 |
| 327 | Ga0105248_10145105 | 3300009177 | Bacteria | 2678 |
| 328 | Ga0105237_10066040 | 3300009545 | Bacteria | 3612 |
| 329 | Ga0105237_10173347 | 3300009545 | Bacteria | 2157 |
| 330 | Ga0105237_10182842 | 3300009545 | Bacteria | 2096 |
| 331 | Ga0105237_10202763 | 3300009545 | Bacteria | 1984 |
| 332 | Ga0105237_10383751 | 3300009545 | Bacteria | 1410 |
| 333 | Ga0105249_10007137 | 3300009553 | Bacteria | 9750 |
| 334 | Ga0105249_10122164 | 3300009553 | Bacteria | 2476 |
| 335 | Ga0105239_10017528 | 3300010375 | Bacteria | 7921 |
| 336 | Ga0105239_10114074 | 3300010375 | Bacteria | 2997 |
| 337 | Ga0105239_10311499 | 3300010375 | Bacteria | 1774 |
| 338 | Ga0105239_10348954 | 3300010375 | Bacteria | 1671 |
| 339 | Ga0105246_10002609 | 3300011119 | Bacteria | 10906 |
| 340 | Ga0105246_10148574 | 3300011119 | Bacteria | 1771 |
| 341 | Ga0157373_10045507 | 3300013100 | Bacteria | 3132 |
| 342 | Ga0157371_10135704 | 3300013102 | Bacteria | 1752 |
| 343 | Ga0157370_10322474 | 3300013104 | Bacteria | 1425 |
| 344 | Ga0157369_10095876 | 3300013105 | Bacteria | 3165 |
| 345 | Ga0157369_10174759 | 3300013105 | Bacteria | 2261 |
| 346 | Ga0157374_10032360 | 3300013296 | Bacteria | 4761 |
| 347 | Ga0157374_10053103 | 3300013296 | Bacteria | 3777 |
| 348 | Ga0157374_10054750 | 3300013296 | Bacteria | 3722 |
| 349 | Ga0157374_10062182 | 3300013296 | Bacteria | 3498 |
| 350 | Ga0157374_10065956 | 3300013296 | Bacteria | 3401 |
| 351 | Ga0157374_10099654 | 3300013296 | Bacteria | 2784 |
| 352 | Ga0157378_10043205 | 3300013297 | Bacteria | 4002 |
| 353 | Ga0157378_10107630 | 3300013297 | Bacteria | 2551 |
| 354 | Ga0157378_10254793 | 3300013297 | Bacteria | 1681 |
| 355 | Ga0163162_10010530 | 3300013306 | Bacteria | 8994 |
| 356 | Ga0163162_10068510 | 3300013306 | Bacteria | 3600 |
| 357 | Ga0163162_10095629 | 3300013306 | Bacteria | 3058 |
| 358 | Ga0163162_10420014 | 3300013306 | Bacteria | 1470 |
| 359 | Ga0157372_10009499 | 3300013307 | Bacteria | 10344 |
| 360 | Ga0157372_10084860 | 3300013307 | Bacteria | 3591 |
| 361 | Ga0157375_10002791 | 3300013308 | Bacteria | 15110 |
| 362 | Ga0157375_10022203 | 3300013308 | Bacteria | 5839 |
| 363 | Ga0157375_10113058 | 3300013308 | Bacteria | 2816 |
| 364 | Ga0157375_10246096 | 3300013308 | Bacteria | 1948 |
| 365 | Ga0157375_10316399 | 3300013308 | Bacteria | 1725 |
| 366 | Ga0157375_10346805 | 3300013308 | Bacteria | 1650 |
| 367 | Ga0163163_10016636 | 3300014325 | Bacteria | 6838 |
| 368 | Ga0163163_10043798 | 3300014325 | Bacteria | 4390 |
| 369 | Ga0163163_10054275 | 3300014325 | Bacteria | 3959 |
| 370 | Ga0163163_10100808 | 3300014325 | Bacteria | 2910 |
| 371 | Ga0163163_10166611 | 3300014325 | Bacteria | 2250 |
| 372 | Ga0163163_10170037 | 3300014325 | Bacteria | 2226 |
| 373 | Ga0163163_10276705 | 3300014325 | Bacteria | 1730 |
| 374 | Ga0157380_10009701 | 3300014326 | Bacteria | 6906 |
| 375 | Ga0157380_10100720 | 3300014326 | Bacteria | 2406 |
| 376 | Ga0157380_10121457 | 3300014326 | Bacteria | 2213 |
| 377 | Ga0157380_10131344 | 3300014326 | Bacteria | 2137 |
| 378 | Ga0157380_10145235 | 3300014326 | Bacteria | 2044 |
| 379 | Ga0157380_10270244 | 3300014326 | Bacteria | 1549 |
| 380 | Ga0157377_10000341 | 3300014745 | Bacteria | 20841 |
| 381 | Ga0157377_10059329 | 3300014745 | Bacteria | 2181 |
| 382 | Ga0157379_10106097 | 3300014968 | Bacteria | 2522 |
| 383 | Ga0157379_10287188 | 3300014968 | Bacteria | 1498 |
| 384 | Ga0157376_10000663 | 3300014969 | Bacteria | 22264 |
| 385 | Ga0157376_10040464 | 3300014969 | Bacteria | 3809 |
| 386 | Ga0157376_10141002 | 3300014969 | Bacteria | 2162 |
| 387 | Ga0157376_10187083 | 3300014969 | Bacteria | 1896 |
| 388 | Ga0157376_10424407 | 3300014969 | Bacteria | 1291 |
| 389 | Ga0163161_10000379 | 3300017792 | Bacteria | 37281 |
| 390 | Ga0163161_10264180 | 3300017792 | Bacteria | 1345 |
| 391 | Ga0207666_1000103 | 3300025271 | Bacteria | 13338 |
| 392 | Ga0209758_1002448 | 3300025297 | Bacteria | 18947 |
| 393 | Ga0209758_1008580 | 3300025297 | Bacteria | 6576 |
| 394 | Ga0207697_10001374 | 3300025315 | Bacteria | 13320 |
| 395 | Ga0207697_10055588 | 3300025315 | Bacteria | 1641 |
| 396 | Ga0207653_10008349 | 3300025885 | Bacteria | 3226 |
| 397 | Ga0207682_10000043 | 3300025893 | Bacteria | 52108 |
| 398 | Ga0207682_10001519 | 3300025893 | Bacteria | 10697 |
| 399 | Ga0207682_10001931 | 3300025893 | Bacteria | 9419 |
| 400 | Ga0207692_10003295 | 3300025898 | Bacteria | 6293 |
| 401 | Ga0207692_10006313 | 3300025898 | Bacteria | 4803 |
| 402 | Ga0207642_10007175 | 3300025899 | Bacteria | 3750 |
| 403 | Ga0207710_10008560 | 3300025900 | Bacteria | 4313 |
| 404 | Ga0207710_10049955 | 3300025900 | Bacteria | 1875 |
| 405 | Ga0207688_10000083 | 3300025901 | Bacteria | 36050 |
| 406 | Ga0207688_10004971 | 3300025901 | Bacteria | 7237 |
| 407 | Ga0207680_10006796 | 3300025903 | Bacteria | 5551 |
| 408 | Ga0207647_10003002 | 3300025904 | Bacteria | 12691 |
| 409 | Ga0207685_10000528 | 3300025905 | Bacteria | 6575 |
| 410 | Ga0207685_10000914 | 3300025905 | Bacteria | 5631 |
| 411 | Ga0207699_10006599 | 3300025906 | Bacteria | 5632 |
| 412 | Ga0207699_10010546 | 3300025906 | Bacteria | 4642 |
| 413 | Ga0207699_10045368 | 3300025906 | Bacteria | 2565 |
| 414 | Ga0207645_10000899 | 3300025907 | Bacteria | 24667 |
| 415 | Ga0207645_10014247 | 3300025907 | Bacteria | 5326 |
| 416 | Ga0207645_10070342 | 3300025907 | Bacteria | 2238 |
| 417 | Ga0207643_10000128 | 3300025908 | Bacteria | 51191 |
| 418 | Ga0207643_10038664 | 3300025908 | Bacteria | 2681 |
| 419 | Ga0207643_10140506 | 3300025908 | Bacteria | 1442 |
| 420 | Ga0207684_10204578 | 3300025910 | Bacteria | 1703 |
| 421 | Ga0207654_10005950 | 3300025911 | Bacteria | 6140 |
| 422 | Ga0207707_10001534 | 3300025912 | Bacteria | 21320 |
| 423 | Ga0207707_10004166 | 3300025912 | Bacteria | 12809 |
| 424 | Ga0207707_10055634 | 3300025912 | Bacteria | 3441 |
| 425 | Ga0207707_10345496 | 3300025912 | Bacteria | 1282 |
| 426 | Ga0207695_10089205 | 3300025913 | Bacteria | 3101 |
| 427 | Ga0207695_10247016 | 3300025913 | Bacteria | 1684 |
| 428 | Ga0207671_10057611 | 3300025914 | Bacteria | 2880 |
| 429 | Ga0207671_10073915 | 3300025914 | Bacteria | 2547 |
| 430 | Ga0207671_10113763 | 3300025914 | Bacteria | 2062 |
| 431 | Ga0207671_10156329 | 3300025914 | Bacteria | 1764 |
| 432 | Ga0207671_10192162 | 3300025914 | Bacteria | 1592 |
| 433 | Ga0207693_10003105 | 3300025915 | Bacteria | 14304 |
| 434 | Ga0207693_10117568 | 3300025915 | Bacteria | 2087 |
| 435 | Ga0207693_10156925 | 3300025915 | Bacteria | 1790 |
| 436 | Ga0207663_10003674 | 3300025916 | Bacteria | 7543 |
| 437 | Ga0207663_10009887 | 3300025916 | Bacteria | 5051 |
| 438 | Ga0207663_10027621 | 3300025916 | Bacteria | 3311 |
| 439 | Ga0207660_10023127 | 3300025917 | Bacteria | 4194 |
| 440 | Ga0207660_10044159 | 3300025917 | Bacteria | 3135 |
| 441 | Ga0207660_10049075 | 3300025917 | Bacteria | 2990 |
| 442 | Ga0207662_10000975 | 3300025918 | Bacteria | 13319 |
| 443 | Ga0207662_10231736 | 3300025918 | Bacteria | 1206 |
| 444 | Ga0207657_10020169 | 3300025919 | Bacteria | 6307 |
| 445 | Ga0207649_10002321 | 3300025920 | Bacteria | 10689 |
| 446 | Ga0207652_10005425 | 3300025921 | Bacteria | 10348 |
| 447 | Ga0207652_10013947 | 3300025921 | Bacteria | 6506 |
| 448 | Ga0207652_10024211 | 3300025921 | Bacteria | 5035 |
| 449 | Ga0207652_10027543 | 3300025921 | Bacteria | 4736 |
| 450 | Ga0207652_10056338 | 3300025921 | Bacteria | 3384 |
| 451 | Ga0207646_10220450 | 3300025922 | Bacteria | 1714 |
| 452 | Ga0207681_10006781 | 3300025923 | Bacteria | 7022 |
| 453 | Ga0207681_10188193 | 3300025923 | Bacteria | 1577 |
| 454 | Ga0207694_10032282 | 3300025924 | Bacteria | 4006 |
| 455 | Ga0207650_10008902 | 3300025925 | Bacteria | 6860 |
| 456 | Ga0207650_10123258 | 3300025925 | Bacteria | 2020 |
| 457 | Ga0207659_10007188 | 3300025926 | Bacteria | 6838 |
| 458 | Ga0207659_10050993 | 3300025926 | Bacteria | 2941 |
| 459 | Ga0207687_10000522 | 3300025927 | Bacteria | 25753 |
| 460 | Ga0207687_10062204 | 3300025927 | Bacteria | 2639 |
| 461 | Ga0207687_10150080 | 3300025927 | Bacteria | 1777 |
| 462 | Ga0207700_10004890 | 3300025928 | Bacteria | 7962 |
| 463 | Ga0207700_10024078 | 3300025928 | Bacteria | 4208 |
| 464 | Ga0207700_10025747 | 3300025928 | Bacteria | 4091 |
| 465 | Ga0207700_10149321 | 3300025928 | Bacteria | 1930 |
| 466 | Ga0207664_10010948 | 3300025929 | Bacteria | 6424 |
| 467 | Ga0207644_10000611 | 3300025931 | Bacteria | 22735 |
| 468 | Ga0207644_10006011 | 3300025931 | Bacteria | 7913 |
| 469 | Ga0207644_10075011 | 3300025931 | Bacteria | 2484 |
| 470 | Ga0207690_10003223 | 3300025932 | Bacteria | 9794 |
| 471 | Ga0207706_10001616 | 3300025933 | Bacteria | 22352 |
| 472 | Ga0207706_10015033 | 3300025933 | Bacteria | 7006 |
| 473 | Ga0207686_10014769 | 3300025934 | Bacteria | 4357 |
| 474 | Ga0207686_10056767 | 3300025934 | Bacteria | 2462 |
| 475 | Ga0207709_10009743 | 3300025935 | Bacteria | 5295 |
| 476 | Ga0207709_10026097 | 3300025935 | Bacteria | 3353 |
| 477 | Ga0207709_10248435 | 3300025935 | Bacteria | 1298 |
| 478 | Ga0207709_10262109 | 3300025935 | Bacteria | 1268 |
| 479 | Ga0207670_10000631 | 3300025936 | Bacteria | 18876 |
| 480 | Ga0207670_10007366 | 3300025936 | Bacteria | 6135 |
| 481 | Ga0207669_10000797 | 3300025937 | Bacteria | 13482 |
| 482 | Ga0207669_10002598 | 3300025937 | Bacteria | 7722 |
| 483 | Ga0207669_10290147 | 3300025937 | Bacteria | 1238 |
| 484 | Ga0207704_10047461 | 3300025938 | Bacteria | 2567 |
| 485 | Ga0207704_10292194 | 3300025938 | Bacteria | 1244 |
| 486 | Ga0207665_10001379 | 3300025939 | Bacteria | 16369 |
| 487 | Ga0207665_10009568 | 3300025939 | Bacteria | 6365 |
| 488 | Ga0207665_10092666 | 3300025939 | Bacteria | 2097 |
| 489 | Ga0207691_10000599 | 3300025940 | Bacteria | 35997 |
| 490 | Ga0207691_10002935 | 3300025940 | Bacteria | 16639 |
| 491 | Ga0207691_10019716 | 3300025940 | Bacteria | 6378 |
| 492 | Ga0207691_10023830 | 3300025940 | Bacteria | 5760 |
| 493 | Ga0207691_10173454 | 3300025940 | Bacteria | 1887 |
| 494 | Ga0207711_10008296 | 3300025941 | Bacteria | 8696 |
| 495 | Ga0207711_10010676 | 3300025941 | Bacteria | 7637 |
| 496 | Ga0207711_10052202 | 3300025941 | Bacteria | 3503 |
| 497 | Ga0207711_10077904 | 3300025941 | Bacteria | 2890 |
| 498 | Ga0207711_10235281 | 3300025941 | Bacteria | 1679 |
| 499 | Ga0207689_10000165 | 3300025942 | Bacteria | 57494 |
| 500 | Ga0207689_10054251 | 3300025942 | Bacteria | 3302 |
| 501 | Ga0207689_10126494 | 3300025942 | Bacteria | 2102 |
| 502 | Ga0207689_10181700 | 3300025942 | Bacteria | 1734 |
| 503 | Ga0207689_10266925 | 3300025942 | Bacteria | 1416 |
| 504 | Ga0207689_10320271 | 3300025942 | Bacteria | 1287 |
| 505 | Ga0207661_10004909 | 3300025944 | Bacteria | 9371 |
| 506 | Ga0207661_10011748 | 3300025944 | Bacteria | 6356 |
| 507 | Ga0207661_10047173 | 3300025944 | Bacteria | 3419 |
| 508 | Ga0207679_10000112 | 3300025945 | Bacteria | 65716 |
| 509 | Ga0207667_10025956 | 3300025949 | Bacteria | 6408 |
| 510 | Ga0207667_10203956 | 3300025949 | Bacteria | 2028 |
| 511 | Ga0207667_10214557 | 3300025949 | Bacteria | 1972 |
| 512 | Ga0207667_10313675 | 3300025949 | Bacteria | 1602 |
| 513 | Ga0207651_10000099 | 3300025960 | Bacteria | 38059 |
| 514 | Ga0207651_10031165 | 3300025960 | Bacteria | 3405 |
| 515 | Ga0207712_10001957 | 3300025961 | Bacteria | 13516 |
| 516 | Ga0207668_10003391 | 3300025972 | Bacteria | 9338 |
| 517 | Ga0207668_10110071 | 3300025972 | Bacteria | 2065 |
| 518 | Ga0207668_10113802 | 3300025972 | Bacteria | 2035 |
| 519 | Ga0207668_10115342 | 3300025972 | Bacteria | 2023 |
| 520 | Ga0207668_10126611 | 3300025972 | Bacteria | 1943 |
| 521 | Ga0207668_10204806 | 3300025972 | Bacteria | 1574 |
| 522 | Ga0207668_10226629 | 3300025972 | Bacteria | 1504 |
| 523 | Ga0207640_10000382 | 3300025981 | Bacteria | 28458 |
| 524 | Ga0207658_10035295 | 3300025986 | Bacteria | 3580 |
| 525 | Ga0207658_10276669 | 3300025986 | Bacteria | 1437 |
| 526 | Ga0207677_10005315 | 3300026023 | Bacteria | 6981 |
| 527 | Ga0207677_10010700 | 3300026023 | Bacteria | 5199 |
| 528 | Ga0207677_10133847 | 3300026023 | Bacteria | 1887 |
| 529 | Ga0207677_10174836 | 3300026023 | Bacteria | 1683 |
| 530 | Ga0207677_10189017 | 3300026023 | Bacteria | 1627 |
| 531 | Ga0207703_10004258 | 3300026035 | Bacteria | 11776 |
| 532 | Ga0207703_10025231 | 3300026035 | Bacteria | 4675 |
| 533 | Ga0207639_10032542 | 3300026041 | Bacteria | 3839 |
| 534 | Ga0207639_10042404 | 3300026041 | Bacteria | 3410 |
| 535 | Ga0207639_10205900 | 3300026041 | Bacteria | 1690 |
| 536 | Ga0207639_10208433 | 3300026041 | Bacteria | 1681 |
| 537 | Ga0207639_10269595 | 3300026041 | Bacteria | 1493 |
| 538 | Ga0207639_10285271 | 3300026041 | Bacteria | 1454 |
| 539 | Ga0207678_10003272 | 3300026067 | Bacteria | 14619 |
| 540 | Ga0207678_10007002 | 3300026067 | Bacteria | 10009 |
| 541 | Ga0207678_10031527 | 3300026067 | Bacteria | 4624 |
| 542 | Ga0207678_10056323 | 3300026067 | Bacteria | 3384 |
| 543 | Ga0207678_10299181 | 3300026067 | Bacteria | 1382 |
| 544 | Ga0207708_10012755 | 3300026075 | Bacteria | 6267 |
| 545 | Ga0207708_10148868 | 3300026075 | Bacteria | 1841 |
| 546 | Ga0207708_10397502 | 3300026075 | Bacteria | 1139 |
| 547 | Ga0207702_10093858 | 3300026078 | Bacteria | 2633 |
| 548 | Ga0207702_10142451 | 3300026078 | Bacteria | 2171 |
| 549 | Ga0207641_10001777 | 3300026088 | Bacteria | 20763 |
| 550 | Ga0207648_10007480 | 3300026089 | Bacteria | 10733 |
| 551 | Ga0207648_10031836 | 3300026089 | Bacteria | 4661 |
| 552 | Ga0207648_10047840 | 3300026089 | Bacteria | 3747 |
| 553 | Ga0207676_10000494 | 3300026095 | Bacteria | 33145 |
| 554 | Ga0207676_10014703 | 3300026095 | Bacteria | 5637 |
| 555 | Ga0207676_10123689 | 3300026095 | Bacteria | 2186 |
| 556 | Ga0207674_10020449 | 3300026116 | Bacteria | 7152 |
| 557 | Ga0207674_10035721 | 3300026116 | Bacteria | 5186 |
| 558 | Ga0207674_10082755 | 3300026116 | Bacteria | 3210 |
| 559 | Ga0207674_10099104 | 3300026116 | Bacteria | 2897 |
| 560 | Ga0207674_10102256 | 3300026116 | Bacteria | 2846 |
| 561 | Ga0207675_100003533 | 3300026118 | Bacteria | 15253 |
| 562 | Ga0207675_100301176 | 3300026118 | Bacteria | 1561 |
| 563 | Ga0207683_10001272 | 3300026121 | Bacteria | 22830 |
| 564 | Ga0207683_10001853 | 3300026121 | Bacteria | 18701 |
| 565 | Ga0207683_10007911 | 3300026121 | Bacteria | 9095 |
| 566 | Ga0207683_10011627 | 3300026121 | Bacteria | 7513 |
| 567 | Ga0207683_10014162 | 3300026121 | Bacteria | 6795 |
| 568 | Ga0207683_10015318 | 3300026121 | Bacteria | 6529 |
| 569 | Ga0207683_10027632 | 3300026121 | Bacteria | 4902 |
| 570 | Ga0207683_10042796 | 3300026121 | Bacteria | 3956 |
| 571 | Ga0207683_10185536 | 3300026121 | Bacteria | 1887 |
| 572 | Ga0207683_10194398 | 3300026121 | Bacteria | 1843 |
| 573 | Ga0207698_10063441 | 3300026142 | Bacteria | 2891 |
| 574 | Ga0207698_10070195 | 3300026142 | Bacteria | 2774 |
| 575 | Ga0210002_1001992 | 3300027617 | Bacteria | 2937 |
| 576 | Ga0209998_10001588 | 3300027717 | Bacteria | 5462 |
| 577 | Ga0209813_10016915 | 3300027866 | Bacteria | 1997 |
| 578 | Ga0209974_10032320 | 3300027876 | Bacteria | 1734 |
| 579 | Ga0207428_10000064 | 3300027907 | Bacteria | 151185 |
| 580 | Ga0207428_10000140 | 3300027907 | Bacteria | 97818 |
| 581 | Ga0268266_10004422 | 3300028379 | Bacteria | 13462 |
| 582 | Ga0268266_10007719 | 3300028379 | Bacteria | 9656 |
| 583 | Ga0268266_10025484 | 3300028379 | Bacteria | 5032 |
| 584 | Ga0268266_10047939 | 3300028379 | Bacteria | 3661 |
| 585 | Ga0268266_10055302 | 3300028379 | Bacteria | 3412 |
| 586 | Ga0268266_10110471 | 3300028379 | Bacteria | 2435 |
| 587 | Ga0268266_10127814 | 3300028379 | Bacteria | 2270 |
| 588 | Ga0268266_10195528 | 3300028379 | Bacteria | 1848 |
| 589 | Ga0268266_10318353 | 3300028379 | Bacteria | 1455 |
| 590 | Ga0268266_10365962 | 3300028379 | Bacteria | 1357 |
| 591 | Ga0268266_10418333 | 3300028379 | Bacteria | 1270 |
| 592 | Ga0268265_10011223 | 3300028380 | Bacteria | 6056 |
| 593 | Ga0268265_10026351 | 3300028380 | Bacteria | 4135 |
| 594 | Ga0268265_10113231 | 3300028380 | Bacteria | 2219 |
| 595 | Ga0268265_10205865 | 3300028380 | Bacteria | 1710 |
| 596 | Ga0268264_10000107 | 3300028381 | Bacteria | 209105 |
| 597 | Ga0268264_10005082 | 3300028381 | Bacteria | 11144 |
| 598 | Ga0268264_10086725 | 3300028381 | Bacteria | 2690 |
| 599 | Ga0268264_10104967 | 3300028381 | Bacteria | 2464 |
| 600 | Ga0265334_10015125 | 3300028573 | Bacteria | 3210 |
| 601 | Ga0307515_10060988 | 3300028794 | Bacteria | 5363 |
| 602 | Ga0265332_10050236 | 3300031238 | Bacteria | 1792 |
| 603 | Ga0265328_10058289 | 3300031239 | Bacteria | 1418 |
| 604 | Ga0265325_10000006 | 3300031241 | Bacteria | 255758 |
| 605 | Ga0265325_10075637 | 3300031241 | Bacteria | 1681 |
| 606 | Ga0265329_10012070 | 3300031242 | Bacteria | 3119 |
| 607 | Ga0265340_10014381 | 3300031247 | Bacteria | 4134 |
| 608 | Ga0265339_10006887 | 3300031249 | Bacteria | 7407 |
| 609 | Ga0265331_10034717 | 3300031250 | Bacteria | 2485 |
| 610 | Ga0265316_10221091 | 3300031344 | Bacteria | 1397 |
| 611 | Ga0307513_10077502 | 3300031456 | Bacteria | 3442 |
| 612 | Ga0307513_10144650 | 3300031456 | Bacteria | 2298 |
| 613 | Ga0307509_10021381 | 3300031507 | Bacteria | 7315 |
| 614 | Ga0265313_10023271 | 3300031595 | Bacteria | 3341 |
| 615 | Ga0307508_10000154 | 3300031616 | Bacteria | 82824 |
| 616 | Ga0307508_10265459 | 3300031616 | Bacteria | 1311 |
| 617 | Ga0265314_10005615 | 3300031711 | Bacteria | 11266 |
| 618 | Ga0265342_10003968 | 3300031712 | Bacteria | 11854 |
| 619 | Ga0265342_10017314 | 3300031712 | Bacteria | 4691 |
| 620 | Ga0265342_10102272 | 3300031712 | Bacteria | 1630 |
| 621 | Ga0265342_10106101 | 3300031712 | Bacteria | 1595 |
| 622 | Ga0307516_10029059 | 3300031730 | Bacteria | 5590 |
| 623 | Ga0307410_10174005 | 3300031852 | Bacteria | 1625 |
| 624 | Ga0307416_100063443 | 3300032002 | Bacteria | 3026 |
| 625 | Ga0307510_10156282 | 3300033180 | Bacteria | 1887 |
| 626 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 627 | Ga0373930_0001231 | 3300034816 | Bacteria | 3781 |
| 628 | Ga0373958_0010245 | 3300034819 | Bacteria | 1560 |
| 629 | Ga0373959_0002918 | 3300034820 | Bacteria | 2713 |
| 630 | Ga0373938_0015719 | 3300034957 | Bacteria | 1470 |
| 631 | Ga0373928_0022088 | 3300035084 | Bacteria | 1347 |
| 632 | Ga0373929_0017606 | 3300035085 | Bacteria | 1412 |
| 633 | Ga0373934_0023900 | 3300035086 | Bacteria | 2363 |
| 634 | Ga0373940_0004788 | 3300035088 | Bacteria | 2885 |
| 635 | Ga0373952_0000859 | 3300035092 | Bacteria | 5518 |
| 636 | Ga0373952_0004422 | 3300035092 | Bacteria | 2550 |
| 637 | Ga0373923_0040479 | 3300035111 | Bacteria | 1918 |
| 638 | Ga0373923_0051674 | 3300035111 | Bacteria | 1725 |
| 639 | Ga0373923_0119338 | 3300035111 | Bacteria | 1177 |
| 640 | Ga0373936_0006063 | 3300035113 | Bacteria | 4555 |
| 641 | Ga0373941_0000494 | 3300035115 | Bacteria | 7908 |
| 642 | Ga0373941_0005534 | 3300035115 | Bacteria | 2978 |
| 643 | Ga0373941_0007844 | 3300035115 | Bacteria | 2630 |
| 644 | Ga0373953_0001092 | 3300035117 | Bacteria | 7676 |
| 645 | Ga0373953_0004155 | 3300035117 | Bacteria | 4592 |
| 646 | Ga0373953_0019195 | 3300035117 | Bacteria | 2541 |
| 647 | Ga0373954_0001821 | 3300035118 | Bacteria | 8793 |
| 648 | Ga0373954_0046149 | 3300035118 | Bacteria | 2036 |
| 649 | Ga0373956_0002051 | 3300035119 | Bacteria | 8345 |
| 650 | Ga0373956_0002956 | 3300035119 | Bacteria | 6879 |
| 651 | Ga0373957_0000374 | 3300035120 | Bacteria | 11335 |
| 652 | Ga0373960_0000398 | 3300035121 | Bacteria | 8493 |
| 653 | Ga0373960_0040243 | 3300035121 | Bacteria | 1348 |
| 654 | Ga0373943_0005372 | 3300035170 | Bacteria | 5763 |
| 655 | Ga0373943_0052716 | 3300035170 | Bacteria | 2006 |
| 656 | Ga0373943_0162967 | 3300035170 | Bacteria | 1215 |
| 657 | Ga0373946_0027757 | 3300035171 | Bacteria | 2241 |
| 658 | Ga0373946_0137298 | 3300035171 | Bacteria | 1130 |
| 659 | Ga0373955_0009267 | 3300035172 | Bacteria | 4609 |
| 660 | Ga0373955_0009372 | 3300035172 | Bacteria | 4582 |
| 661 | Ga0373955_0011740 | 3300035172 | Bacteria | 4187 |
| 662 | Ga0373955_0046015 | 3300035172 | Bacteria | 2357 |
| 663 | Ga0373962_0003525 | 3300035242 | Bacteria | 3760 |
| 664 | Ga0373962_0022368 | 3300035242 | Bacteria | 1676 |
| 665 | Ga0373924_0020683 | 3300035410 | Bacteria | 2560 |
| 666 | Ga0373931_0001718 | 3300035691 | Bacteria | 9499 |
| 667 | Ga0373931_0014040 | 3300035691 | Bacteria | 3908 |
| 668 | Ga0373931_0019150 | 3300035691 | Bacteria | 3412 |
| 669 | Ga0373931_0034618 | 3300035691 | Bacteria | 2622 |
| 670 | Ga0373935_0006022 | 3300035692 | Bacteria | 7205 |
| 671 | Ga0373935_0083521 | 3300035692 | Bacteria | 2079 |
| 672 | Ga0373935_0107474 | 3300035692 | Bacteria | 1847 |
| 673 | Ga0373935_0206185 | 3300035692 | Bacteria | 1361 |
| 674 | Ga0373927_0025352 | 3300035695 | Bacteria | 3876 |
| 675 | Ga0373927_0042636 | 3300035695 | Bacteria | 2940 |
| 676 | Ga0373927_0153904 | 3300035695 | Bacteria | 1505 |
| 677 | Ga0373933_0001100 | 3300035724 | Bacteria | 16117 |
| 678 | Ga0373933_0045156 | 3300035724 | Bacteria | 2612 |
| 679 | Ga0373947_0000340 | 3300035725 | Bacteria | 26369 |
| 680 | Ga0373947_0035595 | 3300035725 | Bacteria | 2948 |
| 681 | Ga0373947_0064359 | 3300035725 | Bacteria | 2236 |
| 682 | Ga0373947_0088961 | 3300035725 | Bacteria | 1923 |
| 683 | Ga0373947_0170331 | 3300035725 | Bacteria | 1412 |
| 684 | Ga0373937_0001302 | 3300036401 | Bacteria | 20904 |
| 685 | Ga0373937_0002947 | 3300036401 | Bacteria | 14245 |
| 686 | Ga0373937_0005103 | 3300036401 | Bacteria | 11187 |
| 687 | Ga0373937_0017774 | 3300036401 | Bacteria | 6344 |
| 688 | Ga0373937_0064217 | 3300036401 | Bacteria | 3377 |
| 689 | Ga0373937_0318829 | 3300036401 | Bacteria | 1470 |
| 690 | Ga0373925_0007663 | 3300037068 | Bacteria | 7864 |
| 691 | Ga0373925_0008452 | 3300037068 | Bacteria | 7500 |
| 692 | Ga0373925_0020271 | 3300037068 | Bacteria | 4838 |
| 693 | Ga0373925_0052361 | 3300037068 | Bacteria | 3050 |
| 694 | Ga0436364_1064018 | 3300037853 | Bacteria | 2560 |
| 695 | Ga0395901_0784501 | 3300038443 | Bacteria | 943 |
| 696 | Ga0436365_0702073 | 3300039437 | Bacteria | 1769 |
| 697 | Ga0439453_0000060 | 3300041408 | Bacteria | 7820 |
| 698 | Ga0451807_0668963 | 3300041486 | Bacteria | 1500 |
| 699 | Ga0439435_0002105 | 3300042436 | Bacteria | 3870 |
| 700 | Ga0466957_0033043 | 3300044842 | Bacteria | 3102 |
| 701 | Ga0466958_0114579 | 3300045836 | Bacteria | 1684 |
| 702 | Ga0466967_0122303 | 3300045976 | Bacteria | 2407 |
| 703 | Ga0495592_0001601 | 3300046454 | Bacteria | 15847 |
| 704 | Ga0495592_0005759 | 3300046454 | Bacteria | 9175 |
| 705 | Ga0495603_0019964 | 3300046455 | Bacteria | 4059 |
| 706 | Ga0495603_0022944 | 3300046455 | Bacteria | 3777 |
| 707 | Ga0495603_0025589 | 3300046455 | Bacteria | 3569 |
| 708 | Ga0495603_0053963 | 3300046455 | Bacteria | 2384 |
| 709 | Ga0495603_0099568 | 3300046455 | Bacteria | 1697 |
| 710 | Ga0495629_0000529 | 3300046459 | Bacteria | 31881 |
| 711 | Ga0495629_0008986 | 3300046459 | Bacteria | 7333 |
| 712 | Ga0495629_0046527 | 3300046459 | Bacteria | 3043 |
| 713 | Ga0495629_0059688 | 3300046459 | Bacteria | 2666 |
| 714 | Ga0495629_0172112 | 3300046459 | Bacteria | 1502 |
| 715 | Ga0495638_0009159 | 3300046460 | Bacteria | 6963 |
| 716 | Ga0495638_0011077 | 3300046460 | Bacteria | 6233 |
| 717 | Ga0495651_0001433 | 3300046462 | Bacteria | 18463 |
| 718 | Ga0495651_0020115 | 3300046462 | Bacteria | 5181 |
| 719 | Ga0495651_0195766 | 3300046462 | Bacteria | 1419 |
| 720 | Ga0495651_0260327 | 3300046462 | Bacteria | 1180 |
| 721 | Ga0495653_0016031 | 3300046463 | Bacteria | 6107 |
| 722 | Ga0495653_0051871 | 3300046463 | Bacteria | 3146 |
| 723 | Ga0495653_0089488 | 3300046463 | Bacteria | 2255 |
| 724 | Ga0495653_0090070 | 3300046463 | Bacteria | 2246 |
| 725 | Ga0495653_0160841 | 3300046463 | Bacteria | 1559 |
| 726 | Ga0495582_0006293 | 3300046473 | Bacteria | 6611 |
| 727 | Ga0495605_0058205 | 3300046474 | Bacteria | 1858 |
| 728 | Ga0495605_0126410 | 3300046474 | Bacteria | 1156 |
| 729 | Ga0495639_0009690 | 3300046475 | Bacteria | 4134 |
| 730 | Ga0495639_0034011 | 3300046475 | Bacteria | 2278 |
| 731 | Ga0495639_0066427 | 3300046475 | Bacteria | 1660 |
| 732 | Ga0495664_0018790 | 3300046477 | Bacteria | 3966 |
| 733 | Ga0495664_0023312 | 3300046477 | Bacteria | 3592 |
| 734 | Ga0495664_0029806 | 3300046477 | Bacteria | 3194 |
| 735 | Ga0495664_0037955 | 3300046477 | Bacteria | 2843 |
| 736 | Ga0495584_0120905 | 3300046491 | Bacteria | 1326 |
| 737 | Ga0495585_0004431 | 3300046492 | Bacteria | 9107 |
| 738 | Ga0495585_0031604 | 3300046492 | Bacteria | 3004 |
| 739 | Ga0495585_0038601 | 3300046492 | Bacteria | 2687 |
| 740 | Ga0495585_0105382 | 3300046492 | Bacteria | 1504 |
| 741 | Ga0495594_0054755 | 3300046499 | Bacteria | 2199 |
| 742 | Ga0495583_0104207 | 3300046506 | Bacteria | 1208 |
| 743 | Ga0495606_0001566 | 3300046507 | Bacteria | 29975 |
| 744 | Ga0495606_0074530 | 3300046507 | Bacteria | 2126 |
| 745 | Ga0495608_0008113 | 3300046511 | Bacteria | 7381 |
| 746 | Ga0495608_0011568 | 3300046511 | Bacteria | 6139 |
| 747 | Ga0495608_0016511 | 3300046511 | Bacteria | 5108 |
| 748 | Ga0495608_0098528 | 3300046511 | Bacteria | 1886 |
| 749 | Ga0495618_0015173 | 3300046514 | Bacteria | 4700 |
| 750 | Ga0495618_0048917 | 3300046514 | Bacteria | 2670 |
| 751 | Ga0495628_0002572 | 3300046516 | Bacteria | 16332 |
| 752 | Ga0495628_0007597 | 3300046516 | Bacteria | 9371 |
| 753 | Ga0495628_0015999 | 3300046516 | Bacteria | 6258 |
| 754 | Ga0495628_0314441 | 3300046516 | Bacteria | 1157 |
| 755 | Ga0495630_0040548 | 3300046517 | Bacteria | 3480 |
| 756 | Ga0495630_0103006 | 3300046517 | Bacteria | 2160 |
| 757 | Ga0495631_0115442 | 3300046518 | Bacteria | 1154 |
| 758 | Ga0495666_0069319 | 3300046526 | Bacteria | 1678 |
| 759 | Ga0495652_0002428 | 3300046529 | Bacteria | 19213 |
| 760 | Ga0495652_0091823 | 3300046529 | Bacteria | 2481 |
| 761 | Ga0495652_0115683 | 3300046529 | Bacteria | 2148 |
| 762 | Ga0495665_0005351 | 3300046531 | Bacteria | 6920 |
| 763 | Ga0495665_0085638 | 3300046531 | Bacteria | 1656 |
| 764 | Ga0495640_0015450 | 3300046533 | Bacteria | 5745 |
| 765 | Ga0495640_0047337 | 3300046533 | Bacteria | 2976 |
| 766 | Ga0495640_0064294 | 3300046533 | Bacteria | 2481 |
| 767 | Ga0495587_0009736 | 3300046536 | Bacteria | 6144 |
| 768 | Ga0495587_0052159 | 3300046536 | Bacteria | 2414 |
| 769 | Ga0495598_0017520 | 3300046537 | Bacteria | 1848 |
| 770 | Ga0495609_0090437 | 3300046538 | Bacteria | 1331 |
| 771 | Ga0495621_0023115 | 3300046539 | Bacteria | 2066 |
| 772 | Ga0495621_0050206 | 3300046539 | Bacteria | 1490 |
| 773 | Ga0495645_0001788 | 3300046543 | Bacteria | 14608 |
| 774 | Ga0495645_0025716 | 3300046543 | Bacteria | 4274 |
| 775 | Ga0495645_0028258 | 3300046543 | Bacteria | 4076 |
| 776 | Ga0495645_0038226 | 3300046543 | Bacteria | 3501 |
| 777 | Ga0495645_0052493 | 3300046543 | Bacteria | 2966 |
| 778 | Ga0495645_0094722 | 3300046543 | Bacteria | 2129 |
| 779 | Ga0495667_0003563 | 3300046559 | Bacteria | 10468 |
| 780 | Ga0495667_0005768 | 3300046559 | Bacteria | 8384 |
| 781 | Ga0495667_0119452 | 3300046559 | Bacteria | 1702 |
| 782 | Ga0495656_0016994 | 3300046615 | Bacteria | 2770 |
| 783 | Ga0495656_0032549 | 3300046615 | Bacteria | 2122 |
| 784 | Ga0495656_0035929 | 3300046615 | Bacteria | 2038 |
| 785 | Ga0495656_0091561 | 3300046615 | Bacteria | 1391 |
| 786 | Ga0495668_0118180 | 3300046616 | Bacteria | 1450 |
| 787 | Ga0495634_0004321 | 3300046642 | Bacteria | 11195 |
| 788 | Ga0495625_0082150 | 3300046660 | Bacteria | 2241 |
| 789 | Ga0495635_0000429 | 3300046663 | Bacteria | 26634 |
| 790 | Ga0495635_0013995 | 3300046663 | Bacteria | 5613 |
| 791 | Ga0495635_0027056 | 3300046663 | Bacteria | 3990 |
| 792 | Ga0495635_0322937 | 3300046663 | Bacteria | 1033 |
| 793 | Ga0495659_0007040 | 3300046664 | Bacteria | 3557 |
| 794 | Ga0495659_0033686 | 3300046664 | Bacteria | 1799 |
| 795 | Ga0495588_0083701 | 3300046674 | Bacteria | 1666 |
| 796 | Ga0495657_0009336 | 3300046675 | Bacteria | 7443 |
| 797 | Ga0495657_0010262 | 3300046675 | Bacteria | 7049 |
| 798 | Ga0495657_0013260 | 3300046675 | Bacteria | 6087 |
| 799 | Ga0495599_0003035 | 3300046678 | Bacteria | 9769 |
| 800 | Ga0495623_0007229 | 3300046679 | Bacteria | 7207 |
| 801 | Ga0495623_0007655 | 3300046679 | Bacteria | 7019 |
| 802 | Ga0495623_0049055 | 3300046679 | Bacteria | 2675 |
| 803 | Ga0495623_0102314 | 3300046679 | Bacteria | 1744 |
| 804 | Ga0495623_0127033 | 3300046679 | Bacteria | 1530 |
| 805 | Ga0495646_0001304 | 3300046680 | Bacteria | 14717 |
| 806 | Ga0495646_0043515 | 3300046680 | Bacteria | 2749 |
| 807 | Ga0495647_0008584 | 3300046681 | Bacteria | 3437 |
| 808 | Ga0495658_0000781 | 3300046683 | Bacteria | 17152 |
| 809 | Ga0495658_0011048 | 3300046683 | Bacteria | 4530 |
| 810 | Ga0495669_0077313 | 3300046684 | Bacteria | 1524 |
| 811 | Ga0495669_0083675 | 3300046684 | Bacteria | 1467 |
| 812 | Ga0495613_0006286 | 3300046689 | Bacteria | 8885 |
| 813 | Ga0495613_0029327 | 3300046689 | Bacteria | 4091 |
| 814 | Ga0495613_0219605 | 3300046689 | Bacteria | 1335 |
| 815 | Ga0495624_0040078 | 3300046690 | Bacteria | 3001 |
| 816 | Ga0495624_0081726 | 3300046690 | Bacteria | 2001 |
| 817 | Ga0495624_0132083 | 3300046690 | Bacteria | 1531 |
| 818 | Ga0495670_0012130 | 3300046691 | Bacteria | 4239 |
| 819 | Ga0495649_0080821 | 3300046694 | Bacteria | 1738 |
| 820 | Ga0495600_0007607 | 3300046809 | Bacteria | 6637 |
| 821 | Ga0495600_0014546 | 3300046809 | Bacteria | 4959 |
| 822 | Ga0495581_0005737 | 3300047315 | Bacteria | 7194 |
| 823 | Ga0495581_0030017 | 3300047315 | Bacteria | 3152 |
| 824 | Ga0495581_0092012 | 3300047315 | Bacteria | 1760 |
| 825 | Ga0495604_0002235 | 3300047317 | Bacteria | 15508 |
| 826 | Ga0495604_0002822 | 3300047317 | Bacteria | 13952 |
| 827 | Ga0495604_0010023 | 3300047317 | Bacteria | 7501 |
| 828 | Ga0495604_0116513 | 3300047317 | Bacteria | 1939 |
| 829 | Ga0495674_0004206 | 3300047319 | Bacteria | 13863 |
| 830 | Ga0495674_0006763 | 3300047319 | Bacteria | 10975 |
| 831 | Ga0495674_0021636 | 3300047319 | Bacteria | 5945 |
| 832 | Ga0495674_0082394 | 3300047319 | Bacteria | 2758 |
| 833 | Ga0495674_0198450 | 3300047319 | Bacteria | 1665 |
| 834 | Ga0495672_0032259 | 3300047320 | Bacteria | 3261 |
| 835 | Ga0495672_0106579 | 3300047320 | Bacteria | 1511 |
| 836 | Ga0495676_0062585 | 3300047321 | Bacteria | 2904 |
| 837 | Ga0495676_0121550 | 3300047321 | Bacteria | 1899 |
| 838 | Ga0495680_0006824 | 3300047322 | Bacteria | 10544 |
| 839 | Ga0495680_0029393 | 3300047322 | Bacteria | 4500 |
| 840 | Ga0495675_0002904 | 3300047444 | Bacteria | 10293 |
| 841 | Ga0495675_0067445 | 3300047444 | Bacteria | 2260 |
| 842 | Ga0495684_0000497 | 3300047471 | Bacteria | 32091 |
| 843 | Ga0495684_0015464 | 3300047471 | Bacteria | 5872 |
| 844 | Ga0495684_0016411 | 3300047471 | Bacteria | 5703 |
| 845 | Ga0495684_0025159 | 3300047471 | Bacteria | 4577 |
| 846 | Ga0495684_0281626 | 3300047471 | Bacteria | 1199 |
| 847 | Ga0495686_0147868 | 3300047472 | Bacteria | 1381 |
| 848 | Ga0495593_0014868 | 3300047673 | Bacteria | 4421 |
| 849 | Ga0495593_0014947 | 3300047673 | Bacteria | 4408 |
| 850 | Ga0495593_0016723 | 3300047673 | Bacteria | 4133 |
| 851 | Ga0495593_0023433 | 3300047673 | Bacteria | 3432 |
| 852 | Ga0495602_0040996 | 3300048088 | Bacteria | 4234 |
| 853 | Ga0495602_0128581 | 3300048088 | Bacteria | 2024 |
| 854 | Ga0495602_0152128 | 3300048088 | Bacteria | 1817 |
| 855 | Ga0495614_0010418 | 3300048089 | Bacteria | 4099 |
| 856 | Ga0495614_0018899 | 3300048089 | Bacteria | 2984 |
| 857 | Ga0495615_0000368 | 3300048090 | Bacteria | 7077 |
| 858 | Ga0495615_0012724 | 3300048090 | Bacteria | 1741 |
| 859 | Ga0496100_0012538 | 3300048903 | Bacteria | 4862 |
| 860 | Ga0496100_0015511 | 3300048903 | Bacteria | 4451 |
| 861 | Ga0496100_0040306 | 3300048903 | Bacteria | 2970 |
| 862 | Ga0496100_0072267 | 3300048903 | Bacteria | 2305 |
| 863 | Ga0496100_0128194 | 3300048903 | Bacteria | 1784 |
| 864 | Ga0496100_0249420 | 3300048903 | Bacteria | 1313 |
| 865 | Ga0496100_0279397 | 3300048903 | Bacteria | 1244 |
| 866 | Ga0496101_0000235 | 3300048904 | Bacteria | 41146 |
| 867 | Ga0496101_0001165 | 3300048904 | Bacteria | 15728 |
| 868 | Ga0496101_0008415 | 3300048904 | Bacteria | 6740 |
| 869 | Ga0496101_0019223 | 3300048904 | Bacteria | 4661 |
| 870 | Ga0496101_0052924 | 3300048904 | Bacteria | 2928 |
| 871 | Ga0496101_0053933 | 3300048904 | Bacteria | 2902 |
| 872 | Ga0496101_0195594 | 3300048904 | Bacteria | 1562 |
| 873 | Ga0496102_0005341 | 3300048905 | Bacteria | 10905 |
| 874 | Ga0496102_0022951 | 3300048905 | Bacteria | 5535 |
| 875 | Ga0496102_0028248 | 3300048905 | Bacteria | 5009 |
| 876 | Ga0496102_0039515 | 3300048905 | Bacteria | 4263 |
| 877 | Ga0496102_0155347 | 3300048905 | Bacteria | 2151 |
| 878 | Ga0496103_0003790 | 3300048906 | Bacteria | 9196 |
| 879 | Ga0496103_0011444 | 3300048906 | Bacteria | 5258 |
| 880 | Ga0496103_0014101 | 3300048906 | Bacteria | 4744 |
| 881 | Ga0496104_0000351 | 3300048907 | Bacteria | 41200 |
| 882 | Ga0496104_0003146 | 3300048907 | Bacteria | 14223 |
| 883 | Ga0496104_0008914 | 3300048907 | Bacteria | 8913 |
| 884 | Ga0496104_0215047 | 3300048907 | Bacteria | 1834 |
| 885 | Ga0496104_0250055 | 3300048907 | Bacteria | 1685 |
| 886 | Ga0496104_0285969 | 3300048907 | Bacteria | 1561 |
| 887 | Ga0496104_0499306 | 3300048907 | Bacteria | 1128 |
| 888 | Ga0496105_0000840 | 3300048908 | Bacteria | 20909 |
| 889 | Ga0496105_0006427 | 3300048908 | Bacteria | 9034 |
| 890 | Ga0496105_0012927 | 3300048908 | Bacteria | 6616 |
| 891 | Ga0496105_0029441 | 3300048908 | Bacteria | 4494 |
| 892 | Ga0496105_0030009 | 3300048908 | Bacteria | 4454 |
| 893 | Ga0496105_0037048 | 3300048908 | Bacteria | 4018 |
| 894 | Ga0496105_0190590 | 3300048908 | Bacteria | 1676 |
| 895 | Ga0496106_0000788 | 3300048909 | Bacteria | 22899 |
| 896 | Ga0496106_0002108 | 3300048909 | Bacteria | 14874 |
| 897 | Ga0496106_0010763 | 3300048909 | Bacteria | 6759 |
| 898 | Ga0496106_0011781 | 3300048909 | Bacteria | 6454 |
| 899 | Ga0496106_0169369 | 3300048909 | Bacteria | 1730 |
| 900 | Ga0496106_0181176 | 3300048909 | Bacteria | 1672 |
| 901 | Ga0496106_0186831 | 3300048909 | Bacteria | 1646 |
| 902 | Ga0496106_0325966 | 3300048909 | Bacteria | 1233 |
| 903 | Ga0496107_0004819 | 3300048910 | Bacteria | 9159 |
| 904 | Ga0496107_0011301 | 3300048910 | Bacteria | 6216 |
| 905 | Ga0496107_0013863 | 3300048910 | Bacteria | 5634 |
| 906 | Ga0496107_0030116 | 3300048910 | Bacteria | 3867 |
| 907 | Ga0496107_0074682 | 3300048910 | Bacteria | 2466 |
| 908 | Ga0496107_0111973 | 3300048910 | Bacteria | 2006 |
| 909 | Ga0496108_0011130 | 3300048911 | Bacteria | 7309 |
| 910 | Ga0496108_0016530 | 3300048911 | Bacteria | 6022 |
| 911 | Ga0496108_0019665 | 3300048911 | Bacteria | 5546 |
| 912 | Ga0496108_0037794 | 3300048911 | Bacteria | 4022 |
| 913 | Ga0496108_0082807 | 3300048911 | Bacteria | 2721 |
| 914 | Ga0496108_0237162 | 3300048911 | Bacteria | 1586 |
| 915 | Ga0496109_0005654 | 3300048912 | Bacteria | 10459 |
| 916 | Ga0496109_0007962 | 3300048912 | Bacteria | 8983 |
| 917 | Ga0496109_0023341 | 3300048912 | Bacteria | 5489 |
| 918 | Ga0496109_0027237 | 3300048912 | Bacteria | 5102 |
| 919 | Ga0496109_0028566 | 3300048912 | Bacteria | 4989 |
| 920 | Ga0496109_0040011 | 3300048912 | Bacteria | 4245 |
| 921 | Ga0496109_0045566 | 3300048912 | Bacteria | 3980 |
| 922 | Ga0496110_0034051 | 3300048913 | Bacteria | 4409 |
| 923 | Ga0496110_0039961 | 3300048913 | Bacteria | 4087 |
| 924 | Ga0496110_0075409 | 3300048913 | Bacteria | 2996 |
| 925 | Ga0496110_0492910 | 3300048913 | Bacteria | 1116 |
| 926 | Ga0496111_0002946 | 3300048914 | Bacteria | 10413 |
| 927 | Ga0496111_0009883 | 3300048914 | Bacteria | 6377 |
| 928 | Ga0496111_0039701 | 3300048914 | Bacteria | 3376 |
| 929 | Ga0496111_0057681 | 3300048914 | Bacteria | 2811 |
| 930 | Ga0496112_0000018 | 3300048915 | Bacteria | 188820 |
| 931 | Ga0496112_0011859 | 3300048915 | Bacteria | 7982 |
| 932 | Ga0496112_0013345 | 3300048915 | Bacteria | 7583 |
| 933 | Ga0496112_0030393 | 3300048915 | Bacteria | 5227 |
| 934 | Ga0496112_0069569 | 3300048915 | Bacteria | 3477 |
| 935 | Ga0496112_0334061 | 3300048915 | Bacteria | 1459 |
| 936 | Ga0496112_0421533 | 3300048915 | Bacteria | 1273 |
| 937 | Ga0496113_0013732 | 3300048916 | Bacteria | 5500 |
| 938 | Ga0496113_0017464 | 3300048916 | Bacteria | 4981 |
| 939 | Ga0496113_0035587 | 3300048916 | Bacteria | 3642 |
| 940 | Ga0496113_0062084 | 3300048916 | Bacteria | 2821 |
| 941 | Ga0496113_0071978 | 3300048916 | Bacteria | 2630 |
| 942 | Ga0496114_0009940 | 3300048917 | Bacteria | 7562 |
| 943 | Ga0496114_0023363 | 3300048917 | Bacteria | 5045 |
| 944 | Ga0496114_0037148 | 3300048917 | Bacteria | 4028 |
| 945 | Ga0496114_0048719 | 3300048917 | Bacteria | 3524 |
| 946 | Ga0496114_0066495 | 3300048917 | Bacteria | 3022 |
| 947 | Ga0496114_0112239 | 3300048917 | Bacteria | 2336 |
| 948 | Ga0496115_0002701 | 3300048918 | Bacteria | 12737 |
| 949 | Ga0496115_0010842 | 3300048918 | Bacteria | 6819 |
| 950 | Ga0496115_0019196 | 3300048918 | Bacteria | 5259 |
| 951 | Ga0496115_0050174 | 3300048918 | Bacteria | 3342 |
| 952 | Ga0496115_0078464 | 3300048918 | Bacteria | 2686 |
| 953 | Ga0496115_0109684 | 3300048918 | Bacteria | 2266 |
| 954 | Ga0496115_0123713 | 3300048918 | Bacteria | 2129 |
| 955 | Ga0496116_0227024 | 3300048919 | Bacteria | 951 |
| 956 | Ga0496117_0007128 | 3300048920 | Bacteria | 11048 |
| 957 | Ga0496117_0074479 | 3300048920 | Bacteria | 2260 |
| 958 | Ga0496118_0003592 | 3300048921 | Bacteria | 19299 |
| 959 | Ga0496118_0078665 | 3300048921 | Bacteria | 2332 |
| 960 | Ga0496119_0055304 | 3300048922 | Bacteria | 2411 |
| 961 | Ga0496121_0000640 | 3300048924 | Bacteria | 65295 |
| 962 | Ga0496121_0038643 | 3300048924 | Bacteria | 4220 |
| 963 | Ga0496121_0046507 | 3300048924 | Bacteria | 3713 |
| 964 | Ga0496121_0048134 | 3300048924 | Bacteria | 3630 |
| 965 | Ga0496121_0093528 | 3300048924 | Bacteria | 2340 |
| 966 | Ga0496121_0188119 | 3300048924 | Bacteria | 1483 |
| 967 | Ga0496124_0002189 | 3300048927 | Bacteria | 26104 |
| 968 | Ga0496125_0085843 | 3300048928 | Bacteria | 2383 |
| 969 | Ga0496126_0009499 | 3300048929 | Bacteria | 10319 |
| 970 | Ga0496126_0018354 | 3300048929 | Bacteria | 6933 |
| 971 | Ga0496126_0043259 | 3300048929 | Bacteria | 4155 |
| 972 | Ga0496126_0047915 | 3300048929 | Bacteria | 3910 |
| 973 | Ga0496126_0068906 | 3300048929 | Bacteria | 3157 |
| 974 | Ga0496126_0080924 | 3300048929 | Bacteria | 2873 |
| 975 | Ga0496126_0115449 | 3300048929 | Bacteria | 2334 |
| 976 | Ga0496126_0164235 | 3300048929 | Bacteria | 1896 |
| 977 | Ga0496126_0254389 | 3300048929 | Bacteria | 1462 |
| 978 | Ga0501036_0003984 | 3300049572 | Bacteria | 11869 |
| 979 | Ga0501037_0025075 | 3300049573 | Bacteria | 4406 |
| 980 | Ga0501037_0040497 | 3300049573 | Bacteria | 3428 |
| 981 | Ga0501038_0040262 | 3300049574 | Bacteria | 4083 |
| 982 | Ga0501046_0067505 | 3300049580 | Bacteria | 2785 |
| 983 | Ga0501047_0000100 | 3300049581 | Bacteria | 105717 |
| 984 | Ga0501047_0052511 | 3300049581 | Bacteria | 3940 |
| 985 | Ga0501048_0000083 | 3300049582 | Bacteria | 49621 |
| 986 | Ga0501048_0098144 | 3300049582 | Bacteria | 2067 |
| 987 | Ga0501068_0041556 | 3300049584 | Bacteria | 2763 |
| 988 | Ga0501070_0009792 | 3300049586 | Bacteria | 8108 |
| 989 | Ga0501070_0152053 | 3300049586 | Bacteria | 1909 |
| 990 | Ga0501070_0215422 | 3300049586 | Bacteria | 1575 |
| 991 | Ga0501072_0003943 | 3300049588 | Bacteria | 11230 |
| 992 | Ga0501072_0218576 | 3300049588 | Bacteria | 1519 |
| 993 | Ga0501074_0017935 | 3300049590 | Bacteria | 5143 |
| 994 | Ga0501074_0040074 | 3300049590 | Bacteria | 3392 |
| 995 | Ga0501074_0046177 | 3300049590 | Bacteria | 3149 |
| 996 | Ga0501079_0033083 | 3300049741 | Bacteria | 3976 |
| 997 | Ga0501080_0000030 | 3300049742 | Bacteria | 87736 |
| 998 | Ga0501080_0029073 | 3300049742 | Bacteria | 5145 |
| 999 | Ga0501080_0290083 | 3300049742 | Bacteria | 1486 |
| 1000 | Ga0501083_0002641 | 3300049744 | Bacteria | 12337 |
| 1001 | Ga0501083_0194828 | 3300049744 | Bacteria | 1322 |
| 1002 | Ga0501035_0023582 | 3300049822 | Bacteria | 5645 |
| 1003 | Ga0501035_0438882 | 3300049822 | Bacteria | 1081 |
| 1004 | Ga0501044_0000587 | 3300049823 | Bacteria | 44137 |
| 1005 | nmdc:mga03n38_150788_c1 | 3300050490 | Bacteria | 1169 |
| 1006 | nmdc:mga0yw44_104257_c1 | 3300050492 | Bacteria | 1810 |
| 1007 | nmdc:mga0yw44_63102_c1 | 3300050492 | Bacteria | 2277 |
| 1008 | nmdc:mga0k408_2505_c2 | 3300050493 | Bacteria | 7672 |
| 1009 | nmdc:mga0k408_36277_c1 | 3300050493 | Bacteria | 2829 |
| 1010 | nmdc:mga06z11_34154_c1 | 3300050494 | Bacteria | 2494 |
| 1011 | nmdc:mga06z11_4911_c1 | 3300050494 | Bacteria | 5306 |
| 1012 | nmdc:mga07m45_49692_c1 | 3300050496 | Bacteria | 2361 |
| 1013 | nmdc:mga05p37_10233_c1 | 3300050507 | Bacteria | 11137 |
| 1014 | nmdc:mga05p37_166916_c1 | 3300050507 | Bacteria | 2686 |
| 1015 | nmdc:mga05p37_225_c1 | 3300050507 | Bacteria | 57238 |
| 1016 | nmdc:mga09592_244_c1 | 3300050508 | Bacteria | 39424 |
| 1017 | nmdc:mga09592_58040_c1 | 3300050508 | Bacteria | 3273 |
| 1018 | nmdc:mga09592_736_c1 | 3300050508 | Bacteria | 25222 |
| 1019 | nmdc:mga0qj67_215_c1 | 3300050509 | Bacteria | 39409 |
| 1020 | nmdc:mga0qj67_2611_c1 | 3300050509 | Bacteria | 12909 |
| 1021 | nmdc:mga0qj67_4314_c1 | 3300050509 | Bacteria | 10307 |
| 1022 | nmdc:mga06r32_12515_c1 | 3300050510 | Bacteria | 7657 |
| 1023 | nmdc:mga06r32_341_c1 | 3300050510 | Bacteria | 38959 |
| 1024 | nmdc:mga06r32_731_c1 | 3300050510 | Bacteria | 28813 |
| 1025 | nmdc:mga08y16_131595_c1 | 3300050511 | Bacteria | 2601 |
| 1026 | nmdc:mga08y16_145004_c1 | 3300050511 | Bacteria | 2468 |
| 1027 | nmdc:mga08y16_252107_c1 | 3300050511 | Bacteria | 1824 |
| 1028 | nmdc:mga08y16_617_c1 | 3300050511 | Bacteria | 33261 |
| 1029 | nmdc:mga08y16_6190_c1 | 3300050511 | Bacteria | 12557 |
| 1030 | nmdc:mga0n895_308807_c1 | 3300050512 | Bacteria | 1603 |
| 1031 | nmdc:mga0n895_457_c1 | 3300050512 | Bacteria | 27383 |
| 1032 | nmdc:mga0n895_543324_c1 | 3300050512 | Bacteria | 1168 |
| 1033 | nmdc:mga0rr50_11539_c1 | 3300050513 | Bacteria | 5662 |
| 1034 | nmdc:mga0rr50_19557_c1 | 3300050513 | Bacteria | 4574 |
| 1035 | nmdc:mga08x19_81571_c1 | 3300050514 | Bacteria | 2124 |
| 1036 | nmdc:mga0a205_1019_c1 | 3300050515 | Bacteria | 23295 |
| 1037 | nmdc:mga0a205_17989_c1 | 3300050515 | Bacteria | 6068 |
| 1038 | Ga0495601_0000413 | 3300053077 | Bacteria | 22423 |
| 1039 | Ga0495601_0000668 | 3300053077 | Bacteria | 18282 |
| 1040 | Ga0495601_0005956 | 3300053077 | Bacteria | 7113 |
| 1041 | Ga0495601_0007499 | 3300053077 | Bacteria | 6400 |
| 1042 | Ga0495601_0018585 | 3300053077 | Bacteria | 4231 |
| 1043 | Ga0495601_0060131 | 3300053077 | Bacteria | 2410 |
| 1044 | Ga0495612_0001564 | 3300053078 | Bacteria | 9430 |
| 1045 | Ga0495612_0002430 | 3300053078 | Bacteria | 7675 |
| 1046 | Ga0495612_0006791 | 3300053078 | Bacteria | 4688 |
| 1047 | Ga0495612_0008871 | 3300053078 | Bacteria | 4073 |
| 1048 | Ga0495612_0019920 | 3300053078 | Bacteria | 2688 |
| 1049 | Ga0495595_0000516 | 3300053084 | Bacteria | 14727 |
| 1050 | Ga0495595_0001465 | 3300053084 | Bacteria | 9212 |
| 1051 | Ga0495595_0003553 | 3300053084 | Bacteria | 6186 |
| 1052 | Ga0495619_0001679 | 3300053085 | Bacteria | 14639 |
| 1053 | Ga0495619_0001957 | 3300053085 | Bacteria | 13737 |
| 1054 | Ga0495619_0002856 | 3300053085 | Bacteria | 11246 |
| 1055 | Ga0495619_0020676 | 3300053085 | Bacteria | 4195 |
| 1056 | Ga0495619_0054518 | 3300053085 | Bacteria | 2646 |
| 1057 | Ga0495619_0106148 | 3300053085 | Bacteria | 1915 |
| 1058 | Ga0495619_0128604 | 3300053085 | Bacteria | 1740 |
| 1059 | Ga0500651_0102011 | 3300053093 | Bacteria | 1758 |
| 1060 | Ga0500651_0185374 | 3300053093 | Bacteria | 1234 |
| 1061 | Ga0500566_0001625 | 3300053094 | Bacteria | 13231 |
| 1062 | Ga0500566_0013519 | 3300053094 | Bacteria | 4804 |
| 1063 | Ga0500566_0107849 | 3300053094 | Bacteria | 1518 |
| 1064 | Ga0500641_0098123 | 3300053096 | Bacteria | 1255 |
| 1065 | Ga0500648_043289 | 3300053097 | Bacteria | 2556 |
| 1066 | Ga0500594_0071074 | 3300053118 | Bacteria | 1023 |
| 1067 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 1068 | Ga0500595_000095 | 3300053119 | Bacteria | 61248 |
| 1069 | Ga0500595_003699 | 3300053119 | Bacteria | 7057 |
| 1070 | Ga0500595_018815 | 3300053119 | Bacteria | 2518 |
| 1071 | Ga0500642_0017123 | 3300053130 | Bacteria | 2771 |
| 1072 | Ga0500658_0024140 | 3300053134 | Bacteria | 2327 |
| 1073 | Ga0500559_0047011 | 3300053136 | Bacteria | 1894 |
| 1074 | Ga0500573_0175702 | 3300053140 | Bacteria | 1155 |
| 1075 | Ga0500622_0054551 | 3300053156 | Bacteria | 2050 |
| 1076 | Ga0500627_0125752 | 3300053158 | Bacteria | 1157 |
| 1077 | Ga0500634_0069625 | 3300053161 | Bacteria | 1844 |
| 1078 | Ga0500638_006677 | 3300053162 | Bacteria | 4750 |
| 1079 | Ga0500636_0014540 | 3300053177 | Bacteria | 4629 |
| 1080 | Ga0500637_0000495 | 3300053178 | Bacteria | 15245 |
| 1081 | Ga0500596_004825 | 3300053735 | Bacteria | 2437 |
| 1082 | Ga0501082_0192337 | 3300060353 | Bacteria | 1775 |
| 1083 | Ga0530510_0058804 | 3300061734 | Bacteria | 2780 |
| 1084 | Ga0530510_0113785 | 3300061734 | Bacteria | 1983 |
| 1085 | Ga0530510_0192984 | 3300061734 | Bacteria | 1512 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025935 | Ga0207709_10262109 | Ga0207709_102621092 | 276 |
| 2 | 3300038443 | Ga0395901_0784501 | Ga0395901_0784501_12_908 | 298 |
| 3 | 3300046660 | Ga0495625_0082150 | Ga0495625_0082150_14_910 | 298 |
| 4 | 3300046663 | Ga0495635_0322937 | Ga0495635_0322937_124_1020 | 298 |
| 5 | 3300048914 | Ga0496111_0057681 | Ga0496111_0057681_1898_2794 | 298 |
| 6 | 3300048919 | Ga0496116_0227024 | Ga0496116_0227024_10_906 | 298 |
| 7 | 3300053119 | Ga0500595_018815 | Ga0500595_018815_1597_2493 | 298 |
| 8 | 3300053156 | Ga0500622_0054551 | Ga0500622_0054551_17_913 | 298 |
| 9 | 3300005293 | Ga0065715_10137549 | Ga0065715_101375493 | 315 |
| 10 | 3300005328 | Ga0070676_10024678 | Ga0070676_100246782 | 316 |
| 11 | 3300005364 | Ga0070673_100262418 | Ga0070673_1002624181 | 316 |
| 12 | 3300006358 | Ga0068871_100073854 | Ga0068871_1000738543 | 316 |
| 13 | 3300006881 | Ga0068865_100103441 | Ga0068865_1001034411 | 316 |
| 14 | 3300014326 | Ga0157380_10100720 | Ga0157380_101007203 | 316 |
| 15 | 3300025907 | Ga0207645_10070342 | Ga0207645_100703423 | 316 |
| 16 | 3300025940 | Ga0207691_10019716 | Ga0207691_100197165 | 316 |
| 17 | 3300046539 | Ga0495621_0023115 | Ga0495621_0023115_494_1552 | 316 |
| 18 | 3300048929 | Ga0496126_0047915 | Ga0496126_0047915_938_1999 | 317 |
| 19 | 3300005290 | Ga0065712_10113471 | Ga0065712_101134712 | 319 |
| 20 | 3300005331 | Ga0070670_100086754 | Ga0070670_1000867544 | 319 |
| 21 | 3300005333 | Ga0070677_10028755 | Ga0070677_100287552 | 319 |
| 22 | 3300005355 | Ga0070671_100202708 | Ga0070671_1002027083 | 319 |
| 23 | 3300005365 | Ga0070688_100097415 | Ga0070688_1000974152 | 319 |
| 24 | 3300005456 | Ga0070678_100061286 | Ga0070678_1000612864 | 319 |
| 25 | 3300005459 | Ga0068867_100031810 | Ga0068867_1000318104 | 319 |
| 26 | 3300013297 | Ga0157378_10254793 | Ga0157378_102547931 | 319 |
| 27 | 3300013308 | Ga0157375_10246096 | Ga0157375_102460962 | 319 |
| 28 | 3300025893 | Ga0207682_10001519 | Ga0207682_100015199 | 319 |
| 29 | 3300025942 | Ga0207689_10320271 | Ga0207689_103202712 | 319 |
| 30 | 3300026089 | Ga0207648_10031836 | Ga0207648_100318365 | 319 |
| 31 | 3300026121 | Ga0207683_10042796 | Ga0207683_100427965 | 319 |
| 32 | 3300046615 | Ga0495656_0035929 | Ga0495656_0035929_454_1512 | 319 |
| 33 | 3300046684 | Ga0495669_0083675 | Ga0495669_0083675_285_1343 | 319 |
| 34 | 3300048090 | Ga0495615_0012724 | Ga0495615_0012724_264_1322 | 319 |
| 35 | 3300046679 | Ga0495623_0127033 | Ga0495623_0127033_550_1515 | 320 |
| 36 | 3300047471 | Ga0495684_0281626 | Ga0495684_0281626_215_1180 | 320 |
| 37 | 3300048922 | Ga0496119_0055304 | Ga0496119_0055304_1233_2324 | 320 |
| 38 | 3300053118 | Ga0500594_0071074 | Ga0500594_0071074_34_996 | 320 |
| 39 | 3300003659 | JGI25404J52841_10015339 | JGI25404J52841_100153392 | 326 |
| 40 | 3300005983 | Ga0081540_1000102 | Ga0081540_100010225 | 326 |
| 41 | 3300005356 | Ga0070674_100074811 | Ga0070674_1000748111 | 327 |
| 42 | 3300046664 | Ga0495659_0033686 | Ga0495659_0033686_171_1268 | 327 |
| 43 | 3300050509 | nmdc:mga0qj67_4314_c1 | nmdc:mga0qj67_4314_c1_6507_7604 | 328 |
| 44 | 3300060353 | Ga0501082_0192337 | Ga0501082_0192337_144_1217 | 328 |
| 45 | 3300061734 | Ga0530510_0192984 | Ga0530510_0192984_137_1210 | 328 |
| 46 | 3300006844 | Ga0075428_100020912 | Ga0075428_1000209124 | 329 |
| 47 | 3300006846 | Ga0075430_100012924 | Ga0075430_1000129246 | 329 |
| 48 | 3300006847 | Ga0075431_100032904 | Ga0075431_1000329044 | 329 |
| 49 | 3300006880 | Ga0075429_100030873 | Ga0075429_1000308733 | 329 |
| 50 | 3300009147 | Ga0114129_10097181 | Ga0114129_100971813 | 329 |
| 51 | 3300046615 | Ga0495656_0016994 | Ga0495656_0016994_252_1319 | 329 |
| 52 | 3300046615 | Ga0495656_0091561 | Ga0495656_0091561_15_1112 | 329 |
| 53 | 3300050510 | nmdc:mga06r32_12515_c1 | nmdc:mga06r32_12515_c1_3755_4852 | 329 |
| 54 | 3300061734 | Ga0530510_0113785 | Ga0530510_0113785_838_1959 | 329 |
| 55 | 3300025315 | Ga0207697_10055588 | Ga0207697_100555881 | 330 |
| 56 | 3300009094 | Ga0111539_10150346 | Ga0111539_101503462 | 332 |
| 57 | 3300009101 | Ga0105247_10048427 | Ga0105247_100484272 | 332 |
| 58 | 3300048907 | Ga0496104_0000351 | Ga0496104_0000351_12109_13173 | 332 |
| 59 | 3300048908 | Ga0496105_0037048 | Ga0496105_0037048_1061_2125 | 332 |
| 60 | 3300048916 | Ga0496113_0071978 | Ga0496113_0071978_933_1997 | 332 |
| 61 | 3300048918 | Ga0496115_0050174 | Ga0496115_0050174_1031_2095 | 332 |
| 62 | 3300049573 | Ga0501037_0025075 | Ga0501037_0025075_1363_2442 | 332 |
| 63 | 3300049741 | Ga0501079_0033083 | Ga0501079_0033083_1957_3036 | 332 |
| 64 | 3300050490 | nmdc:mga03n38_150788_c1 | nmdc:mga03n38_150788_c1_138_1139 | 332 |
| 65 | 3300050511 | nmdc:mga08y16_252107_c1 | nmdc:mga08y16_252107_c1_79_1128 | 332 |
| 66 | 3300046538 | Ga0495609_0090437 | Ga0495609_0090437_29_1030 | 333 |
| 67 | 3300049572 | Ga0501036_0003984 | Ga0501036_0003984_3815_4897 | 333 |
| 68 | 3300049573 | Ga0501037_0040497 | Ga0501037_0040497_577_1659 | 333 |
| 69 | 3300049581 | Ga0501047_0000100 | Ga0501047_0000100_47008_48090 | 333 |
| 70 | 3300049582 | Ga0501048_0000083 | Ga0501048_0000083_45981_47063 | 333 |
| 71 | 3300049586 | Ga0501070_0009792 | Ga0501070_0009792_3440_4522 | 333 |
| 72 | 3300049588 | Ga0501072_0003943 | Ga0501072_0003943_5795_6856 | 333 |
| 73 | 3300049590 | Ga0501074_0017935 | Ga0501074_0017935_2158_3240 | 333 |
| 74 | 3300049742 | Ga0501080_0000030 | Ga0501080_0000030_40548_41630 | 333 |
| 75 | 3300049744 | Ga0501083_0002641 | Ga0501083_0002641_5226_6308 | 333 |
| 76 | 3300049823 | Ga0501044_0000587 | Ga0501044_0000587_21707_22789 | 333 |
| 77 | 3300050492 | nmdc:mga0yw44_104257_c1 | nmdc:mga0yw44_104257_c1_11_1012 | 333 |
| 78 | 3300032002 | Ga0307416_100063443 | Ga0307416_1000634432 | 334 |
| 79 | 3300035170 | Ga0373943_0162967 | Ga0373943_0162967_124_1182 | 334 |
| 80 | 3300035172 | Ga0373955_0011740 | Ga0373955_0011740_15_1073 | 334 |
| 81 | 3300035725 | Ga0373947_0088961 | Ga0373947_0088961_285_1343 | 334 |
| 82 | 3300036401 | Ga0373937_0002947 | Ga0373937_0002947_7051_8109 | 334 |
| 83 | 3300037068 | Ga0373925_0008452 | Ga0373925_0008452_3818_4876 | 334 |
| 84 | 3300046454 | Ga0495592_0005759 | Ga0495592_0005759_4638_5696 | 334 |
| 85 | 3300046463 | Ga0495653_0160841 | Ga0495653_0160841_252_1310 | 334 |
| 86 | 3300046477 | Ga0495664_0029806 | Ga0495664_0029806_1685_2743 | 334 |
| 87 | 3300046511 | Ga0495608_0011568 | Ga0495608_0011568_3223_4281 | 334 |
| 88 | 3300046516 | Ga0495628_0002572 | Ga0495628_0002572_8736_9794 | 334 |
| 89 | 3300046529 | Ga0495652_0002428 | Ga0495652_0002428_5722_6780 | 334 |
| 90 | 3300046543 | Ga0495645_0001788 | Ga0495645_0001788_9586_10644 | 334 |
| 91 | 3300046675 | Ga0495657_0009336 | Ga0495657_0009336_4130_5188 | 334 |
| 92 | 3300047317 | Ga0495604_0002822 | Ga0495604_0002822_8051_9109 | 334 |
| 93 | 3300048088 | Ga0495602_0040996 | Ga0495602_0040996_2909_3967 | 334 |
| 94 | 3300053077 | Ga0495601_0000668 | Ga0495601_0000668_10615_11673 | 334 |
| 95 | 3300053078 | Ga0495612_0008871 | Ga0495612_0008871_2780_3838 | 334 |
| 96 | 3300053084 | Ga0495595_0000516 | Ga0495595_0000516_13482_14540 | 334 |
| 97 | 3300053085 | Ga0495619_0054518 | Ga0495619_0054518_569_1627 | 334 |
| 98 | 3300005290 | Ga0065712_10135995 | Ga0065712_101359951 | 335 |
| 99 | 3300005330 | Ga0070690_100171286 | Ga0070690_1001712862 | 335 |
| 100 | 3300005367 | Ga0070667_100122297 | Ga0070667_1001222972 | 335 |
| 101 | 3300046460 | Ga0495638_0011077 | Ga0495638_0011077_396_1448 | 335 |
| 102 | 3300046679 | Ga0495623_0007229 | Ga0495623_0007229_6003_7139 | 335 |
| 103 | 3300053094 | Ga0500566_0013519 | Ga0500566_0013519_3778_4788 | 335 |
| 104 | 3300002239 | JGI24034J26672_10000462 | JGI24034J26672_100004623 | 336 |
| 105 | 3300005328 | Ga0070676_10006058 | Ga0070676_100060582 | 336 |
| 106 | 3300005331 | Ga0070670_100006794 | Ga0070670_1000067942 | 336 |
| 107 | 3300005333 | Ga0070677_10000406 | Ga0070677_100004062 | 336 |
| 108 | 3300005334 | Ga0068869_100000653 | Ga0068869_10000065314 | 336 |
| 109 | 3300005337 | Ga0070682_100005253 | Ga0070682_1000052532 | 336 |
| 110 | 3300005343 | Ga0070687_100000387 | Ga0070687_1000003874 | 336 |
| 111 | 3300005438 | Ga0070701_10002820 | Ga0070701_100028202 | 336 |
| 112 | 3300005457 | Ga0070662_100009816 | Ga0070662_1000098162 | 336 |
| 113 | 3300005535 | Ga0070684_100004467 | Ga0070684_1000044672 | 336 |
| 114 | 3300005615 | Ga0070702_100003283 | Ga0070702_1000032832 | 336 |
| 115 | 3300006871 | Ga0075434_100001174 | Ga0075434_10000117420 | 336 |
| 116 | 3300009011 | Ga0105251_10077573 | Ga0105251_100775732 | 336 |
| 117 | 3300009094 | Ga0111539_10014415 | Ga0111539_100144152 | 336 |
| 118 | 3300009098 | Ga0105245_10000380 | Ga0105245_100003802 | 336 |
| 119 | 3300009101 | Ga0105247_10001411 | Ga0105247_100014112 | 336 |
| 120 | 3300009148 | Ga0105243_10008080 | Ga0105243_100080802 | 336 |
| 121 | 3300009174 | Ga0105241_10027743 | Ga0105241_100277432 | 336 |
| 122 | 3300009176 | Ga0105242_10000350 | Ga0105242_1000035019 | 336 |
| 123 | 3300009177 | Ga0105248_10015595 | Ga0105248_100155956 | 336 |
| 124 | 3300009545 | Ga0105237_10182842 | Ga0105237_101828422 | 336 |
| 125 | 3300009553 | Ga0105249_10007137 | Ga0105249_100071372 | 336 |
| 126 | 3300010375 | Ga0105239_10114074 | Ga0105239_101140742 | 336 |
| 127 | 3300011119 | Ga0105246_10002609 | Ga0105246_100026092 | 336 |
| 128 | 3300013100 | Ga0157373_10045507 | Ga0157373_100455072 | 336 |
| 129 | 3300013102 | Ga0157371_10135704 | Ga0157371_101357042 | 336 |
| 130 | 3300013105 | Ga0157369_10174759 | Ga0157369_101747592 | 336 |
| 131 | 3300013296 | Ga0157374_10053103 | Ga0157374_100531032 | 336 |
| 132 | 3300013297 | Ga0157378_10043205 | Ga0157378_100432052 | 336 |
| 133 | 3300013306 | Ga0163162_10010530 | Ga0163162_100105306 | 336 |
| 134 | 3300013307 | Ga0157372_10009499 | Ga0157372_100094994 | 336 |
| 135 | 3300013308 | Ga0157375_10002791 | Ga0157375_1000279114 | 336 |
| 136 | 3300014325 | Ga0163163_10170037 | Ga0163163_101700372 | 336 |
| 137 | 3300014326 | Ga0157380_10009701 | Ga0157380_100097015 | 336 |
| 138 | 3300014745 | Ga0157377_10000341 | Ga0157377_1000034119 | 336 |
| 139 | 3300014969 | Ga0157376_10000663 | Ga0157376_100006639 | 336 |
| 140 | 3300017792 | Ga0163161_10000379 | Ga0163161_1000037937 | 336 |
| 141 | 3300025901 | Ga0207688_10000083 | Ga0207688_100000832 | 336 |
| 142 | 3300025908 | Ga0207643_10000128 | Ga0207643_1000012813 | 336 |
| 143 | 3300025914 | Ga0207671_10156329 | Ga0207671_101563292 | 336 |
| 144 | 3300025919 | Ga0207657_10020169 | Ga0207657_100201695 | 336 |
| 145 | 3300025923 | Ga0207681_10006781 | Ga0207681_100067812 | 336 |
| 146 | 3300025925 | Ga0207650_10008902 | Ga0207650_100089022 | 336 |
| 147 | 3300025933 | Ga0207706_10001616 | Ga0207706_1000161621 | 336 |
| 148 | 3300025940 | Ga0207691_10000599 | Ga0207691_100005992 | 336 |
| 149 | 3300025945 | Ga0207679_10000112 | Ga0207679_1000011220 | 336 |
| 150 | 3300025949 | Ga0207667_10025956 | Ga0207667_100259565 | 336 |
| 151 | 3300025960 | Ga0207651_10000099 | Ga0207651_1000009939 | 336 |
| 152 | 3300026116 | Ga0207674_10035721 | Ga0207674_100357213 | 336 |
| 153 | 3300027876 | Ga0209974_10032320 | Ga0209974_100323202 | 336 |
| 154 | 3300034819 | Ga0373958_0010245 | Ga0373958_0010245_350_1360 | 336 |
| 155 | 3300034820 | Ga0373959_0002918 | Ga0373959_0002918_1485_2495 | 336 |
| 156 | 3300035092 | Ga0373952_0000859 | Ga0373952_0000859_2264_3274 | 336 |
| 157 | 3300035115 | Ga0373941_0005534 | Ga0373941_0005534_904_1914 | 336 |
| 158 | 3300035121 | Ga0373960_0000398 | Ga0373960_0000398_3897_4907 | 336 |
| 159 | 3300035242 | Ga0373962_0003525 | Ga0373962_0003525_2351_3361 | 336 |
| 160 | 3300035691 | Ga0373931_0001718 | Ga0373931_0001718_1204_2214 | 336 |
| 161 | 3300046491 | Ga0495584_0120905 | Ga0495584_0120905_303_1313 | 336 |
| 162 | 3300048903 | Ga0496100_0015511 | Ga0496100_0015511_1805_2815 | 336 |
| 163 | 3300048904 | Ga0496101_0000235 | Ga0496101_0000235_24991_26001 | 336 |
| 164 | 3300048905 | Ga0496102_0022951 | Ga0496102_0022951_2001_3011 | 336 |
| 165 | 3300048906 | Ga0496103_0003790 | Ga0496103_0003790_3163_4173 | 336 |
| 166 | 3300048909 | Ga0496106_0002108 | Ga0496106_0002108_880_1890 | 336 |
| 167 | 3300048910 | Ga0496107_0111973 | Ga0496107_0111973_905_1915 | 336 |
| 168 | 3300048912 | Ga0496109_0005654 | Ga0496109_0005654_2349_3359 | 336 |
| 169 | 3300048916 | Ga0496113_0035587 | Ga0496113_0035587_379_1389 | 336 |
| 170 | 3300048917 | Ga0496114_0112239 | Ga0496114_0112239_554_1564 | 336 |
| 171 | 3300048918 | Ga0496115_0002701 | Ga0496115_0002701_4189_5199 | 336 |
| 172 | 3300050494 | nmdc:mga06z11_4911_c1 | nmdc:mga06z11_4911_c1_3013_4023 | 336 |
| 173 | 3300050511 | nmdc:mga08y16_6190_c1 | nmdc:mga08y16_6190_c1_169_1179 | 336 |
| 174 | 3300050515 | nmdc:mga0a205_17989_c1 | nmdc:mga0a205_17989_c1_360_1370 | 336 |
| 175 | 3300005328 | Ga0070676_10088731 | Ga0070676_100887312 | 337 |
| 176 | 3300005333 | Ga0070677_10002338 | Ga0070677_100023382 | 337 |
| 177 | 3300005354 | Ga0070675_100125571 | Ga0070675_1001255712 | 337 |
| 178 | 3300005356 | Ga0070674_100001918 | Ga0070674_1000019186 | 337 |
| 179 | 3300005365 | Ga0070688_100154625 | Ga0070688_1001546252 | 337 |
| 180 | 3300005456 | Ga0070678_100031777 | Ga0070678_1000317773 | 337 |
| 181 | 3300005458 | Ga0070681_10325796 | Ga0070681_103257961 | 337 |
| 182 | 3300005459 | Ga0068867_100050648 | Ga0068867_1000506482 | 337 |
| 183 | 3300005530 | Ga0070679_100210850 | Ga0070679_1002108502 | 337 |
| 184 | 3300005543 | Ga0070672_100005379 | Ga0070672_1000053795 | 337 |
| 185 | 3300013308 | Ga0157375_10113058 | Ga0157375_101130582 | 337 |
| 186 | 3300014326 | Ga0157380_10131344 | Ga0157380_101313442 | 337 |
| 187 | 3300025893 | Ga0207682_10001931 | Ga0207682_100019314 | 337 |
| 188 | 3300025921 | Ga0207652_10013947 | Ga0207652_100139472 | 337 |
| 189 | 3300025923 | Ga0207681_10188193 | Ga0207681_101881932 | 337 |
| 190 | 3300025926 | Ga0207659_10050993 | Ga0207659_100509932 | 337 |
| 191 | 3300025937 | Ga0207669_10002598 | Ga0207669_100025986 | 337 |
| 192 | 3300025940 | Ga0207691_10002935 | Ga0207691_100029356 | 337 |
| 193 | 3300025972 | Ga0207668_10226629 | Ga0207668_102266291 | 337 |
| 194 | 3300026089 | Ga0207648_10007480 | Ga0207648_100074802 | 337 |
| 195 | 3300026121 | Ga0207683_10001853 | Ga0207683_100018537 | 337 |
| 196 | 3300035115 | Ga0373941_0000494 | Ga0373941_0000494_2338_3417 | 337 |
| 197 | 3300039437 | Ga0436365_0702073 | Ga0436365_0702073_286_1335 | 337 |
| 198 | 3300046492 | Ga0495585_0038601 | Ga0495585_0038601_11_1030 | 337 |
| 199 | 3300048090 | Ga0495615_0000368 | Ga0495615_0000368_5638_6660 | 337 |
| 200 | 3300049574 | Ga0501038_0040262 | Ga0501038_0040262_875_1954 | 337 |
| 201 | 3300049582 | Ga0501048_0098144 | Ga0501048_0098144_11_1090 | 337 |
| 202 | 3300049584 | Ga0501068_0041556 | Ga0501068_0041556_764_1843 | 337 |
| 203 | 3300049586 | Ga0501070_0152053 | Ga0501070_0152053_316_1395 | 337 |
| 204 | 3300049588 | Ga0501072_0218576 | Ga0501072_0218576_133_1212 | 337 |
| 205 | 3300049590 | Ga0501074_0040074 | Ga0501074_0040074_1733_2812 | 337 |
| 206 | 3300049742 | Ga0501080_0290083 | Ga0501080_0290083_405_1472 | 337 |
| 207 | 3300049744 | Ga0501083_0194828 | Ga0501083_0194828_22_1071 | 337 |
| 208 | 3300049822 | Ga0501035_0023582 | Ga0501035_0023582_2399_3478 | 337 |
| 209 | 3300049822 | Ga0501035_0438882 | Ga0501035_0438882_37_1059 | 337 |
| 210 | 3300053119 | Ga0500595_000010 | Ga0500595_000010_30858_32030 | 337 |
| 211 | 3300005468 | Ga0070707_100099390 | Ga0070707_1000993902 | 339 |
| 212 | 3300025912 | Ga0207707_10345496 | Ga0207707_103454962 | 339 |
| 213 | 3300025922 | Ga0207646_10220450 | Ga0207646_102204501 | 339 |
| 214 | 3300006038 | Ga0075365_10018199 | Ga0075365_100181993 | 340 |
| 215 | 3300036401 | Ga0373937_0017774 | Ga0373937_0017774_4252_5328 | 340 |
| 216 | 3300046462 | Ga0495651_0260327 | Ga0495651_0260327_31_1107 | 340 |
| 217 | 3300046663 | Ga0495635_0027056 | Ga0495635_0027056_2151_3227 | 340 |
| 218 | 3300047673 | Ga0495593_0016723 | Ga0495593_0016723_2987_4063 | 340 |
| 219 | 3300053077 | Ga0495601_0005956 | Ga0495601_0005956_1671_2747 | 340 |
| 220 | 3300053078 | Ga0495612_0006791 | Ga0495612_0006791_1162_2238 | 340 |
| 221 | 3300005548 | Ga0070665_100350418 | Ga0070665_1003504182 | 341 |
| 222 | 3300005563 | Ga0068855_100235299 | Ga0068855_1002352992 | 341 |
| 223 | 3300025924 | Ga0207694_10032282 | Ga0207694_100322823 | 341 |
| 224 | 3300025949 | Ga0207667_10214557 | Ga0207667_102145572 | 341 |
| 225 | 3300028379 | Ga0268266_10318353 | Ga0268266_103183532 | 341 |
| 226 | 3300048904 | Ga0496101_0195594 | Ga0496101_0195594_23_1054 | 341 |
| 227 | 3300053078 | Ga0495612_0019920 | Ga0495612_0019920_76_1143 | 341 |
| 228 | 3300005331 | Ga0070670_100046472 | Ga0070670_1000464722 | 342 |
| 229 | 3300005577 | Ga0068857_100069181 | Ga0068857_1000691812 | 342 |
| 230 | 3300005617 | Ga0068859_100038170 | Ga0068859_1000381703 | 342 |
| 231 | 3300005841 | Ga0068863_100107159 | Ga0068863_1001071592 | 342 |
| 232 | 3300006931 | Ga0097620_100038166 | Ga0097620_1000381663 | 342 |
| 233 | 3300009098 | Ga0105245_10070201 | Ga0105245_100702012 | 342 |
| 234 | 3300014325 | Ga0163163_10054275 | Ga0163163_100542752 | 342 |
| 235 | 3300025908 | Ga0207643_10038664 | Ga0207643_100386642 | 342 |
| 236 | 3300025925 | Ga0207650_10123258 | Ga0207650_101232582 | 342 |
| 237 | 3300025942 | Ga0207689_10054251 | Ga0207689_100542512 | 342 |
| 238 | 3300026041 | Ga0207639_10269595 | Ga0207639_102695951 | 342 |
| 239 | 3300026116 | Ga0207674_10082755 | Ga0207674_100827553 | 342 |
| 240 | 3300036401 | Ga0373937_0005103 | Ga0373937_0005103_2721_3776 | 342 |
| 241 | 3300037853 | Ga0436364_1064018 | Ga0436364_1064018_645_1709 | 342 |
| 242 | 3300013296 | Ga0157374_10099654 | Ga0157374_100996542 | 343 |
| 243 | 3300014326 | Ga0157380_10145235 | Ga0157380_101452352 | 343 |
| 244 | 3300025942 | Ga0207689_10266925 | Ga0207689_102669251 | 343 |
| 245 | 3300047320 | Ga0495672_0106579 | Ga0495672_0106579_396_1484 | 343 |
| 246 | 3300053097 | Ga0500648_043289 | Ga0500648_043289_35_1069 | 343 |
| 247 | 3300005290 | Ga0065712_10029709 | Ga0065712_100297091 | 344 |
| 248 | 3300005293 | Ga0065715_10037919 | Ga0065715_100379191 | 344 |
| 249 | 3300005333 | Ga0070677_10037432 | Ga0070677_100374321 | 344 |
| 250 | 3300005356 | Ga0070674_100374632 | Ga0070674_1003746321 | 344 |
| 251 | 3300005457 | Ga0070662_100178517 | Ga0070662_1001785171 | 344 |
| 252 | 3300005466 | Ga0070685_10246411 | Ga0070685_102464111 | 344 |
| 253 | 3300005539 | Ga0068853_100330674 | Ga0068853_1003306741 | 344 |
| 254 | 3300005617 | Ga0068859_100276898 | Ga0068859_1002768982 | 344 |
| 255 | 3300005618 | Ga0068864_100099414 | Ga0068864_1000994141 | 344 |
| 256 | 3300006028 | Ga0070717_10013303 | Ga0070717_100133033 | 344 |
| 257 | 3300006931 | Ga0097620_100276897 | Ga0097620_1002768972 | 344 |
| 258 | 3300009101 | Ga0105247_10016700 | Ga0105247_100167003 | 344 |
| 259 | 3300025901 | Ga0207688_10004971 | Ga0207688_100049716 | 344 |
| 260 | 3300025935 | Ga0207709_10026097 | Ga0207709_100260972 | 344 |
| 261 | 3300025937 | Ga0207669_10290147 | Ga0207669_102901471 | 344 |
| 262 | 3300026075 | Ga0207708_10397502 | Ga0207708_103975021 | 344 |
| 263 | 3300026116 | Ga0207674_10020449 | Ga0207674_100204496 | 344 |
| 264 | 3300046543 | Ga0495645_0094722 | Ga0495645_0094722_99_1166 | 344 |
| 265 | 3300061734 | Ga0530510_0058804 | Ga0530510_0058804_1309_2373 | 344 |
| 266 | 3300041408 | Ga0439453_0000060 | Ga0439453_0000060_4742_5791 | 346 |
| 267 | 3300042436 | Ga0439435_0002105 | Ga0439435_0002105_34_1083 | 346 |
| 268 | 3300045976 | Ga0466967_0122303 | Ga0466967_0122303_709_1776 | 346 |
| 269 | 3300005439 | Ga0070711_100221046 | Ga0070711_1002210462 | 347 |
| 270 | 3300006186 | Ga0075369_10026031 | Ga0075369_100260312 | 347 |
| 271 | 3300025916 | Ga0207663_10027621 | Ga0207663_100276213 | 347 |
| 272 | 3300031241 | Ga0265325_10075637 | Ga0265325_100756371 | 347 |
| 273 | 3300031242 | Ga0265329_10012070 | Ga0265329_100120702 | 347 |
| 274 | 3300031247 | Ga0265340_10014381 | Ga0265340_100143812 | 347 |
| 275 | 3300031250 | Ga0265331_10034717 | Ga0265331_100347172 | 347 |
| 276 | 3300031344 | Ga0265316_10221091 | Ga0265316_102210911 | 347 |
| 277 | 3300031712 | Ga0265342_10102272 | Ga0265342_101022722 | 347 |
| 278 | 3300046474 | Ga0495605_0126410 | Ga0495605_0126410_62_1111 | 347 |
| 279 | iso_pu_bacteria | 2513237096 | 2513661634 | 347 |
| 280 | iso_pu_bacteria | 2513237137 | 2513863107 | 347 |
| 281 | iso_pu_bacteria | 2513237145 | 2513923311 | 347 |
| 282 | iso_pu_bacteria | 2517572143 | 2517889126 | 347 |
| 283 | iso_pu_bacteria | 2524023228 | 2524541222 | 347 |
| 284 | iso_pu_bacteria | 2667528175 | 2671121588 | 347 |
| 285 | iso_pu_bacteria | 2728368998 | 2728753705 | 347 |
| 286 | iso_pu_bacteria | 2791355197 | 2793072628 | 347 |
| 287 | iso_pu_bacteria | 2885374607 | 2885382864 | 347 |
| 288 | iso_pu_bacteria | 2903748898 | 2903756127 | 347 |
| 289 | iso_pu_bacteria | 2904690495 | 2904690931 | 347 |
| 290 | iso_pu_bacteria | 2904699407 | 2904708248 | 347 |
| 291 | iso_pu_bacteria | 2906610324 | 2906613483 | 347 |
| 292 | iso_pu_bacteria | 2906635258 | 2906643032 | 347 |
| 293 | iso_pu_bacteria | 2906660503 | 2906668201 | 347 |
| 294 | iso_pu_bacteria | 2908739725 | 2908747738 | 347 |
| 295 | iso_pu_bacteria | 2908756301 | 2908756987 | 347 |
| 296 | iso_pu_bacteria | 2922425934 | 2922433921 | 347 |
| 297 | iso_pu_bacteria | 2935630451 | 2935634942 | 347 |
| 298 | iso_pu_bacteria | 2941507105 | 2941514270 | 347 |
| 299 | iso_pu_bacteria | 2941515067 | 2941522231 | 347 |
| 300 | iso_pu_bacteria | 2941523033 | 2941530102 | 347 |
| 301 | iso_pu_bacteria | 3005474847 | 3005475361 | 347 |
| 302 | iso_pu_bacteria | 8006933436 | 8006935923 | 347 |
| 303 | iso_pu_bacteria | 8006973647 | 8006975961 | 347 |
| 304 | iso_pu_bacteria | 8019555841 | 8019562749 | 347 |
| 305 | iso_pu_bacteria | 8019565922 | 8019572828 | 347 |
| 306 | 3300007265 | Ga0099794_10015687 | Ga0099794_100156872 | 348 |
| 307 | 3300025939 | Ga0207665_10092666 | Ga0207665_100926662 | 348 |
| 308 | 3300046462 | Ga0495651_0195766 | Ga0495651_0195766_216_1280 | 348 |
| 309 | 3300046474 | Ga0495605_0058205 | Ga0495605_0058205_41_1096 | 348 |
| 310 | iso_pu_bacteria | 2876808645 | 2876818203 | 348 |
| 311 | iso_pu_bacteria | 2879110137 | 2879115151 | 348 |
| 312 | iso_pu_bacteria | 2922386360 | 2922388792 | 348 |
| 313 | 3300025918 | Ga0207662_10231736 | Ga0207662_102317361 | 349 |
| 314 | 3300025927 | Ga0207687_10150080 | Ga0207687_101500802 | 349 |
| 315 | 3300025935 | Ga0207709_10248435 | Ga0207709_102484351 | 349 |
| 316 | 3300025941 | Ga0207711_10235281 | Ga0207711_102352811 | 349 |
| 317 | 3300026075 | Ga0207708_10148868 | Ga0207708_101488682 | 349 |
| 318 | 3300037068 | Ga0373925_0052361 | Ga0373925_0052361_1342_2400 | 349 |
| 319 | 3300046492 | Ga0495585_0004431 | Ga0495585_0004431_3923_5149 | 349 |
| 320 | 3300046507 | Ga0495606_0001566 | Ga0495606_0001566_17556_18617 | 349 |
| 321 | 3300048915 | Ga0496112_0000018 | Ga0496112_0000018_184017_185078 | 349 |
| 322 | 3300053085 | Ga0495619_0128604 | Ga0495619_0128604_70_1128 | 349 |
| 323 | 3300003203 | JGI25406J46586_10000028 | JGI25406J46586_1000002832 | 350 |
| 324 | 3300005329 | Ga0070683_100067592 | Ga0070683_1000675923 | 350 |
| 325 | 3300005330 | Ga0070690_100063572 | Ga0070690_1000635722 | 350 |
| 326 | 3300005333 | Ga0070677_10036854 | Ga0070677_100368542 | 350 |
| 327 | 3300005338 | Ga0068868_100010958 | Ga0068868_1000109584 | 350 |
| 328 | 3300005339 | Ga0070660_100214228 | Ga0070660_1002142282 | 350 |
| 329 | 3300005340 | Ga0070689_100010029 | Ga0070689_1000100293 | 350 |
| 330 | 3300005347 | Ga0070668_100093673 | Ga0070668_1000936732 | 350 |
| 331 | 3300005355 | Ga0070671_100172306 | Ga0070671_1001723061 | 350 |
| 332 | 3300005365 | Ga0070688_100054495 | Ga0070688_1000544952 | 350 |
| 333 | 3300005367 | Ga0070667_100327348 | Ga0070667_1003273482 | 350 |
| 334 | 3300005455 | Ga0070663_100025326 | Ga0070663_1000253264 | 350 |
| 335 | 3300005456 | Ga0070678_100028582 | Ga0070678_1000285823 | 350 |
| 336 | 3300005456 | Ga0070678_100056209 | Ga0070678_1000562092 | 350 |
| 337 | 3300005457 | Ga0070662_100012878 | Ga0070662_1000128784 | 350 |
| 338 | 3300005535 | Ga0070684_100171967 | Ga0070684_1001719672 | 350 |
| 339 | 3300005539 | Ga0068853_100175699 | Ga0068853_1001756992 | 350 |
| 340 | 3300005617 | Ga0068859_100122021 | Ga0068859_1001220212 | 350 |
| 341 | 3300005618 | Ga0068864_100087223 | Ga0068864_1000872232 | 350 |
| 342 | 3300005618 | Ga0068864_100195682 | Ga0068864_1001956822 | 350 |
| 343 | 3300005718 | Ga0068866_10096173 | Ga0068866_100961732 | 350 |
| 344 | 3300005841 | Ga0068863_100120246 | Ga0068863_1001202462 | 350 |
| 345 | 3300005843 | Ga0068860_100276217 | Ga0068860_1002762172 | 350 |
| 346 | 3300005843 | Ga0068860_100304064 | Ga0068860_1003040642 | 350 |
| 347 | 3300005985 | Ga0081539_10000048 | Ga0081539_10000048183 | 350 |
| 348 | 3300006178 | Ga0075367_10048843 | Ga0075367_100488431 | 350 |
| 349 | 3300006195 | Ga0075366_10002375 | Ga0075366_100023757 | 350 |
| 350 | 3300006237 | Ga0097621_100034122 | Ga0097621_1000341224 | 350 |
| 351 | 3300006358 | Ga0068871_100195067 | Ga0068871_1001950672 | 350 |
| 352 | 3300006931 | Ga0097620_100122027 | Ga0097620_1001220272 | 350 |
| 353 | 3300009098 | Ga0105245_10060762 | Ga0105245_100607623 | 350 |
| 354 | 3300009148 | Ga0105243_10230951 | Ga0105243_102309512 | 350 |
| 355 | 3300009176 | Ga0105242_10131844 | Ga0105242_101318442 | 350 |
| 356 | 3300009177 | Ga0105248_10019063 | Ga0105248_100190633 | 350 |
| 357 | 3300011119 | Ga0105246_10148574 | Ga0105246_101485743 | 350 |
| 358 | 3300013296 | Ga0157374_10065956 | Ga0157374_100659563 | 350 |
| 359 | 3300013306 | Ga0163162_10420014 | Ga0163162_104200141 | 350 |
| 360 | 3300013308 | Ga0157375_10022203 | Ga0157375_100222035 | 350 |
| 361 | 3300014325 | Ga0163163_10016636 | Ga0163163_100166363 | 350 |
| 362 | 3300014325 | Ga0163163_10043798 | Ga0163163_100437982 | 350 |
| 363 | 3300014325 | Ga0163163_10166611 | Ga0163163_101666112 | 350 |
| 364 | 3300014969 | Ga0157376_10040464 | Ga0157376_100404643 | 350 |
| 365 | 3300025910 | Ga0207684_10204578 | Ga0207684_102045782 | 350 |
| 366 | 3300025931 | Ga0207644_10075011 | Ga0207644_100750113 | 350 |
| 367 | 3300025933 | Ga0207706_10015033 | Ga0207706_100150333 | 350 |
| 368 | 3300025936 | Ga0207670_10007366 | Ga0207670_100073663 | 350 |
| 369 | 3300025940 | Ga0207691_10023830 | Ga0207691_100238305 | 350 |
| 370 | 3300025941 | Ga0207711_10010676 | Ga0207711_100106766 | 350 |
| 371 | 3300025972 | Ga0207668_10110071 | Ga0207668_101100712 | 350 |
| 372 | 3300025986 | Ga0207658_10276669 | Ga0207658_102766692 | 350 |
| 373 | 3300026067 | Ga0207678_10056323 | Ga0207678_100563233 | 350 |
| 374 | 3300026095 | Ga0207676_10014703 | Ga0207676_100147035 | 350 |
| 375 | 3300026095 | Ga0207676_10123689 | Ga0207676_101236893 | 350 |
| 376 | 3300026121 | Ga0207683_10014162 | Ga0207683_100141625 | 350 |
| 377 | 3300026121 | Ga0207683_10015318 | Ga0207683_100153183 | 350 |
| 378 | 3300026142 | Ga0207698_10063441 | Ga0207698_100634411 | 350 |
| 379 | 3300028379 | Ga0268266_10055302 | Ga0268266_100553023 | 350 |
| 380 | 3300028381 | Ga0268264_10104967 | Ga0268264_101049672 | 350 |
| 381 | 3300034957 | Ga0373938_0015719 | Ga0373938_0015719_369_1430 | 350 |
| 382 | 3300035084 | Ga0373928_0022088 | Ga0373928_0022088_38_1099 | 350 |
| 383 | 3300035115 | Ga0373941_0007844 | Ga0373941_0007844_704_1765 | 350 |
| 384 | 3300035121 | Ga0373960_0040243 | Ga0373960_0040243_128_1189 | 350 |
| 385 | 3300035242 | Ga0373962_0022368 | Ga0373962_0022368_600_1661 | 350 |
| 386 | 3300035691 | Ga0373931_0014040 | Ga0373931_0014040_2076_3137 | 350 |
| 387 | 3300035695 | Ga0373927_0025352 | Ga0373927_0025352_1460_2521 | 350 |
| 388 | 3300035725 | Ga0373947_0035595 | Ga0373947_0035595_1785_2846 | 350 |
| 389 | 3300046455 | Ga0495603_0019964 | Ga0495603_0019964_2035_3096 | 350 |
| 390 | 3300046516 | Ga0495628_0314441 | Ga0495628_0314441_81_1142 | 350 |
| 391 | 3300048089 | Ga0495614_0010418 | Ga0495614_0010418_37_1113 | 350 |
| 392 | 3300048903 | Ga0496100_0072267 | Ga0496100_0072267_715_1776 | 350 |
| 393 | 3300048903 | Ga0496100_0249420 | Ga0496100_0249420_198_1259 | 350 |
| 394 | 3300048903 | Ga0496100_0279397 | Ga0496100_0279397_77_1141 | 350 |
| 395 | 3300048904 | Ga0496101_0008415 | Ga0496101_0008415_1797_2858 | 350 |
| 396 | 3300048904 | Ga0496101_0019223 | Ga0496101_0019223_3196_4257 | 350 |
| 397 | 3300048905 | Ga0496102_0028248 | Ga0496102_0028248_299_1360 | 350 |
| 398 | 3300048905 | Ga0496102_0155347 | Ga0496102_0155347_411_1472 | 350 |
| 399 | 3300048907 | Ga0496104_0008914 | Ga0496104_0008914_5097_6158 | 350 |
| 400 | 3300048907 | Ga0496104_0250055 | Ga0496104_0250055_153_1214 | 350 |
| 401 | 3300048908 | Ga0496105_0006427 | Ga0496105_0006427_6088_7149 | 350 |
| 402 | 3300048908 | Ga0496105_0012927 | Ga0496105_0012927_1207_2268 | 350 |
| 403 | 3300048909 | Ga0496106_0010763 | Ga0496106_0010763_707_1768 | 350 |
| 404 | 3300048909 | Ga0496106_0181176 | Ga0496106_0181176_228_1289 | 350 |
| 405 | 3300048909 | Ga0496106_0325966 | Ga0496106_0325966_44_1105 | 350 |
| 406 | 3300048910 | Ga0496107_0011301 | Ga0496107_0011301_1124_2185 | 350 |
| 407 | 3300048911 | Ga0496108_0016530 | Ga0496108_0016530_3705_4766 | 350 |
| 408 | 3300048911 | Ga0496108_0082807 | Ga0496108_0082807_1581_2642 | 350 |
| 409 | 3300048912 | Ga0496109_0040011 | Ga0496109_0040011_2204_3265 | 350 |
| 410 | 3300048912 | Ga0496109_0045566 | Ga0496109_0045566_2569_3630 | 350 |
| 411 | 3300048913 | Ga0496110_0039961 | Ga0496110_0039961_838_1899 | 350 |
| 412 | 3300048914 | Ga0496111_0009883 | Ga0496111_0009883_5099_6160 | 350 |
| 413 | 3300048915 | Ga0496112_0069569 | Ga0496112_0069569_440_1501 | 350 |
| 414 | 3300048915 | Ga0496112_0334061 | Ga0496112_0334061_370_1431 | 350 |
| 415 | 3300048916 | Ga0496113_0013732 | Ga0496113_0013732_3048_4109 | 350 |
| 416 | 3300048917 | Ga0496114_0009940 | Ga0496114_0009940_619_1680 | 350 |
| 417 | 3300048917 | Ga0496114_0066495 | Ga0496114_0066495_235_1296 | 350 |
| 418 | 3300048918 | Ga0496115_0010842 | Ga0496115_0010842_5085_6146 | 350 |
| 419 | 3300048918 | Ga0496115_0019196 | Ga0496115_0019196_1667_2728 | 350 |
| 420 | 3300050493 | nmdc:mga0k408_2505_c2 | nmdc:mga0k408_2505_c2_3032_4093 | 350 |
| 421 | 3300050494 | nmdc:mga06z11_34154_c1 | nmdc:mga06z11_34154_c1_25_1086 | 350 |
| 422 | 3300005336 | Ga0070680_100043949 | Ga0070680_1000439492 | 351 |
| 423 | 3300005356 | Ga0070674_100011258 | Ga0070674_1000112584 | 351 |
| 424 | 3300005456 | Ga0070678_100089587 | Ga0070678_1000895872 | 351 |
| 425 | 3300005458 | Ga0070681_10050414 | Ga0070681_100504143 | 351 |
| 426 | 3300005458 | Ga0070681_10220683 | Ga0070681_102206832 | 351 |
| 427 | 3300005530 | Ga0070679_100040768 | Ga0070679_1000407682 | 351 |
| 428 | 3300005536 | Ga0070697_100002564 | Ga0070697_1000025644 | 351 |
| 429 | 3300005539 | Ga0068853_100093456 | Ga0068853_1000934562 | 351 |
| 430 | 3300005543 | Ga0070672_100053092 | Ga0070672_1000530922 | 351 |
| 431 | 3300005545 | Ga0070695_100026443 | Ga0070695_1000264431 | 351 |
| 432 | 3300005563 | Ga0068855_100082241 | Ga0068855_1000822411 | 351 |
| 433 | 3300005718 | Ga0068866_10037249 | Ga0068866_100372492 | 351 |
| 434 | 3300005937 | Ga0081455_10003093 | Ga0081455_1000309313 | 351 |
| 435 | 3300005937 | Ga0081455_10011459 | Ga0081455_100114592 | 351 |
| 436 | 3300005937 | Ga0081455_10103105 | Ga0081455_101031052 | 351 |
| 437 | 3300005937 | Ga0081455_10158909 | Ga0081455_101589092 | 351 |
| 438 | 3300005937 | Ga0081455_10215824 | Ga0081455_102158241 | 351 |
| 439 | 3300005983 | Ga0081540_1001430 | Ga0081540_10014307 | 351 |
| 440 | 3300005983 | Ga0081540_1003755 | Ga0081540_10037557 | 351 |
| 441 | 3300005983 | Ga0081540_1009790 | Ga0081540_10097902 | 351 |
| 442 | 3300005983 | Ga0081540_1017229 | Ga0081540_10172292 | 351 |
| 443 | 3300005983 | Ga0081540_1063111 | Ga0081540_10631112 | 351 |
| 444 | 3300005985 | Ga0081539_10058707 | Ga0081539_100587072 | 351 |
| 445 | 3300006028 | Ga0070717_10059267 | Ga0070717_100592671 | 351 |
| 446 | 3300006173 | Ga0070716_100006717 | Ga0070716_1000067171 | 351 |
| 447 | 3300006914 | Ga0075436_100004698 | Ga0075436_1000046987 | 351 |
| 448 | 3300007076 | Ga0075435_100266357 | Ga0075435_1002663572 | 351 |
| 449 | 3300013308 | Ga0157375_10316399 | Ga0157375_103163992 | 351 |
| 450 | 3300014326 | Ga0157380_10270244 | Ga0157380_102702442 | 351 |
| 451 | 3300014969 | Ga0157376_10187083 | Ga0157376_101870832 | 351 |
| 452 | 3300017792 | Ga0163161_10264180 | Ga0163161_102641802 | 351 |
| 453 | 3300025898 | Ga0207692_10003295 | Ga0207692_100032954 | 351 |
| 454 | 3300025905 | Ga0207685_10000528 | Ga0207685_100005283 | 351 |
| 455 | 3300025906 | Ga0207699_10010546 | Ga0207699_100105463 | 351 |
| 456 | 3300025908 | Ga0207643_10140506 | Ga0207643_101405062 | 351 |
| 457 | 3300025912 | Ga0207707_10055634 | Ga0207707_100556342 | 351 |
| 458 | 3300025915 | Ga0207693_10003105 | Ga0207693_100031058 | 351 |
| 459 | 3300025916 | Ga0207663_10003674 | Ga0207663_100036745 | 351 |
| 460 | 3300025917 | Ga0207660_10044159 | Ga0207660_100441592 | 351 |
| 461 | 3300025921 | Ga0207652_10024211 | Ga0207652_100242114 | 351 |
| 462 | 3300025928 | Ga0207700_10025747 | Ga0207700_100257471 | 351 |
| 463 | 3300025929 | Ga0207664_10010948 | Ga0207664_100109485 | 351 |
| 464 | 3300025939 | Ga0207665_10001379 | Ga0207665_100013794 | 351 |
| 465 | 3300026041 | Ga0207639_10042404 | Ga0207639_100424042 | 351 |
| 466 | 3300026121 | Ga0207683_10011627 | Ga0207683_100116274 | 351 |
| 467 | 3300033442 | Ga0315911_1000008 | Ga0315911_100000819 | 351 |
| 468 | 3300046475 | Ga0495639_0034011 | Ga0495639_0034011_534_1595 | 351 |
| 469 | 3300046477 | Ga0495664_0018790 | Ga0495664_0018790_1711_2775 | 351 |
| 470 | 3300046507 | Ga0495606_0074530 | Ga0495606_0074530_295_1356 | 351 |
| 471 | 3300046616 | Ga0495668_0118180 | Ga0495668_0118180_339_1400 | 351 |
| 472 | 3300048910 | Ga0496107_0030116 | Ga0496107_0030116_1205_2269 | 351 |
| 473 | 3300048921 | Ga0496118_0078665 | Ga0496118_0078665_1005_2066 | 351 |
| 474 | 3300048924 | Ga0496121_0046507 | Ga0496121_0046507_2474_3535 | 351 |
| 475 | 3300048924 | Ga0496121_0188119 | Ga0496121_0188119_101_1165 | 351 |
| 476 | 3300048929 | Ga0496126_0068906 | Ga0496126_0068906_369_1433 | 351 |
| 477 | 3300050493 | nmdc:mga0k408_36277_c1 | nmdc:mga0k408_36277_c1_1152_2219 | 351 |
| 478 | 3300050513 | nmdc:mga0rr50_19557_c1 | nmdc:mga0rr50_19557_c1_2104_3168 | 351 |
| 479 | 3300053077 | Ga0495601_0018585 | Ga0495601_0018585_2298_3362 | 351 |
| 480 | 3300053093 | Ga0500651_0102011 | Ga0500651_0102011_62_1123 | 351 |
| 481 | 3300053094 | Ga0500566_0001625 | Ga0500566_0001625_980_2044 | 351 |
| 482 | 3300053119 | Ga0500595_000095 | Ga0500595_000095_37221_38285 | 351 |
| 483 | 3300053130 | Ga0500642_0017123 | Ga0500642_0017123_1201_2262 | 351 |
| 484 | 3300053140 | Ga0500573_0175702 | Ga0500573_0175702_72_1136 | 351 |
| 485 | 3300053162 | Ga0500638_006677 | Ga0500638_006677_1259_2323 | 351 |
| 486 | 3300053177 | Ga0500636_0014540 | Ga0500636_0014540_2845_3906 | 351 |
| 487 | 3300053178 | Ga0500637_0000495 | Ga0500637_0000495_10592_11656 | 351 |
| 488 | 3300005328 | Ga0070676_10131041 | Ga0070676_101310412 | 352 |
| 489 | 3300005329 | Ga0070683_100011738 | Ga0070683_1000117384 | 352 |
| 490 | 3300005331 | Ga0070670_100031028 | Ga0070670_1000310282 | 352 |
| 491 | 3300005334 | Ga0068869_100106003 | Ga0068869_1001060032 | 352 |
| 492 | 3300005335 | Ga0070666_10005529 | Ga0070666_100055292 | 352 |
| 493 | 3300005336 | Ga0070680_100069523 | Ga0070680_1000695232 | 352 |
| 494 | 3300005336 | Ga0070680_100073871 | Ga0070680_1000738712 | 352 |
| 495 | 3300005338 | Ga0068868_100097041 | Ga0068868_1000970412 | 352 |
| 496 | 3300005338 | Ga0068868_100114377 | Ga0068868_1001143773 | 352 |
| 497 | 3300005356 | Ga0070674_100358750 | Ga0070674_1003587501 | 352 |
| 498 | 3300005364 | Ga0070673_100122369 | Ga0070673_1001223692 | 352 |
| 499 | 3300005367 | Ga0070667_100139796 | Ga0070667_1001397962 | 352 |
| 500 | 3300005434 | Ga0070709_10006522 | Ga0070709_100065221 | 352 |
| 501 | 3300005434 | Ga0070709_10009430 | Ga0070709_100094303 | 352 |
| 502 | 3300005435 | Ga0070714_100141720 | Ga0070714_1001417202 | 352 |
| 503 | 3300005435 | Ga0070714_100175934 | Ga0070714_1001759342 | 352 |
| 504 | 3300005436 | Ga0070713_100020428 | Ga0070713_1000204283 | 352 |
| 505 | 3300005437 | Ga0070710_10091766 | Ga0070710_100917662 | 352 |
| 506 | 3300005438 | Ga0070701_10099733 | Ga0070701_100997332 | 352 |
| 507 | 3300005439 | Ga0070711_100035137 | Ga0070711_1000351372 | 352 |
| 508 | 3300005440 | Ga0070705_100158085 | Ga0070705_1001580852 | 352 |
| 509 | 3300005455 | Ga0070663_100093309 | Ga0070663_1000933091 | 352 |
| 510 | 3300005456 | Ga0070678_100139062 | Ga0070678_1001390622 | 352 |
| 511 | 3300005457 | Ga0070662_100176492 | Ga0070662_1001764922 | 352 |
| 512 | 3300005458 | Ga0070681_10015832 | Ga0070681_100158322 | 352 |
| 513 | 3300005535 | Ga0070684_100016286 | Ga0070684_1000162862 | 352 |
| 514 | 3300005539 | Ga0068853_100069092 | Ga0068853_1000690923 | 352 |
| 515 | 3300005539 | Ga0068853_100098738 | Ga0068853_1000987382 | 352 |
| 516 | 3300005539 | Ga0068853_100253732 | Ga0068853_1002537321 | 352 |
| 517 | 3300005543 | Ga0070672_100262842 | Ga0070672_1002628422 | 352 |
| 518 | 3300005545 | Ga0070695_100135344 | Ga0070695_1001353441 | 352 |
| 519 | 3300005547 | Ga0070693_100168400 | Ga0070693_1001684002 | 352 |
| 520 | 3300005548 | Ga0070665_100023550 | Ga0070665_1000235506 | 352 |
| 521 | 3300005548 | Ga0070665_100203213 | Ga0070665_1002032132 | 352 |
| 522 | 3300005548 | Ga0070665_100234436 | Ga0070665_1002344362 | 352 |
| 523 | 3300005549 | Ga0070704_100065568 | Ga0070704_1000655682 | 352 |
| 524 | 3300005563 | Ga0068855_100098486 | Ga0068855_1000984863 | 352 |
| 525 | 3300005563 | Ga0068855_100108293 | Ga0068855_1001082933 | 352 |
| 526 | 3300005578 | Ga0068854_100106576 | Ga0068854_1001065762 | 352 |
| 527 | 3300005614 | Ga0068856_100007430 | Ga0068856_1000074306 | 352 |
| 528 | 3300005614 | Ga0068856_100061086 | Ga0068856_1000610862 | 352 |
| 529 | 3300005616 | Ga0068852_100093916 | Ga0068852_1000939162 | 352 |
| 530 | 3300005616 | Ga0068852_100366140 | Ga0068852_1003661402 | 352 |
| 531 | 3300005842 | Ga0068858_100065499 | Ga0068858_1000654992 | 352 |
| 532 | 3300005842 | Ga0068858_100222549 | Ga0068858_1002225492 | 352 |
| 533 | 3300005843 | Ga0068860_100000577 | Ga0068860_10000057719 | 352 |
| 534 | 3300005844 | Ga0068862_100019155 | Ga0068862_1000191554 | 352 |
| 535 | 3300005844 | Ga0068862_100234364 | Ga0068862_1002343642 | 352 |
| 536 | 3300005937 | Ga0081455_10006033 | Ga0081455_100060337 | 352 |
| 537 | 3300005937 | Ga0081455_10053413 | Ga0081455_100534132 | 352 |
| 538 | 3300005983 | Ga0081540_1003410 | Ga0081540_10034108 | 352 |
| 539 | 3300005983 | Ga0081540_1014713 | Ga0081540_10147133 | 352 |
| 540 | 3300005985 | Ga0081539_10072824 | Ga0081539_100728242 | 352 |
| 541 | 3300006028 | Ga0070717_10010868 | Ga0070717_100108682 | 352 |
| 542 | 3300006038 | Ga0075365_10099182 | Ga0075365_100991822 | 352 |
| 543 | 3300006048 | Ga0075363_100008259 | Ga0075363_1000082594 | 352 |
| 544 | 3300006048 | Ga0075363_100023705 | Ga0075363_1000237052 | 352 |
| 545 | 3300006058 | Ga0075432_10000765 | Ga0075432_100007653 | 352 |
| 546 | 3300006175 | Ga0070712_100024348 | Ga0070712_1000243483 | 352 |
| 547 | 3300006177 | Ga0075362_10045225 | Ga0075362_100452252 | 352 |
| 548 | 3300006178 | Ga0075367_10045981 | Ga0075367_100459812 | 352 |
| 549 | 3300006353 | Ga0075370_10026132 | Ga0075370_100261323 | 352 |
| 550 | 3300006358 | Ga0068871_100027579 | Ga0068871_1000275792 | 352 |
| 551 | 3300006358 | Ga0068871_100292928 | Ga0068871_1002929281 | 352 |
| 552 | 3300006844 | Ga0075428_100131629 | Ga0075428_1001316292 | 352 |
| 553 | 3300006844 | Ga0075428_100135424 | Ga0075428_1001354242 | 352 |
| 554 | 3300006846 | Ga0075430_100000026 | Ga0075430_10000002625 | 352 |
| 555 | 3300006846 | Ga0075430_100000222 | Ga0075430_10000022220 | 352 |
| 556 | 3300006847 | Ga0075431_100000451 | Ga0075431_1000004516 | 352 |
| 557 | 3300006847 | Ga0075431_100032904 | Ga0075431_1000329043 | 352 |
| 558 | 3300006852 | Ga0075433_10002991 | Ga0075433_100029913 | 352 |
| 559 | 3300006871 | Ga0075434_100000110 | Ga0075434_10000011010 | 352 |
| 560 | 3300006880 | Ga0075429_100000247 | Ga0075429_10000024710 | 352 |
| 561 | 3300006880 | Ga0075429_100009429 | Ga0075429_1000094296 | 352 |
| 562 | 3300006880 | Ga0075429_100030873 | Ga0075429_1000308732 | 352 |
| 563 | 3300006914 | Ga0075436_100089836 | Ga0075436_1000898362 | 352 |
| 564 | 3300007076 | Ga0075435_100016201 | Ga0075435_1000162016 | 352 |
| 565 | 3300007076 | Ga0075435_100110089 | Ga0075435_1001100891 | 352 |
| 566 | 3300009093 | Ga0105240_10121284 | Ga0105240_101212843 | 352 |
| 567 | 3300009094 | Ga0111539_10000337 | Ga0111539_1000033729 | 352 |
| 568 | 3300009098 | Ga0105245_10111892 | Ga0105245_101118922 | 352 |
| 569 | 3300009101 | Ga0105247_10006423 | Ga0105247_100064233 | 352 |
| 570 | 3300009101 | Ga0105247_10062814 | Ga0105247_100628142 | 352 |
| 571 | 3300009147 | Ga0114129_10053822 | Ga0114129_100538221 | 352 |
| 572 | 3300009147 | Ga0114129_10229244 | Ga0114129_102292442 | 352 |
| 573 | 3300009147 | Ga0114129_10652340 | Ga0114129_106523402 | 352 |
| 574 | 3300009174 | Ga0105241_10159805 | Ga0105241_101598052 | 352 |
| 575 | 3300009177 | Ga0105248_10037197 | Ga0105248_100371975 | 352 |
| 576 | 3300009177 | Ga0105248_10080964 | Ga0105248_100809642 | 352 |
| 577 | 3300009545 | Ga0105237_10066040 | Ga0105237_100660403 | 352 |
| 578 | 3300009545 | Ga0105237_10173347 | Ga0105237_101733472 | 352 |
| 579 | 3300009545 | Ga0105237_10383751 | Ga0105237_103837511 | 352 |
| 580 | 3300009553 | Ga0105249_10122164 | Ga0105249_101221641 | 352 |
| 581 | 3300010375 | Ga0105239_10017528 | Ga0105239_100175284 | 352 |
| 582 | 3300013104 | Ga0157370_10322474 | Ga0157370_103224741 | 352 |
| 583 | 3300013105 | Ga0157369_10095876 | Ga0157369_100958762 | 352 |
| 584 | 3300013296 | Ga0157374_10054750 | Ga0157374_100547502 | 352 |
| 585 | 3300013297 | Ga0157378_10107630 | Ga0157378_101076302 | 352 |
| 586 | 3300013306 | Ga0163162_10095629 | Ga0163162_100956292 | 352 |
| 587 | 3300013307 | Ga0157372_10084860 | Ga0157372_100848602 | 352 |
| 588 | 3300014745 | Ga0157377_10059329 | Ga0157377_100593292 | 352 |
| 589 | 3300014969 | Ga0157376_10141002 | Ga0157376_101410022 | 352 |
| 590 | 3300025297 | Ga0209758_1002448 | Ga0209758_100244814 | 352 |
| 591 | 3300025297 | Ga0209758_1008580 | Ga0209758_10085805 | 352 |
| 592 | 3300025900 | Ga0207710_10008560 | Ga0207710_100085606 | 352 |
| 593 | 3300025906 | Ga0207699_10006599 | Ga0207699_100065993 | 352 |
| 594 | 3300025906 | Ga0207699_10045368 | Ga0207699_100453682 | 352 |
| 595 | 3300025912 | Ga0207707_10001534 | Ga0207707_1000153414 | 352 |
| 596 | 3300025913 | Ga0207695_10089205 | Ga0207695_100892052 | 352 |
| 597 | 3300025913 | Ga0207695_10247016 | Ga0207695_102470162 | 352 |
| 598 | 3300025914 | Ga0207671_10057611 | Ga0207671_100576112 | 352 |
| 599 | 3300025914 | Ga0207671_10073915 | Ga0207671_100739152 | 352 |
| 600 | 3300025914 | Ga0207671_10113763 | Ga0207671_101137632 | 352 |
| 601 | 3300025915 | Ga0207693_10117568 | Ga0207693_101175681 | 352 |
| 602 | 3300025917 | Ga0207660_10049075 | Ga0207660_100490752 | 352 |
| 603 | 3300025921 | Ga0207652_10027543 | Ga0207652_100275434 | 352 |
| 604 | 3300025921 | Ga0207652_10056338 | Ga0207652_100563382 | 352 |
| 605 | 3300025927 | Ga0207687_10062204 | Ga0207687_100622042 | 352 |
| 606 | 3300025928 | Ga0207700_10149321 | Ga0207700_101493212 | 352 |
| 607 | 3300025934 | Ga0207686_10056767 | Ga0207686_100567671 | 352 |
| 608 | 3300025938 | Ga0207704_10292194 | Ga0207704_102921941 | 352 |
| 609 | 3300025940 | Ga0207691_10173454 | Ga0207691_101734542 | 352 |
| 610 | 3300025941 | Ga0207711_10077904 | Ga0207711_100779042 | 352 |
| 611 | 3300025942 | Ga0207689_10126494 | Ga0207689_101264942 | 352 |
| 612 | 3300025942 | Ga0207689_10181700 | Ga0207689_101817002 | 352 |
| 613 | 3300025944 | Ga0207661_10011748 | Ga0207661_100117483 | 352 |
| 614 | 3300025949 | Ga0207667_10203956 | Ga0207667_102039562 | 352 |
| 615 | 3300025949 | Ga0207667_10313675 | Ga0207667_103136752 | 352 |
| 616 | 3300025960 | Ga0207651_10031165 | Ga0207651_100311652 | 352 |
| 617 | 3300025972 | Ga0207668_10113802 | Ga0207668_101138022 | 352 |
| 618 | 3300025972 | Ga0207668_10115342 | Ga0207668_101153422 | 352 |
| 619 | 3300025972 | Ga0207668_10126611 | Ga0207668_101266112 | 352 |
| 620 | 3300025972 | Ga0207668_10204806 | Ga0207668_102048061 | 352 |
| 621 | 3300026023 | Ga0207677_10010700 | Ga0207677_100107007 | 352 |
| 622 | 3300026023 | Ga0207677_10133847 | Ga0207677_101338471 | 352 |
| 623 | 3300026023 | Ga0207677_10174836 | Ga0207677_101748362 | 352 |
| 624 | 3300026023 | Ga0207677_10189017 | Ga0207677_101890172 | 352 |
| 625 | 3300026035 | Ga0207703_10025231 | Ga0207703_100252311 | 352 |
| 626 | 3300026041 | Ga0207639_10205900 | Ga0207639_102059002 | 352 |
| 627 | 3300026041 | Ga0207639_10208433 | Ga0207639_102084332 | 352 |
| 628 | 3300026041 | Ga0207639_10285271 | Ga0207639_102852712 | 352 |
| 629 | 3300026067 | Ga0207678_10007002 | Ga0207678_100070025 | 352 |
| 630 | 3300026067 | Ga0207678_10299181 | Ga0207678_102991811 | 352 |
| 631 | 3300026078 | Ga0207702_10142451 | Ga0207702_101424512 | 352 |
| 632 | 3300026116 | Ga0207674_10099104 | Ga0207674_100991043 | 352 |
| 633 | 3300026116 | Ga0207674_10102256 | Ga0207674_101022562 | 352 |
| 634 | 3300026118 | Ga0207675_100301176 | Ga0207675_1003011762 | 352 |
| 635 | 3300026121 | Ga0207683_10185536 | Ga0207683_101855362 | 352 |
| 636 | 3300026121 | Ga0207683_10194398 | Ga0207683_101943982 | 352 |
| 637 | 3300026142 | Ga0207698_10070195 | Ga0207698_100701951 | 352 |
| 638 | 3300027866 | Ga0209813_10016915 | Ga0209813_100169152 | 352 |
| 639 | 3300027907 | Ga0207428_10000140 | Ga0207428_1000014078 | 352 |
| 640 | 3300028379 | Ga0268266_10004422 | Ga0268266_100044226 | 352 |
| 641 | 3300028379 | Ga0268266_10007719 | Ga0268266_100077199 | 352 |
| 642 | 3300028379 | Ga0268266_10047939 | Ga0268266_100479392 | 352 |
| 643 | 3300028379 | Ga0268266_10110471 | Ga0268266_101104712 | 352 |
| 644 | 3300028379 | Ga0268266_10127814 | Ga0268266_101278142 | 352 |
| 645 | 3300028379 | Ga0268266_10195528 | Ga0268266_101955282 | 352 |
| 646 | 3300028379 | Ga0268266_10365962 | Ga0268266_103659622 | 352 |
| 647 | 3300028379 | Ga0268266_10418333 | Ga0268266_104183331 | 352 |
| 648 | 3300028380 | Ga0268265_10026351 | Ga0268265_100263512 | 352 |
| 649 | 3300028380 | Ga0268265_10113231 | Ga0268265_101132312 | 352 |
| 650 | 3300028380 | Ga0268265_10205865 | Ga0268265_102058652 | 352 |
| 651 | 3300028381 | Ga0268264_10000107 | Ga0268264_10000107171 | 352 |
| 652 | 3300028381 | Ga0268264_10086725 | Ga0268264_100867252 | 352 |
| 653 | 3300028573 | Ga0265334_10015125 | Ga0265334_100151252 | 352 |
| 654 | 3300028794 | Ga0307515_10060988 | Ga0307515_100609882 | 352 |
| 655 | 3300031238 | Ga0265332_10050236 | Ga0265332_100502362 | 352 |
| 656 | 3300031239 | Ga0265328_10058289 | Ga0265328_100582892 | 352 |
| 657 | 3300031249 | Ga0265339_10006887 | Ga0265339_100068872 | 352 |
| 658 | 3300031456 | Ga0307513_10077502 | Ga0307513_100775022 | 352 |
| 659 | 3300031456 | Ga0307513_10144650 | Ga0307513_101446502 | 352 |
| 660 | 3300031507 | Ga0307509_10021381 | Ga0307509_100213813 | 352 |
| 661 | 3300031616 | Ga0307508_10000154 | Ga0307508_1000015444 | 352 |
| 662 | 3300031616 | Ga0307508_10265459 | Ga0307508_102654592 | 352 |
| 663 | 3300031711 | Ga0265314_10005615 | Ga0265314_100056155 | 352 |
| 664 | 3300031712 | Ga0265342_10003968 | Ga0265342_100039682 | 352 |
| 665 | 3300031712 | Ga0265342_10017314 | Ga0265342_100173143 | 352 |
| 666 | 3300031712 | Ga0265342_10106101 | Ga0265342_101061011 | 352 |
| 667 | 3300031730 | Ga0307516_10029059 | Ga0307516_100290592 | 352 |
| 668 | 3300031852 | Ga0307410_10174005 | Ga0307410_101740051 | 352 |
| 669 | 3300033180 | Ga0307510_10156282 | Ga0307510_101562822 | 352 |
| 670 | 3300034816 | Ga0373930_0001231 | Ga0373930_0001231_1086_2153 | 352 |
| 671 | 3300035086 | Ga0373934_0023900 | Ga0373934_0023900_509_1579 | 352 |
| 672 | 3300035088 | Ga0373940_0004788 | Ga0373940_0004788_637_1704 | 352 |
| 673 | 3300035111 | Ga0373923_0040479 | Ga0373923_0040479_333_1412 | 352 |
| 674 | 3300035111 | Ga0373923_0119338 | Ga0373923_0119338_61_1119 | 352 |
| 675 | 3300035113 | Ga0373936_0006063 | Ga0373936_0006063_3320_4387 | 352 |
| 676 | 3300035117 | Ga0373953_0001092 | Ga0373953_0001092_4563_5642 | 352 |
| 677 | 3300035117 | Ga0373953_0019195 | Ga0373953_0019195_258_1325 | 352 |
| 678 | 3300035118 | Ga0373954_0001821 | Ga0373954_0001821_933_2012 | 352 |
| 679 | 3300035119 | Ga0373956_0002956 | Ga0373956_0002956_481_1560 | 352 |
| 680 | 3300035120 | Ga0373957_0000374 | Ga0373957_0000374_9129_10208 | 352 |
| 681 | 3300035170 | Ga0373943_0052716 | Ga0373943_0052716_335_1402 | 352 |
| 682 | 3300035171 | Ga0373946_0137298 | Ga0373946_0137298_31_1089 | 352 |
| 683 | 3300035172 | Ga0373955_0009267 | Ga0373955_0009267_287_1366 | 352 |
| 684 | 3300035172 | Ga0373955_0046015 | Ga0373955_0046015_476_1546 | 352 |
| 685 | 3300035410 | Ga0373924_0020683 | Ga0373924_0020683_770_1837 | 352 |
| 686 | 3300035691 | Ga0373931_0019150 | Ga0373931_0019150_574_1641 | 352 |
| 687 | 3300035692 | Ga0373935_0083521 | Ga0373935_0083521_216_1286 | 352 |
| 688 | 3300035692 | Ga0373935_0107474 | Ga0373935_0107474_465_1532 | 352 |
| 689 | 3300035692 | Ga0373935_0206185 | Ga0373935_0206185_270_1337 | 352 |
| 690 | 3300035724 | Ga0373933_0001100 | Ga0373933_0001100_12471_13550 | 352 |
| 691 | 3300036401 | Ga0373937_0064217 | Ga0373937_0064217_1126_2190 | 352 |
| 692 | 3300036401 | Ga0373937_0318829 | Ga0373937_0318829_179_1249 | 352 |
| 693 | 3300037068 | Ga0373925_0020271 | Ga0373925_0020271_2370_3437 | 352 |
| 694 | 3300041486 | Ga0451807_0668963 | Ga0451807_0668963_155_1267 | 352 |
| 695 | 3300044842 | Ga0466957_0033043 | Ga0466957_0033043_1993_3060 | 352 |
| 696 | 3300045836 | Ga0466958_0114579 | Ga0466958_0114579_100_1167 | 352 |
| 697 | 3300046454 | Ga0495592_0001601 | Ga0495592_0001601_7879_8958 | 352 |
| 698 | 3300046455 | Ga0495603_0022944 | Ga0495603_0022944_1880_2947 | 352 |
| 699 | 3300046455 | Ga0495603_0025589 | Ga0495603_0025589_546_1613 | 352 |
| 700 | 3300046455 | Ga0495603_0053963 | Ga0495603_0053963_131_1210 | 352 |
| 701 | 3300046459 | Ga0495629_0000529 | Ga0495629_0000529_22859_23938 | 352 |
| 702 | 3300046459 | Ga0495629_0059688 | Ga0495629_0059688_1498_2565 | 352 |
| 703 | 3300046459 | Ga0495629_0172112 | Ga0495629_0172112_48_1106 | 352 |
| 704 | 3300046460 | Ga0495638_0009159 | Ga0495638_0009159_4216_5283 | 352 |
| 705 | 3300046462 | Ga0495651_0001433 | Ga0495651_0001433_1663_2742 | 352 |
| 706 | 3300046462 | Ga0495651_0020115 | Ga0495651_0020115_485_1552 | 352 |
| 707 | 3300046463 | Ga0495653_0051871 | Ga0495653_0051871_1335_2414 | 352 |
| 708 | 3300046463 | Ga0495653_0089488 | Ga0495653_0089488_306_1364 | 352 |
| 709 | 3300046463 | Ga0495653_0090070 | Ga0495653_0090070_86_1156 | 352 |
| 710 | 3300046473 | Ga0495582_0006293 | Ga0495582_0006293_3708_4775 | 352 |
| 711 | 3300046475 | Ga0495639_0066427 | Ga0495639_0066427_418_1485 | 352 |
| 712 | 3300046477 | Ga0495664_0023312 | Ga0495664_0023312_1845_2903 | 352 |
| 713 | 3300046492 | Ga0495585_0031604 | Ga0495585_0031604_1036_2103 | 352 |
| 714 | 3300046492 | Ga0495585_0105382 | Ga0495585_0105382_164_1231 | 352 |
| 715 | 3300046506 | Ga0495583_0104207 | Ga0495583_0104207_58_1125 | 352 |
| 716 | 3300046511 | Ga0495608_0008113 | Ga0495608_0008113_1739_2818 | 352 |
| 717 | 3300046511 | Ga0495608_0098528 | Ga0495608_0098528_128_1198 | 352 |
| 718 | 3300046514 | Ga0495618_0048917 | Ga0495618_0048917_466_1545 | 352 |
| 719 | 3300046516 | Ga0495628_0007597 | Ga0495628_0007597_4951_6030 | 352 |
| 720 | 3300046517 | Ga0495630_0103006 | Ga0495630_0103006_851_1909 | 352 |
| 721 | 3300046518 | Ga0495631_0115442 | Ga0495631_0115442_48_1115 | 352 |
| 722 | 3300046526 | Ga0495666_0069319 | Ga0495666_0069319_570_1637 | 352 |
| 723 | 3300046529 | Ga0495652_0091823 | Ga0495652_0091823_1175_2233 | 352 |
| 724 | 3300046529 | Ga0495652_0115683 | Ga0495652_0115683_464_1534 | 352 |
| 725 | 3300046531 | Ga0495665_0005351 | Ga0495665_0005351_1755_2816 | 352 |
| 726 | 3300046531 | Ga0495665_0085638 | Ga0495665_0085638_322_1389 | 352 |
| 727 | 3300046533 | Ga0495640_0047337 | Ga0495640_0047337_402_1469 | 352 |
| 728 | 3300046533 | Ga0495640_0064294 | Ga0495640_0064294_1146_2204 | 352 |
| 729 | 3300046536 | Ga0495587_0052159 | Ga0495587_0052159_1120_2190 | 352 |
| 730 | 3300046537 | Ga0495598_0017520 | Ga0495598_0017520_465_1532 | 352 |
| 731 | 3300046539 | Ga0495621_0050206 | Ga0495621_0050206_284_1351 | 352 |
| 732 | 3300046543 | Ga0495645_0025716 | Ga0495645_0025716_2551_3630 | 352 |
| 733 | 3300046543 | Ga0495645_0028258 | Ga0495645_0028258_288_1355 | 352 |
| 734 | 3300046543 | Ga0495645_0038226 | Ga0495645_0038226_2313_3371 | 352 |
| 735 | 3300046543 | Ga0495645_0052493 | Ga0495645_0052493_1819_2886 | 352 |
| 736 | 3300046559 | Ga0495667_0003563 | Ga0495667_0003563_3554_4633 | 352 |
| 737 | 3300046559 | Ga0495667_0119452 | Ga0495667_0119452_96_1166 | 352 |
| 738 | 3300046615 | Ga0495656_0032549 | Ga0495656_0032549_796_1863 | 352 |
| 739 | 3300046642 | Ga0495634_0004321 | Ga0495634_0004321_7912_8991 | 352 |
| 740 | 3300046663 | Ga0495635_0000429 | Ga0495635_0000429_23369_24448 | 352 |
| 741 | 3300046664 | Ga0495659_0007040 | Ga0495659_0007040_604_1671 | 352 |
| 742 | 3300046674 | Ga0495588_0083701 | Ga0495588_0083701_54_1121 | 352 |
| 743 | 3300046675 | Ga0495657_0010262 | Ga0495657_0010262_1535_2614 | 352 |
| 744 | 3300046678 | Ga0495599_0003035 | Ga0495599_0003035_385_1464 | 352 |
| 745 | 3300046679 | Ga0495623_0007655 | Ga0495623_0007655_1377_2456 | 352 |
| 746 | 3300046679 | Ga0495623_0102314 | Ga0495623_0102314_417_1484 | 352 |
| 747 | 3300046680 | Ga0495646_0001304 | Ga0495646_0001304_5580_6659 | 352 |
| 748 | 3300046680 | Ga0495646_0043515 | Ga0495646_0043515_935_2002 | 352 |
| 749 | 3300046684 | Ga0495669_0077313 | Ga0495669_0077313_347_1414 | 352 |
| 750 | 3300046689 | Ga0495613_0219605 | Ga0495613_0219605_228_1295 | 352 |
| 751 | 3300046690 | Ga0495624_0040078 | Ga0495624_0040078_1711_2769 | 352 |
| 752 | 3300046690 | Ga0495624_0132083 | Ga0495624_0132083_94_1161 | 352 |
| 753 | 3300046694 | Ga0495649_0080821 | Ga0495649_0080821_544_1611 | 352 |
| 754 | 3300046809 | Ga0495600_0014546 | Ga0495600_0014546_1335_2414 | 352 |
| 755 | 3300047315 | Ga0495581_0005737 | Ga0495581_0005737_1822_2889 | 352 |
| 756 | 3300047315 | Ga0495581_0092012 | Ga0495581_0092012_108_1175 | 352 |
| 757 | 3300047317 | Ga0495604_0010023 | Ga0495604_0010023_2269_3348 | 352 |
| 758 | 3300047317 | Ga0495604_0116513 | Ga0495604_0116513_857_1927 | 352 |
| 759 | 3300047319 | Ga0495674_0004206 | Ga0495674_0004206_8308_9375 | 352 |
| 760 | 3300047319 | Ga0495674_0021636 | Ga0495674_0021636_3723_4781 | 352 |
| 761 | 3300047319 | Ga0495674_0082394 | Ga0495674_0082394_68_1138 | 352 |
| 762 | 3300047319 | Ga0495674_0198450 | Ga0495674_0198450_80_1159 | 352 |
| 763 | 3300047320 | Ga0495672_0032259 | Ga0495672_0032259_1836_2903 | 352 |
| 764 | 3300047322 | Ga0495680_0006824 | Ga0495680_0006824_1244_2323 | 352 |
| 765 | 3300047444 | Ga0495675_0067445 | Ga0495675_0067445_313_1392 | 352 |
| 766 | 3300047471 | Ga0495684_0000497 | Ga0495684_0000497_8035_9114 | 352 |
| 767 | 3300047471 | Ga0495684_0015464 | Ga0495684_0015464_785_1843 | 352 |
| 768 | 3300047471 | Ga0495684_0025159 | Ga0495684_0025159_1060_2127 | 352 |
| 769 | 3300047472 | Ga0495686_0147868 | Ga0495686_0147868_278_1345 | 352 |
| 770 | 3300047673 | Ga0495593_0014868 | Ga0495593_0014868_2693_3772 | 352 |
| 771 | 3300047673 | Ga0495593_0014947 | Ga0495593_0014947_2297_3364 | 352 |
| 772 | 3300048088 | Ga0495602_0128581 | Ga0495602_0128581_554_1633 | 352 |
| 773 | 3300048088 | Ga0495602_0152128 | Ga0495602_0152128_285_1355 | 352 |
| 774 | 3300048089 | Ga0495614_0018899 | Ga0495614_0018899_58_1122 | 352 |
| 775 | 3300048904 | Ga0496101_0052924 | Ga0496101_0052924_1514_2581 | 352 |
| 776 | 3300048904 | Ga0496101_0053933 | Ga0496101_0053933_822_1889 | 352 |
| 777 | 3300048905 | Ga0496102_0039515 | Ga0496102_0039515_1344_2411 | 352 |
| 778 | 3300048907 | Ga0496104_0003146 | Ga0496104_0003146_1931_2989 | 352 |
| 779 | 3300048907 | Ga0496104_0215047 | Ga0496104_0215047_199_1266 | 352 |
| 780 | 3300048907 | Ga0496104_0499306 | Ga0496104_0499306_28_1086 | 352 |
| 781 | 3300048908 | Ga0496105_0000840 | Ga0496105_0000840_8782_9840 | 352 |
| 782 | 3300048908 | Ga0496105_0190590 | Ga0496105_0190590_416_1483 | 352 |
| 783 | 3300048909 | Ga0496106_0000788 | Ga0496106_0000788_13610_14674 | 352 |
| 784 | 3300048909 | Ga0496106_0169369 | Ga0496106_0169369_583_1650 | 352 |
| 785 | 3300048909 | Ga0496106_0186831 | Ga0496106_0186831_229_1296 | 352 |
| 786 | 3300048910 | Ga0496107_0004819 | Ga0496107_0004819_2514_3581 | 352 |
| 787 | 3300048911 | Ga0496108_0011130 | Ga0496108_0011130_1344_2411 | 352 |
| 788 | 3300048911 | Ga0496108_0237162 | Ga0496108_0237162_306_1364 | 352 |
| 789 | 3300048912 | Ga0496109_0027237 | Ga0496109_0027237_2074_3141 | 352 |
| 790 | 3300048912 | Ga0496109_0028566 | Ga0496109_0028566_291_1349 | 352 |
| 791 | 3300048913 | Ga0496110_0034051 | Ga0496110_0034051_875_1942 | 352 |
| 792 | 3300048913 | Ga0496110_0492910 | Ga0496110_0492910_18_1076 | 352 |
| 793 | 3300048914 | Ga0496111_0002946 | Ga0496111_0002946_8301_9368 | 352 |
| 794 | 3300048915 | Ga0496112_0013345 | Ga0496112_0013345_333_1391 | 352 |
| 795 | 3300048915 | Ga0496112_0030393 | Ga0496112_0030393_1162_2229 | 352 |
| 796 | 3300048915 | Ga0496112_0421533 | Ga0496112_0421533_23_1090 | 352 |
| 797 | 3300048917 | Ga0496114_0037148 | Ga0496114_0037148_2842_3900 | 352 |
| 798 | 3300048917 | Ga0496114_0048719 | Ga0496114_0048719_1552_2619 | 352 |
| 799 | 3300048918 | Ga0496115_0109684 | Ga0496115_0109684_307_1374 | 352 |
| 800 | 3300048920 | Ga0496117_0007128 | Ga0496117_0007128_1544_2608 | 352 |
| 801 | 3300048920 | Ga0496117_0074479 | Ga0496117_0074479_520_1587 | 352 |
| 802 | 3300048921 | Ga0496118_0003592 | Ga0496118_0003592_7426_8490 | 352 |
| 803 | 3300048924 | Ga0496121_0000640 | Ga0496121_0000640_30683_31747 | 352 |
| 804 | 3300048924 | Ga0496121_0048134 | Ga0496121_0048134_1792_2859 | 352 |
| 805 | 3300048924 | Ga0496121_0093528 | Ga0496121_0093528_807_1874 | 352 |
| 806 | 3300048927 | Ga0496124_0002189 | Ga0496124_0002189_12706_13770 | 352 |
| 807 | 3300048928 | Ga0496125_0085843 | Ga0496125_0085843_1266_2330 | 352 |
| 808 | 3300048929 | Ga0496126_0009499 | Ga0496126_0009499_2524_3591 | 352 |
| 809 | 3300048929 | Ga0496126_0018354 | Ga0496126_0018354_731_1795 | 352 |
| 810 | 3300048929 | Ga0496126_0043259 | Ga0496126_0043259_1761_2825 | 352 |
| 811 | 3300048929 | Ga0496126_0080924 | Ga0496126_0080924_60_1127 | 352 |
| 812 | 3300048929 | Ga0496126_0115449 | Ga0496126_0115449_686_1801 | 352 |
| 813 | 3300048929 | Ga0496126_0164235 | Ga0496126_0164235_476_1540 | 352 |
| 814 | 3300048929 | Ga0496126_0254389 | Ga0496126_0254389_59_1126 | 352 |
| 815 | 3300049580 | Ga0501046_0067505 | Ga0501046_0067505_661_1728 | 352 |
| 816 | 3300049581 | Ga0501047_0052511 | Ga0501047_0052511_998_2065 | 352 |
| 817 | 3300049586 | Ga0501070_0215422 | Ga0501070_0215422_148_1215 | 352 |
| 818 | 3300049590 | Ga0501074_0046177 | Ga0501074_0046177_1251_2318 | 352 |
| 819 | 3300049742 | Ga0501080_0029073 | Ga0501080_0029073_1444_2511 | 352 |
| 820 | 3300050492 | nmdc:mga0yw44_63102_c1 | nmdc:mga0yw44_63102_c1_827_1894 | 352 |
| 821 | 3300050496 | nmdc:mga07m45_49692_c1 | nmdc:mga07m45_49692_c1_440_1507 | 352 |
| 822 | 3300050507 | nmdc:mga05p37_10233_c1 | nmdc:mga05p37_10233_c1_827_1894 | 352 |
| 823 | 3300050507 | nmdc:mga05p37_166916_c1 | nmdc:mga05p37_166916_c1_71_1138 | 352 |
| 824 | 3300050507 | nmdc:mga05p37_225_c1 | nmdc:mga05p37_225_c1_28436_29494 | 352 |
| 825 | 3300050508 | nmdc:mga09592_244_c1 | nmdc:mga09592_244_c1_9616_10674 | 352 |
| 826 | 3300050508 | nmdc:mga09592_58040_c1 | nmdc:mga09592_58040_c1_514_1614 | 352 |
| 827 | 3300050508 | nmdc:mga09592_736_c1 | nmdc:mga09592_736_c1_17196_18266 | 352 |
| 828 | 3300050509 | nmdc:mga0qj67_215_c1 | nmdc:mga0qj67_215_c1_11684_12751 | 352 |
| 829 | 3300050509 | nmdc:mga0qj67_2611_c1 | nmdc:mga0qj67_2611_c1_8566_9624 | 352 |
| 830 | 3300050509 | nmdc:mga0qj67_4314_c1 | nmdc:mga0qj67_4314_c1_2985_4052 | 352 |
| 831 | 3300050509 | nmdc:mga0qj67_4314_c1 | nmdc:mga0qj67_4314_c1_5311_6411 | 352 |
| 832 | 3300050510 | nmdc:mga06r32_12515_c1 | nmdc:mga06r32_12515_c1_4948_6048 | 352 |
| 833 | 3300050510 | nmdc:mga06r32_341_c1 | nmdc:mga06r32_341_c1_31886_32956 | 352 |
| 834 | 3300050510 | nmdc:mga06r32_731_c1 | nmdc:mga06r32_731_c1_10989_12047 | 352 |
| 835 | 3300050511 | nmdc:mga08y16_617_c1 | nmdc:mga08y16_617_c1_22438_23496 | 352 |
| 836 | 3300050512 | nmdc:mga0n895_308807_c1 | nmdc:mga0n895_308807_c1_37_1104 | 352 |
| 837 | 3300050512 | nmdc:mga0n895_457_c1 | nmdc:mga0n895_457_c1_228_1286 | 352 |
| 838 | 3300050512 | nmdc:mga0n895_543324_c1 | nmdc:mga0n895_543324_c1_27_1085 | 352 |
| 839 | 3300050513 | nmdc:mga0rr50_11539_c1 | nmdc:mga0rr50_11539_c1_541_1599 | 352 |
| 840 | 3300050514 | nmdc:mga08x19_81571_c1 | nmdc:mga08x19_81571_c1_27_1085 | 352 |
| 841 | 3300050515 | nmdc:mga0a205_1019_c1 | nmdc:mga0a205_1019_c1_7565_8623 | 352 |
| 842 | 3300053077 | Ga0495601_0000413 | Ga0495601_0000413_1200_2258 | 352 |
| 843 | 3300053077 | Ga0495601_0007499 | Ga0495601_0007499_1051_2130 | 352 |
| 844 | 3300053078 | Ga0495612_0002430 | Ga0495612_0002430_2202_3260 | 352 |
| 845 | 3300053084 | Ga0495595_0001465 | Ga0495595_0001465_1326_2405 | 352 |
| 846 | 3300053085 | Ga0495619_0001957 | Ga0495619_0001957_869_1948 | 352 |
| 847 | 3300053085 | Ga0495619_0002856 | Ga0495619_0002856_5307_6365 | 352 |
| 848 | 3300053085 | Ga0495619_0106148 | Ga0495619_0106148_25_1095 | 352 |
| 849 | 3300053093 | Ga0500651_0185374 | Ga0500651_0185374_152_1219 | 352 |
| 850 | 3300053094 | Ga0500566_0107849 | Ga0500566_0107849_321_1388 | 352 |
| 851 | 3300053096 | Ga0500641_0098123 | Ga0500641_0098123_117_1184 | 352 |
| 852 | 3300053119 | Ga0500595_003699 | Ga0500595_003699_4627_5694 | 352 |
| 853 | 3300053134 | Ga0500658_0024140 | Ga0500658_0024140_480_1547 | 352 |
| 854 | 3300053136 | Ga0500559_0047011 | Ga0500559_0047011_511_1575 | 352 |
| 855 | 3300053158 | Ga0500627_0125752 | Ga0500627_0125752_41_1108 | 352 |
| 856 | 3300053161 | Ga0500634_0069625 | Ga0500634_0069625_120_1187 | 352 |
| 857 | 3300053735 | Ga0500596_004825 | Ga0500596_004825_479_1543 | 352 |
| 858 | 3300001977 | JGI24746J21847_1004478 | JGI24746J21847_10044782 | 353 |
| 859 | 3300001989 | JGI24739J22299_10004105 | JGI24739J22299_100041052 | 353 |
| 860 | 3300001990 | JGI24737J22298_10002708 | JGI24737J22298_100027085 | 353 |
| 861 | 3300002070 | JGI24750J21931_1000175 | JGI24750J21931_10001753 | 353 |
| 862 | 3300002074 | JGI24748J21848_1000514 | JGI24748J21848_10005144 | 353 |
| 863 | 3300002075 | JGI24738J21930_10001046 | JGI24738J21930_100010462 | 353 |
| 864 | 3300002076 | JGI24749J21850_1001064 | JGI24749J21850_10010642 | 353 |
| 865 | 3300002077 | JGI24744J21845_10000566 | JGI24744J21845_100005667 | 353 |
| 866 | 3300002244 | JGI24742J22300_10000420 | JGI24742J22300_100004202 | 353 |
| 867 | 3300002459 | JGI24751J29686_10016485 | JGI24751J29686_100164852 | 353 |
| 868 | 3300003911 | JGI25405J52794_10009101 | JGI25405J52794_100091012 | 353 |
| 869 | 3300005327 | Ga0070658_10101559 | Ga0070658_101015592 | 353 |
| 870 | 3300005329 | Ga0070683_100000836 | Ga0070683_10000083610 | 353 |
| 871 | 3300005329 | Ga0070683_100075014 | Ga0070683_1000750144 | 353 |
| 872 | 3300005330 | Ga0070690_100000700 | Ga0070690_10000070015 | 353 |
| 873 | 3300005335 | Ga0070666_10031827 | Ga0070666_100318273 | 353 |
| 874 | 3300005336 | Ga0070680_100005042 | Ga0070680_1000050425 | 353 |
| 875 | 3300005337 | Ga0070682_100020427 | Ga0070682_1000204272 | 353 |
| 876 | 3300005337 | Ga0070682_100090951 | Ga0070682_1000909512 | 353 |
| 877 | 3300005338 | Ga0068868_100005815 | Ga0068868_1000058152 | 353 |
| 878 | 3300005339 | Ga0070660_100023548 | Ga0070660_1000235482 | 353 |
| 879 | 3300005340 | Ga0070689_100045887 | Ga0070689_1000458872 | 353 |
| 880 | 3300005341 | Ga0070691_10004006 | Ga0070691_100040064 | 353 |
| 881 | 3300005344 | Ga0070661_100001217 | Ga0070661_10000121714 | 353 |
| 882 | 3300005345 | Ga0070692_10003662 | Ga0070692_100036622 | 353 |
| 883 | 3300005347 | Ga0070668_100019465 | Ga0070668_1000194652 | 353 |
| 884 | 3300005353 | Ga0070669_100009354 | Ga0070669_1000093543 | 353 |
| 885 | 3300005354 | Ga0070675_100021874 | Ga0070675_1000218742 | 353 |
| 886 | 3300005355 | Ga0070671_100005891 | Ga0070671_1000058914 | 353 |
| 887 | 3300005355 | Ga0070671_100020315 | Ga0070671_1000203156 | 353 |
| 888 | 3300005355 | Ga0070671_100031898 | Ga0070671_1000318981 | 353 |
| 889 | 3300005355 | Ga0070671_100288270 | Ga0070671_1002882701 | 353 |
| 890 | 3300005356 | Ga0070674_100003371 | Ga0070674_1000033712 | 353 |
| 891 | 3300005364 | Ga0070673_100001086 | Ga0070673_1000010863 | 353 |
| 892 | 3300005365 | Ga0070688_100034076 | Ga0070688_1000340762 | 353 |
| 893 | 3300005366 | Ga0070659_100006583 | Ga0070659_1000065832 | 353 |
| 894 | 3300005367 | Ga0070667_100002687 | Ga0070667_10000268714 | 353 |
| 895 | 3300005434 | Ga0070709_10001257 | Ga0070709_100012575 | 353 |
| 896 | 3300005436 | Ga0070713_100000374 | Ga0070713_10000037422 | 353 |
| 897 | 3300005436 | Ga0070713_100028156 | Ga0070713_1000281562 | 353 |
| 898 | 3300005438 | Ga0070701_10141958 | Ga0070701_101419581 | 353 |
| 899 | 3300005439 | Ga0070711_100023758 | Ga0070711_1000237584 | 353 |
| 900 | 3300005439 | Ga0070711_100033722 | Ga0070711_1000337222 | 353 |
| 901 | 3300005440 | Ga0070705_100001711 | Ga0070705_1000017119 | 353 |
| 902 | 3300005441 | Ga0070700_100016369 | Ga0070700_1000163693 | 353 |
| 903 | 3300005444 | Ga0070694_100007442 | Ga0070694_1000074424 | 353 |
| 904 | 3300005445 | Ga0070708_100104737 | Ga0070708_1001047372 | 353 |
| 905 | 3300005445 | Ga0070708_100209862 | Ga0070708_1002098622 | 353 |
| 906 | 3300005455 | Ga0070663_100021845 | Ga0070663_1000218451 | 353 |
| 907 | 3300005455 | Ga0070663_100064000 | Ga0070663_1000640002 | 353 |
| 908 | 3300005456 | Ga0070678_100001680 | Ga0070678_10000168014 | 353 |
| 909 | 3300005458 | Ga0070681_10061500 | Ga0070681_100615002 | 353 |
| 910 | 3300005459 | Ga0068867_100000874 | Ga0068867_1000008742 | 353 |
| 911 | 3300005466 | Ga0070685_10003079 | Ga0070685_100030795 | 353 |
| 912 | 3300005530 | Ga0070679_100151164 | Ga0070679_1001511642 | 353 |
| 913 | 3300005539 | Ga0068853_100003110 | Ga0068853_10000311011 | 353 |
| 914 | 3300005543 | Ga0070672_100005531 | Ga0070672_1000055312 | 353 |
| 915 | 3300005543 | Ga0070672_100131220 | Ga0070672_1001312202 | 353 |
| 916 | 3300005544 | Ga0070686_100004079 | Ga0070686_1000040792 | 353 |
| 917 | 3300005545 | Ga0070695_100012339 | Ga0070695_1000123392 | 353 |
| 918 | 3300005546 | Ga0070696_100008243 | Ga0070696_1000082432 | 353 |
| 919 | 3300005546 | Ga0070696_100039848 | Ga0070696_1000398482 | 353 |
| 920 | 3300005547 | Ga0070693_100072635 | Ga0070693_1000726352 | 353 |
| 921 | 3300005563 | Ga0068855_100072645 | Ga0068855_1000726453 | 353 |
| 922 | 3300005564 | Ga0070664_100027792 | Ga0070664_1000277922 | 353 |
| 923 | 3300005577 | Ga0068857_100025732 | Ga0068857_1000257322 | 353 |
| 924 | 3300005578 | Ga0068854_100002509 | Ga0068854_1000025098 | 353 |
| 925 | 3300005614 | Ga0068856_100085445 | Ga0068856_1000854452 | 353 |
| 926 | 3300005614 | Ga0068856_100119327 | Ga0068856_1001193272 | 353 |
| 927 | 3300005616 | Ga0068852_100006607 | Ga0068852_1000066072 | 353 |
| 928 | 3300005617 | Ga0068859_100069054 | Ga0068859_1000690542 | 353 |
| 929 | 3300005618 | Ga0068864_100001321 | Ga0068864_10000132116 | 353 |
| 930 | 3300005718 | Ga0068866_10002168 | Ga0068866_100021683 | 353 |
| 931 | 3300005840 | Ga0068870_10000716 | Ga0068870_100007164 | 353 |
| 932 | 3300005841 | Ga0068863_100000965 | Ga0068863_10000096510 | 353 |
| 933 | 3300005842 | Ga0068858_100003017 | Ga0068858_10000301714 | 353 |
| 934 | 3300005842 | Ga0068858_100064343 | Ga0068858_1000643433 | 353 |
| 935 | 3300005843 | Ga0068860_100014200 | Ga0068860_1000142002 | 353 |
| 936 | 3300005843 | Ga0068860_100041961 | Ga0068860_1000419616 | 353 |
| 937 | 3300005844 | Ga0068862_100003246 | Ga0068862_10000324612 | 353 |
| 938 | 3300005937 | Ga0081455_10000327 | Ga0081455_1000032768 | 353 |
| 939 | 3300006028 | Ga0070717_10007141 | Ga0070717_100071419 | 353 |
| 940 | 3300006175 | Ga0070712_100106270 | Ga0070712_1001062702 | 353 |
| 941 | 3300006178 | Ga0075367_10039381 | Ga0075367_100393812 | 353 |
| 942 | 3300006358 | Ga0068871_100001025 | Ga0068871_10000102515 | 353 |
| 943 | 3300006358 | Ga0068871_100005428 | Ga0068871_1000054282 | 353 |
| 944 | 3300006852 | Ga0075433_10016718 | Ga0075433_100167184 | 353 |
| 945 | 3300006881 | Ga0068865_100005281 | Ga0068865_1000052816 | 353 |
| 946 | 3300006881 | Ga0068865_100013742 | Ga0068865_1000137427 | 353 |
| 947 | 3300006931 | Ga0097620_100069047 | Ga0097620_1000690472 | 353 |
| 948 | 3300009098 | Ga0105245_10114924 | Ga0105245_101149241 | 353 |
| 949 | 3300009101 | Ga0105247_10025590 | Ga0105247_100255901 | 353 |
| 950 | 3300009148 | Ga0105243_10031539 | Ga0105243_100315392 | 353 |
| 951 | 3300009148 | Ga0105243_10283021 | Ga0105243_102830212 | 353 |
| 952 | 3300009174 | Ga0105241_10128056 | Ga0105241_101280563 | 353 |
| 953 | 3300009176 | Ga0105242_10035266 | Ga0105242_100352662 | 353 |
| 954 | 3300009176 | Ga0105242_10078490 | Ga0105242_100784903 | 353 |
| 955 | 3300009177 | Ga0105248_10013825 | Ga0105248_100138252 | 353 |
| 956 | 3300009177 | Ga0105248_10145105 | Ga0105248_101451052 | 353 |
| 957 | 3300009545 | Ga0105237_10202763 | Ga0105237_102027632 | 353 |
| 958 | 3300010375 | Ga0105239_10311499 | Ga0105239_103114991 | 353 |
| 959 | 3300010375 | Ga0105239_10348954 | Ga0105239_103489542 | 353 |
| 960 | 3300013296 | Ga0157374_10032360 | Ga0157374_100323604 | 353 |
| 961 | 3300013296 | Ga0157374_10062182 | Ga0157374_100621822 | 353 |
| 962 | 3300013306 | Ga0163162_10068510 | Ga0163162_100685102 | 353 |
| 963 | 3300013308 | Ga0157375_10346805 | Ga0157375_103468051 | 353 |
| 964 | 3300014325 | Ga0163163_10100808 | Ga0163163_101008082 | 353 |
| 965 | 3300014325 | Ga0163163_10276705 | Ga0163163_102767051 | 353 |
| 966 | 3300014326 | Ga0157380_10121457 | Ga0157380_101214572 | 353 |
| 967 | 3300014968 | Ga0157379_10106097 | Ga0157379_101060971 | 353 |
| 968 | 3300014968 | Ga0157379_10287188 | Ga0157379_102871882 | 353 |
| 969 | 3300014969 | Ga0157376_10424407 | Ga0157376_104244071 | 353 |
| 970 | 3300025271 | Ga0207666_1000103 | Ga0207666_100010313 | 353 |
| 971 | 3300025315 | Ga0207697_10001374 | Ga0207697_1000137413 | 353 |
| 972 | 3300025885 | Ga0207653_10008349 | Ga0207653_100083492 | 353 |
| 973 | 3300025893 | Ga0207682_10000043 | Ga0207682_1000004332 | 353 |
| 974 | 3300025898 | Ga0207692_10006313 | Ga0207692_100063132 | 353 |
| 975 | 3300025899 | Ga0207642_10007175 | Ga0207642_100071752 | 353 |
| 976 | 3300025900 | Ga0207710_10049955 | Ga0207710_100499552 | 353 |
| 977 | 3300025903 | Ga0207680_10006796 | Ga0207680_100067964 | 353 |
| 978 | 3300025904 | Ga0207647_10003002 | Ga0207647_1000300213 | 353 |
| 979 | 3300025905 | Ga0207685_10000914 | Ga0207685_100009146 | 353 |
| 980 | 3300025907 | Ga0207645_10000899 | Ga0207645_1000089913 | 353 |
| 981 | 3300025907 | Ga0207645_10014247 | Ga0207645_100142472 | 353 |
| 982 | 3300025911 | Ga0207654_10005950 | Ga0207654_100059503 | 353 |
| 983 | 3300025912 | Ga0207707_10004166 | Ga0207707_100041669 | 353 |
| 984 | 3300025914 | Ga0207671_10192162 | Ga0207671_101921622 | 353 |
| 985 | 3300025915 | Ga0207693_10156925 | Ga0207693_101569251 | 353 |
| 986 | 3300025916 | Ga0207663_10009887 | Ga0207663_100098876 | 353 |
| 987 | 3300025917 | Ga0207660_10023127 | Ga0207660_100231273 | 353 |
| 988 | 3300025918 | Ga0207662_10000975 | Ga0207662_1000097513 | 353 |
| 989 | 3300025920 | Ga0207649_10002321 | Ga0207649_100023218 | 353 |
| 990 | 3300025921 | Ga0207652_10005425 | Ga0207652_100054258 | 353 |
| 991 | 3300025926 | Ga0207659_10007188 | Ga0207659_100071884 | 353 |
| 992 | 3300025927 | Ga0207687_10000522 | Ga0207687_100005222 | 353 |
| 993 | 3300025928 | Ga0207700_10004890 | Ga0207700_100048909 | 353 |
| 994 | 3300025928 | Ga0207700_10024078 | Ga0207700_100240784 | 353 |
| 995 | 3300025931 | Ga0207644_10000611 | Ga0207644_100006114 | 353 |
| 996 | 3300025931 | Ga0207644_10006011 | Ga0207644_100060117 | 353 |
| 997 | 3300025932 | Ga0207690_10003223 | Ga0207690_100032238 | 353 |
| 998 | 3300025934 | Ga0207686_10014769 | Ga0207686_100147692 | 353 |
| 999 | 3300025935 | Ga0207709_10009743 | Ga0207709_100097432 | 353 |
| 1000 | 3300025936 | Ga0207670_10000631 | Ga0207670_1000063113 | 353 |
| 1001 | 3300025937 | Ga0207669_10000797 | Ga0207669_100007975 | 353 |
| 1002 | 3300025938 | Ga0207704_10047461 | Ga0207704_100474612 | 353 |
| 1003 | 3300025939 | Ga0207665_10009568 | Ga0207665_100095689 | 353 |
| 1004 | 3300025941 | Ga0207711_10008296 | Ga0207711_100082962 | 353 |
| 1005 | 3300025941 | Ga0207711_10052202 | Ga0207711_100522022 | 353 |
| 1006 | 3300025942 | Ga0207689_10000165 | Ga0207689_1000016520 | 353 |
| 1007 | 3300025944 | Ga0207661_10004909 | Ga0207661_100049093 | 353 |
| 1008 | 3300025944 | Ga0207661_10047173 | Ga0207661_100471734 | 353 |
| 1009 | 3300025961 | Ga0207712_10001957 | Ga0207712_100019572 | 353 |
| 1010 | 3300025972 | Ga0207668_10003391 | Ga0207668_100033913 | 353 |
| 1011 | 3300025981 | Ga0207640_10000382 | Ga0207640_1000038222 | 353 |
| 1012 | 3300025986 | Ga0207658_10035295 | Ga0207658_100352956 | 353 |
| 1013 | 3300026023 | Ga0207677_10005315 | Ga0207677_100053156 | 353 |
| 1014 | 3300026035 | Ga0207703_10004258 | Ga0207703_1000425810 | 353 |
| 1015 | 3300026041 | Ga0207639_10032542 | Ga0207639_100325422 | 353 |
| 1016 | 3300026067 | Ga0207678_10003272 | Ga0207678_100032723 | 353 |
| 1017 | 3300026067 | Ga0207678_10031527 | Ga0207678_100315272 | 353 |
| 1018 | 3300026075 | Ga0207708_10012755 | Ga0207708_100127555 | 353 |
| 1019 | 3300026078 | Ga0207702_10093858 | Ga0207702_100938582 | 353 |
| 1020 | 3300026088 | Ga0207641_10001777 | Ga0207641_1000177711 | 353 |
| 1021 | 3300026089 | Ga0207648_10047840 | Ga0207648_100478402 | 353 |
| 1022 | 3300026095 | Ga0207676_10000494 | Ga0207676_1000049416 | 353 |
| 1023 | 3300026118 | Ga0207675_100003533 | Ga0207675_10000353313 | 353 |
| 1024 | 3300026121 | Ga0207683_10001272 | Ga0207683_1000127213 | 353 |
| 1025 | 3300026121 | Ga0207683_10007911 | Ga0207683_100079115 | 353 |
| 1026 | 3300026121 | Ga0207683_10027632 | Ga0207683_100276325 | 353 |
| 1027 | 3300027617 | Ga0210002_1001992 | Ga0210002_10019922 | 353 |
| 1028 | 3300027717 | Ga0209998_10001588 | Ga0209998_100015882 | 353 |
| 1029 | 3300027907 | Ga0207428_10000064 | Ga0207428_1000006457 | 353 |
| 1030 | 3300028379 | Ga0268266_10025484 | Ga0268266_100254842 | 353 |
| 1031 | 3300028380 | Ga0268265_10011223 | Ga0268265_100112231 | 353 |
| 1032 | 3300028381 | Ga0268264_10005082 | Ga0268264_1000508210 | 353 |
| 1033 | 3300031241 | Ga0265325_10000006 | Ga0265325_10000006167 | 353 |
| 1034 | 3300031595 | Ga0265313_10023271 | Ga0265313_100232713 | 353 |
| 1035 | 3300035085 | Ga0373929_0017606 | Ga0373929_0017606_279_1382 | 353 |
| 1036 | 3300035092 | Ga0373952_0004422 | Ga0373952_0004422_603_1706 | 353 |
| 1037 | 3300035111 | Ga0373923_0051674 | Ga0373923_0051674_284_1387 | 353 |
| 1038 | 3300035117 | Ga0373953_0004155 | Ga0373953_0004155_1399_2502 | 353 |
| 1039 | 3300035118 | Ga0373954_0046149 | Ga0373954_0046149_855_1958 | 353 |
| 1040 | 3300035119 | Ga0373956_0002051 | Ga0373956_0002051_6933_8036 | 353 |
| 1041 | 3300035170 | Ga0373943_0005372 | Ga0373943_0005372_796_1899 | 353 |
| 1042 | 3300035171 | Ga0373946_0027757 | Ga0373946_0027757_31_1134 | 353 |
| 1043 | 3300035172 | Ga0373955_0009372 | Ga0373955_0009372_3345_4448 | 353 |
| 1044 | 3300035691 | Ga0373931_0034618 | Ga0373931_0034618_600_1703 | 353 |
| 1045 | 3300035692 | Ga0373935_0006022 | Ga0373935_0006022_2957_4060 | 353 |
| 1046 | 3300035695 | Ga0373927_0042636 | Ga0373927_0042636_1195_2298 | 353 |
| 1047 | 3300035695 | Ga0373927_0153904 | Ga0373927_0153904_300_1385 | 353 |
| 1048 | 3300035724 | Ga0373933_0045156 | Ga0373933_0045156_1163_2266 | 353 |
| 1049 | 3300035725 | Ga0373947_0000340 | Ga0373947_0000340_4416_5519 | 353 |
| 1050 | 3300035725 | Ga0373947_0064359 | Ga0373947_0064359_901_2004 | 353 |
| 1051 | 3300035725 | Ga0373947_0170331 | Ga0373947_0170331_244_1329 | 353 |
| 1052 | 3300036401 | Ga0373937_0001302 | Ga0373937_0001302_967_2070 | 353 |
| 1053 | 3300037068 | Ga0373925_0007663 | Ga0373925_0007663_2755_3858 | 353 |
| 1054 | 3300046455 | Ga0495603_0099568 | Ga0495603_0099568_572_1657 | 353 |
| 1055 | 3300046459 | Ga0495629_0008986 | Ga0495629_0008986_6194_7297 | 353 |
| 1056 | 3300046459 | Ga0495629_0046527 | Ga0495629_0046527_539_1642 | 353 |
| 1057 | 3300046463 | Ga0495653_0016031 | Ga0495653_0016031_1618_2721 | 353 |
| 1058 | 3300046475 | Ga0495639_0009690 | Ga0495639_0009690_135_1220 | 353 |
| 1059 | 3300046477 | Ga0495664_0037955 | Ga0495664_0037955_337_1440 | 353 |
| 1060 | 3300046499 | Ga0495594_0054755 | Ga0495594_0054755_814_1917 | 353 |
| 1061 | 3300046511 | Ga0495608_0016511 | Ga0495608_0016511_157_1260 | 353 |
| 1062 | 3300046514 | Ga0495618_0015173 | Ga0495618_0015173_174_1277 | 353 |
| 1063 | 3300046516 | Ga0495628_0015999 | Ga0495628_0015999_1163_2266 | 353 |
| 1064 | 3300046517 | Ga0495630_0040548 | Ga0495630_0040548_2071_3174 | 353 |
| 1065 | 3300046533 | Ga0495640_0015450 | Ga0495640_0015450_673_1776 | 353 |
| 1066 | 3300046536 | Ga0495587_0009736 | Ga0495587_0009736_1284_2387 | 353 |
| 1067 | 3300046559 | Ga0495667_0005768 | Ga0495667_0005768_1644_2747 | 353 |
| 1068 | 3300046663 | Ga0495635_0013995 | Ga0495635_0013995_1181_2284 | 353 |
| 1069 | 3300046675 | Ga0495657_0013260 | Ga0495657_0013260_3682_4785 | 353 |
| 1070 | 3300046679 | Ga0495623_0049055 | Ga0495623_0049055_123_1226 | 353 |
| 1071 | 3300046681 | Ga0495647_0008584 | Ga0495647_0008584_1859_2962 | 353 |
| 1072 | 3300046683 | Ga0495658_0000781 | Ga0495658_0000781_2531_3634 | 353 |
| 1073 | 3300046683 | Ga0495658_0011048 | Ga0495658_0011048_3418_4503 | 353 |
| 1074 | 3300046689 | Ga0495613_0006286 | Ga0495613_0006286_3887_4990 | 353 |
| 1075 | 3300046689 | Ga0495613_0029327 | Ga0495613_0029327_1662_2765 | 353 |
| 1076 | 3300046690 | Ga0495624_0081726 | Ga0495624_0081726_443_1546 | 353 |
| 1077 | 3300046691 | Ga0495670_0012130 | Ga0495670_0012130_185_1288 | 353 |
| 1078 | 3300046809 | Ga0495600_0007607 | Ga0495600_0007607_3993_5096 | 353 |
| 1079 | 3300047315 | Ga0495581_0030017 | Ga0495581_0030017_551_1654 | 353 |
| 1080 | 3300047317 | Ga0495604_0002235 | Ga0495604_0002235_482_1585 | 353 |
| 1081 | 3300047319 | Ga0495674_0006763 | Ga0495674_0006763_7900_9003 | 353 |
| 1082 | 3300047321 | Ga0495676_0062585 | Ga0495676_0062585_402_1487 | 353 |
| 1083 | 3300047321 | Ga0495676_0121550 | Ga0495676_0121550_293_1396 | 353 |
| 1084 | 3300047322 | Ga0495680_0029393 | Ga0495680_0029393_1697_2800 | 353 |
| 1085 | 3300047444 | Ga0495675_0002904 | Ga0495675_0002904_1216_2319 | 353 |
| 1086 | 3300047471 | Ga0495684_0016411 | Ga0495684_0016411_3795_4898 | 353 |
| 1087 | 3300047673 | Ga0495593_0023433 | Ga0495593_0023433_1248_2351 | 353 |
| 1088 | 3300048903 | Ga0496100_0012538 | Ga0496100_0012538_2802_3905 | 353 |
| 1089 | 3300048903 | Ga0496100_0040306 | Ga0496100_0040306_1407_2510 | 353 |
| 1090 | 3300048903 | Ga0496100_0128194 | Ga0496100_0128194_152_1291 | 353 |
| 1091 | 3300048904 | Ga0496101_0001165 | Ga0496101_0001165_297_1400 | 353 |
| 1092 | 3300048905 | Ga0496102_0005341 | Ga0496102_0005341_8709_9794 | 353 |
| 1093 | 3300048906 | Ga0496103_0011444 | Ga0496103_0011444_2579_3682 | 353 |
| 1094 | 3300048906 | Ga0496103_0014101 | Ga0496103_0014101_149_1252 | 353 |
| 1095 | 3300048907 | Ga0496104_0285969 | Ga0496104_0285969_298_1401 | 353 |
| 1096 | 3300048908 | Ga0496105_0029441 | Ga0496105_0029441_218_1324 | 353 |
| 1097 | 3300048908 | Ga0496105_0030009 | Ga0496105_0030009_3106_4209 | 353 |
| 1098 | 3300048909 | Ga0496106_0011781 | Ga0496106_0011781_1016_2119 | 353 |
| 1099 | 3300048910 | Ga0496107_0013863 | Ga0496107_0013863_2913_4052 | 353 |
| 1100 | 3300048910 | Ga0496107_0074682 | Ga0496107_0074682_1146_2249 | 353 |
| 1101 | 3300048911 | Ga0496108_0019665 | Ga0496108_0019665_3508_4611 | 353 |
| 1102 | 3300048911 | Ga0496108_0037794 | Ga0496108_0037794_399_1502 | 353 |
| 1103 | 3300048912 | Ga0496109_0007962 | Ga0496109_0007962_2798_3859 | 353 |
| 1104 | 3300048912 | Ga0496109_0023341 | Ga0496109_0023341_1269_2372 | 353 |
| 1105 | 3300048913 | Ga0496110_0075409 | Ga0496110_0075409_1733_2836 | 353 |
| 1106 | 3300048914 | Ga0496111_0039701 | Ga0496111_0039701_98_1201 | 353 |
| 1107 | 3300048915 | Ga0496112_0011859 | Ga0496112_0011859_2231_3334 | 353 |
| 1108 | 3300048916 | Ga0496113_0017464 | Ga0496113_0017464_1733_2836 | 353 |
| 1109 | 3300048916 | Ga0496113_0062084 | Ga0496113_0062084_361_1422 | 353 |
| 1110 | 3300048917 | Ga0496114_0023363 | Ga0496114_0023363_3128_4231 | 353 |
| 1111 | 3300048918 | Ga0496115_0078464 | Ga0496115_0078464_453_1556 | 353 |
| 1112 | 3300048918 | Ga0496115_0123713 | Ga0496115_0123713_11_1114 | 353 |
| 1113 | 3300048924 | Ga0496121_0038643 | Ga0496121_0038643_1454_2590 | 353 |
| 1114 | 3300050511 | nmdc:mga08y16_131595_c1 | nmdc:mga08y16_131595_c1_199_1302 | 353 |
| 1115 | 3300050511 | nmdc:mga08y16_145004_c1 | nmdc:mga08y16_145004_c1_108_1235 | 353 |
| 1116 | 3300053077 | Ga0495601_0060131 | Ga0495601_0060131_1277_2380 | 353 |
| 1117 | 3300053078 | Ga0495612_0001564 | Ga0495612_0001564_4277_5380 | 353 |
| 1118 | 3300053084 | Ga0495595_0003553 | Ga0495595_0003553_1345_2448 | 353 |
| 1119 | 3300053085 | Ga0495619_0001679 | Ga0495619_0001679_2842_3945 | 353 |
| 1120 | 3300053085 | Ga0495619_0020676 | Ga0495619_0020676_1816_2919 | 353 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r74-assembly4.cif.gz_D | structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) | 0.9097 | 48 | 353 |
| 7f6o-assembly2.cif.gz_B | crystal structure of metal-citrate-binding mutant (s26a) protein (mcta) of abc transporter endogenously bound to mn2+-citrate complex | 0.8948 | 37 | 352 |
| 7f6p-assembly3.cif.gz_C | crystal structure of metal-citrate-binding mutant (d28a) protein (mcta) of abc transporter endogenously bound to citrate | 0.8946 | 37 | 352 |
| 6wce-assembly1.cif.gz_A | structure of the periplasmic binding protein p5pa | 0.8923 | 48 | 351 |
| 7f6e-assembly1.cif.gz_A | crystal structure of metal-citrate-binding protein (mcta) of abc transporter endogenously bound to mg2+-citrate complex (form i) | 0.8885 | 30 | 352 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4r74A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8827 | 48 | 318 | 3.40.190.10 |
| 1y4tD01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8827 | 50 | 315 | 3.40.190.10 |
| af_Q2G1D9_30_309_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.869 | 50 | 330 | 3.40.190.10 |
| 1y4tD01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8661 | 50 | 315 | 3.40.190.10 |
| 4elqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8651 | 49 | 321 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537SX32-F1-model_v4 | Extracellular solute-binding protein | 0.9936 | 57 | 353 |
GO:0042597
GO:0046872 |
| AF-A0A537SX32-F1-model_v4 | Extracellular solute-binding protein | 0.987 | 57 | 353 |
GO:0042597
GO:0046872 |
| AF-A0A7S7TCI2-F1-model_v4 | Iron ABC transporter substrate-binding protein | 0.9867 | 19 | 353 |
GO:0046872
|
| AF-A0A1F9A1T1-F1-model_v4 | Iron ABC transporter substrate-binding protein | 0.9802 | 71 | 353 |
|
| AF-A0A1F7TGV6-F1-model_v4 | Iron ABC transporter substrate-binding protein | 0.9739 | 39 | 353 |
GO:0046872
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar