F490393

General Info

Members Datasets Scaffolds Average Seq Length
1120 444 1085 352

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0004431|Ga0495585_0004431_3923_5149
Length 408
Sequence MAGAGRLLSRRKLLKAVAALPLAYAAPLCAEPPPAQAITPALIAAATKEGQLTWYTSADSQLAEKVGKAFEQKFRGVRVRVERAGGERIFARVAQEYASGLHVADAVSTGDAAQFLAWKRQELLAPYVPEDVARYIPPEHRDPDGFYASVRSSLCVIAYNTAMVKREDAPKSFANLLDLKWKGKIVKAHPSYSGTIMTSTYQMVRELSWSYLEQLARQQVLQVQSATDTPKKVVLGERPVMADGNESNVLLLKEAGGPIEVVYAAEGTPSIVQPSAIFVAAPHPNAARLFQNYLFGVEGQELFVNLGGLRSLHALVKDKPGRTPLSAIKVWKDDPAAVETQGEDIKRRYSLWCLITRSRGSTPRLHMKQLKQVLLSVSWVHDCRYKPSAGQPLPRFDLSRSQLVSGLR

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
4 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
5 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
6 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
7 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
8 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
9 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
10 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
11 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
12 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
13 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
14 2904699407
15 2906610324
16 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
17 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
18 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
19 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
20 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
21 2922425934
22 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
23 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
24 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
25 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
26 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
27 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
30 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
31 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
32 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
33 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
34 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
35 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
36 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
37 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
38 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
74 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
75 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
78 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
85 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
112 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
113 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
114 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
115 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
116 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
119 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
120 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
121 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
122 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
123 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
124 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
125 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
127 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
128 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
129 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
130 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
131 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
132 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
133 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
134 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
135 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
136 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
138 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
139 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
140 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
141 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
143 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
144 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
147 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
148 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
149 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
150 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
165 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
166 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
167 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
168 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
239 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
245 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
246 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
247 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
248 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
249 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
250 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
251 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
252 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
253 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
254 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
255 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
256 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
257 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
258 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
259 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
260 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
261 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
262 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
263 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
264 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
265 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
266 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
267 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
268 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
269 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
270 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
273 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
274 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
276 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
277 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
278 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
279 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
280 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
281 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
282 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
283 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
284 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
285 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
286 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
287 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
288 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
290 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
291 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
292 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
293 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
295 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
296 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
297 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
298 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
299 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
300 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
301 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
302 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
305 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
306 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
307 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
308 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
309 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
310 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
311 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
312 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
313 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
314 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
315 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
316 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
317 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
318 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
319 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
320 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
321 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
322 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
323 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
324 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
325 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
326 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
327 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
328 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
329 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
330 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
331 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
332 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
333 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
334 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
335 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
336 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
337 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
338 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
339 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
340 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
341 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
342 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
343 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
344 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
345 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
346 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
347 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
348 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
349 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
350 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
351 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
352 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
353 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
354 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
355 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
356 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
357 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
358 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
359 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
360 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
361 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
362 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
363 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
364 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
365 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
366 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
367 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
368 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
371 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
372 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
373 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
374 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
375 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
376 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
377 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
378 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
379 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
380 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
381 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
382 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
383 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
384 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
385 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
386 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
387 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
388 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
389 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
396 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
397 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
398 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
399 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
400 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
401 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
402 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
405 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
406 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
407 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
408 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
409 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
410 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
411 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
412 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
413 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
414 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
415 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
416 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
417 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
418 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
419 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
420 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
421 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
422 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
423 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
424 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
425 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
426 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
427 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
428 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
429 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
430 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
431 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
432 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
433 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
434 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
435 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
436 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
437 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
438 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
439 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
440 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
441 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
442 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
443 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
444 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0
Isolates 2.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 1.96
Rhizoplane 8.75
Rhizosphere 81.61
Stem 0
Stem Tuber 0
Unclassified 3.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1004478 3300001977 Bacteria 2202
2 JGI24739J22299_10004105 3300001989 Bacteria 5568
3 JGI24737J22298_10002708 3300001990 Bacteria 6265
4 JGI24750J21931_1000175 3300002070 Bacteria 10684
5 JGI24748J21848_1000514 3300002074 Bacteria 4251
6 JGI24738J21930_10001046 3300002075 Bacteria 7887
7 JGI24749J21850_1001064 3300002076 Bacteria 3908
8 JGI24744J21845_10000566 3300002077 Bacteria 6684
9 JGI24034J26672_10000462 3300002239 Bacteria 5246
10 JGI24742J22300_10000420 3300002244 Bacteria 6269
11 JGI24751J29686_10016485 3300002459 Bacteria 1523
12 JGI25406J46586_10000028 3300003203 Bacteria 70247
13 JGI25404J52841_10015339 3300003659 Bacteria 1662
14 JGI25405J52794_10009101 3300003911 Bacteria 1869
15 Ga0065712_10029709 3300005290 Bacteria 1233
16 Ga0065712_10113471 3300005290 Bacteria 1782
17 Ga0065712_10135995 3300005290 Bacteria 1489
18 Ga0065715_10037919 3300005293 Bacteria 1156
19 Ga0065715_10137549 3300005293 Bacteria 1903
20 Ga0070658_10101559 3300005327 Bacteria 2378
21 Ga0070676_10006058 3300005328 Bacteria 6455
22 Ga0070676_10024678 3300005328 Bacteria 3390
23 Ga0070676_10088731 3300005328 Bacteria 1890
24 Ga0070676_10131041 3300005328 Bacteria 1585
25 Ga0070683_100000836 3300005329 Bacteria 22825
26 Ga0070683_100011738 3300005329 Bacteria 7585
27 Ga0070683_100067592 3300005329 Bacteria 3329
28 Ga0070683_100075014 3300005329 Bacteria 3159
29 Ga0070690_100000700 3300005330 Bacteria 17192
30 Ga0070690_100063572 3300005330 Bacteria 2382
31 Ga0070690_100171286 3300005330 Bacteria 1494
32 Ga0070670_100006794 3300005331 Bacteria 9685
33 Ga0070670_100031028 3300005331 Bacteria 4602
34 Ga0070670_100046472 3300005331 Bacteria 3733
35 Ga0070670_100086754 3300005331 Bacteria 2689
36 Ga0070677_10000406 3300005333 Bacteria 14999
37 Ga0070677_10002338 3300005333 Bacteria 6059
38 Ga0070677_10028755 3300005333 Bacteria 2102
39 Ga0070677_10036854 3300005333 Bacteria 1905
40 Ga0070677_10037432 3300005333 Bacteria 1892
41 Ga0068869_100000653 3300005334 Bacteria 19619
42 Ga0068869_100106003 3300005334 Bacteria 2132
43 Ga0070666_10005529 3300005335 Bacteria 7752
44 Ga0070666_10031827 3300005335 Bacteria 3483
45 Ga0070680_100005042 3300005336 Bacteria 9963
46 Ga0070680_100043949 3300005336 Bacteria 3630
47 Ga0070680_100069523 3300005336 Bacteria 2891
48 Ga0070680_100073871 3300005336 Bacteria 2805
49 Ga0070682_100005253 3300005337 Bacteria 7206
50 Ga0070682_100020427 3300005337 Bacteria 3895
51 Ga0070682_100090951 3300005337 Bacteria 1997
52 Ga0068868_100005815 3300005338 Bacteria 8692
53 Ga0068868_100010958 3300005338 Bacteria 6584
54 Ga0068868_100097041 3300005338 Bacteria 2381
55 Ga0068868_100114377 3300005338 Bacteria 2195
56 Ga0070660_100023548 3300005339 Bacteria 4562
57 Ga0070660_100214228 3300005339 Bacteria 1564
58 Ga0070689_100010029 3300005340 Bacteria 6743
59 Ga0070689_100045887 3300005340 Bacteria 3366
60 Ga0070691_10004006 3300005341 Bacteria 6669
61 Ga0070687_100000387 3300005343 Bacteria 14981
62 Ga0070661_100001217 3300005344 Bacteria 18141
63 Ga0070692_10003662 3300005345 Bacteria 6283
64 Ga0070668_100019465 3300005347 Bacteria 5109
65 Ga0070668_100093673 3300005347 Bacteria 2371
66 Ga0070669_100009354 3300005353 Bacteria 6980
67 Ga0070675_100021874 3300005354 Bacteria 5109
68 Ga0070675_100125571 3300005354 Bacteria 2182
69 Ga0070671_100005891 3300005355 Bacteria 9767
70 Ga0070671_100020315 3300005355 Bacteria 5415
71 Ga0070671_100031898 3300005355 Bacteria 4355
72 Ga0070671_100172306 3300005355 Bacteria 1831
73 Ga0070671_100202708 3300005355 Bacteria 1683
74 Ga0070671_100288270 3300005355 Bacteria 1397
75 Ga0070674_100001918 3300005356 Bacteria 11324
76 Ga0070674_100003371 3300005356 Bacteria 8951
77 Ga0070674_100011258 3300005356 Bacteria 5439
78 Ga0070674_100074811 3300005356 Bacteria 2404
79 Ga0070674_100358750 3300005356 Bacteria 1179
80 Ga0070674_100374632 3300005356 Bacteria 1156
81 Ga0070673_100001086 3300005364 Bacteria 15555
82 Ga0070673_100122369 3300005364 Bacteria 2173
83 Ga0070673_100262418 3300005364 Bacteria 1509
84 Ga0070688_100034076 3300005365 Bacteria 3081
85 Ga0070688_100054495 3300005365 Bacteria 2505
86 Ga0070688_100097415 3300005365 Bacteria 1933
87 Ga0070688_100154625 3300005365 Bacteria 1570
88 Ga0070659_100006583 3300005366 Bacteria 8390
89 Ga0070667_100002687 3300005367 Bacteria 15394
90 Ga0070667_100122297 3300005367 Bacteria 2265
91 Ga0070667_100139796 3300005367 Bacteria 2119
92 Ga0070667_100327348 3300005367 Bacteria 1384
93 Ga0070709_10001257 3300005434 Bacteria 13866
94 Ga0070709_10006522 3300005434 Bacteria 6362
95 Ga0070709_10009430 3300005434 Bacteria 5386
96 Ga0070714_100141720 3300005435 Bacteria 2159
97 Ga0070714_100175934 3300005435 Bacteria 1945
98 Ga0070713_100000374 3300005436 Bacteria 28680
99 Ga0070713_100020428 3300005436 Bacteria 5078
100 Ga0070713_100028156 3300005436 Bacteria 4434
101 Ga0070710_10091766 3300005437 Bacteria 1793
102 Ga0070701_10002820 3300005438 Bacteria 6767
103 Ga0070701_10099733 3300005438 Bacteria 1607
104 Ga0070701_10141958 3300005438 Unclassified 1374
105 Ga0070711_100023758 3300005439 Bacteria 3991
106 Ga0070711_100033722 3300005439 Bacteria 3410
107 Ga0070711_100035137 3300005439 Bacteria 3348
108 Ga0070711_100221046 3300005439 Bacteria 1472
109 Ga0070705_100001711 3300005440 Bacteria 11431
110 Ga0070705_100158085 3300005440 Bacteria 1512
111 Ga0070700_100016369 3300005441 Bacteria 4223
112 Ga0070694_100007442 3300005444 Bacteria 6676
113 Ga0070708_100104737 3300005445 Bacteria 2594
114 Ga0070708_100209862 3300005445 Bacteria 1825
115 Ga0070663_100021845 3300005455 Bacteria 4264
116 Ga0070663_100025326 3300005455 Bacteria 4004
117 Ga0070663_100064000 3300005455 Bacteria 2657
118 Ga0070663_100093309 3300005455 Bacteria 2233
119 Ga0070678_100001680 3300005456 Bacteria 11863
120 Ga0070678_100028582 3300005456 Bacteria 3805
121 Ga0070678_100031777 3300005456 Bacteria 3647
122 Ga0070678_100056209 3300005456 Bacteria 2877
123 Ga0070678_100061286 3300005456 Bacteria 2772
124 Ga0070678_100089587 3300005456 Bacteria 2355
125 Ga0070678_100139062 3300005456 Bacteria 1940
126 Ga0070662_100009816 3300005457 Bacteria 6271
127 Ga0070662_100012878 3300005457 Bacteria 5557
128 Ga0070662_100176492 3300005457 Bacteria 1682
129 Ga0070662_100178517 3300005457 Bacteria 1672
130 Ga0070681_10015832 3300005458 Bacteria 7517
131 Ga0070681_10050414 3300005458 Bacteria 4153
132 Ga0070681_10061500 3300005458 Bacteria 3729
133 Ga0070681_10220683 3300005458 Bacteria 1811
134 Ga0070681_10325796 3300005458 Bacteria 1446
135 Ga0068867_100000874 3300005459 Bacteria 20341
136 Ga0068867_100031810 3300005459 Bacteria 3812
137 Ga0068867_100050648 3300005459 Bacteria 3062
138 Ga0070685_10003079 3300005466 Bacteria 8488
139 Ga0070685_10246411 3300005466 Bacteria 1182
140 Ga0070707_100099390 3300005468 Bacteria 2819
141 Ga0070679_100040768 3300005530 Bacteria 4619
142 Ga0070679_100151164 3300005530 Bacteria 2298
143 Ga0070679_100210850 3300005530 Bacteria 1906
144 Ga0070684_100004467 3300005535 Bacteria 10651
145 Ga0070684_100016286 3300005535 Bacteria 6074
146 Ga0070684_100171967 3300005535 Bacteria 1968
147 Ga0070697_100002564 3300005536 Bacteria 13978
148 Ga0068853_100003110 3300005539 Bacteria 12691
149 Ga0068853_100069092 3300005539 Bacteria 3072
150 Ga0068853_100093456 3300005539 Bacteria 2648
151 Ga0068853_100098738 3300005539 Bacteria 2579
152 Ga0068853_100175699 3300005539 Bacteria 1940
153 Ga0068853_100253732 3300005539 Bacteria 1615
154 Ga0068853_100330674 3300005539 Bacteria 1414
155 Ga0070672_100005379 3300005543 Bacteria 8483
156 Ga0070672_100005531 3300005543 Bacteria 8389
157 Ga0070672_100053092 3300005543 Bacteria 3167
158 Ga0070672_100131220 3300005543 Bacteria 2059
159 Ga0070672_100262842 3300005543 Bacteria 1456
160 Ga0070686_100004079 3300005544 Bacteria 8032
161 Ga0070695_100012339 3300005545 Bacteria 5123
162 Ga0070695_100026443 3300005545 Bacteria 3590
163 Ga0070695_100135344 3300005545 Bacteria 1703
164 Ga0070696_100008243 3300005546 Bacteria 6975
165 Ga0070696_100039848 3300005546 Bacteria 3244
166 Ga0070693_100072635 3300005547 Bacteria 2030
167 Ga0070693_100168400 3300005547 Bacteria 1401
168 Ga0070665_100023550 3300005548 Bacteria 6200
169 Ga0070665_100203213 3300005548 Bacteria 1982
170 Ga0070665_100234436 3300005548 Bacteria 1836
171 Ga0070665_100350418 3300005548 Bacteria 1482
172 Ga0070704_100065568 3300005549 Bacteria 2615
173 Ga0068855_100072645 3300005563 Bacteria 3998
174 Ga0068855_100082241 3300005563 Bacteria 3732
175 Ga0068855_100098486 3300005563 Bacteria 3368
176 Ga0068855_100108293 3300005563 Bacteria 3192
177 Ga0068855_100235299 3300005563 Bacteria 2049
178 Ga0070664_100027792 3300005564 Bacteria 4703
179 Ga0068857_100025732 3300005577 Bacteria 5181
180 Ga0068857_100069181 3300005577 Bacteria 3143
181 Ga0068854_100002509 3300005578 Bacteria 11386
182 Ga0068854_100106576 3300005578 Bacteria 2109
183 Ga0068856_100007430 3300005614 Bacteria 10692
184 Ga0068856_100061086 3300005614 Bacteria 3722
185 Ga0068856_100085445 3300005614 Bacteria 3134
186 Ga0068856_100119327 3300005614 Bacteria 2638
187 Ga0070702_100003283 3300005615 Bacteria 7206
188 Ga0068852_100006607 3300005616 Bacteria 8398
189 Ga0068852_100093916 3300005616 Bacteria 2689
190 Ga0068852_100366140 3300005616 Bacteria 1411
191 Ga0068859_100038170 3300005617 Bacteria 4819
192 Ga0068859_100069054 3300005617 Bacteria 3568
193 Ga0068859_100122021 3300005617 Bacteria 2672
194 Ga0068859_100276898 3300005617 Bacteria 1770
195 Ga0068864_100001321 3300005618 Bacteria 20620
196 Ga0068864_100087223 3300005618 Bacteria 2747
197 Ga0068864_100099414 3300005618 Bacteria 2577
198 Ga0068864_100195682 3300005618 Bacteria 1855
199 Ga0068866_10002168 3300005718 Bacteria 8173
200 Ga0068866_10037249 3300005718 Bacteria 2388
201 Ga0068866_10096173 3300005718 Bacteria 1624
202 Ga0068870_10000716 3300005840 Bacteria 12739
203 Ga0068863_100000965 3300005841 Bacteria 28914
204 Ga0068863_100107159 3300005841 Bacteria 2659
205 Ga0068863_100120246 3300005841 Bacteria 2504
206 Ga0068858_100003017 3300005842 Bacteria 16885
207 Ga0068858_100064343 3300005842 Bacteria 3394
208 Ga0068858_100065499 3300005842 Bacteria 3362
209 Ga0068858_100222549 3300005842 Bacteria 1788
210 Ga0068860_100000577 3300005843 Bacteria 44036
211 Ga0068860_100014200 3300005843 Bacteria 7808
212 Ga0068860_100041961 3300005843 Bacteria 4371
213 Ga0068860_100276217 3300005843 Bacteria 1641
214 Ga0068860_100304064 3300005843 Bacteria 1563
215 Ga0068862_100003246 3300005844 Bacteria 14077
216 Ga0068862_100019155 3300005844 Bacteria 5706
217 Ga0068862_100234364 3300005844 Bacteria 1666
218 Ga0081455_10000327 3300005937 Bacteria 62253
219 Ga0081455_10003093 3300005937 Bacteria 19378
220 Ga0081455_10006033 3300005937 Bacteria 13120
221 Ga0081455_10011459 3300005937 Bacteria 8907
222 Ga0081455_10053413 3300005937 Bacteria 3451
223 Ga0081455_10103105 3300005937 Bacteria 2286
224 Ga0081455_10158909 3300005937 Bacteria 1735
225 Ga0081455_10215824 3300005937 Bacteria 1426
226 Ga0081540_1000102 3300005983 Bacteria 91311
227 Ga0081540_1001430 3300005983 Bacteria 20638
228 Ga0081540_1003410 3300005983 Bacteria 12579
229 Ga0081540_1003755 3300005983 Bacteria 11903
230 Ga0081540_1009790 3300005983 Bacteria 6562
231 Ga0081540_1014713 3300005983 Bacteria 4996
232 Ga0081540_1017229 3300005983 Bacteria 4479
233 Ga0081540_1063111 3300005983 Bacteria 1755
234 Ga0081539_10000048 3300005985 Bacteria 272906
235 Ga0081539_10058707 3300005985 Bacteria 2122
236 Ga0081539_10072824 3300005985 Bacteria 1835
237 Ga0070717_10007141 3300006028 Bacteria 8277
238 Ga0070717_10010868 3300006028 Bacteria 6891
239 Ga0070717_10013303 3300006028 Bacteria 6301
240 Ga0070717_10059267 3300006028 Bacteria 3167
241 Ga0075365_10018199 3300006038 Bacteria 4315
242 Ga0075365_10099182 3300006038 Bacteria 1993
243 Ga0075363_100008259 3300006048 Bacteria 4839
244 Ga0075363_100023705 3300006048 Bacteria 3114
245 Ga0075432_10000765 3300006058 Bacteria 9994
246 Ga0070716_100006717 3300006173 Bacteria 5634
247 Ga0070712_100024348 3300006175 Bacteria 4011
248 Ga0070712_100106270 3300006175 Bacteria 2086
249 Ga0075362_10045225 3300006177 Bacteria 1954
250 Ga0075367_10039381 3300006178 Bacteria 2756
251 Ga0075367_10045981 3300006178 Bacteria 2563
252 Ga0075367_10048843 3300006178 Bacteria 2494
253 Ga0075369_10026031 3300006186 Bacteria 2436
254 Ga0075366_10002375 3300006195 Bacteria 9645
255 Ga0097621_100034122 3300006237 Bacteria 4057
256 Ga0075370_10026132 3300006353 Bacteria 3232
257 Ga0068871_100001025 3300006358 Bacteria 18716
258 Ga0068871_100005428 3300006358 Bacteria 8937
259 Ga0068871_100027579 3300006358 Bacteria 4443
260 Ga0068871_100073854 3300006358 Bacteria 2812
261 Ga0068871_100195067 3300006358 Bacteria 1746
262 Ga0068871_100292928 3300006358 Bacteria 1427
263 Ga0075428_100020912 3300006844 Bacteria 7246
264 Ga0075428_100131629 3300006844 Bacteria 2720
265 Ga0075428_100135424 3300006844 Bacteria 2679
266 Ga0075430_100000026 3300006846 Bacteria 78833
267 Ga0075430_100000222 3300006846 Bacteria 39248
268 Ga0075430_100012924 3300006846 Bacteria 7115
269 Ga0075431_100000451 3300006847 Bacteria 33773
270 Ga0075431_100032904 3300006847 Bacteria 5343
271 Ga0075433_10002991 3300006852 Bacteria 12983
272 Ga0075433_10016718 3300006852 Bacteria 6056
273 Ga0075434_100000110 3300006871 Bacteria 46873
274 Ga0075434_100001174 3300006871 Bacteria 21706
275 Ga0075429_100000247 3300006880 Bacteria 37266
276 Ga0075429_100009429 3300006880 Bacteria 8475
277 Ga0075429_100030873 3300006880 Bacteria 4657
278 Ga0068865_100005281 3300006881 Bacteria 7815
279 Ga0068865_100013742 3300006881 Bacteria 5127
280 Ga0068865_100103441 3300006881 Bacteria 2089
281 Ga0075436_100004698 3300006914 Bacteria 9369
282 Ga0075436_100089836 3300006914 Bacteria 2135
283 Ga0097620_100038166 3300006931 Bacteria 4819
284 Ga0097620_100069047 3300006931 Bacteria 3568
285 Ga0097620_100122027 3300006931 Bacteria 2672
286 Ga0097620_100276897 3300006931 Bacteria 1770
287 Ga0075435_100016201 3300007076 Bacteria 5618
288 Ga0075435_100110089 3300007076 Bacteria 2290
289 Ga0075435_100266357 3300007076 Bacteria 1461
290 Ga0099794_10015687 3300007265 Bacteria 3349
291 Ga0105251_10077573 3300009011 Bacteria 1540
292 Ga0105240_10121284 3300009093 Bacteria 3147
293 Ga0111539_10000337 3300009094 Bacteria 57733
294 Ga0111539_10014415 3300009094 Bacteria 9866
295 Ga0111539_10150346 3300009094 Bacteria 2726
296 Ga0105245_10000380 3300009098 Bacteria 41293
297 Ga0105245_10060762 3300009098 Bacteria 3404
298 Ga0105245_10070201 3300009098 Bacteria 3178
299 Ga0105245_10111892 3300009098 Bacteria 2540
300 Ga0105245_10114924 3300009098 Bacteria 2507
301 Ga0105247_10001411 3300009101 Bacteria 17428
302 Ga0105247_10006423 3300009101 Bacteria 7280
303 Ga0105247_10016700 3300009101 Bacteria 4401
304 Ga0105247_10025590 3300009101 Bacteria 3561
305 Ga0105247_10048427 3300009101 Bacteria 2610
306 Ga0105247_10062814 3300009101 Bacteria 2304
307 Ga0114129_10053822 3300009147 Bacteria 5645
308 Ga0114129_10097181 3300009147 Bacteria 4077
309 Ga0114129_10229244 3300009147 Bacteria 2502
310 Ga0114129_10652340 3300009147 Bacteria 1358
311 Ga0105243_10008080 3300009148 Bacteria 8076
312 Ga0105243_10031539 3300009148 Bacteria 4087
313 Ga0105243_10230951 3300009148 Bacteria 1641
314 Ga0105243_10283021 3300009148 Bacteria 1494
315 Ga0105241_10027743 3300009174 Bacteria 4215
316 Ga0105241_10128056 3300009174 Bacteria 2052
317 Ga0105241_10159805 3300009174 Bacteria 1851
318 Ga0105242_10000350 3300009176 Bacteria 37047
319 Ga0105242_10035266 3300009176 Bacteria 4012
320 Ga0105242_10078490 3300009176 Bacteria 2756
321 Ga0105242_10131844 3300009176 Bacteria 2158
322 Ga0105248_10013825 3300009177 Bacteria 8882
323 Ga0105248_10015595 3300009177 Bacteria 8376
324 Ga0105248_10019063 3300009177 Bacteria 7586
325 Ga0105248_10037197 3300009177 Bacteria 5445
326 Ga0105248_10080964 3300009177 Bacteria 3651
327 Ga0105248_10145105 3300009177 Bacteria 2678
328 Ga0105237_10066040 3300009545 Bacteria 3612
329 Ga0105237_10173347 3300009545 Bacteria 2157
330 Ga0105237_10182842 3300009545 Bacteria 2096
331 Ga0105237_10202763 3300009545 Bacteria 1984
332 Ga0105237_10383751 3300009545 Bacteria 1410
333 Ga0105249_10007137 3300009553 Bacteria 9750
334 Ga0105249_10122164 3300009553 Bacteria 2476
335 Ga0105239_10017528 3300010375 Bacteria 7921
336 Ga0105239_10114074 3300010375 Bacteria 2997
337 Ga0105239_10311499 3300010375 Bacteria 1774
338 Ga0105239_10348954 3300010375 Bacteria 1671
339 Ga0105246_10002609 3300011119 Bacteria 10906
340 Ga0105246_10148574 3300011119 Bacteria 1771
341 Ga0157373_10045507 3300013100 Bacteria 3132
342 Ga0157371_10135704 3300013102 Bacteria 1752
343 Ga0157370_10322474 3300013104 Bacteria 1425
344 Ga0157369_10095876 3300013105 Bacteria 3165
345 Ga0157369_10174759 3300013105 Bacteria 2261
346 Ga0157374_10032360 3300013296 Bacteria 4761
347 Ga0157374_10053103 3300013296 Bacteria 3777
348 Ga0157374_10054750 3300013296 Bacteria 3722
349 Ga0157374_10062182 3300013296 Bacteria 3498
350 Ga0157374_10065956 3300013296 Bacteria 3401
351 Ga0157374_10099654 3300013296 Bacteria 2784
352 Ga0157378_10043205 3300013297 Bacteria 4002
353 Ga0157378_10107630 3300013297 Bacteria 2551
354 Ga0157378_10254793 3300013297 Bacteria 1681
355 Ga0163162_10010530 3300013306 Bacteria 8994
356 Ga0163162_10068510 3300013306 Bacteria 3600
357 Ga0163162_10095629 3300013306 Bacteria 3058
358 Ga0163162_10420014 3300013306 Bacteria 1470
359 Ga0157372_10009499 3300013307 Bacteria 10344
360 Ga0157372_10084860 3300013307 Bacteria 3591
361 Ga0157375_10002791 3300013308 Bacteria 15110
362 Ga0157375_10022203 3300013308 Bacteria 5839
363 Ga0157375_10113058 3300013308 Bacteria 2816
364 Ga0157375_10246096 3300013308 Bacteria 1948
365 Ga0157375_10316399 3300013308 Bacteria 1725
366 Ga0157375_10346805 3300013308 Bacteria 1650
367 Ga0163163_10016636 3300014325 Bacteria 6838
368 Ga0163163_10043798 3300014325 Bacteria 4390
369 Ga0163163_10054275 3300014325 Bacteria 3959
370 Ga0163163_10100808 3300014325 Bacteria 2910
371 Ga0163163_10166611 3300014325 Bacteria 2250
372 Ga0163163_10170037 3300014325 Bacteria 2226
373 Ga0163163_10276705 3300014325 Bacteria 1730
374 Ga0157380_10009701 3300014326 Bacteria 6906
375 Ga0157380_10100720 3300014326 Bacteria 2406
376 Ga0157380_10121457 3300014326 Bacteria 2213
377 Ga0157380_10131344 3300014326 Bacteria 2137
378 Ga0157380_10145235 3300014326 Bacteria 2044
379 Ga0157380_10270244 3300014326 Bacteria 1549
380 Ga0157377_10000341 3300014745 Bacteria 20841
381 Ga0157377_10059329 3300014745 Bacteria 2181
382 Ga0157379_10106097 3300014968 Bacteria 2522
383 Ga0157379_10287188 3300014968 Bacteria 1498
384 Ga0157376_10000663 3300014969 Bacteria 22264
385 Ga0157376_10040464 3300014969 Bacteria 3809
386 Ga0157376_10141002 3300014969 Bacteria 2162
387 Ga0157376_10187083 3300014969 Bacteria 1896
388 Ga0157376_10424407 3300014969 Bacteria 1291
389 Ga0163161_10000379 3300017792 Bacteria 37281
390 Ga0163161_10264180 3300017792 Bacteria 1345
391 Ga0207666_1000103 3300025271 Bacteria 13338
392 Ga0209758_1002448 3300025297 Bacteria 18947
393 Ga0209758_1008580 3300025297 Bacteria 6576
394 Ga0207697_10001374 3300025315 Bacteria 13320
395 Ga0207697_10055588 3300025315 Bacteria 1641
396 Ga0207653_10008349 3300025885 Bacteria 3226
397 Ga0207682_10000043 3300025893 Bacteria 52108
398 Ga0207682_10001519 3300025893 Bacteria 10697
399 Ga0207682_10001931 3300025893 Bacteria 9419
400 Ga0207692_10003295 3300025898 Bacteria 6293
401 Ga0207692_10006313 3300025898 Bacteria 4803
402 Ga0207642_10007175 3300025899 Bacteria 3750
403 Ga0207710_10008560 3300025900 Bacteria 4313
404 Ga0207710_10049955 3300025900 Bacteria 1875
405 Ga0207688_10000083 3300025901 Bacteria 36050
406 Ga0207688_10004971 3300025901 Bacteria 7237
407 Ga0207680_10006796 3300025903 Bacteria 5551
408 Ga0207647_10003002 3300025904 Bacteria 12691
409 Ga0207685_10000528 3300025905 Bacteria 6575
410 Ga0207685_10000914 3300025905 Bacteria 5631
411 Ga0207699_10006599 3300025906 Bacteria 5632
412 Ga0207699_10010546 3300025906 Bacteria 4642
413 Ga0207699_10045368 3300025906 Bacteria 2565
414 Ga0207645_10000899 3300025907 Bacteria 24667
415 Ga0207645_10014247 3300025907 Bacteria 5326
416 Ga0207645_10070342 3300025907 Bacteria 2238
417 Ga0207643_10000128 3300025908 Bacteria 51191
418 Ga0207643_10038664 3300025908 Bacteria 2681
419 Ga0207643_10140506 3300025908 Bacteria 1442
420 Ga0207684_10204578 3300025910 Bacteria 1703
421 Ga0207654_10005950 3300025911 Bacteria 6140
422 Ga0207707_10001534 3300025912 Bacteria 21320
423 Ga0207707_10004166 3300025912 Bacteria 12809
424 Ga0207707_10055634 3300025912 Bacteria 3441
425 Ga0207707_10345496 3300025912 Bacteria 1282
426 Ga0207695_10089205 3300025913 Bacteria 3101
427 Ga0207695_10247016 3300025913 Bacteria 1684
428 Ga0207671_10057611 3300025914 Bacteria 2880
429 Ga0207671_10073915 3300025914 Bacteria 2547
430 Ga0207671_10113763 3300025914 Bacteria 2062
431 Ga0207671_10156329 3300025914 Bacteria 1764
432 Ga0207671_10192162 3300025914 Bacteria 1592
433 Ga0207693_10003105 3300025915 Bacteria 14304
434 Ga0207693_10117568 3300025915 Bacteria 2087
435 Ga0207693_10156925 3300025915 Bacteria 1790
436 Ga0207663_10003674 3300025916 Bacteria 7543
437 Ga0207663_10009887 3300025916 Bacteria 5051
438 Ga0207663_10027621 3300025916 Bacteria 3311
439 Ga0207660_10023127 3300025917 Bacteria 4194
440 Ga0207660_10044159 3300025917 Bacteria 3135
441 Ga0207660_10049075 3300025917 Bacteria 2990
442 Ga0207662_10000975 3300025918 Bacteria 13319
443 Ga0207662_10231736 3300025918 Bacteria 1206
444 Ga0207657_10020169 3300025919 Bacteria 6307
445 Ga0207649_10002321 3300025920 Bacteria 10689
446 Ga0207652_10005425 3300025921 Bacteria 10348
447 Ga0207652_10013947 3300025921 Bacteria 6506
448 Ga0207652_10024211 3300025921 Bacteria 5035
449 Ga0207652_10027543 3300025921 Bacteria 4736
450 Ga0207652_10056338 3300025921 Bacteria 3384
451 Ga0207646_10220450 3300025922 Bacteria 1714
452 Ga0207681_10006781 3300025923 Bacteria 7022
453 Ga0207681_10188193 3300025923 Bacteria 1577
454 Ga0207694_10032282 3300025924 Bacteria 4006
455 Ga0207650_10008902 3300025925 Bacteria 6860
456 Ga0207650_10123258 3300025925 Bacteria 2020
457 Ga0207659_10007188 3300025926 Bacteria 6838
458 Ga0207659_10050993 3300025926 Bacteria 2941
459 Ga0207687_10000522 3300025927 Bacteria 25753
460 Ga0207687_10062204 3300025927 Bacteria 2639
461 Ga0207687_10150080 3300025927 Bacteria 1777
462 Ga0207700_10004890 3300025928 Bacteria 7962
463 Ga0207700_10024078 3300025928 Bacteria 4208
464 Ga0207700_10025747 3300025928 Bacteria 4091
465 Ga0207700_10149321 3300025928 Bacteria 1930
466 Ga0207664_10010948 3300025929 Bacteria 6424
467 Ga0207644_10000611 3300025931 Bacteria 22735
468 Ga0207644_10006011 3300025931 Bacteria 7913
469 Ga0207644_10075011 3300025931 Bacteria 2484
470 Ga0207690_10003223 3300025932 Bacteria 9794
471 Ga0207706_10001616 3300025933 Bacteria 22352
472 Ga0207706_10015033 3300025933 Bacteria 7006
473 Ga0207686_10014769 3300025934 Bacteria 4357
474 Ga0207686_10056767 3300025934 Bacteria 2462
475 Ga0207709_10009743 3300025935 Bacteria 5295
476 Ga0207709_10026097 3300025935 Bacteria 3353
477 Ga0207709_10248435 3300025935 Bacteria 1298
478 Ga0207709_10262109 3300025935 Bacteria 1268
479 Ga0207670_10000631 3300025936 Bacteria 18876
480 Ga0207670_10007366 3300025936 Bacteria 6135
481 Ga0207669_10000797 3300025937 Bacteria 13482
482 Ga0207669_10002598 3300025937 Bacteria 7722
483 Ga0207669_10290147 3300025937 Bacteria 1238
484 Ga0207704_10047461 3300025938 Bacteria 2567
485 Ga0207704_10292194 3300025938 Bacteria 1244
486 Ga0207665_10001379 3300025939 Bacteria 16369
487 Ga0207665_10009568 3300025939 Bacteria 6365
488 Ga0207665_10092666 3300025939 Bacteria 2097
489 Ga0207691_10000599 3300025940 Bacteria 35997
490 Ga0207691_10002935 3300025940 Bacteria 16639
491 Ga0207691_10019716 3300025940 Bacteria 6378
492 Ga0207691_10023830 3300025940 Bacteria 5760
493 Ga0207691_10173454 3300025940 Bacteria 1887
494 Ga0207711_10008296 3300025941 Bacteria 8696
495 Ga0207711_10010676 3300025941 Bacteria 7637
496 Ga0207711_10052202 3300025941 Bacteria 3503
497 Ga0207711_10077904 3300025941 Bacteria 2890
498 Ga0207711_10235281 3300025941 Bacteria 1679
499 Ga0207689_10000165 3300025942 Bacteria 57494
500 Ga0207689_10054251 3300025942 Bacteria 3302
501 Ga0207689_10126494 3300025942 Bacteria 2102
502 Ga0207689_10181700 3300025942 Bacteria 1734
503 Ga0207689_10266925 3300025942 Bacteria 1416
504 Ga0207689_10320271 3300025942 Bacteria 1287
505 Ga0207661_10004909 3300025944 Bacteria 9371
506 Ga0207661_10011748 3300025944 Bacteria 6356
507 Ga0207661_10047173 3300025944 Bacteria 3419
508 Ga0207679_10000112 3300025945 Bacteria 65716
509 Ga0207667_10025956 3300025949 Bacteria 6408
510 Ga0207667_10203956 3300025949 Bacteria 2028
511 Ga0207667_10214557 3300025949 Bacteria 1972
512 Ga0207667_10313675 3300025949 Bacteria 1602
513 Ga0207651_10000099 3300025960 Bacteria 38059
514 Ga0207651_10031165 3300025960 Bacteria 3405
515 Ga0207712_10001957 3300025961 Bacteria 13516
516 Ga0207668_10003391 3300025972 Bacteria 9338
517 Ga0207668_10110071 3300025972 Bacteria 2065
518 Ga0207668_10113802 3300025972 Bacteria 2035
519 Ga0207668_10115342 3300025972 Bacteria 2023
520 Ga0207668_10126611 3300025972 Bacteria 1943
521 Ga0207668_10204806 3300025972 Bacteria 1574
522 Ga0207668_10226629 3300025972 Bacteria 1504
523 Ga0207640_10000382 3300025981 Bacteria 28458
524 Ga0207658_10035295 3300025986 Bacteria 3580
525 Ga0207658_10276669 3300025986 Bacteria 1437
526 Ga0207677_10005315 3300026023 Bacteria 6981
527 Ga0207677_10010700 3300026023 Bacteria 5199
528 Ga0207677_10133847 3300026023 Bacteria 1887
529 Ga0207677_10174836 3300026023 Bacteria 1683
530 Ga0207677_10189017 3300026023 Bacteria 1627
531 Ga0207703_10004258 3300026035 Bacteria 11776
532 Ga0207703_10025231 3300026035 Bacteria 4675
533 Ga0207639_10032542 3300026041 Bacteria 3839
534 Ga0207639_10042404 3300026041 Bacteria 3410
535 Ga0207639_10205900 3300026041 Bacteria 1690
536 Ga0207639_10208433 3300026041 Bacteria 1681
537 Ga0207639_10269595 3300026041 Bacteria 1493
538 Ga0207639_10285271 3300026041 Bacteria 1454
539 Ga0207678_10003272 3300026067 Bacteria 14619
540 Ga0207678_10007002 3300026067 Bacteria 10009
541 Ga0207678_10031527 3300026067 Bacteria 4624
542 Ga0207678_10056323 3300026067 Bacteria 3384
543 Ga0207678_10299181 3300026067 Bacteria 1382
544 Ga0207708_10012755 3300026075 Bacteria 6267
545 Ga0207708_10148868 3300026075 Bacteria 1841
546 Ga0207708_10397502 3300026075 Bacteria 1139
547 Ga0207702_10093858 3300026078 Bacteria 2633
548 Ga0207702_10142451 3300026078 Bacteria 2171
549 Ga0207641_10001777 3300026088 Bacteria 20763
550 Ga0207648_10007480 3300026089 Bacteria 10733
551 Ga0207648_10031836 3300026089 Bacteria 4661
552 Ga0207648_10047840 3300026089 Bacteria 3747
553 Ga0207676_10000494 3300026095 Bacteria 33145
554 Ga0207676_10014703 3300026095 Bacteria 5637
555 Ga0207676_10123689 3300026095 Bacteria 2186
556 Ga0207674_10020449 3300026116 Bacteria 7152
557 Ga0207674_10035721 3300026116 Bacteria 5186
558 Ga0207674_10082755 3300026116 Bacteria 3210
559 Ga0207674_10099104 3300026116 Bacteria 2897
560 Ga0207674_10102256 3300026116 Bacteria 2846
561 Ga0207675_100003533 3300026118 Bacteria 15253
562 Ga0207675_100301176 3300026118 Bacteria 1561
563 Ga0207683_10001272 3300026121 Bacteria 22830
564 Ga0207683_10001853 3300026121 Bacteria 18701
565 Ga0207683_10007911 3300026121 Bacteria 9095
566 Ga0207683_10011627 3300026121 Bacteria 7513
567 Ga0207683_10014162 3300026121 Bacteria 6795
568 Ga0207683_10015318 3300026121 Bacteria 6529
569 Ga0207683_10027632 3300026121 Bacteria 4902
570 Ga0207683_10042796 3300026121 Bacteria 3956
571 Ga0207683_10185536 3300026121 Bacteria 1887
572 Ga0207683_10194398 3300026121 Bacteria 1843
573 Ga0207698_10063441 3300026142 Bacteria 2891
574 Ga0207698_10070195 3300026142 Bacteria 2774
575 Ga0210002_1001992 3300027617 Bacteria 2937
576 Ga0209998_10001588 3300027717 Bacteria 5462
577 Ga0209813_10016915 3300027866 Bacteria 1997
578 Ga0209974_10032320 3300027876 Bacteria 1734
579 Ga0207428_10000064 3300027907 Bacteria 151185
580 Ga0207428_10000140 3300027907 Bacteria 97818
581 Ga0268266_10004422 3300028379 Bacteria 13462
582 Ga0268266_10007719 3300028379 Bacteria 9656
583 Ga0268266_10025484 3300028379 Bacteria 5032
584 Ga0268266_10047939 3300028379 Bacteria 3661
585 Ga0268266_10055302 3300028379 Bacteria 3412
586 Ga0268266_10110471 3300028379 Bacteria 2435
587 Ga0268266_10127814 3300028379 Bacteria 2270
588 Ga0268266_10195528 3300028379 Bacteria 1848
589 Ga0268266_10318353 3300028379 Bacteria 1455
590 Ga0268266_10365962 3300028379 Bacteria 1357
591 Ga0268266_10418333 3300028379 Bacteria 1270
592 Ga0268265_10011223 3300028380 Bacteria 6056
593 Ga0268265_10026351 3300028380 Bacteria 4135
594 Ga0268265_10113231 3300028380 Bacteria 2219
595 Ga0268265_10205865 3300028380 Bacteria 1710
596 Ga0268264_10000107 3300028381 Bacteria 209105
597 Ga0268264_10005082 3300028381 Bacteria 11144
598 Ga0268264_10086725 3300028381 Bacteria 2690
599 Ga0268264_10104967 3300028381 Bacteria 2464
600 Ga0265334_10015125 3300028573 Bacteria 3210
601 Ga0307515_10060988 3300028794 Bacteria 5363
602 Ga0265332_10050236 3300031238 Bacteria 1792
603 Ga0265328_10058289 3300031239 Bacteria 1418
604 Ga0265325_10000006 3300031241 Bacteria 255758
605 Ga0265325_10075637 3300031241 Bacteria 1681
606 Ga0265329_10012070 3300031242 Bacteria 3119
607 Ga0265340_10014381 3300031247 Bacteria 4134
608 Ga0265339_10006887 3300031249 Bacteria 7407
609 Ga0265331_10034717 3300031250 Bacteria 2485
610 Ga0265316_10221091 3300031344 Bacteria 1397
611 Ga0307513_10077502 3300031456 Bacteria 3442
612 Ga0307513_10144650 3300031456 Bacteria 2298
613 Ga0307509_10021381 3300031507 Bacteria 7315
614 Ga0265313_10023271 3300031595 Bacteria 3341
615 Ga0307508_10000154 3300031616 Bacteria 82824
616 Ga0307508_10265459 3300031616 Bacteria 1311
617 Ga0265314_10005615 3300031711 Bacteria 11266
618 Ga0265342_10003968 3300031712 Bacteria 11854
619 Ga0265342_10017314 3300031712 Bacteria 4691
620 Ga0265342_10102272 3300031712 Bacteria 1630
621 Ga0265342_10106101 3300031712 Bacteria 1595
622 Ga0307516_10029059 3300031730 Bacteria 5590
623 Ga0307410_10174005 3300031852 Bacteria 1625
624 Ga0307416_100063443 3300032002 Bacteria 3026
625 Ga0307510_10156282 3300033180 Bacteria 1887
626 Ga0315911_1000008 3300033442 Bacteria 381285
627 Ga0373930_0001231 3300034816 Bacteria 3781
628 Ga0373958_0010245 3300034819 Bacteria 1560
629 Ga0373959_0002918 3300034820 Bacteria 2713
630 Ga0373938_0015719 3300034957 Bacteria 1470
631 Ga0373928_0022088 3300035084 Bacteria 1347
632 Ga0373929_0017606 3300035085 Bacteria 1412
633 Ga0373934_0023900 3300035086 Bacteria 2363
634 Ga0373940_0004788 3300035088 Bacteria 2885
635 Ga0373952_0000859 3300035092 Bacteria 5518
636 Ga0373952_0004422 3300035092 Bacteria 2550
637 Ga0373923_0040479 3300035111 Bacteria 1918
638 Ga0373923_0051674 3300035111 Bacteria 1725
639 Ga0373923_0119338 3300035111 Bacteria 1177
640 Ga0373936_0006063 3300035113 Bacteria 4555
641 Ga0373941_0000494 3300035115 Bacteria 7908
642 Ga0373941_0005534 3300035115 Bacteria 2978
643 Ga0373941_0007844 3300035115 Bacteria 2630
644 Ga0373953_0001092 3300035117 Bacteria 7676
645 Ga0373953_0004155 3300035117 Bacteria 4592
646 Ga0373953_0019195 3300035117 Bacteria 2541
647 Ga0373954_0001821 3300035118 Bacteria 8793
648 Ga0373954_0046149 3300035118 Bacteria 2036
649 Ga0373956_0002051 3300035119 Bacteria 8345
650 Ga0373956_0002956 3300035119 Bacteria 6879
651 Ga0373957_0000374 3300035120 Bacteria 11335
652 Ga0373960_0000398 3300035121 Bacteria 8493
653 Ga0373960_0040243 3300035121 Bacteria 1348
654 Ga0373943_0005372 3300035170 Bacteria 5763
655 Ga0373943_0052716 3300035170 Bacteria 2006
656 Ga0373943_0162967 3300035170 Bacteria 1215
657 Ga0373946_0027757 3300035171 Bacteria 2241
658 Ga0373946_0137298 3300035171 Bacteria 1130
659 Ga0373955_0009267 3300035172 Bacteria 4609
660 Ga0373955_0009372 3300035172 Bacteria 4582
661 Ga0373955_0011740 3300035172 Bacteria 4187
662 Ga0373955_0046015 3300035172 Bacteria 2357
663 Ga0373962_0003525 3300035242 Bacteria 3760
664 Ga0373962_0022368 3300035242 Bacteria 1676
665 Ga0373924_0020683 3300035410 Bacteria 2560
666 Ga0373931_0001718 3300035691 Bacteria 9499
667 Ga0373931_0014040 3300035691 Bacteria 3908
668 Ga0373931_0019150 3300035691 Bacteria 3412
669 Ga0373931_0034618 3300035691 Bacteria 2622
670 Ga0373935_0006022 3300035692 Bacteria 7205
671 Ga0373935_0083521 3300035692 Bacteria 2079
672 Ga0373935_0107474 3300035692 Bacteria 1847
673 Ga0373935_0206185 3300035692 Bacteria 1361
674 Ga0373927_0025352 3300035695 Bacteria 3876
675 Ga0373927_0042636 3300035695 Bacteria 2940
676 Ga0373927_0153904 3300035695 Bacteria 1505
677 Ga0373933_0001100 3300035724 Bacteria 16117
678 Ga0373933_0045156 3300035724 Bacteria 2612
679 Ga0373947_0000340 3300035725 Bacteria 26369
680 Ga0373947_0035595 3300035725 Bacteria 2948
681 Ga0373947_0064359 3300035725 Bacteria 2236
682 Ga0373947_0088961 3300035725 Bacteria 1923
683 Ga0373947_0170331 3300035725 Bacteria 1412
684 Ga0373937_0001302 3300036401 Bacteria 20904
685 Ga0373937_0002947 3300036401 Bacteria 14245
686 Ga0373937_0005103 3300036401 Bacteria 11187
687 Ga0373937_0017774 3300036401 Bacteria 6344
688 Ga0373937_0064217 3300036401 Bacteria 3377
689 Ga0373937_0318829 3300036401 Bacteria 1470
690 Ga0373925_0007663 3300037068 Bacteria 7864
691 Ga0373925_0008452 3300037068 Bacteria 7500
692 Ga0373925_0020271 3300037068 Bacteria 4838
693 Ga0373925_0052361 3300037068 Bacteria 3050
694 Ga0436364_1064018 3300037853 Bacteria 2560
695 Ga0395901_0784501 3300038443 Bacteria 943
696 Ga0436365_0702073 3300039437 Bacteria 1769
697 Ga0439453_0000060 3300041408 Bacteria 7820
698 Ga0451807_0668963 3300041486 Bacteria 1500
699 Ga0439435_0002105 3300042436 Bacteria 3870
700 Ga0466957_0033043 3300044842 Bacteria 3102
701 Ga0466958_0114579 3300045836 Bacteria 1684
702 Ga0466967_0122303 3300045976 Bacteria 2407
703 Ga0495592_0001601 3300046454 Bacteria 15847
704 Ga0495592_0005759 3300046454 Bacteria 9175
705 Ga0495603_0019964 3300046455 Bacteria 4059
706 Ga0495603_0022944 3300046455 Bacteria 3777
707 Ga0495603_0025589 3300046455 Bacteria 3569
708 Ga0495603_0053963 3300046455 Bacteria 2384
709 Ga0495603_0099568 3300046455 Bacteria 1697
710 Ga0495629_0000529 3300046459 Bacteria 31881
711 Ga0495629_0008986 3300046459 Bacteria 7333
712 Ga0495629_0046527 3300046459 Bacteria 3043
713 Ga0495629_0059688 3300046459 Bacteria 2666
714 Ga0495629_0172112 3300046459 Bacteria 1502
715 Ga0495638_0009159 3300046460 Bacteria 6963
716 Ga0495638_0011077 3300046460 Bacteria 6233
717 Ga0495651_0001433 3300046462 Bacteria 18463
718 Ga0495651_0020115 3300046462 Bacteria 5181
719 Ga0495651_0195766 3300046462 Bacteria 1419
720 Ga0495651_0260327 3300046462 Bacteria 1180
721 Ga0495653_0016031 3300046463 Bacteria 6107
722 Ga0495653_0051871 3300046463 Bacteria 3146
723 Ga0495653_0089488 3300046463 Bacteria 2255
724 Ga0495653_0090070 3300046463 Bacteria 2246
725 Ga0495653_0160841 3300046463 Bacteria 1559
726 Ga0495582_0006293 3300046473 Bacteria 6611
727 Ga0495605_0058205 3300046474 Bacteria 1858
728 Ga0495605_0126410 3300046474 Bacteria 1156
729 Ga0495639_0009690 3300046475 Bacteria 4134
730 Ga0495639_0034011 3300046475 Bacteria 2278
731 Ga0495639_0066427 3300046475 Bacteria 1660
732 Ga0495664_0018790 3300046477 Bacteria 3966
733 Ga0495664_0023312 3300046477 Bacteria 3592
734 Ga0495664_0029806 3300046477 Bacteria 3194
735 Ga0495664_0037955 3300046477 Bacteria 2843
736 Ga0495584_0120905 3300046491 Bacteria 1326
737 Ga0495585_0004431 3300046492 Bacteria 9107
738 Ga0495585_0031604 3300046492 Bacteria 3004
739 Ga0495585_0038601 3300046492 Bacteria 2687
740 Ga0495585_0105382 3300046492 Bacteria 1504
741 Ga0495594_0054755 3300046499 Bacteria 2199
742 Ga0495583_0104207 3300046506 Bacteria 1208
743 Ga0495606_0001566 3300046507 Bacteria 29975
744 Ga0495606_0074530 3300046507 Bacteria 2126
745 Ga0495608_0008113 3300046511 Bacteria 7381
746 Ga0495608_0011568 3300046511 Bacteria 6139
747 Ga0495608_0016511 3300046511 Bacteria 5108
748 Ga0495608_0098528 3300046511 Bacteria 1886
749 Ga0495618_0015173 3300046514 Bacteria 4700
750 Ga0495618_0048917 3300046514 Bacteria 2670
751 Ga0495628_0002572 3300046516 Bacteria 16332
752 Ga0495628_0007597 3300046516 Bacteria 9371
753 Ga0495628_0015999 3300046516 Bacteria 6258
754 Ga0495628_0314441 3300046516 Bacteria 1157
755 Ga0495630_0040548 3300046517 Bacteria 3480
756 Ga0495630_0103006 3300046517 Bacteria 2160
757 Ga0495631_0115442 3300046518 Bacteria 1154
758 Ga0495666_0069319 3300046526 Bacteria 1678
759 Ga0495652_0002428 3300046529 Bacteria 19213
760 Ga0495652_0091823 3300046529 Bacteria 2481
761 Ga0495652_0115683 3300046529 Bacteria 2148
762 Ga0495665_0005351 3300046531 Bacteria 6920
763 Ga0495665_0085638 3300046531 Bacteria 1656
764 Ga0495640_0015450 3300046533 Bacteria 5745
765 Ga0495640_0047337 3300046533 Bacteria 2976
766 Ga0495640_0064294 3300046533 Bacteria 2481
767 Ga0495587_0009736 3300046536 Bacteria 6144
768 Ga0495587_0052159 3300046536 Bacteria 2414
769 Ga0495598_0017520 3300046537 Bacteria 1848
770 Ga0495609_0090437 3300046538 Bacteria 1331
771 Ga0495621_0023115 3300046539 Bacteria 2066
772 Ga0495621_0050206 3300046539 Bacteria 1490
773 Ga0495645_0001788 3300046543 Bacteria 14608
774 Ga0495645_0025716 3300046543 Bacteria 4274
775 Ga0495645_0028258 3300046543 Bacteria 4076
776 Ga0495645_0038226 3300046543 Bacteria 3501
777 Ga0495645_0052493 3300046543 Bacteria 2966
778 Ga0495645_0094722 3300046543 Bacteria 2129
779 Ga0495667_0003563 3300046559 Bacteria 10468
780 Ga0495667_0005768 3300046559 Bacteria 8384
781 Ga0495667_0119452 3300046559 Bacteria 1702
782 Ga0495656_0016994 3300046615 Bacteria 2770
783 Ga0495656_0032549 3300046615 Bacteria 2122
784 Ga0495656_0035929 3300046615 Bacteria 2038
785 Ga0495656_0091561 3300046615 Bacteria 1391
786 Ga0495668_0118180 3300046616 Bacteria 1450
787 Ga0495634_0004321 3300046642 Bacteria 11195
788 Ga0495625_0082150 3300046660 Bacteria 2241
789 Ga0495635_0000429 3300046663 Bacteria 26634
790 Ga0495635_0013995 3300046663 Bacteria 5613
791 Ga0495635_0027056 3300046663 Bacteria 3990
792 Ga0495635_0322937 3300046663 Bacteria 1033
793 Ga0495659_0007040 3300046664 Bacteria 3557
794 Ga0495659_0033686 3300046664 Bacteria 1799
795 Ga0495588_0083701 3300046674 Bacteria 1666
796 Ga0495657_0009336 3300046675 Bacteria 7443
797 Ga0495657_0010262 3300046675 Bacteria 7049
798 Ga0495657_0013260 3300046675 Bacteria 6087
799 Ga0495599_0003035 3300046678 Bacteria 9769
800 Ga0495623_0007229 3300046679 Bacteria 7207
801 Ga0495623_0007655 3300046679 Bacteria 7019
802 Ga0495623_0049055 3300046679 Bacteria 2675
803 Ga0495623_0102314 3300046679 Bacteria 1744
804 Ga0495623_0127033 3300046679 Bacteria 1530
805 Ga0495646_0001304 3300046680 Bacteria 14717
806 Ga0495646_0043515 3300046680 Bacteria 2749
807 Ga0495647_0008584 3300046681 Bacteria 3437
808 Ga0495658_0000781 3300046683 Bacteria 17152
809 Ga0495658_0011048 3300046683 Bacteria 4530
810 Ga0495669_0077313 3300046684 Bacteria 1524
811 Ga0495669_0083675 3300046684 Bacteria 1467
812 Ga0495613_0006286 3300046689 Bacteria 8885
813 Ga0495613_0029327 3300046689 Bacteria 4091
814 Ga0495613_0219605 3300046689 Bacteria 1335
815 Ga0495624_0040078 3300046690 Bacteria 3001
816 Ga0495624_0081726 3300046690 Bacteria 2001
817 Ga0495624_0132083 3300046690 Bacteria 1531
818 Ga0495670_0012130 3300046691 Bacteria 4239
819 Ga0495649_0080821 3300046694 Bacteria 1738
820 Ga0495600_0007607 3300046809 Bacteria 6637
821 Ga0495600_0014546 3300046809 Bacteria 4959
822 Ga0495581_0005737 3300047315 Bacteria 7194
823 Ga0495581_0030017 3300047315 Bacteria 3152
824 Ga0495581_0092012 3300047315 Bacteria 1760
825 Ga0495604_0002235 3300047317 Bacteria 15508
826 Ga0495604_0002822 3300047317 Bacteria 13952
827 Ga0495604_0010023 3300047317 Bacteria 7501
828 Ga0495604_0116513 3300047317 Bacteria 1939
829 Ga0495674_0004206 3300047319 Bacteria 13863
830 Ga0495674_0006763 3300047319 Bacteria 10975
831 Ga0495674_0021636 3300047319 Bacteria 5945
832 Ga0495674_0082394 3300047319 Bacteria 2758
833 Ga0495674_0198450 3300047319 Bacteria 1665
834 Ga0495672_0032259 3300047320 Bacteria 3261
835 Ga0495672_0106579 3300047320 Bacteria 1511
836 Ga0495676_0062585 3300047321 Bacteria 2904
837 Ga0495676_0121550 3300047321 Bacteria 1899
838 Ga0495680_0006824 3300047322 Bacteria 10544
839 Ga0495680_0029393 3300047322 Bacteria 4500
840 Ga0495675_0002904 3300047444 Bacteria 10293
841 Ga0495675_0067445 3300047444 Bacteria 2260
842 Ga0495684_0000497 3300047471 Bacteria 32091
843 Ga0495684_0015464 3300047471 Bacteria 5872
844 Ga0495684_0016411 3300047471 Bacteria 5703
845 Ga0495684_0025159 3300047471 Bacteria 4577
846 Ga0495684_0281626 3300047471 Bacteria 1199
847 Ga0495686_0147868 3300047472 Bacteria 1381
848 Ga0495593_0014868 3300047673 Bacteria 4421
849 Ga0495593_0014947 3300047673 Bacteria 4408
850 Ga0495593_0016723 3300047673 Bacteria 4133
851 Ga0495593_0023433 3300047673 Bacteria 3432
852 Ga0495602_0040996 3300048088 Bacteria 4234
853 Ga0495602_0128581 3300048088 Bacteria 2024
854 Ga0495602_0152128 3300048088 Bacteria 1817
855 Ga0495614_0010418 3300048089 Bacteria 4099
856 Ga0495614_0018899 3300048089 Bacteria 2984
857 Ga0495615_0000368 3300048090 Bacteria 7077
858 Ga0495615_0012724 3300048090 Bacteria 1741
859 Ga0496100_0012538 3300048903 Bacteria 4862
860 Ga0496100_0015511 3300048903 Bacteria 4451
861 Ga0496100_0040306 3300048903 Bacteria 2970
862 Ga0496100_0072267 3300048903 Bacteria 2305
863 Ga0496100_0128194 3300048903 Bacteria 1784
864 Ga0496100_0249420 3300048903 Bacteria 1313
865 Ga0496100_0279397 3300048903 Bacteria 1244
866 Ga0496101_0000235 3300048904 Bacteria 41146
867 Ga0496101_0001165 3300048904 Bacteria 15728
868 Ga0496101_0008415 3300048904 Bacteria 6740
869 Ga0496101_0019223 3300048904 Bacteria 4661
870 Ga0496101_0052924 3300048904 Bacteria 2928
871 Ga0496101_0053933 3300048904 Bacteria 2902
872 Ga0496101_0195594 3300048904 Bacteria 1562
873 Ga0496102_0005341 3300048905 Bacteria 10905
874 Ga0496102_0022951 3300048905 Bacteria 5535
875 Ga0496102_0028248 3300048905 Bacteria 5009
876 Ga0496102_0039515 3300048905 Bacteria 4263
877 Ga0496102_0155347 3300048905 Bacteria 2151
878 Ga0496103_0003790 3300048906 Bacteria 9196
879 Ga0496103_0011444 3300048906 Bacteria 5258
880 Ga0496103_0014101 3300048906 Bacteria 4744
881 Ga0496104_0000351 3300048907 Bacteria 41200
882 Ga0496104_0003146 3300048907 Bacteria 14223
883 Ga0496104_0008914 3300048907 Bacteria 8913
884 Ga0496104_0215047 3300048907 Bacteria 1834
885 Ga0496104_0250055 3300048907 Bacteria 1685
886 Ga0496104_0285969 3300048907 Bacteria 1561
887 Ga0496104_0499306 3300048907 Bacteria 1128
888 Ga0496105_0000840 3300048908 Bacteria 20909
889 Ga0496105_0006427 3300048908 Bacteria 9034
890 Ga0496105_0012927 3300048908 Bacteria 6616
891 Ga0496105_0029441 3300048908 Bacteria 4494
892 Ga0496105_0030009 3300048908 Bacteria 4454
893 Ga0496105_0037048 3300048908 Bacteria 4018
894 Ga0496105_0190590 3300048908 Bacteria 1676
895 Ga0496106_0000788 3300048909 Bacteria 22899
896 Ga0496106_0002108 3300048909 Bacteria 14874
897 Ga0496106_0010763 3300048909 Bacteria 6759
898 Ga0496106_0011781 3300048909 Bacteria 6454
899 Ga0496106_0169369 3300048909 Bacteria 1730
900 Ga0496106_0181176 3300048909 Bacteria 1672
901 Ga0496106_0186831 3300048909 Bacteria 1646
902 Ga0496106_0325966 3300048909 Bacteria 1233
903 Ga0496107_0004819 3300048910 Bacteria 9159
904 Ga0496107_0011301 3300048910 Bacteria 6216
905 Ga0496107_0013863 3300048910 Bacteria 5634
906 Ga0496107_0030116 3300048910 Bacteria 3867
907 Ga0496107_0074682 3300048910 Bacteria 2466
908 Ga0496107_0111973 3300048910 Bacteria 2006
909 Ga0496108_0011130 3300048911 Bacteria 7309
910 Ga0496108_0016530 3300048911 Bacteria 6022
911 Ga0496108_0019665 3300048911 Bacteria 5546
912 Ga0496108_0037794 3300048911 Bacteria 4022
913 Ga0496108_0082807 3300048911 Bacteria 2721
914 Ga0496108_0237162 3300048911 Bacteria 1586
915 Ga0496109_0005654 3300048912 Bacteria 10459
916 Ga0496109_0007962 3300048912 Bacteria 8983
917 Ga0496109_0023341 3300048912 Bacteria 5489
918 Ga0496109_0027237 3300048912 Bacteria 5102
919 Ga0496109_0028566 3300048912 Bacteria 4989
920 Ga0496109_0040011 3300048912 Bacteria 4245
921 Ga0496109_0045566 3300048912 Bacteria 3980
922 Ga0496110_0034051 3300048913 Bacteria 4409
923 Ga0496110_0039961 3300048913 Bacteria 4087
924 Ga0496110_0075409 3300048913 Bacteria 2996
925 Ga0496110_0492910 3300048913 Bacteria 1116
926 Ga0496111_0002946 3300048914 Bacteria 10413
927 Ga0496111_0009883 3300048914 Bacteria 6377
928 Ga0496111_0039701 3300048914 Bacteria 3376
929 Ga0496111_0057681 3300048914 Bacteria 2811
930 Ga0496112_0000018 3300048915 Bacteria 188820
931 Ga0496112_0011859 3300048915 Bacteria 7982
932 Ga0496112_0013345 3300048915 Bacteria 7583
933 Ga0496112_0030393 3300048915 Bacteria 5227
934 Ga0496112_0069569 3300048915 Bacteria 3477
935 Ga0496112_0334061 3300048915 Bacteria 1459
936 Ga0496112_0421533 3300048915 Bacteria 1273
937 Ga0496113_0013732 3300048916 Bacteria 5500
938 Ga0496113_0017464 3300048916 Bacteria 4981
939 Ga0496113_0035587 3300048916 Bacteria 3642
940 Ga0496113_0062084 3300048916 Bacteria 2821
941 Ga0496113_0071978 3300048916 Bacteria 2630
942 Ga0496114_0009940 3300048917 Bacteria 7562
943 Ga0496114_0023363 3300048917 Bacteria 5045
944 Ga0496114_0037148 3300048917 Bacteria 4028
945 Ga0496114_0048719 3300048917 Bacteria 3524
946 Ga0496114_0066495 3300048917 Bacteria 3022
947 Ga0496114_0112239 3300048917 Bacteria 2336
948 Ga0496115_0002701 3300048918 Bacteria 12737
949 Ga0496115_0010842 3300048918 Bacteria 6819
950 Ga0496115_0019196 3300048918 Bacteria 5259
951 Ga0496115_0050174 3300048918 Bacteria 3342
952 Ga0496115_0078464 3300048918 Bacteria 2686
953 Ga0496115_0109684 3300048918 Bacteria 2266
954 Ga0496115_0123713 3300048918 Bacteria 2129
955 Ga0496116_0227024 3300048919 Bacteria 951
956 Ga0496117_0007128 3300048920 Bacteria 11048
957 Ga0496117_0074479 3300048920 Bacteria 2260
958 Ga0496118_0003592 3300048921 Bacteria 19299
959 Ga0496118_0078665 3300048921 Bacteria 2332
960 Ga0496119_0055304 3300048922 Bacteria 2411
961 Ga0496121_0000640 3300048924 Bacteria 65295
962 Ga0496121_0038643 3300048924 Bacteria 4220
963 Ga0496121_0046507 3300048924 Bacteria 3713
964 Ga0496121_0048134 3300048924 Bacteria 3630
965 Ga0496121_0093528 3300048924 Bacteria 2340
966 Ga0496121_0188119 3300048924 Bacteria 1483
967 Ga0496124_0002189 3300048927 Bacteria 26104
968 Ga0496125_0085843 3300048928 Bacteria 2383
969 Ga0496126_0009499 3300048929 Bacteria 10319
970 Ga0496126_0018354 3300048929 Bacteria 6933
971 Ga0496126_0043259 3300048929 Bacteria 4155
972 Ga0496126_0047915 3300048929 Bacteria 3910
973 Ga0496126_0068906 3300048929 Bacteria 3157
974 Ga0496126_0080924 3300048929 Bacteria 2873
975 Ga0496126_0115449 3300048929 Bacteria 2334
976 Ga0496126_0164235 3300048929 Bacteria 1896
977 Ga0496126_0254389 3300048929 Bacteria 1462
978 Ga0501036_0003984 3300049572 Bacteria 11869
979 Ga0501037_0025075 3300049573 Bacteria 4406
980 Ga0501037_0040497 3300049573 Bacteria 3428
981 Ga0501038_0040262 3300049574 Bacteria 4083
982 Ga0501046_0067505 3300049580 Bacteria 2785
983 Ga0501047_0000100 3300049581 Bacteria 105717
984 Ga0501047_0052511 3300049581 Bacteria 3940
985 Ga0501048_0000083 3300049582 Bacteria 49621
986 Ga0501048_0098144 3300049582 Bacteria 2067
987 Ga0501068_0041556 3300049584 Bacteria 2763
988 Ga0501070_0009792 3300049586 Bacteria 8108
989 Ga0501070_0152053 3300049586 Bacteria 1909
990 Ga0501070_0215422 3300049586 Bacteria 1575
991 Ga0501072_0003943 3300049588 Bacteria 11230
992 Ga0501072_0218576 3300049588 Bacteria 1519
993 Ga0501074_0017935 3300049590 Bacteria 5143
994 Ga0501074_0040074 3300049590 Bacteria 3392
995 Ga0501074_0046177 3300049590 Bacteria 3149
996 Ga0501079_0033083 3300049741 Bacteria 3976
997 Ga0501080_0000030 3300049742 Bacteria 87736
998 Ga0501080_0029073 3300049742 Bacteria 5145
999 Ga0501080_0290083 3300049742 Bacteria 1486
1000 Ga0501083_0002641 3300049744 Bacteria 12337
1001 Ga0501083_0194828 3300049744 Bacteria 1322
1002 Ga0501035_0023582 3300049822 Bacteria 5645
1003 Ga0501035_0438882 3300049822 Bacteria 1081
1004 Ga0501044_0000587 3300049823 Bacteria 44137
1005 nmdc:mga03n38_150788_c1 3300050490 Bacteria 1169
1006 nmdc:mga0yw44_104257_c1 3300050492 Bacteria 1810
1007 nmdc:mga0yw44_63102_c1 3300050492 Bacteria 2277
1008 nmdc:mga0k408_2505_c2 3300050493 Bacteria 7672
1009 nmdc:mga0k408_36277_c1 3300050493 Bacteria 2829
1010 nmdc:mga06z11_34154_c1 3300050494 Bacteria 2494
1011 nmdc:mga06z11_4911_c1 3300050494 Bacteria 5306
1012 nmdc:mga07m45_49692_c1 3300050496 Bacteria 2361
1013 nmdc:mga05p37_10233_c1 3300050507 Bacteria 11137
1014 nmdc:mga05p37_166916_c1 3300050507 Bacteria 2686
1015 nmdc:mga05p37_225_c1 3300050507 Bacteria 57238
1016 nmdc:mga09592_244_c1 3300050508 Bacteria 39424
1017 nmdc:mga09592_58040_c1 3300050508 Bacteria 3273
1018 nmdc:mga09592_736_c1 3300050508 Bacteria 25222
1019 nmdc:mga0qj67_215_c1 3300050509 Bacteria 39409
1020 nmdc:mga0qj67_2611_c1 3300050509 Bacteria 12909
1021 nmdc:mga0qj67_4314_c1 3300050509 Bacteria 10307
1022 nmdc:mga06r32_12515_c1 3300050510 Bacteria 7657
1023 nmdc:mga06r32_341_c1 3300050510 Bacteria 38959
1024 nmdc:mga06r32_731_c1 3300050510 Bacteria 28813
1025 nmdc:mga08y16_131595_c1 3300050511 Bacteria 2601
1026 nmdc:mga08y16_145004_c1 3300050511 Bacteria 2468
1027 nmdc:mga08y16_252107_c1 3300050511 Bacteria 1824
1028 nmdc:mga08y16_617_c1 3300050511 Bacteria 33261
1029 nmdc:mga08y16_6190_c1 3300050511 Bacteria 12557
1030 nmdc:mga0n895_308807_c1 3300050512 Bacteria 1603
1031 nmdc:mga0n895_457_c1 3300050512 Bacteria 27383
1032 nmdc:mga0n895_543324_c1 3300050512 Bacteria 1168
1033 nmdc:mga0rr50_11539_c1 3300050513 Bacteria 5662
1034 nmdc:mga0rr50_19557_c1 3300050513 Bacteria 4574
1035 nmdc:mga08x19_81571_c1 3300050514 Bacteria 2124
1036 nmdc:mga0a205_1019_c1 3300050515 Bacteria 23295
1037 nmdc:mga0a205_17989_c1 3300050515 Bacteria 6068
1038 Ga0495601_0000413 3300053077 Bacteria 22423
1039 Ga0495601_0000668 3300053077 Bacteria 18282
1040 Ga0495601_0005956 3300053077 Bacteria 7113
1041 Ga0495601_0007499 3300053077 Bacteria 6400
1042 Ga0495601_0018585 3300053077 Bacteria 4231
1043 Ga0495601_0060131 3300053077 Bacteria 2410
1044 Ga0495612_0001564 3300053078 Bacteria 9430
1045 Ga0495612_0002430 3300053078 Bacteria 7675
1046 Ga0495612_0006791 3300053078 Bacteria 4688
1047 Ga0495612_0008871 3300053078 Bacteria 4073
1048 Ga0495612_0019920 3300053078 Bacteria 2688
1049 Ga0495595_0000516 3300053084 Bacteria 14727
1050 Ga0495595_0001465 3300053084 Bacteria 9212
1051 Ga0495595_0003553 3300053084 Bacteria 6186
1052 Ga0495619_0001679 3300053085 Bacteria 14639
1053 Ga0495619_0001957 3300053085 Bacteria 13737
1054 Ga0495619_0002856 3300053085 Bacteria 11246
1055 Ga0495619_0020676 3300053085 Bacteria 4195
1056 Ga0495619_0054518 3300053085 Bacteria 2646
1057 Ga0495619_0106148 3300053085 Bacteria 1915
1058 Ga0495619_0128604 3300053085 Bacteria 1740
1059 Ga0500651_0102011 3300053093 Bacteria 1758
1060 Ga0500651_0185374 3300053093 Bacteria 1234
1061 Ga0500566_0001625 3300053094 Bacteria 13231
1062 Ga0500566_0013519 3300053094 Bacteria 4804
1063 Ga0500566_0107849 3300053094 Bacteria 1518
1064 Ga0500641_0098123 3300053096 Bacteria 1255
1065 Ga0500648_043289 3300053097 Bacteria 2556
1066 Ga0500594_0071074 3300053118 Bacteria 1023
1067 Ga0500595_000010 3300053119 Bacteria 275806
1068 Ga0500595_000095 3300053119 Bacteria 61248
1069 Ga0500595_003699 3300053119 Bacteria 7057
1070 Ga0500595_018815 3300053119 Bacteria 2518
1071 Ga0500642_0017123 3300053130 Bacteria 2771
1072 Ga0500658_0024140 3300053134 Bacteria 2327
1073 Ga0500559_0047011 3300053136 Bacteria 1894
1074 Ga0500573_0175702 3300053140 Bacteria 1155
1075 Ga0500622_0054551 3300053156 Bacteria 2050
1076 Ga0500627_0125752 3300053158 Bacteria 1157
1077 Ga0500634_0069625 3300053161 Bacteria 1844
1078 Ga0500638_006677 3300053162 Bacteria 4750
1079 Ga0500636_0014540 3300053177 Bacteria 4629
1080 Ga0500637_0000495 3300053178 Bacteria 15245
1081 Ga0500596_004825 3300053735 Bacteria 2437
1082 Ga0501082_0192337 3300060353 Bacteria 1775
1083 Ga0530510_0058804 3300061734 Bacteria 2780
1084 Ga0530510_0113785 3300061734 Bacteria 1983
1085 Ga0530510_0192984 3300061734 Bacteria 1512

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025935 Ga0207709_10262109 Ga0207709_102621092 276
2 3300038443 Ga0395901_0784501 Ga0395901_0784501_12_908 298
3 3300046660 Ga0495625_0082150 Ga0495625_0082150_14_910 298
4 3300046663 Ga0495635_0322937 Ga0495635_0322937_124_1020 298
5 3300048914 Ga0496111_0057681 Ga0496111_0057681_1898_2794 298
6 3300048919 Ga0496116_0227024 Ga0496116_0227024_10_906 298
7 3300053119 Ga0500595_018815 Ga0500595_018815_1597_2493 298
8 3300053156 Ga0500622_0054551 Ga0500622_0054551_17_913 298
9 3300005293 Ga0065715_10137549 Ga0065715_101375493 315
10 3300005328 Ga0070676_10024678 Ga0070676_100246782 316
11 3300005364 Ga0070673_100262418 Ga0070673_1002624181 316
12 3300006358 Ga0068871_100073854 Ga0068871_1000738543 316
13 3300006881 Ga0068865_100103441 Ga0068865_1001034411 316
14 3300014326 Ga0157380_10100720 Ga0157380_101007203 316
15 3300025907 Ga0207645_10070342 Ga0207645_100703423 316
16 3300025940 Ga0207691_10019716 Ga0207691_100197165 316
17 3300046539 Ga0495621_0023115 Ga0495621_0023115_494_1552 316
18 3300048929 Ga0496126_0047915 Ga0496126_0047915_938_1999 317
19 3300005290 Ga0065712_10113471 Ga0065712_101134712 319
20 3300005331 Ga0070670_100086754 Ga0070670_1000867544 319
21 3300005333 Ga0070677_10028755 Ga0070677_100287552 319
22 3300005355 Ga0070671_100202708 Ga0070671_1002027083 319
23 3300005365 Ga0070688_100097415 Ga0070688_1000974152 319
24 3300005456 Ga0070678_100061286 Ga0070678_1000612864 319
25 3300005459 Ga0068867_100031810 Ga0068867_1000318104 319
26 3300013297 Ga0157378_10254793 Ga0157378_102547931 319
27 3300013308 Ga0157375_10246096 Ga0157375_102460962 319
28 3300025893 Ga0207682_10001519 Ga0207682_100015199 319
29 3300025942 Ga0207689_10320271 Ga0207689_103202712 319
30 3300026089 Ga0207648_10031836 Ga0207648_100318365 319
31 3300026121 Ga0207683_10042796 Ga0207683_100427965 319
32 3300046615 Ga0495656_0035929 Ga0495656_0035929_454_1512 319
33 3300046684 Ga0495669_0083675 Ga0495669_0083675_285_1343 319
34 3300048090 Ga0495615_0012724 Ga0495615_0012724_264_1322 319
35 3300046679 Ga0495623_0127033 Ga0495623_0127033_550_1515 320
36 3300047471 Ga0495684_0281626 Ga0495684_0281626_215_1180 320
37 3300048922 Ga0496119_0055304 Ga0496119_0055304_1233_2324 320
38 3300053118 Ga0500594_0071074 Ga0500594_0071074_34_996 320
39 3300003659 JGI25404J52841_10015339 JGI25404J52841_100153392 326
40 3300005983 Ga0081540_1000102 Ga0081540_100010225 326
41 3300005356 Ga0070674_100074811 Ga0070674_1000748111 327
42 3300046664 Ga0495659_0033686 Ga0495659_0033686_171_1268 327
43 3300050509 nmdc:mga0qj67_4314_c1 nmdc:mga0qj67_4314_c1_6507_7604 328
44 3300060353 Ga0501082_0192337 Ga0501082_0192337_144_1217 328
45 3300061734 Ga0530510_0192984 Ga0530510_0192984_137_1210 328
46 3300006844 Ga0075428_100020912 Ga0075428_1000209124 329
47 3300006846 Ga0075430_100012924 Ga0075430_1000129246 329
48 3300006847 Ga0075431_100032904 Ga0075431_1000329044 329
49 3300006880 Ga0075429_100030873 Ga0075429_1000308733 329
50 3300009147 Ga0114129_10097181 Ga0114129_100971813 329
51 3300046615 Ga0495656_0016994 Ga0495656_0016994_252_1319 329
52 3300046615 Ga0495656_0091561 Ga0495656_0091561_15_1112 329
53 3300050510 nmdc:mga06r32_12515_c1 nmdc:mga06r32_12515_c1_3755_4852 329
54 3300061734 Ga0530510_0113785 Ga0530510_0113785_838_1959 329
55 3300025315 Ga0207697_10055588 Ga0207697_100555881 330
56 3300009094 Ga0111539_10150346 Ga0111539_101503462 332
57 3300009101 Ga0105247_10048427 Ga0105247_100484272 332
58 3300048907 Ga0496104_0000351 Ga0496104_0000351_12109_13173 332
59 3300048908 Ga0496105_0037048 Ga0496105_0037048_1061_2125 332
60 3300048916 Ga0496113_0071978 Ga0496113_0071978_933_1997 332
61 3300048918 Ga0496115_0050174 Ga0496115_0050174_1031_2095 332
62 3300049573 Ga0501037_0025075 Ga0501037_0025075_1363_2442 332
63 3300049741 Ga0501079_0033083 Ga0501079_0033083_1957_3036 332
64 3300050490 nmdc:mga03n38_150788_c1 nmdc:mga03n38_150788_c1_138_1139 332
65 3300050511 nmdc:mga08y16_252107_c1 nmdc:mga08y16_252107_c1_79_1128 332
66 3300046538 Ga0495609_0090437 Ga0495609_0090437_29_1030 333
67 3300049572 Ga0501036_0003984 Ga0501036_0003984_3815_4897 333
68 3300049573 Ga0501037_0040497 Ga0501037_0040497_577_1659 333
69 3300049581 Ga0501047_0000100 Ga0501047_0000100_47008_48090 333
70 3300049582 Ga0501048_0000083 Ga0501048_0000083_45981_47063 333
71 3300049586 Ga0501070_0009792 Ga0501070_0009792_3440_4522 333
72 3300049588 Ga0501072_0003943 Ga0501072_0003943_5795_6856 333
73 3300049590 Ga0501074_0017935 Ga0501074_0017935_2158_3240 333
74 3300049742 Ga0501080_0000030 Ga0501080_0000030_40548_41630 333
75 3300049744 Ga0501083_0002641 Ga0501083_0002641_5226_6308 333
76 3300049823 Ga0501044_0000587 Ga0501044_0000587_21707_22789 333
77 3300050492 nmdc:mga0yw44_104257_c1 nmdc:mga0yw44_104257_c1_11_1012 333
78 3300032002 Ga0307416_100063443 Ga0307416_1000634432 334
79 3300035170 Ga0373943_0162967 Ga0373943_0162967_124_1182 334
80 3300035172 Ga0373955_0011740 Ga0373955_0011740_15_1073 334
81 3300035725 Ga0373947_0088961 Ga0373947_0088961_285_1343 334
82 3300036401 Ga0373937_0002947 Ga0373937_0002947_7051_8109 334
83 3300037068 Ga0373925_0008452 Ga0373925_0008452_3818_4876 334
84 3300046454 Ga0495592_0005759 Ga0495592_0005759_4638_5696 334
85 3300046463 Ga0495653_0160841 Ga0495653_0160841_252_1310 334
86 3300046477 Ga0495664_0029806 Ga0495664_0029806_1685_2743 334
87 3300046511 Ga0495608_0011568 Ga0495608_0011568_3223_4281 334
88 3300046516 Ga0495628_0002572 Ga0495628_0002572_8736_9794 334
89 3300046529 Ga0495652_0002428 Ga0495652_0002428_5722_6780 334
90 3300046543 Ga0495645_0001788 Ga0495645_0001788_9586_10644 334
91 3300046675 Ga0495657_0009336 Ga0495657_0009336_4130_5188 334
92 3300047317 Ga0495604_0002822 Ga0495604_0002822_8051_9109 334
93 3300048088 Ga0495602_0040996 Ga0495602_0040996_2909_3967 334
94 3300053077 Ga0495601_0000668 Ga0495601_0000668_10615_11673 334
95 3300053078 Ga0495612_0008871 Ga0495612_0008871_2780_3838 334
96 3300053084 Ga0495595_0000516 Ga0495595_0000516_13482_14540 334
97 3300053085 Ga0495619_0054518 Ga0495619_0054518_569_1627 334
98 3300005290 Ga0065712_10135995 Ga0065712_101359951 335
99 3300005330 Ga0070690_100171286 Ga0070690_1001712862 335
100 3300005367 Ga0070667_100122297 Ga0070667_1001222972 335
101 3300046460 Ga0495638_0011077 Ga0495638_0011077_396_1448 335
102 3300046679 Ga0495623_0007229 Ga0495623_0007229_6003_7139 335
103 3300053094 Ga0500566_0013519 Ga0500566_0013519_3778_4788 335
104 3300002239 JGI24034J26672_10000462 JGI24034J26672_100004623 336
105 3300005328 Ga0070676_10006058 Ga0070676_100060582 336
106 3300005331 Ga0070670_100006794 Ga0070670_1000067942 336
107 3300005333 Ga0070677_10000406 Ga0070677_100004062 336
108 3300005334 Ga0068869_100000653 Ga0068869_10000065314 336
109 3300005337 Ga0070682_100005253 Ga0070682_1000052532 336
110 3300005343 Ga0070687_100000387 Ga0070687_1000003874 336
111 3300005438 Ga0070701_10002820 Ga0070701_100028202 336
112 3300005457 Ga0070662_100009816 Ga0070662_1000098162 336
113 3300005535 Ga0070684_100004467 Ga0070684_1000044672 336
114 3300005615 Ga0070702_100003283 Ga0070702_1000032832 336
115 3300006871 Ga0075434_100001174 Ga0075434_10000117420 336
116 3300009011 Ga0105251_10077573 Ga0105251_100775732 336
117 3300009094 Ga0111539_10014415 Ga0111539_100144152 336
118 3300009098 Ga0105245_10000380 Ga0105245_100003802 336
119 3300009101 Ga0105247_10001411 Ga0105247_100014112 336
120 3300009148 Ga0105243_10008080 Ga0105243_100080802 336
121 3300009174 Ga0105241_10027743 Ga0105241_100277432 336
122 3300009176 Ga0105242_10000350 Ga0105242_1000035019 336
123 3300009177 Ga0105248_10015595 Ga0105248_100155956 336
124 3300009545 Ga0105237_10182842 Ga0105237_101828422 336
125 3300009553 Ga0105249_10007137 Ga0105249_100071372 336
126 3300010375 Ga0105239_10114074 Ga0105239_101140742 336
127 3300011119 Ga0105246_10002609 Ga0105246_100026092 336
128 3300013100 Ga0157373_10045507 Ga0157373_100455072 336
129 3300013102 Ga0157371_10135704 Ga0157371_101357042 336
130 3300013105 Ga0157369_10174759 Ga0157369_101747592 336
131 3300013296 Ga0157374_10053103 Ga0157374_100531032 336
132 3300013297 Ga0157378_10043205 Ga0157378_100432052 336
133 3300013306 Ga0163162_10010530 Ga0163162_100105306 336
134 3300013307 Ga0157372_10009499 Ga0157372_100094994 336
135 3300013308 Ga0157375_10002791 Ga0157375_1000279114 336
136 3300014325 Ga0163163_10170037 Ga0163163_101700372 336
137 3300014326 Ga0157380_10009701 Ga0157380_100097015 336
138 3300014745 Ga0157377_10000341 Ga0157377_1000034119 336
139 3300014969 Ga0157376_10000663 Ga0157376_100006639 336
140 3300017792 Ga0163161_10000379 Ga0163161_1000037937 336
141 3300025901 Ga0207688_10000083 Ga0207688_100000832 336
142 3300025908 Ga0207643_10000128 Ga0207643_1000012813 336
143 3300025914 Ga0207671_10156329 Ga0207671_101563292 336
144 3300025919 Ga0207657_10020169 Ga0207657_100201695 336
145 3300025923 Ga0207681_10006781 Ga0207681_100067812 336
146 3300025925 Ga0207650_10008902 Ga0207650_100089022 336
147 3300025933 Ga0207706_10001616 Ga0207706_1000161621 336
148 3300025940 Ga0207691_10000599 Ga0207691_100005992 336
149 3300025945 Ga0207679_10000112 Ga0207679_1000011220 336
150 3300025949 Ga0207667_10025956 Ga0207667_100259565 336
151 3300025960 Ga0207651_10000099 Ga0207651_1000009939 336
152 3300026116 Ga0207674_10035721 Ga0207674_100357213 336
153 3300027876 Ga0209974_10032320 Ga0209974_100323202 336
154 3300034819 Ga0373958_0010245 Ga0373958_0010245_350_1360 336
155 3300034820 Ga0373959_0002918 Ga0373959_0002918_1485_2495 336
156 3300035092 Ga0373952_0000859 Ga0373952_0000859_2264_3274 336
157 3300035115 Ga0373941_0005534 Ga0373941_0005534_904_1914 336
158 3300035121 Ga0373960_0000398 Ga0373960_0000398_3897_4907 336
159 3300035242 Ga0373962_0003525 Ga0373962_0003525_2351_3361 336
160 3300035691 Ga0373931_0001718 Ga0373931_0001718_1204_2214 336
161 3300046491 Ga0495584_0120905 Ga0495584_0120905_303_1313 336
162 3300048903 Ga0496100_0015511 Ga0496100_0015511_1805_2815 336
163 3300048904 Ga0496101_0000235 Ga0496101_0000235_24991_26001 336
164 3300048905 Ga0496102_0022951 Ga0496102_0022951_2001_3011 336
165 3300048906 Ga0496103_0003790 Ga0496103_0003790_3163_4173 336
166 3300048909 Ga0496106_0002108 Ga0496106_0002108_880_1890 336
167 3300048910 Ga0496107_0111973 Ga0496107_0111973_905_1915 336
168 3300048912 Ga0496109_0005654 Ga0496109_0005654_2349_3359 336
169 3300048916 Ga0496113_0035587 Ga0496113_0035587_379_1389 336
170 3300048917 Ga0496114_0112239 Ga0496114_0112239_554_1564 336
171 3300048918 Ga0496115_0002701 Ga0496115_0002701_4189_5199 336
172 3300050494 nmdc:mga06z11_4911_c1 nmdc:mga06z11_4911_c1_3013_4023 336
173 3300050511 nmdc:mga08y16_6190_c1 nmdc:mga08y16_6190_c1_169_1179 336
174 3300050515 nmdc:mga0a205_17989_c1 nmdc:mga0a205_17989_c1_360_1370 336
175 3300005328 Ga0070676_10088731 Ga0070676_100887312 337
176 3300005333 Ga0070677_10002338 Ga0070677_100023382 337
177 3300005354 Ga0070675_100125571 Ga0070675_1001255712 337
178 3300005356 Ga0070674_100001918 Ga0070674_1000019186 337
179 3300005365 Ga0070688_100154625 Ga0070688_1001546252 337
180 3300005456 Ga0070678_100031777 Ga0070678_1000317773 337
181 3300005458 Ga0070681_10325796 Ga0070681_103257961 337
182 3300005459 Ga0068867_100050648 Ga0068867_1000506482 337
183 3300005530 Ga0070679_100210850 Ga0070679_1002108502 337
184 3300005543 Ga0070672_100005379 Ga0070672_1000053795 337
185 3300013308 Ga0157375_10113058 Ga0157375_101130582 337
186 3300014326 Ga0157380_10131344 Ga0157380_101313442 337
187 3300025893 Ga0207682_10001931 Ga0207682_100019314 337
188 3300025921 Ga0207652_10013947 Ga0207652_100139472 337
189 3300025923 Ga0207681_10188193 Ga0207681_101881932 337
190 3300025926 Ga0207659_10050993 Ga0207659_100509932 337
191 3300025937 Ga0207669_10002598 Ga0207669_100025986 337
192 3300025940 Ga0207691_10002935 Ga0207691_100029356 337
193 3300025972 Ga0207668_10226629 Ga0207668_102266291 337
194 3300026089 Ga0207648_10007480 Ga0207648_100074802 337
195 3300026121 Ga0207683_10001853 Ga0207683_100018537 337
196 3300035115 Ga0373941_0000494 Ga0373941_0000494_2338_3417 337
197 3300039437 Ga0436365_0702073 Ga0436365_0702073_286_1335 337
198 3300046492 Ga0495585_0038601 Ga0495585_0038601_11_1030 337
199 3300048090 Ga0495615_0000368 Ga0495615_0000368_5638_6660 337
200 3300049574 Ga0501038_0040262 Ga0501038_0040262_875_1954 337
201 3300049582 Ga0501048_0098144 Ga0501048_0098144_11_1090 337
202 3300049584 Ga0501068_0041556 Ga0501068_0041556_764_1843 337
203 3300049586 Ga0501070_0152053 Ga0501070_0152053_316_1395 337
204 3300049588 Ga0501072_0218576 Ga0501072_0218576_133_1212 337
205 3300049590 Ga0501074_0040074 Ga0501074_0040074_1733_2812 337
206 3300049742 Ga0501080_0290083 Ga0501080_0290083_405_1472 337
207 3300049744 Ga0501083_0194828 Ga0501083_0194828_22_1071 337
208 3300049822 Ga0501035_0023582 Ga0501035_0023582_2399_3478 337
209 3300049822 Ga0501035_0438882 Ga0501035_0438882_37_1059 337
210 3300053119 Ga0500595_000010 Ga0500595_000010_30858_32030 337
211 3300005468 Ga0070707_100099390 Ga0070707_1000993902 339
212 3300025912 Ga0207707_10345496 Ga0207707_103454962 339
213 3300025922 Ga0207646_10220450 Ga0207646_102204501 339
214 3300006038 Ga0075365_10018199 Ga0075365_100181993 340
215 3300036401 Ga0373937_0017774 Ga0373937_0017774_4252_5328 340
216 3300046462 Ga0495651_0260327 Ga0495651_0260327_31_1107 340
217 3300046663 Ga0495635_0027056 Ga0495635_0027056_2151_3227 340
218 3300047673 Ga0495593_0016723 Ga0495593_0016723_2987_4063 340
219 3300053077 Ga0495601_0005956 Ga0495601_0005956_1671_2747 340
220 3300053078 Ga0495612_0006791 Ga0495612_0006791_1162_2238 340
221 3300005548 Ga0070665_100350418 Ga0070665_1003504182 341
222 3300005563 Ga0068855_100235299 Ga0068855_1002352992 341
223 3300025924 Ga0207694_10032282 Ga0207694_100322823 341
224 3300025949 Ga0207667_10214557 Ga0207667_102145572 341
225 3300028379 Ga0268266_10318353 Ga0268266_103183532 341
226 3300048904 Ga0496101_0195594 Ga0496101_0195594_23_1054 341
227 3300053078 Ga0495612_0019920 Ga0495612_0019920_76_1143 341
228 3300005331 Ga0070670_100046472 Ga0070670_1000464722 342
229 3300005577 Ga0068857_100069181 Ga0068857_1000691812 342
230 3300005617 Ga0068859_100038170 Ga0068859_1000381703 342
231 3300005841 Ga0068863_100107159 Ga0068863_1001071592 342
232 3300006931 Ga0097620_100038166 Ga0097620_1000381663 342
233 3300009098 Ga0105245_10070201 Ga0105245_100702012 342
234 3300014325 Ga0163163_10054275 Ga0163163_100542752 342
235 3300025908 Ga0207643_10038664 Ga0207643_100386642 342
236 3300025925 Ga0207650_10123258 Ga0207650_101232582 342
237 3300025942 Ga0207689_10054251 Ga0207689_100542512 342
238 3300026041 Ga0207639_10269595 Ga0207639_102695951 342
239 3300026116 Ga0207674_10082755 Ga0207674_100827553 342
240 3300036401 Ga0373937_0005103 Ga0373937_0005103_2721_3776 342
241 3300037853 Ga0436364_1064018 Ga0436364_1064018_645_1709 342
242 3300013296 Ga0157374_10099654 Ga0157374_100996542 343
243 3300014326 Ga0157380_10145235 Ga0157380_101452352 343
244 3300025942 Ga0207689_10266925 Ga0207689_102669251 343
245 3300047320 Ga0495672_0106579 Ga0495672_0106579_396_1484 343
246 3300053097 Ga0500648_043289 Ga0500648_043289_35_1069 343
247 3300005290 Ga0065712_10029709 Ga0065712_100297091 344
248 3300005293 Ga0065715_10037919 Ga0065715_100379191 344
249 3300005333 Ga0070677_10037432 Ga0070677_100374321 344
250 3300005356 Ga0070674_100374632 Ga0070674_1003746321 344
251 3300005457 Ga0070662_100178517 Ga0070662_1001785171 344
252 3300005466 Ga0070685_10246411 Ga0070685_102464111 344
253 3300005539 Ga0068853_100330674 Ga0068853_1003306741 344
254 3300005617 Ga0068859_100276898 Ga0068859_1002768982 344
255 3300005618 Ga0068864_100099414 Ga0068864_1000994141 344
256 3300006028 Ga0070717_10013303 Ga0070717_100133033 344
257 3300006931 Ga0097620_100276897 Ga0097620_1002768972 344
258 3300009101 Ga0105247_10016700 Ga0105247_100167003 344
259 3300025901 Ga0207688_10004971 Ga0207688_100049716 344
260 3300025935 Ga0207709_10026097 Ga0207709_100260972 344
261 3300025937 Ga0207669_10290147 Ga0207669_102901471 344
262 3300026075 Ga0207708_10397502 Ga0207708_103975021 344
263 3300026116 Ga0207674_10020449 Ga0207674_100204496 344
264 3300046543 Ga0495645_0094722 Ga0495645_0094722_99_1166 344
265 3300061734 Ga0530510_0058804 Ga0530510_0058804_1309_2373 344
266 3300041408 Ga0439453_0000060 Ga0439453_0000060_4742_5791 346
267 3300042436 Ga0439435_0002105 Ga0439435_0002105_34_1083 346
268 3300045976 Ga0466967_0122303 Ga0466967_0122303_709_1776 346
269 3300005439 Ga0070711_100221046 Ga0070711_1002210462 347
270 3300006186 Ga0075369_10026031 Ga0075369_100260312 347
271 3300025916 Ga0207663_10027621 Ga0207663_100276213 347
272 3300031241 Ga0265325_10075637 Ga0265325_100756371 347
273 3300031242 Ga0265329_10012070 Ga0265329_100120702 347
274 3300031247 Ga0265340_10014381 Ga0265340_100143812 347
275 3300031250 Ga0265331_10034717 Ga0265331_100347172 347
276 3300031344 Ga0265316_10221091 Ga0265316_102210911 347
277 3300031712 Ga0265342_10102272 Ga0265342_101022722 347
278 3300046474 Ga0495605_0126410 Ga0495605_0126410_62_1111 347
279 iso_pu_bacteria 2513237096 2513661634 347
280 iso_pu_bacteria 2513237137 2513863107 347
281 iso_pu_bacteria 2513237145 2513923311 347
282 iso_pu_bacteria 2517572143 2517889126 347
283 iso_pu_bacteria 2524023228 2524541222 347
284 iso_pu_bacteria 2667528175 2671121588 347
285 iso_pu_bacteria 2728368998 2728753705 347
286 iso_pu_bacteria 2791355197 2793072628 347
287 iso_pu_bacteria 2885374607 2885382864 347
288 iso_pu_bacteria 2903748898 2903756127 347
289 iso_pu_bacteria 2904690495 2904690931 347
290 iso_pu_bacteria 2904699407 2904708248 347
291 iso_pu_bacteria 2906610324 2906613483 347
292 iso_pu_bacteria 2906635258 2906643032 347
293 iso_pu_bacteria 2906660503 2906668201 347
294 iso_pu_bacteria 2908739725 2908747738 347
295 iso_pu_bacteria 2908756301 2908756987 347
296 iso_pu_bacteria 2922425934 2922433921 347
297 iso_pu_bacteria 2935630451 2935634942 347
298 iso_pu_bacteria 2941507105 2941514270 347
299 iso_pu_bacteria 2941515067 2941522231 347
300 iso_pu_bacteria 2941523033 2941530102 347
301 iso_pu_bacteria 3005474847 3005475361 347
302 iso_pu_bacteria 8006933436 8006935923 347
303 iso_pu_bacteria 8006973647 8006975961 347
304 iso_pu_bacteria 8019555841 8019562749 347
305 iso_pu_bacteria 8019565922 8019572828 347
306 3300007265 Ga0099794_10015687 Ga0099794_100156872 348
307 3300025939 Ga0207665_10092666 Ga0207665_100926662 348
308 3300046462 Ga0495651_0195766 Ga0495651_0195766_216_1280 348
309 3300046474 Ga0495605_0058205 Ga0495605_0058205_41_1096 348
310 iso_pu_bacteria 2876808645 2876818203 348
311 iso_pu_bacteria 2879110137 2879115151 348
312 iso_pu_bacteria 2922386360 2922388792 348
313 3300025918 Ga0207662_10231736 Ga0207662_102317361 349
314 3300025927 Ga0207687_10150080 Ga0207687_101500802 349
315 3300025935 Ga0207709_10248435 Ga0207709_102484351 349
316 3300025941 Ga0207711_10235281 Ga0207711_102352811 349
317 3300026075 Ga0207708_10148868 Ga0207708_101488682 349
318 3300037068 Ga0373925_0052361 Ga0373925_0052361_1342_2400 349
319 3300046492 Ga0495585_0004431 Ga0495585_0004431_3923_5149 349
320 3300046507 Ga0495606_0001566 Ga0495606_0001566_17556_18617 349
321 3300048915 Ga0496112_0000018 Ga0496112_0000018_184017_185078 349
322 3300053085 Ga0495619_0128604 Ga0495619_0128604_70_1128 349
323 3300003203 JGI25406J46586_10000028 JGI25406J46586_1000002832 350
324 3300005329 Ga0070683_100067592 Ga0070683_1000675923 350
325 3300005330 Ga0070690_100063572 Ga0070690_1000635722 350
326 3300005333 Ga0070677_10036854 Ga0070677_100368542 350
327 3300005338 Ga0068868_100010958 Ga0068868_1000109584 350
328 3300005339 Ga0070660_100214228 Ga0070660_1002142282 350
329 3300005340 Ga0070689_100010029 Ga0070689_1000100293 350
330 3300005347 Ga0070668_100093673 Ga0070668_1000936732 350
331 3300005355 Ga0070671_100172306 Ga0070671_1001723061 350
332 3300005365 Ga0070688_100054495 Ga0070688_1000544952 350
333 3300005367 Ga0070667_100327348 Ga0070667_1003273482 350
334 3300005455 Ga0070663_100025326 Ga0070663_1000253264 350
335 3300005456 Ga0070678_100028582 Ga0070678_1000285823 350
336 3300005456 Ga0070678_100056209 Ga0070678_1000562092 350
337 3300005457 Ga0070662_100012878 Ga0070662_1000128784 350
338 3300005535 Ga0070684_100171967 Ga0070684_1001719672 350
339 3300005539 Ga0068853_100175699 Ga0068853_1001756992 350
340 3300005617 Ga0068859_100122021 Ga0068859_1001220212 350
341 3300005618 Ga0068864_100087223 Ga0068864_1000872232 350
342 3300005618 Ga0068864_100195682 Ga0068864_1001956822 350
343 3300005718 Ga0068866_10096173 Ga0068866_100961732 350
344 3300005841 Ga0068863_100120246 Ga0068863_1001202462 350
345 3300005843 Ga0068860_100276217 Ga0068860_1002762172 350
346 3300005843 Ga0068860_100304064 Ga0068860_1003040642 350
347 3300005985 Ga0081539_10000048 Ga0081539_10000048183 350
348 3300006178 Ga0075367_10048843 Ga0075367_100488431 350
349 3300006195 Ga0075366_10002375 Ga0075366_100023757 350
350 3300006237 Ga0097621_100034122 Ga0097621_1000341224 350
351 3300006358 Ga0068871_100195067 Ga0068871_1001950672 350
352 3300006931 Ga0097620_100122027 Ga0097620_1001220272 350
353 3300009098 Ga0105245_10060762 Ga0105245_100607623 350
354 3300009148 Ga0105243_10230951 Ga0105243_102309512 350
355 3300009176 Ga0105242_10131844 Ga0105242_101318442 350
356 3300009177 Ga0105248_10019063 Ga0105248_100190633 350
357 3300011119 Ga0105246_10148574 Ga0105246_101485743 350
358 3300013296 Ga0157374_10065956 Ga0157374_100659563 350
359 3300013306 Ga0163162_10420014 Ga0163162_104200141 350
360 3300013308 Ga0157375_10022203 Ga0157375_100222035 350
361 3300014325 Ga0163163_10016636 Ga0163163_100166363 350
362 3300014325 Ga0163163_10043798 Ga0163163_100437982 350
363 3300014325 Ga0163163_10166611 Ga0163163_101666112 350
364 3300014969 Ga0157376_10040464 Ga0157376_100404643 350
365 3300025910 Ga0207684_10204578 Ga0207684_102045782 350
366 3300025931 Ga0207644_10075011 Ga0207644_100750113 350
367 3300025933 Ga0207706_10015033 Ga0207706_100150333 350
368 3300025936 Ga0207670_10007366 Ga0207670_100073663 350
369 3300025940 Ga0207691_10023830 Ga0207691_100238305 350
370 3300025941 Ga0207711_10010676 Ga0207711_100106766 350
371 3300025972 Ga0207668_10110071 Ga0207668_101100712 350
372 3300025986 Ga0207658_10276669 Ga0207658_102766692 350
373 3300026067 Ga0207678_10056323 Ga0207678_100563233 350
374 3300026095 Ga0207676_10014703 Ga0207676_100147035 350
375 3300026095 Ga0207676_10123689 Ga0207676_101236893 350
376 3300026121 Ga0207683_10014162 Ga0207683_100141625 350
377 3300026121 Ga0207683_10015318 Ga0207683_100153183 350
378 3300026142 Ga0207698_10063441 Ga0207698_100634411 350
379 3300028379 Ga0268266_10055302 Ga0268266_100553023 350
380 3300028381 Ga0268264_10104967 Ga0268264_101049672 350
381 3300034957 Ga0373938_0015719 Ga0373938_0015719_369_1430 350
382 3300035084 Ga0373928_0022088 Ga0373928_0022088_38_1099 350
383 3300035115 Ga0373941_0007844 Ga0373941_0007844_704_1765 350
384 3300035121 Ga0373960_0040243 Ga0373960_0040243_128_1189 350
385 3300035242 Ga0373962_0022368 Ga0373962_0022368_600_1661 350
386 3300035691 Ga0373931_0014040 Ga0373931_0014040_2076_3137 350
387 3300035695 Ga0373927_0025352 Ga0373927_0025352_1460_2521 350
388 3300035725 Ga0373947_0035595 Ga0373947_0035595_1785_2846 350
389 3300046455 Ga0495603_0019964 Ga0495603_0019964_2035_3096 350
390 3300046516 Ga0495628_0314441 Ga0495628_0314441_81_1142 350
391 3300048089 Ga0495614_0010418 Ga0495614_0010418_37_1113 350
392 3300048903 Ga0496100_0072267 Ga0496100_0072267_715_1776 350
393 3300048903 Ga0496100_0249420 Ga0496100_0249420_198_1259 350
394 3300048903 Ga0496100_0279397 Ga0496100_0279397_77_1141 350
395 3300048904 Ga0496101_0008415 Ga0496101_0008415_1797_2858 350
396 3300048904 Ga0496101_0019223 Ga0496101_0019223_3196_4257 350
397 3300048905 Ga0496102_0028248 Ga0496102_0028248_299_1360 350
398 3300048905 Ga0496102_0155347 Ga0496102_0155347_411_1472 350
399 3300048907 Ga0496104_0008914 Ga0496104_0008914_5097_6158 350
400 3300048907 Ga0496104_0250055 Ga0496104_0250055_153_1214 350
401 3300048908 Ga0496105_0006427 Ga0496105_0006427_6088_7149 350
402 3300048908 Ga0496105_0012927 Ga0496105_0012927_1207_2268 350
403 3300048909 Ga0496106_0010763 Ga0496106_0010763_707_1768 350
404 3300048909 Ga0496106_0181176 Ga0496106_0181176_228_1289 350
405 3300048909 Ga0496106_0325966 Ga0496106_0325966_44_1105 350
406 3300048910 Ga0496107_0011301 Ga0496107_0011301_1124_2185 350
407 3300048911 Ga0496108_0016530 Ga0496108_0016530_3705_4766 350
408 3300048911 Ga0496108_0082807 Ga0496108_0082807_1581_2642 350
409 3300048912 Ga0496109_0040011 Ga0496109_0040011_2204_3265 350
410 3300048912 Ga0496109_0045566 Ga0496109_0045566_2569_3630 350
411 3300048913 Ga0496110_0039961 Ga0496110_0039961_838_1899 350
412 3300048914 Ga0496111_0009883 Ga0496111_0009883_5099_6160 350
413 3300048915 Ga0496112_0069569 Ga0496112_0069569_440_1501 350
414 3300048915 Ga0496112_0334061 Ga0496112_0334061_370_1431 350
415 3300048916 Ga0496113_0013732 Ga0496113_0013732_3048_4109 350
416 3300048917 Ga0496114_0009940 Ga0496114_0009940_619_1680 350
417 3300048917 Ga0496114_0066495 Ga0496114_0066495_235_1296 350
418 3300048918 Ga0496115_0010842 Ga0496115_0010842_5085_6146 350
419 3300048918 Ga0496115_0019196 Ga0496115_0019196_1667_2728 350
420 3300050493 nmdc:mga0k408_2505_c2 nmdc:mga0k408_2505_c2_3032_4093 350
421 3300050494 nmdc:mga06z11_34154_c1 nmdc:mga06z11_34154_c1_25_1086 350
422 3300005336 Ga0070680_100043949 Ga0070680_1000439492 351
423 3300005356 Ga0070674_100011258 Ga0070674_1000112584 351
424 3300005456 Ga0070678_100089587 Ga0070678_1000895872 351
425 3300005458 Ga0070681_10050414 Ga0070681_100504143 351
426 3300005458 Ga0070681_10220683 Ga0070681_102206832 351
427 3300005530 Ga0070679_100040768 Ga0070679_1000407682 351
428 3300005536 Ga0070697_100002564 Ga0070697_1000025644 351
429 3300005539 Ga0068853_100093456 Ga0068853_1000934562 351
430 3300005543 Ga0070672_100053092 Ga0070672_1000530922 351
431 3300005545 Ga0070695_100026443 Ga0070695_1000264431 351
432 3300005563 Ga0068855_100082241 Ga0068855_1000822411 351
433 3300005718 Ga0068866_10037249 Ga0068866_100372492 351
434 3300005937 Ga0081455_10003093 Ga0081455_1000309313 351
435 3300005937 Ga0081455_10011459 Ga0081455_100114592 351
436 3300005937 Ga0081455_10103105 Ga0081455_101031052 351
437 3300005937 Ga0081455_10158909 Ga0081455_101589092 351
438 3300005937 Ga0081455_10215824 Ga0081455_102158241 351
439 3300005983 Ga0081540_1001430 Ga0081540_10014307 351
440 3300005983 Ga0081540_1003755 Ga0081540_10037557 351
441 3300005983 Ga0081540_1009790 Ga0081540_10097902 351
442 3300005983 Ga0081540_1017229 Ga0081540_10172292 351
443 3300005983 Ga0081540_1063111 Ga0081540_10631112 351
444 3300005985 Ga0081539_10058707 Ga0081539_100587072 351
445 3300006028 Ga0070717_10059267 Ga0070717_100592671 351
446 3300006173 Ga0070716_100006717 Ga0070716_1000067171 351
447 3300006914 Ga0075436_100004698 Ga0075436_1000046987 351
448 3300007076 Ga0075435_100266357 Ga0075435_1002663572 351
449 3300013308 Ga0157375_10316399 Ga0157375_103163992 351
450 3300014326 Ga0157380_10270244 Ga0157380_102702442 351
451 3300014969 Ga0157376_10187083 Ga0157376_101870832 351
452 3300017792 Ga0163161_10264180 Ga0163161_102641802 351
453 3300025898 Ga0207692_10003295 Ga0207692_100032954 351
454 3300025905 Ga0207685_10000528 Ga0207685_100005283 351
455 3300025906 Ga0207699_10010546 Ga0207699_100105463 351
456 3300025908 Ga0207643_10140506 Ga0207643_101405062 351
457 3300025912 Ga0207707_10055634 Ga0207707_100556342 351
458 3300025915 Ga0207693_10003105 Ga0207693_100031058 351
459 3300025916 Ga0207663_10003674 Ga0207663_100036745 351
460 3300025917 Ga0207660_10044159 Ga0207660_100441592 351
461 3300025921 Ga0207652_10024211 Ga0207652_100242114 351
462 3300025928 Ga0207700_10025747 Ga0207700_100257471 351
463 3300025929 Ga0207664_10010948 Ga0207664_100109485 351
464 3300025939 Ga0207665_10001379 Ga0207665_100013794 351
465 3300026041 Ga0207639_10042404 Ga0207639_100424042 351
466 3300026121 Ga0207683_10011627 Ga0207683_100116274 351
467 3300033442 Ga0315911_1000008 Ga0315911_100000819 351
468 3300046475 Ga0495639_0034011 Ga0495639_0034011_534_1595 351
469 3300046477 Ga0495664_0018790 Ga0495664_0018790_1711_2775 351
470 3300046507 Ga0495606_0074530 Ga0495606_0074530_295_1356 351
471 3300046616 Ga0495668_0118180 Ga0495668_0118180_339_1400 351
472 3300048910 Ga0496107_0030116 Ga0496107_0030116_1205_2269 351
473 3300048921 Ga0496118_0078665 Ga0496118_0078665_1005_2066 351
474 3300048924 Ga0496121_0046507 Ga0496121_0046507_2474_3535 351
475 3300048924 Ga0496121_0188119 Ga0496121_0188119_101_1165 351
476 3300048929 Ga0496126_0068906 Ga0496126_0068906_369_1433 351
477 3300050493 nmdc:mga0k408_36277_c1 nmdc:mga0k408_36277_c1_1152_2219 351
478 3300050513 nmdc:mga0rr50_19557_c1 nmdc:mga0rr50_19557_c1_2104_3168 351
479 3300053077 Ga0495601_0018585 Ga0495601_0018585_2298_3362 351
480 3300053093 Ga0500651_0102011 Ga0500651_0102011_62_1123 351
481 3300053094 Ga0500566_0001625 Ga0500566_0001625_980_2044 351
482 3300053119 Ga0500595_000095 Ga0500595_000095_37221_38285 351
483 3300053130 Ga0500642_0017123 Ga0500642_0017123_1201_2262 351
484 3300053140 Ga0500573_0175702 Ga0500573_0175702_72_1136 351
485 3300053162 Ga0500638_006677 Ga0500638_006677_1259_2323 351
486 3300053177 Ga0500636_0014540 Ga0500636_0014540_2845_3906 351
487 3300053178 Ga0500637_0000495 Ga0500637_0000495_10592_11656 351
488 3300005328 Ga0070676_10131041 Ga0070676_101310412 352
489 3300005329 Ga0070683_100011738 Ga0070683_1000117384 352
490 3300005331 Ga0070670_100031028 Ga0070670_1000310282 352
491 3300005334 Ga0068869_100106003 Ga0068869_1001060032 352
492 3300005335 Ga0070666_10005529 Ga0070666_100055292 352
493 3300005336 Ga0070680_100069523 Ga0070680_1000695232 352
494 3300005336 Ga0070680_100073871 Ga0070680_1000738712 352
495 3300005338 Ga0068868_100097041 Ga0068868_1000970412 352
496 3300005338 Ga0068868_100114377 Ga0068868_1001143773 352
497 3300005356 Ga0070674_100358750 Ga0070674_1003587501 352
498 3300005364 Ga0070673_100122369 Ga0070673_1001223692 352
499 3300005367 Ga0070667_100139796 Ga0070667_1001397962 352
500 3300005434 Ga0070709_10006522 Ga0070709_100065221 352
501 3300005434 Ga0070709_10009430 Ga0070709_100094303 352
502 3300005435 Ga0070714_100141720 Ga0070714_1001417202 352
503 3300005435 Ga0070714_100175934 Ga0070714_1001759342 352
504 3300005436 Ga0070713_100020428 Ga0070713_1000204283 352
505 3300005437 Ga0070710_10091766 Ga0070710_100917662 352
506 3300005438 Ga0070701_10099733 Ga0070701_100997332 352
507 3300005439 Ga0070711_100035137 Ga0070711_1000351372 352
508 3300005440 Ga0070705_100158085 Ga0070705_1001580852 352
509 3300005455 Ga0070663_100093309 Ga0070663_1000933091 352
510 3300005456 Ga0070678_100139062 Ga0070678_1001390622 352
511 3300005457 Ga0070662_100176492 Ga0070662_1001764922 352
512 3300005458 Ga0070681_10015832 Ga0070681_100158322 352
513 3300005535 Ga0070684_100016286 Ga0070684_1000162862 352
514 3300005539 Ga0068853_100069092 Ga0068853_1000690923 352
515 3300005539 Ga0068853_100098738 Ga0068853_1000987382 352
516 3300005539 Ga0068853_100253732 Ga0068853_1002537321 352
517 3300005543 Ga0070672_100262842 Ga0070672_1002628422 352
518 3300005545 Ga0070695_100135344 Ga0070695_1001353441 352
519 3300005547 Ga0070693_100168400 Ga0070693_1001684002 352
520 3300005548 Ga0070665_100023550 Ga0070665_1000235506 352
521 3300005548 Ga0070665_100203213 Ga0070665_1002032132 352
522 3300005548 Ga0070665_100234436 Ga0070665_1002344362 352
523 3300005549 Ga0070704_100065568 Ga0070704_1000655682 352
524 3300005563 Ga0068855_100098486 Ga0068855_1000984863 352
525 3300005563 Ga0068855_100108293 Ga0068855_1001082933 352
526 3300005578 Ga0068854_100106576 Ga0068854_1001065762 352
527 3300005614 Ga0068856_100007430 Ga0068856_1000074306 352
528 3300005614 Ga0068856_100061086 Ga0068856_1000610862 352
529 3300005616 Ga0068852_100093916 Ga0068852_1000939162 352
530 3300005616 Ga0068852_100366140 Ga0068852_1003661402 352
531 3300005842 Ga0068858_100065499 Ga0068858_1000654992 352
532 3300005842 Ga0068858_100222549 Ga0068858_1002225492 352
533 3300005843 Ga0068860_100000577 Ga0068860_10000057719 352
534 3300005844 Ga0068862_100019155 Ga0068862_1000191554 352
535 3300005844 Ga0068862_100234364 Ga0068862_1002343642 352
536 3300005937 Ga0081455_10006033 Ga0081455_100060337 352
537 3300005937 Ga0081455_10053413 Ga0081455_100534132 352
538 3300005983 Ga0081540_1003410 Ga0081540_10034108 352
539 3300005983 Ga0081540_1014713 Ga0081540_10147133 352
540 3300005985 Ga0081539_10072824 Ga0081539_100728242 352
541 3300006028 Ga0070717_10010868 Ga0070717_100108682 352
542 3300006038 Ga0075365_10099182 Ga0075365_100991822 352
543 3300006048 Ga0075363_100008259 Ga0075363_1000082594 352
544 3300006048 Ga0075363_100023705 Ga0075363_1000237052 352
545 3300006058 Ga0075432_10000765 Ga0075432_100007653 352
546 3300006175 Ga0070712_100024348 Ga0070712_1000243483 352
547 3300006177 Ga0075362_10045225 Ga0075362_100452252 352
548 3300006178 Ga0075367_10045981 Ga0075367_100459812 352
549 3300006353 Ga0075370_10026132 Ga0075370_100261323 352
550 3300006358 Ga0068871_100027579 Ga0068871_1000275792 352
551 3300006358 Ga0068871_100292928 Ga0068871_1002929281 352
552 3300006844 Ga0075428_100131629 Ga0075428_1001316292 352
553 3300006844 Ga0075428_100135424 Ga0075428_1001354242 352
554 3300006846 Ga0075430_100000026 Ga0075430_10000002625 352
555 3300006846 Ga0075430_100000222 Ga0075430_10000022220 352
556 3300006847 Ga0075431_100000451 Ga0075431_1000004516 352
557 3300006847 Ga0075431_100032904 Ga0075431_1000329043 352
558 3300006852 Ga0075433_10002991 Ga0075433_100029913 352
559 3300006871 Ga0075434_100000110 Ga0075434_10000011010 352
560 3300006880 Ga0075429_100000247 Ga0075429_10000024710 352
561 3300006880 Ga0075429_100009429 Ga0075429_1000094296 352
562 3300006880 Ga0075429_100030873 Ga0075429_1000308732 352
563 3300006914 Ga0075436_100089836 Ga0075436_1000898362 352
564 3300007076 Ga0075435_100016201 Ga0075435_1000162016 352
565 3300007076 Ga0075435_100110089 Ga0075435_1001100891 352
566 3300009093 Ga0105240_10121284 Ga0105240_101212843 352
567 3300009094 Ga0111539_10000337 Ga0111539_1000033729 352
568 3300009098 Ga0105245_10111892 Ga0105245_101118922 352
569 3300009101 Ga0105247_10006423 Ga0105247_100064233 352
570 3300009101 Ga0105247_10062814 Ga0105247_100628142 352
571 3300009147 Ga0114129_10053822 Ga0114129_100538221 352
572 3300009147 Ga0114129_10229244 Ga0114129_102292442 352
573 3300009147 Ga0114129_10652340 Ga0114129_106523402 352
574 3300009174 Ga0105241_10159805 Ga0105241_101598052 352
575 3300009177 Ga0105248_10037197 Ga0105248_100371975 352
576 3300009177 Ga0105248_10080964 Ga0105248_100809642 352
577 3300009545 Ga0105237_10066040 Ga0105237_100660403 352
578 3300009545 Ga0105237_10173347 Ga0105237_101733472 352
579 3300009545 Ga0105237_10383751 Ga0105237_103837511 352
580 3300009553 Ga0105249_10122164 Ga0105249_101221641 352
581 3300010375 Ga0105239_10017528 Ga0105239_100175284 352
582 3300013104 Ga0157370_10322474 Ga0157370_103224741 352
583 3300013105 Ga0157369_10095876 Ga0157369_100958762 352
584 3300013296 Ga0157374_10054750 Ga0157374_100547502 352
585 3300013297 Ga0157378_10107630 Ga0157378_101076302 352
586 3300013306 Ga0163162_10095629 Ga0163162_100956292 352
587 3300013307 Ga0157372_10084860 Ga0157372_100848602 352
588 3300014745 Ga0157377_10059329 Ga0157377_100593292 352
589 3300014969 Ga0157376_10141002 Ga0157376_101410022 352
590 3300025297 Ga0209758_1002448 Ga0209758_100244814 352
591 3300025297 Ga0209758_1008580 Ga0209758_10085805 352
592 3300025900 Ga0207710_10008560 Ga0207710_100085606 352
593 3300025906 Ga0207699_10006599 Ga0207699_100065993 352
594 3300025906 Ga0207699_10045368 Ga0207699_100453682 352
595 3300025912 Ga0207707_10001534 Ga0207707_1000153414 352
596 3300025913 Ga0207695_10089205 Ga0207695_100892052 352
597 3300025913 Ga0207695_10247016 Ga0207695_102470162 352
598 3300025914 Ga0207671_10057611 Ga0207671_100576112 352
599 3300025914 Ga0207671_10073915 Ga0207671_100739152 352
600 3300025914 Ga0207671_10113763 Ga0207671_101137632 352
601 3300025915 Ga0207693_10117568 Ga0207693_101175681 352
602 3300025917 Ga0207660_10049075 Ga0207660_100490752 352
603 3300025921 Ga0207652_10027543 Ga0207652_100275434 352
604 3300025921 Ga0207652_10056338 Ga0207652_100563382 352
605 3300025927 Ga0207687_10062204 Ga0207687_100622042 352
606 3300025928 Ga0207700_10149321 Ga0207700_101493212 352
607 3300025934 Ga0207686_10056767 Ga0207686_100567671 352
608 3300025938 Ga0207704_10292194 Ga0207704_102921941 352
609 3300025940 Ga0207691_10173454 Ga0207691_101734542 352
610 3300025941 Ga0207711_10077904 Ga0207711_100779042 352
611 3300025942 Ga0207689_10126494 Ga0207689_101264942 352
612 3300025942 Ga0207689_10181700 Ga0207689_101817002 352
613 3300025944 Ga0207661_10011748 Ga0207661_100117483 352
614 3300025949 Ga0207667_10203956 Ga0207667_102039562 352
615 3300025949 Ga0207667_10313675 Ga0207667_103136752 352
616 3300025960 Ga0207651_10031165 Ga0207651_100311652 352
617 3300025972 Ga0207668_10113802 Ga0207668_101138022 352
618 3300025972 Ga0207668_10115342 Ga0207668_101153422 352
619 3300025972 Ga0207668_10126611 Ga0207668_101266112 352
620 3300025972 Ga0207668_10204806 Ga0207668_102048061 352
621 3300026023 Ga0207677_10010700 Ga0207677_100107007 352
622 3300026023 Ga0207677_10133847 Ga0207677_101338471 352
623 3300026023 Ga0207677_10174836 Ga0207677_101748362 352
624 3300026023 Ga0207677_10189017 Ga0207677_101890172 352
625 3300026035 Ga0207703_10025231 Ga0207703_100252311 352
626 3300026041 Ga0207639_10205900 Ga0207639_102059002 352
627 3300026041 Ga0207639_10208433 Ga0207639_102084332 352
628 3300026041 Ga0207639_10285271 Ga0207639_102852712 352
629 3300026067 Ga0207678_10007002 Ga0207678_100070025 352
630 3300026067 Ga0207678_10299181 Ga0207678_102991811 352
631 3300026078 Ga0207702_10142451 Ga0207702_101424512 352
632 3300026116 Ga0207674_10099104 Ga0207674_100991043 352
633 3300026116 Ga0207674_10102256 Ga0207674_101022562 352
634 3300026118 Ga0207675_100301176 Ga0207675_1003011762 352
635 3300026121 Ga0207683_10185536 Ga0207683_101855362 352
636 3300026121 Ga0207683_10194398 Ga0207683_101943982 352
637 3300026142 Ga0207698_10070195 Ga0207698_100701951 352
638 3300027866 Ga0209813_10016915 Ga0209813_100169152 352
639 3300027907 Ga0207428_10000140 Ga0207428_1000014078 352
640 3300028379 Ga0268266_10004422 Ga0268266_100044226 352
641 3300028379 Ga0268266_10007719 Ga0268266_100077199 352
642 3300028379 Ga0268266_10047939 Ga0268266_100479392 352
643 3300028379 Ga0268266_10110471 Ga0268266_101104712 352
644 3300028379 Ga0268266_10127814 Ga0268266_101278142 352
645 3300028379 Ga0268266_10195528 Ga0268266_101955282 352
646 3300028379 Ga0268266_10365962 Ga0268266_103659622 352
647 3300028379 Ga0268266_10418333 Ga0268266_104183331 352
648 3300028380 Ga0268265_10026351 Ga0268265_100263512 352
649 3300028380 Ga0268265_10113231 Ga0268265_101132312 352
650 3300028380 Ga0268265_10205865 Ga0268265_102058652 352
651 3300028381 Ga0268264_10000107 Ga0268264_10000107171 352
652 3300028381 Ga0268264_10086725 Ga0268264_100867252 352
653 3300028573 Ga0265334_10015125 Ga0265334_100151252 352
654 3300028794 Ga0307515_10060988 Ga0307515_100609882 352
655 3300031238 Ga0265332_10050236 Ga0265332_100502362 352
656 3300031239 Ga0265328_10058289 Ga0265328_100582892 352
657 3300031249 Ga0265339_10006887 Ga0265339_100068872 352
658 3300031456 Ga0307513_10077502 Ga0307513_100775022 352
659 3300031456 Ga0307513_10144650 Ga0307513_101446502 352
660 3300031507 Ga0307509_10021381 Ga0307509_100213813 352
661 3300031616 Ga0307508_10000154 Ga0307508_1000015444 352
662 3300031616 Ga0307508_10265459 Ga0307508_102654592 352
663 3300031711 Ga0265314_10005615 Ga0265314_100056155 352
664 3300031712 Ga0265342_10003968 Ga0265342_100039682 352
665 3300031712 Ga0265342_10017314 Ga0265342_100173143 352
666 3300031712 Ga0265342_10106101 Ga0265342_101061011 352
667 3300031730 Ga0307516_10029059 Ga0307516_100290592 352
668 3300031852 Ga0307410_10174005 Ga0307410_101740051 352
669 3300033180 Ga0307510_10156282 Ga0307510_101562822 352
670 3300034816 Ga0373930_0001231 Ga0373930_0001231_1086_2153 352
671 3300035086 Ga0373934_0023900 Ga0373934_0023900_509_1579 352
672 3300035088 Ga0373940_0004788 Ga0373940_0004788_637_1704 352
673 3300035111 Ga0373923_0040479 Ga0373923_0040479_333_1412 352
674 3300035111 Ga0373923_0119338 Ga0373923_0119338_61_1119 352
675 3300035113 Ga0373936_0006063 Ga0373936_0006063_3320_4387 352
676 3300035117 Ga0373953_0001092 Ga0373953_0001092_4563_5642 352
677 3300035117 Ga0373953_0019195 Ga0373953_0019195_258_1325 352
678 3300035118 Ga0373954_0001821 Ga0373954_0001821_933_2012 352
679 3300035119 Ga0373956_0002956 Ga0373956_0002956_481_1560 352
680 3300035120 Ga0373957_0000374 Ga0373957_0000374_9129_10208 352
681 3300035170 Ga0373943_0052716 Ga0373943_0052716_335_1402 352
682 3300035171 Ga0373946_0137298 Ga0373946_0137298_31_1089 352
683 3300035172 Ga0373955_0009267 Ga0373955_0009267_287_1366 352
684 3300035172 Ga0373955_0046015 Ga0373955_0046015_476_1546 352
685 3300035410 Ga0373924_0020683 Ga0373924_0020683_770_1837 352
686 3300035691 Ga0373931_0019150 Ga0373931_0019150_574_1641 352
687 3300035692 Ga0373935_0083521 Ga0373935_0083521_216_1286 352
688 3300035692 Ga0373935_0107474 Ga0373935_0107474_465_1532 352
689 3300035692 Ga0373935_0206185 Ga0373935_0206185_270_1337 352
690 3300035724 Ga0373933_0001100 Ga0373933_0001100_12471_13550 352
691 3300036401 Ga0373937_0064217 Ga0373937_0064217_1126_2190 352
692 3300036401 Ga0373937_0318829 Ga0373937_0318829_179_1249 352
693 3300037068 Ga0373925_0020271 Ga0373925_0020271_2370_3437 352
694 3300041486 Ga0451807_0668963 Ga0451807_0668963_155_1267 352
695 3300044842 Ga0466957_0033043 Ga0466957_0033043_1993_3060 352
696 3300045836 Ga0466958_0114579 Ga0466958_0114579_100_1167 352
697 3300046454 Ga0495592_0001601 Ga0495592_0001601_7879_8958 352
698 3300046455 Ga0495603_0022944 Ga0495603_0022944_1880_2947 352
699 3300046455 Ga0495603_0025589 Ga0495603_0025589_546_1613 352
700 3300046455 Ga0495603_0053963 Ga0495603_0053963_131_1210 352
701 3300046459 Ga0495629_0000529 Ga0495629_0000529_22859_23938 352
702 3300046459 Ga0495629_0059688 Ga0495629_0059688_1498_2565 352
703 3300046459 Ga0495629_0172112 Ga0495629_0172112_48_1106 352
704 3300046460 Ga0495638_0009159 Ga0495638_0009159_4216_5283 352
705 3300046462 Ga0495651_0001433 Ga0495651_0001433_1663_2742 352
706 3300046462 Ga0495651_0020115 Ga0495651_0020115_485_1552 352
707 3300046463 Ga0495653_0051871 Ga0495653_0051871_1335_2414 352
708 3300046463 Ga0495653_0089488 Ga0495653_0089488_306_1364 352
709 3300046463 Ga0495653_0090070 Ga0495653_0090070_86_1156 352
710 3300046473 Ga0495582_0006293 Ga0495582_0006293_3708_4775 352
711 3300046475 Ga0495639_0066427 Ga0495639_0066427_418_1485 352
712 3300046477 Ga0495664_0023312 Ga0495664_0023312_1845_2903 352
713 3300046492 Ga0495585_0031604 Ga0495585_0031604_1036_2103 352
714 3300046492 Ga0495585_0105382 Ga0495585_0105382_164_1231 352
715 3300046506 Ga0495583_0104207 Ga0495583_0104207_58_1125 352
716 3300046511 Ga0495608_0008113 Ga0495608_0008113_1739_2818 352
717 3300046511 Ga0495608_0098528 Ga0495608_0098528_128_1198 352
718 3300046514 Ga0495618_0048917 Ga0495618_0048917_466_1545 352
719 3300046516 Ga0495628_0007597 Ga0495628_0007597_4951_6030 352
720 3300046517 Ga0495630_0103006 Ga0495630_0103006_851_1909 352
721 3300046518 Ga0495631_0115442 Ga0495631_0115442_48_1115 352
722 3300046526 Ga0495666_0069319 Ga0495666_0069319_570_1637 352
723 3300046529 Ga0495652_0091823 Ga0495652_0091823_1175_2233 352
724 3300046529 Ga0495652_0115683 Ga0495652_0115683_464_1534 352
725 3300046531 Ga0495665_0005351 Ga0495665_0005351_1755_2816 352
726 3300046531 Ga0495665_0085638 Ga0495665_0085638_322_1389 352
727 3300046533 Ga0495640_0047337 Ga0495640_0047337_402_1469 352
728 3300046533 Ga0495640_0064294 Ga0495640_0064294_1146_2204 352
729 3300046536 Ga0495587_0052159 Ga0495587_0052159_1120_2190 352
730 3300046537 Ga0495598_0017520 Ga0495598_0017520_465_1532 352
731 3300046539 Ga0495621_0050206 Ga0495621_0050206_284_1351 352
732 3300046543 Ga0495645_0025716 Ga0495645_0025716_2551_3630 352
733 3300046543 Ga0495645_0028258 Ga0495645_0028258_288_1355 352
734 3300046543 Ga0495645_0038226 Ga0495645_0038226_2313_3371 352
735 3300046543 Ga0495645_0052493 Ga0495645_0052493_1819_2886 352
736 3300046559 Ga0495667_0003563 Ga0495667_0003563_3554_4633 352
737 3300046559 Ga0495667_0119452 Ga0495667_0119452_96_1166 352
738 3300046615 Ga0495656_0032549 Ga0495656_0032549_796_1863 352
739 3300046642 Ga0495634_0004321 Ga0495634_0004321_7912_8991 352
740 3300046663 Ga0495635_0000429 Ga0495635_0000429_23369_24448 352
741 3300046664 Ga0495659_0007040 Ga0495659_0007040_604_1671 352
742 3300046674 Ga0495588_0083701 Ga0495588_0083701_54_1121 352
743 3300046675 Ga0495657_0010262 Ga0495657_0010262_1535_2614 352
744 3300046678 Ga0495599_0003035 Ga0495599_0003035_385_1464 352
745 3300046679 Ga0495623_0007655 Ga0495623_0007655_1377_2456 352
746 3300046679 Ga0495623_0102314 Ga0495623_0102314_417_1484 352
747 3300046680 Ga0495646_0001304 Ga0495646_0001304_5580_6659 352
748 3300046680 Ga0495646_0043515 Ga0495646_0043515_935_2002 352
749 3300046684 Ga0495669_0077313 Ga0495669_0077313_347_1414 352
750 3300046689 Ga0495613_0219605 Ga0495613_0219605_228_1295 352
751 3300046690 Ga0495624_0040078 Ga0495624_0040078_1711_2769 352
752 3300046690 Ga0495624_0132083 Ga0495624_0132083_94_1161 352
753 3300046694 Ga0495649_0080821 Ga0495649_0080821_544_1611 352
754 3300046809 Ga0495600_0014546 Ga0495600_0014546_1335_2414 352
755 3300047315 Ga0495581_0005737 Ga0495581_0005737_1822_2889 352
756 3300047315 Ga0495581_0092012 Ga0495581_0092012_108_1175 352
757 3300047317 Ga0495604_0010023 Ga0495604_0010023_2269_3348 352
758 3300047317 Ga0495604_0116513 Ga0495604_0116513_857_1927 352
759 3300047319 Ga0495674_0004206 Ga0495674_0004206_8308_9375 352
760 3300047319 Ga0495674_0021636 Ga0495674_0021636_3723_4781 352
761 3300047319 Ga0495674_0082394 Ga0495674_0082394_68_1138 352
762 3300047319 Ga0495674_0198450 Ga0495674_0198450_80_1159 352
763 3300047320 Ga0495672_0032259 Ga0495672_0032259_1836_2903 352
764 3300047322 Ga0495680_0006824 Ga0495680_0006824_1244_2323 352
765 3300047444 Ga0495675_0067445 Ga0495675_0067445_313_1392 352
766 3300047471 Ga0495684_0000497 Ga0495684_0000497_8035_9114 352
767 3300047471 Ga0495684_0015464 Ga0495684_0015464_785_1843 352
768 3300047471 Ga0495684_0025159 Ga0495684_0025159_1060_2127 352
769 3300047472 Ga0495686_0147868 Ga0495686_0147868_278_1345 352
770 3300047673 Ga0495593_0014868 Ga0495593_0014868_2693_3772 352
771 3300047673 Ga0495593_0014947 Ga0495593_0014947_2297_3364 352
772 3300048088 Ga0495602_0128581 Ga0495602_0128581_554_1633 352
773 3300048088 Ga0495602_0152128 Ga0495602_0152128_285_1355 352
774 3300048089 Ga0495614_0018899 Ga0495614_0018899_58_1122 352
775 3300048904 Ga0496101_0052924 Ga0496101_0052924_1514_2581 352
776 3300048904 Ga0496101_0053933 Ga0496101_0053933_822_1889 352
777 3300048905 Ga0496102_0039515 Ga0496102_0039515_1344_2411 352
778 3300048907 Ga0496104_0003146 Ga0496104_0003146_1931_2989 352
779 3300048907 Ga0496104_0215047 Ga0496104_0215047_199_1266 352
780 3300048907 Ga0496104_0499306 Ga0496104_0499306_28_1086 352
781 3300048908 Ga0496105_0000840 Ga0496105_0000840_8782_9840 352
782 3300048908 Ga0496105_0190590 Ga0496105_0190590_416_1483 352
783 3300048909 Ga0496106_0000788 Ga0496106_0000788_13610_14674 352
784 3300048909 Ga0496106_0169369 Ga0496106_0169369_583_1650 352
785 3300048909 Ga0496106_0186831 Ga0496106_0186831_229_1296 352
786 3300048910 Ga0496107_0004819 Ga0496107_0004819_2514_3581 352
787 3300048911 Ga0496108_0011130 Ga0496108_0011130_1344_2411 352
788 3300048911 Ga0496108_0237162 Ga0496108_0237162_306_1364 352
789 3300048912 Ga0496109_0027237 Ga0496109_0027237_2074_3141 352
790 3300048912 Ga0496109_0028566 Ga0496109_0028566_291_1349 352
791 3300048913 Ga0496110_0034051 Ga0496110_0034051_875_1942 352
792 3300048913 Ga0496110_0492910 Ga0496110_0492910_18_1076 352
793 3300048914 Ga0496111_0002946 Ga0496111_0002946_8301_9368 352
794 3300048915 Ga0496112_0013345 Ga0496112_0013345_333_1391 352
795 3300048915 Ga0496112_0030393 Ga0496112_0030393_1162_2229 352
796 3300048915 Ga0496112_0421533 Ga0496112_0421533_23_1090 352
797 3300048917 Ga0496114_0037148 Ga0496114_0037148_2842_3900 352
798 3300048917 Ga0496114_0048719 Ga0496114_0048719_1552_2619 352
799 3300048918 Ga0496115_0109684 Ga0496115_0109684_307_1374 352
800 3300048920 Ga0496117_0007128 Ga0496117_0007128_1544_2608 352
801 3300048920 Ga0496117_0074479 Ga0496117_0074479_520_1587 352
802 3300048921 Ga0496118_0003592 Ga0496118_0003592_7426_8490 352
803 3300048924 Ga0496121_0000640 Ga0496121_0000640_30683_31747 352
804 3300048924 Ga0496121_0048134 Ga0496121_0048134_1792_2859 352
805 3300048924 Ga0496121_0093528 Ga0496121_0093528_807_1874 352
806 3300048927 Ga0496124_0002189 Ga0496124_0002189_12706_13770 352
807 3300048928 Ga0496125_0085843 Ga0496125_0085843_1266_2330 352
808 3300048929 Ga0496126_0009499 Ga0496126_0009499_2524_3591 352
809 3300048929 Ga0496126_0018354 Ga0496126_0018354_731_1795 352
810 3300048929 Ga0496126_0043259 Ga0496126_0043259_1761_2825 352
811 3300048929 Ga0496126_0080924 Ga0496126_0080924_60_1127 352
812 3300048929 Ga0496126_0115449 Ga0496126_0115449_686_1801 352
813 3300048929 Ga0496126_0164235 Ga0496126_0164235_476_1540 352
814 3300048929 Ga0496126_0254389 Ga0496126_0254389_59_1126 352
815 3300049580 Ga0501046_0067505 Ga0501046_0067505_661_1728 352
816 3300049581 Ga0501047_0052511 Ga0501047_0052511_998_2065 352
817 3300049586 Ga0501070_0215422 Ga0501070_0215422_148_1215 352
818 3300049590 Ga0501074_0046177 Ga0501074_0046177_1251_2318 352
819 3300049742 Ga0501080_0029073 Ga0501080_0029073_1444_2511 352
820 3300050492 nmdc:mga0yw44_63102_c1 nmdc:mga0yw44_63102_c1_827_1894 352
821 3300050496 nmdc:mga07m45_49692_c1 nmdc:mga07m45_49692_c1_440_1507 352
822 3300050507 nmdc:mga05p37_10233_c1 nmdc:mga05p37_10233_c1_827_1894 352
823 3300050507 nmdc:mga05p37_166916_c1 nmdc:mga05p37_166916_c1_71_1138 352
824 3300050507 nmdc:mga05p37_225_c1 nmdc:mga05p37_225_c1_28436_29494 352
825 3300050508 nmdc:mga09592_244_c1 nmdc:mga09592_244_c1_9616_10674 352
826 3300050508 nmdc:mga09592_58040_c1 nmdc:mga09592_58040_c1_514_1614 352
827 3300050508 nmdc:mga09592_736_c1 nmdc:mga09592_736_c1_17196_18266 352
828 3300050509 nmdc:mga0qj67_215_c1 nmdc:mga0qj67_215_c1_11684_12751 352
829 3300050509 nmdc:mga0qj67_2611_c1 nmdc:mga0qj67_2611_c1_8566_9624 352
830 3300050509 nmdc:mga0qj67_4314_c1 nmdc:mga0qj67_4314_c1_2985_4052 352
831 3300050509 nmdc:mga0qj67_4314_c1 nmdc:mga0qj67_4314_c1_5311_6411 352
832 3300050510 nmdc:mga06r32_12515_c1 nmdc:mga06r32_12515_c1_4948_6048 352
833 3300050510 nmdc:mga06r32_341_c1 nmdc:mga06r32_341_c1_31886_32956 352
834 3300050510 nmdc:mga06r32_731_c1 nmdc:mga06r32_731_c1_10989_12047 352
835 3300050511 nmdc:mga08y16_617_c1 nmdc:mga08y16_617_c1_22438_23496 352
836 3300050512 nmdc:mga0n895_308807_c1 nmdc:mga0n895_308807_c1_37_1104 352
837 3300050512 nmdc:mga0n895_457_c1 nmdc:mga0n895_457_c1_228_1286 352
838 3300050512 nmdc:mga0n895_543324_c1 nmdc:mga0n895_543324_c1_27_1085 352
839 3300050513 nmdc:mga0rr50_11539_c1 nmdc:mga0rr50_11539_c1_541_1599 352
840 3300050514 nmdc:mga08x19_81571_c1 nmdc:mga08x19_81571_c1_27_1085 352
841 3300050515 nmdc:mga0a205_1019_c1 nmdc:mga0a205_1019_c1_7565_8623 352
842 3300053077 Ga0495601_0000413 Ga0495601_0000413_1200_2258 352
843 3300053077 Ga0495601_0007499 Ga0495601_0007499_1051_2130 352
844 3300053078 Ga0495612_0002430 Ga0495612_0002430_2202_3260 352
845 3300053084 Ga0495595_0001465 Ga0495595_0001465_1326_2405 352
846 3300053085 Ga0495619_0001957 Ga0495619_0001957_869_1948 352
847 3300053085 Ga0495619_0002856 Ga0495619_0002856_5307_6365 352
848 3300053085 Ga0495619_0106148 Ga0495619_0106148_25_1095 352
849 3300053093 Ga0500651_0185374 Ga0500651_0185374_152_1219 352
850 3300053094 Ga0500566_0107849 Ga0500566_0107849_321_1388 352
851 3300053096 Ga0500641_0098123 Ga0500641_0098123_117_1184 352
852 3300053119 Ga0500595_003699 Ga0500595_003699_4627_5694 352
853 3300053134 Ga0500658_0024140 Ga0500658_0024140_480_1547 352
854 3300053136 Ga0500559_0047011 Ga0500559_0047011_511_1575 352
855 3300053158 Ga0500627_0125752 Ga0500627_0125752_41_1108 352
856 3300053161 Ga0500634_0069625 Ga0500634_0069625_120_1187 352
857 3300053735 Ga0500596_004825 Ga0500596_004825_479_1543 352
858 3300001977 JGI24746J21847_1004478 JGI24746J21847_10044782 353
859 3300001989 JGI24739J22299_10004105 JGI24739J22299_100041052 353
860 3300001990 JGI24737J22298_10002708 JGI24737J22298_100027085 353
861 3300002070 JGI24750J21931_1000175 JGI24750J21931_10001753 353
862 3300002074 JGI24748J21848_1000514 JGI24748J21848_10005144 353
863 3300002075 JGI24738J21930_10001046 JGI24738J21930_100010462 353
864 3300002076 JGI24749J21850_1001064 JGI24749J21850_10010642 353
865 3300002077 JGI24744J21845_10000566 JGI24744J21845_100005667 353
866 3300002244 JGI24742J22300_10000420 JGI24742J22300_100004202 353
867 3300002459 JGI24751J29686_10016485 JGI24751J29686_100164852 353
868 3300003911 JGI25405J52794_10009101 JGI25405J52794_100091012 353
869 3300005327 Ga0070658_10101559 Ga0070658_101015592 353
870 3300005329 Ga0070683_100000836 Ga0070683_10000083610 353
871 3300005329 Ga0070683_100075014 Ga0070683_1000750144 353
872 3300005330 Ga0070690_100000700 Ga0070690_10000070015 353
873 3300005335 Ga0070666_10031827 Ga0070666_100318273 353
874 3300005336 Ga0070680_100005042 Ga0070680_1000050425 353
875 3300005337 Ga0070682_100020427 Ga0070682_1000204272 353
876 3300005337 Ga0070682_100090951 Ga0070682_1000909512 353
877 3300005338 Ga0068868_100005815 Ga0068868_1000058152 353
878 3300005339 Ga0070660_100023548 Ga0070660_1000235482 353
879 3300005340 Ga0070689_100045887 Ga0070689_1000458872 353
880 3300005341 Ga0070691_10004006 Ga0070691_100040064 353
881 3300005344 Ga0070661_100001217 Ga0070661_10000121714 353
882 3300005345 Ga0070692_10003662 Ga0070692_100036622 353
883 3300005347 Ga0070668_100019465 Ga0070668_1000194652 353
884 3300005353 Ga0070669_100009354 Ga0070669_1000093543 353
885 3300005354 Ga0070675_100021874 Ga0070675_1000218742 353
886 3300005355 Ga0070671_100005891 Ga0070671_1000058914 353
887 3300005355 Ga0070671_100020315 Ga0070671_1000203156 353
888 3300005355 Ga0070671_100031898 Ga0070671_1000318981 353
889 3300005355 Ga0070671_100288270 Ga0070671_1002882701 353
890 3300005356 Ga0070674_100003371 Ga0070674_1000033712 353
891 3300005364 Ga0070673_100001086 Ga0070673_1000010863 353
892 3300005365 Ga0070688_100034076 Ga0070688_1000340762 353
893 3300005366 Ga0070659_100006583 Ga0070659_1000065832 353
894 3300005367 Ga0070667_100002687 Ga0070667_10000268714 353
895 3300005434 Ga0070709_10001257 Ga0070709_100012575 353
896 3300005436 Ga0070713_100000374 Ga0070713_10000037422 353
897 3300005436 Ga0070713_100028156 Ga0070713_1000281562 353
898 3300005438 Ga0070701_10141958 Ga0070701_101419581 353
899 3300005439 Ga0070711_100023758 Ga0070711_1000237584 353
900 3300005439 Ga0070711_100033722 Ga0070711_1000337222 353
901 3300005440 Ga0070705_100001711 Ga0070705_1000017119 353
902 3300005441 Ga0070700_100016369 Ga0070700_1000163693 353
903 3300005444 Ga0070694_100007442 Ga0070694_1000074424 353
904 3300005445 Ga0070708_100104737 Ga0070708_1001047372 353
905 3300005445 Ga0070708_100209862 Ga0070708_1002098622 353
906 3300005455 Ga0070663_100021845 Ga0070663_1000218451 353
907 3300005455 Ga0070663_100064000 Ga0070663_1000640002 353
908 3300005456 Ga0070678_100001680 Ga0070678_10000168014 353
909 3300005458 Ga0070681_10061500 Ga0070681_100615002 353
910 3300005459 Ga0068867_100000874 Ga0068867_1000008742 353
911 3300005466 Ga0070685_10003079 Ga0070685_100030795 353
912 3300005530 Ga0070679_100151164 Ga0070679_1001511642 353
913 3300005539 Ga0068853_100003110 Ga0068853_10000311011 353
914 3300005543 Ga0070672_100005531 Ga0070672_1000055312 353
915 3300005543 Ga0070672_100131220 Ga0070672_1001312202 353
916 3300005544 Ga0070686_100004079 Ga0070686_1000040792 353
917 3300005545 Ga0070695_100012339 Ga0070695_1000123392 353
918 3300005546 Ga0070696_100008243 Ga0070696_1000082432 353
919 3300005546 Ga0070696_100039848 Ga0070696_1000398482 353
920 3300005547 Ga0070693_100072635 Ga0070693_1000726352 353
921 3300005563 Ga0068855_100072645 Ga0068855_1000726453 353
922 3300005564 Ga0070664_100027792 Ga0070664_1000277922 353
923 3300005577 Ga0068857_100025732 Ga0068857_1000257322 353
924 3300005578 Ga0068854_100002509 Ga0068854_1000025098 353
925 3300005614 Ga0068856_100085445 Ga0068856_1000854452 353
926 3300005614 Ga0068856_100119327 Ga0068856_1001193272 353
927 3300005616 Ga0068852_100006607 Ga0068852_1000066072 353
928 3300005617 Ga0068859_100069054 Ga0068859_1000690542 353
929 3300005618 Ga0068864_100001321 Ga0068864_10000132116 353
930 3300005718 Ga0068866_10002168 Ga0068866_100021683 353
931 3300005840 Ga0068870_10000716 Ga0068870_100007164 353
932 3300005841 Ga0068863_100000965 Ga0068863_10000096510 353
933 3300005842 Ga0068858_100003017 Ga0068858_10000301714 353
934 3300005842 Ga0068858_100064343 Ga0068858_1000643433 353
935 3300005843 Ga0068860_100014200 Ga0068860_1000142002 353
936 3300005843 Ga0068860_100041961 Ga0068860_1000419616 353
937 3300005844 Ga0068862_100003246 Ga0068862_10000324612 353
938 3300005937 Ga0081455_10000327 Ga0081455_1000032768 353
939 3300006028 Ga0070717_10007141 Ga0070717_100071419 353
940 3300006175 Ga0070712_100106270 Ga0070712_1001062702 353
941 3300006178 Ga0075367_10039381 Ga0075367_100393812 353
942 3300006358 Ga0068871_100001025 Ga0068871_10000102515 353
943 3300006358 Ga0068871_100005428 Ga0068871_1000054282 353
944 3300006852 Ga0075433_10016718 Ga0075433_100167184 353
945 3300006881 Ga0068865_100005281 Ga0068865_1000052816 353
946 3300006881 Ga0068865_100013742 Ga0068865_1000137427 353
947 3300006931 Ga0097620_100069047 Ga0097620_1000690472 353
948 3300009098 Ga0105245_10114924 Ga0105245_101149241 353
949 3300009101 Ga0105247_10025590 Ga0105247_100255901 353
950 3300009148 Ga0105243_10031539 Ga0105243_100315392 353
951 3300009148 Ga0105243_10283021 Ga0105243_102830212 353
952 3300009174 Ga0105241_10128056 Ga0105241_101280563 353
953 3300009176 Ga0105242_10035266 Ga0105242_100352662 353
954 3300009176 Ga0105242_10078490 Ga0105242_100784903 353
955 3300009177 Ga0105248_10013825 Ga0105248_100138252 353
956 3300009177 Ga0105248_10145105 Ga0105248_101451052 353
957 3300009545 Ga0105237_10202763 Ga0105237_102027632 353
958 3300010375 Ga0105239_10311499 Ga0105239_103114991 353
959 3300010375 Ga0105239_10348954 Ga0105239_103489542 353
960 3300013296 Ga0157374_10032360 Ga0157374_100323604 353
961 3300013296 Ga0157374_10062182 Ga0157374_100621822 353
962 3300013306 Ga0163162_10068510 Ga0163162_100685102 353
963 3300013308 Ga0157375_10346805 Ga0157375_103468051 353
964 3300014325 Ga0163163_10100808 Ga0163163_101008082 353
965 3300014325 Ga0163163_10276705 Ga0163163_102767051 353
966 3300014326 Ga0157380_10121457 Ga0157380_101214572 353
967 3300014968 Ga0157379_10106097 Ga0157379_101060971 353
968 3300014968 Ga0157379_10287188 Ga0157379_102871882 353
969 3300014969 Ga0157376_10424407 Ga0157376_104244071 353
970 3300025271 Ga0207666_1000103 Ga0207666_100010313 353
971 3300025315 Ga0207697_10001374 Ga0207697_1000137413 353
972 3300025885 Ga0207653_10008349 Ga0207653_100083492 353
973 3300025893 Ga0207682_10000043 Ga0207682_1000004332 353
974 3300025898 Ga0207692_10006313 Ga0207692_100063132 353
975 3300025899 Ga0207642_10007175 Ga0207642_100071752 353
976 3300025900 Ga0207710_10049955 Ga0207710_100499552 353
977 3300025903 Ga0207680_10006796 Ga0207680_100067964 353
978 3300025904 Ga0207647_10003002 Ga0207647_1000300213 353
979 3300025905 Ga0207685_10000914 Ga0207685_100009146 353
980 3300025907 Ga0207645_10000899 Ga0207645_1000089913 353
981 3300025907 Ga0207645_10014247 Ga0207645_100142472 353
982 3300025911 Ga0207654_10005950 Ga0207654_100059503 353
983 3300025912 Ga0207707_10004166 Ga0207707_100041669 353
984 3300025914 Ga0207671_10192162 Ga0207671_101921622 353
985 3300025915 Ga0207693_10156925 Ga0207693_101569251 353
986 3300025916 Ga0207663_10009887 Ga0207663_100098876 353
987 3300025917 Ga0207660_10023127 Ga0207660_100231273 353
988 3300025918 Ga0207662_10000975 Ga0207662_1000097513 353
989 3300025920 Ga0207649_10002321 Ga0207649_100023218 353
990 3300025921 Ga0207652_10005425 Ga0207652_100054258 353
991 3300025926 Ga0207659_10007188 Ga0207659_100071884 353
992 3300025927 Ga0207687_10000522 Ga0207687_100005222 353
993 3300025928 Ga0207700_10004890 Ga0207700_100048909 353
994 3300025928 Ga0207700_10024078 Ga0207700_100240784 353
995 3300025931 Ga0207644_10000611 Ga0207644_100006114 353
996 3300025931 Ga0207644_10006011 Ga0207644_100060117 353
997 3300025932 Ga0207690_10003223 Ga0207690_100032238 353
998 3300025934 Ga0207686_10014769 Ga0207686_100147692 353
999 3300025935 Ga0207709_10009743 Ga0207709_100097432 353
1000 3300025936 Ga0207670_10000631 Ga0207670_1000063113 353
1001 3300025937 Ga0207669_10000797 Ga0207669_100007975 353
1002 3300025938 Ga0207704_10047461 Ga0207704_100474612 353
1003 3300025939 Ga0207665_10009568 Ga0207665_100095689 353
1004 3300025941 Ga0207711_10008296 Ga0207711_100082962 353
1005 3300025941 Ga0207711_10052202 Ga0207711_100522022 353
1006 3300025942 Ga0207689_10000165 Ga0207689_1000016520 353
1007 3300025944 Ga0207661_10004909 Ga0207661_100049093 353
1008 3300025944 Ga0207661_10047173 Ga0207661_100471734 353
1009 3300025961 Ga0207712_10001957 Ga0207712_100019572 353
1010 3300025972 Ga0207668_10003391 Ga0207668_100033913 353
1011 3300025981 Ga0207640_10000382 Ga0207640_1000038222 353
1012 3300025986 Ga0207658_10035295 Ga0207658_100352956 353
1013 3300026023 Ga0207677_10005315 Ga0207677_100053156 353
1014 3300026035 Ga0207703_10004258 Ga0207703_1000425810 353
1015 3300026041 Ga0207639_10032542 Ga0207639_100325422 353
1016 3300026067 Ga0207678_10003272 Ga0207678_100032723 353
1017 3300026067 Ga0207678_10031527 Ga0207678_100315272 353
1018 3300026075 Ga0207708_10012755 Ga0207708_100127555 353
1019 3300026078 Ga0207702_10093858 Ga0207702_100938582 353
1020 3300026088 Ga0207641_10001777 Ga0207641_1000177711 353
1021 3300026089 Ga0207648_10047840 Ga0207648_100478402 353
1022 3300026095 Ga0207676_10000494 Ga0207676_1000049416 353
1023 3300026118 Ga0207675_100003533 Ga0207675_10000353313 353
1024 3300026121 Ga0207683_10001272 Ga0207683_1000127213 353
1025 3300026121 Ga0207683_10007911 Ga0207683_100079115 353
1026 3300026121 Ga0207683_10027632 Ga0207683_100276325 353
1027 3300027617 Ga0210002_1001992 Ga0210002_10019922 353
1028 3300027717 Ga0209998_10001588 Ga0209998_100015882 353
1029 3300027907 Ga0207428_10000064 Ga0207428_1000006457 353
1030 3300028379 Ga0268266_10025484 Ga0268266_100254842 353
1031 3300028380 Ga0268265_10011223 Ga0268265_100112231 353
1032 3300028381 Ga0268264_10005082 Ga0268264_1000508210 353
1033 3300031241 Ga0265325_10000006 Ga0265325_10000006167 353
1034 3300031595 Ga0265313_10023271 Ga0265313_100232713 353
1035 3300035085 Ga0373929_0017606 Ga0373929_0017606_279_1382 353
1036 3300035092 Ga0373952_0004422 Ga0373952_0004422_603_1706 353
1037 3300035111 Ga0373923_0051674 Ga0373923_0051674_284_1387 353
1038 3300035117 Ga0373953_0004155 Ga0373953_0004155_1399_2502 353
1039 3300035118 Ga0373954_0046149 Ga0373954_0046149_855_1958 353
1040 3300035119 Ga0373956_0002051 Ga0373956_0002051_6933_8036 353
1041 3300035170 Ga0373943_0005372 Ga0373943_0005372_796_1899 353
1042 3300035171 Ga0373946_0027757 Ga0373946_0027757_31_1134 353
1043 3300035172 Ga0373955_0009372 Ga0373955_0009372_3345_4448 353
1044 3300035691 Ga0373931_0034618 Ga0373931_0034618_600_1703 353
1045 3300035692 Ga0373935_0006022 Ga0373935_0006022_2957_4060 353
1046 3300035695 Ga0373927_0042636 Ga0373927_0042636_1195_2298 353
1047 3300035695 Ga0373927_0153904 Ga0373927_0153904_300_1385 353
1048 3300035724 Ga0373933_0045156 Ga0373933_0045156_1163_2266 353
1049 3300035725 Ga0373947_0000340 Ga0373947_0000340_4416_5519 353
1050 3300035725 Ga0373947_0064359 Ga0373947_0064359_901_2004 353
1051 3300035725 Ga0373947_0170331 Ga0373947_0170331_244_1329 353
1052 3300036401 Ga0373937_0001302 Ga0373937_0001302_967_2070 353
1053 3300037068 Ga0373925_0007663 Ga0373925_0007663_2755_3858 353
1054 3300046455 Ga0495603_0099568 Ga0495603_0099568_572_1657 353
1055 3300046459 Ga0495629_0008986 Ga0495629_0008986_6194_7297 353
1056 3300046459 Ga0495629_0046527 Ga0495629_0046527_539_1642 353
1057 3300046463 Ga0495653_0016031 Ga0495653_0016031_1618_2721 353
1058 3300046475 Ga0495639_0009690 Ga0495639_0009690_135_1220 353
1059 3300046477 Ga0495664_0037955 Ga0495664_0037955_337_1440 353
1060 3300046499 Ga0495594_0054755 Ga0495594_0054755_814_1917 353
1061 3300046511 Ga0495608_0016511 Ga0495608_0016511_157_1260 353
1062 3300046514 Ga0495618_0015173 Ga0495618_0015173_174_1277 353
1063 3300046516 Ga0495628_0015999 Ga0495628_0015999_1163_2266 353
1064 3300046517 Ga0495630_0040548 Ga0495630_0040548_2071_3174 353
1065 3300046533 Ga0495640_0015450 Ga0495640_0015450_673_1776 353
1066 3300046536 Ga0495587_0009736 Ga0495587_0009736_1284_2387 353
1067 3300046559 Ga0495667_0005768 Ga0495667_0005768_1644_2747 353
1068 3300046663 Ga0495635_0013995 Ga0495635_0013995_1181_2284 353
1069 3300046675 Ga0495657_0013260 Ga0495657_0013260_3682_4785 353
1070 3300046679 Ga0495623_0049055 Ga0495623_0049055_123_1226 353
1071 3300046681 Ga0495647_0008584 Ga0495647_0008584_1859_2962 353
1072 3300046683 Ga0495658_0000781 Ga0495658_0000781_2531_3634 353
1073 3300046683 Ga0495658_0011048 Ga0495658_0011048_3418_4503 353
1074 3300046689 Ga0495613_0006286 Ga0495613_0006286_3887_4990 353
1075 3300046689 Ga0495613_0029327 Ga0495613_0029327_1662_2765 353
1076 3300046690 Ga0495624_0081726 Ga0495624_0081726_443_1546 353
1077 3300046691 Ga0495670_0012130 Ga0495670_0012130_185_1288 353
1078 3300046809 Ga0495600_0007607 Ga0495600_0007607_3993_5096 353
1079 3300047315 Ga0495581_0030017 Ga0495581_0030017_551_1654 353
1080 3300047317 Ga0495604_0002235 Ga0495604_0002235_482_1585 353
1081 3300047319 Ga0495674_0006763 Ga0495674_0006763_7900_9003 353
1082 3300047321 Ga0495676_0062585 Ga0495676_0062585_402_1487 353
1083 3300047321 Ga0495676_0121550 Ga0495676_0121550_293_1396 353
1084 3300047322 Ga0495680_0029393 Ga0495680_0029393_1697_2800 353
1085 3300047444 Ga0495675_0002904 Ga0495675_0002904_1216_2319 353
1086 3300047471 Ga0495684_0016411 Ga0495684_0016411_3795_4898 353
1087 3300047673 Ga0495593_0023433 Ga0495593_0023433_1248_2351 353
1088 3300048903 Ga0496100_0012538 Ga0496100_0012538_2802_3905 353
1089 3300048903 Ga0496100_0040306 Ga0496100_0040306_1407_2510 353
1090 3300048903 Ga0496100_0128194 Ga0496100_0128194_152_1291 353
1091 3300048904 Ga0496101_0001165 Ga0496101_0001165_297_1400 353
1092 3300048905 Ga0496102_0005341 Ga0496102_0005341_8709_9794 353
1093 3300048906 Ga0496103_0011444 Ga0496103_0011444_2579_3682 353
1094 3300048906 Ga0496103_0014101 Ga0496103_0014101_149_1252 353
1095 3300048907 Ga0496104_0285969 Ga0496104_0285969_298_1401 353
1096 3300048908 Ga0496105_0029441 Ga0496105_0029441_218_1324 353
1097 3300048908 Ga0496105_0030009 Ga0496105_0030009_3106_4209 353
1098 3300048909 Ga0496106_0011781 Ga0496106_0011781_1016_2119 353
1099 3300048910 Ga0496107_0013863 Ga0496107_0013863_2913_4052 353
1100 3300048910 Ga0496107_0074682 Ga0496107_0074682_1146_2249 353
1101 3300048911 Ga0496108_0019665 Ga0496108_0019665_3508_4611 353
1102 3300048911 Ga0496108_0037794 Ga0496108_0037794_399_1502 353
1103 3300048912 Ga0496109_0007962 Ga0496109_0007962_2798_3859 353
1104 3300048912 Ga0496109_0023341 Ga0496109_0023341_1269_2372 353
1105 3300048913 Ga0496110_0075409 Ga0496110_0075409_1733_2836 353
1106 3300048914 Ga0496111_0039701 Ga0496111_0039701_98_1201 353
1107 3300048915 Ga0496112_0011859 Ga0496112_0011859_2231_3334 353
1108 3300048916 Ga0496113_0017464 Ga0496113_0017464_1733_2836 353
1109 3300048916 Ga0496113_0062084 Ga0496113_0062084_361_1422 353
1110 3300048917 Ga0496114_0023363 Ga0496114_0023363_3128_4231 353
1111 3300048918 Ga0496115_0078464 Ga0496115_0078464_453_1556 353
1112 3300048918 Ga0496115_0123713 Ga0496115_0123713_11_1114 353
1113 3300048924 Ga0496121_0038643 Ga0496121_0038643_1454_2590 353
1114 3300050511 nmdc:mga08y16_131595_c1 nmdc:mga08y16_131595_c1_199_1302 353
1115 3300050511 nmdc:mga08y16_145004_c1 nmdc:mga08y16_145004_c1_108_1235 353
1116 3300053077 Ga0495601_0060131 Ga0495601_0060131_1277_2380 353
1117 3300053078 Ga0495612_0001564 Ga0495612_0001564_4277_5380 353
1118 3300053084 Ga0495595_0003553 Ga0495595_0003553_1345_2448 353
1119 3300053085 Ga0495619_0001679 Ga0495619_0001679_2842_3945 353
1120 3300053085 Ga0495619_0020676 Ga0495619_0020676_1816_2919 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

52

307

0.87

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

104

325

0.83

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

53

301

0.82

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

65

338

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r74-assembly4.cif.gz_D structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) 0.9097 48 353
7f6o-assembly2.cif.gz_B crystal structure of metal-citrate-binding mutant (s26a) protein (mcta) of abc transporter endogenously bound to mn2+-citrate complex 0.8948 37 352
7f6p-assembly3.cif.gz_C crystal structure of metal-citrate-binding mutant (d28a) protein (mcta) of abc transporter endogenously bound to citrate 0.8946 37 352
6wce-assembly1.cif.gz_A structure of the periplasmic binding protein p5pa 0.8923 48 351
7f6e-assembly1.cif.gz_A crystal structure of metal-citrate-binding protein (mcta) of abc transporter endogenously bound to mg2+-citrate complex (form i) 0.8885 30 352
ID Description Score Start End Superfamily
4r74A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8827 48 318 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8827 50 315 3.40.190.10
af_Q2G1D9_30_309_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.869 50 330 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8661 50 315 3.40.190.10
4elqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8651 49 321 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537SX32-F1-model_v4 Extracellular solute-binding protein 0.9936 57 353 GO:0042597
GO:0046872
AF-A0A537SX32-F1-model_v4 Extracellular solute-binding protein 0.987 57 353 GO:0042597
GO:0046872
AF-A0A7S7TCI2-F1-model_v4 Iron ABC transporter substrate-binding protein 0.9867 19 353 GO:0046872
AF-A0A1F9A1T1-F1-model_v4 Iron ABC transporter substrate-binding protein 0.9802 71 353
AF-A0A1F7TGV6-F1-model_v4 Iron ABC transporter substrate-binding protein 0.9739 39 353 GO:0046872

Feature Viewer

pLDDT pTM Quality
92.29 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map