F490384
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1120 | 402 | 2240 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_12083366|Ga0163162_120833662 |
| Length | 164 |
| Sequence | MQVLVLNASYEPLNVCTVKRAHVLVFKGKAEVIESLDRPLRSAQQVLLGGGKQDLVDFAVSLQGRIDDLHRAVDEIAAGLSRVDRRVDTAVSKTSLVRYDAYEGAGGHQSASIAFLDAGRSGVVLSAIQGRDYARIYVKELDRGRPNVALSPEEQEAVERAMAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 205 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 206 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 209 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 212 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 233 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 236 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 237 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 240 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 241 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 242 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 243 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 244 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 245 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 246 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 247 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 248 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 249 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 250 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 251 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 252 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 253 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 254 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 255 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 256 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 257 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 258 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 259 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 260 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 261 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 262 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 263 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 336 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 344 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 345 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 346 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 349 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 384 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 400 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 402 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.73 |
| Metatranscriptomes | 0.27 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.8 |
| Nodule | 0 |
| Rhizoplane | 11.52 |
| Rhizosphere | 86.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163162_12083366 | 3300013306 | Unclassified | 651 |
| 2 | JGI24737J22298_10062174 | 3300001990 | Unclassified | 1122 |
| 3 | JGI24744J21845_10004005 | 3300002077 | Bacteria | 3040 |
| 4 | JGI25406J46586_10019807 | 3300003203 | Bacteria | 2733 |
| 5 | Ga0070683_100054315 | 3300005329 | Bacteria | 3714 |
| 6 | Ga0070683_100380230 | 3300005329 | Bacteria | 1345 |
| 7 | Ga0070690_100051674 | 3300005330 | Bacteria | 2625 |
| 8 | Ga0068869_101361970 | 3300005334 | Bacteria | 627 |
| 9 | Ga0070666_10042015 | 3300005335 | Bacteria | 3057 |
| 10 | Ga0070680_100573206 | 3300005336 | Bacteria | 968 |
| 11 | Ga0068868_100033217 | 3300005338 | Bacteria | 3975 |
| 12 | Ga0068868_100080858 | 3300005338 | Bacteria | 2604 |
| 13 | Ga0068868_100190637 | 3300005338 | Bacteria | 1705 |
| 14 | Ga0068868_100733022 | 3300005338 | Unclassified | 887 |
| 15 | Ga0068868_100736586 | 3300005338 | Bacteria | 885 |
| 16 | Ga0068868_100815719 | 3300005338 | Bacteria | 843 |
| 17 | Ga0070660_100097819 | 3300005339 | Bacteria | 2322 |
| 18 | Ga0070660_100135766 | 3300005339 | Bacteria | 1971 |
| 19 | Ga0070689_100006043 | 3300005340 | Bacteria | 8341 |
| 20 | Ga0070691_10011849 | 3300005341 | Bacteria | 3989 |
| 21 | Ga0070691_10116750 | 3300005341 | Bacteria | 1340 |
| 22 | Ga0070687_100010557 | 3300005343 | Bacteria | 4000 |
| 23 | Ga0070687_100507548 | 3300005343 | Unclassified | 813 |
| 24 | Ga0070692_10008869 | 3300005345 | Bacteria | 4506 |
| 25 | Ga0070692_10246331 | 3300005345 | Bacteria | 1067 |
| 26 | Ga0070668_100016130 | 3300005347 | Bacteria | 5590 |
| 27 | Ga0070668_100101819 | 3300005347 | Bacteria | 2277 |
| 28 | Ga0070668_100465875 | 3300005347 | Bacteria | 1089 |
| 29 | Ga0070669_100497258 | 3300005353 | Bacteria | 1011 |
| 30 | Ga0070675_100850420 | 3300005354 | Bacteria | 835 |
| 31 | Ga0070671_100718069 | 3300005355 | Bacteria | 867 |
| 32 | Ga0070671_100771857 | 3300005355 | Unclassified | 836 |
| 33 | Ga0070671_100891465 | 3300005355 | Bacteria | 777 |
| 34 | Ga0070674_100027492 | 3300005356 | Bacteria | 3728 |
| 35 | Ga0070674_100145636 | 3300005356 | Bacteria | 1783 |
| 36 | Ga0070673_100138761 | 3300005364 | Unclassified | 2049 |
| 37 | Ga0070673_100256321 | 3300005364 | Bacteria | 1526 |
| 38 | Ga0070688_100081762 | 3300005365 | Bacteria | 2092 |
| 39 | Ga0070688_100523484 | 3300005365 | Bacteria | 898 |
| 40 | Ga0070659_100058074 | 3300005366 | Bacteria | 3052 |
| 41 | Ga0070659_100084348 | 3300005366 | Bacteria | 2540 |
| 42 | Ga0070659_100283899 | 3300005366 | Bacteria | 1377 |
| 43 | Ga0070659_100825940 | 3300005366 | Bacteria | 807 |
| 44 | Ga0070667_100009269 | 3300005367 | Bacteria | 8156 |
| 45 | Ga0070703_10004128 | 3300005406 | Bacteria | 4096 |
| 46 | Ga0070709_10118357 | 3300005434 | Unclassified | 1791 |
| 47 | Ga0070709_10380545 | 3300005434 | Bacteria | 1049 |
| 48 | Ga0070714_100013978 | 3300005435 | Bacteria | 6440 |
| 49 | Ga0070713_100094275 | 3300005436 | Bacteria | 2580 |
| 50 | Ga0070713_100126996 | 3300005436 | Bacteria | 2245 |
| 51 | Ga0070713_100194509 | 3300005436 | Bacteria | 1829 |
| 52 | Ga0070713_101060234 | 3300005436 | Bacteria | 783 |
| 53 | Ga0070710_10003456 | 3300005437 | Bacteria | 7484 |
| 54 | Ga0070710_10227327 | 3300005437 | Unclassified | 1190 |
| 55 | Ga0070710_10270137 | 3300005437 | Bacteria | 1099 |
| 56 | Ga0070701_10038274 | 3300005438 | Bacteria | 2427 |
| 57 | Ga0070701_10041770 | 3300005438 | Bacteria | 2338 |
| 58 | Ga0070711_100005669 | 3300005439 | Bacteria | 7481 |
| 59 | Ga0070711_100043303 | 3300005439 | Bacteria | 3048 |
| 60 | Ga0070711_100061427 | 3300005439 | Bacteria | 2616 |
| 61 | Ga0070711_100124043 | 3300005439 | Bacteria | 1915 |
| 62 | Ga0070711_100208263 | 3300005439 | Bacteria | 1513 |
| 63 | Ga0070705_100008491 | 3300005440 | Bacteria | 5089 |
| 64 | Ga0070705_100021380 | 3300005440 | Bacteria | 3441 |
| 65 | Ga0070705_100030381 | 3300005440 | Bacteria | 2982 |
| 66 | Ga0070705_100272905 | 3300005440 | Bacteria | 1198 |
| 67 | Ga0070705_101020023 | 3300005440 | Bacteria | 673 |
| 68 | Ga0070700_100007462 | 3300005441 | Bacteria | 5907 |
| 69 | Ga0070700_100185205 | 3300005441 | Bacteria | 1452 |
| 70 | Ga0070700_100349027 | 3300005441 | Bacteria | 1096 |
| 71 | Ga0070694_100008799 | 3300005444 | Bacteria | 6185 |
| 72 | Ga0070694_100046114 | 3300005444 | Bacteria | 2924 |
| 73 | Ga0070694_100449229 | 3300005444 | Unclassified | 1017 |
| 74 | Ga0070708_100006986 | 3300005445 | Bacteria | 9007 |
| 75 | Ga0070708_100092441 | 3300005445 | Bacteria | 2756 |
| 76 | Ga0070708_100971190 | 3300005445 | Bacteria | 797 |
| 77 | Ga0070708_101064386 | 3300005445 | Unclassified | 758 |
| 78 | Ga0070663_100028914 | 3300005455 | Bacteria | 3780 |
| 79 | Ga0070678_100012006 | 3300005456 | Bacteria | 5366 |
| 80 | Ga0070678_100024949 | 3300005456 | Bacteria | 4012 |
| 81 | Ga0070678_100285679 | 3300005456 | Unclassified | 1397 |
| 82 | Ga0070678_100841054 | 3300005456 | Bacteria | 836 |
| 83 | Ga0070662_100058460 | 3300005457 | Bacteria | 2806 |
| 84 | Ga0070662_100134020 | 3300005457 | Bacteria | 1914 |
| 85 | Ga0070662_100324726 | 3300005457 | Bacteria | 1256 |
| 86 | Ga0070662_100425769 | 3300005457 | Bacteria | 1099 |
| 87 | Ga0070662_100831817 | 3300005457 | Bacteria | 786 |
| 88 | Ga0070681_10029536 | 3300005458 | Bacteria | 5506 |
| 89 | Ga0070681_10140062 | 3300005458 | Bacteria | 2349 |
| 90 | Ga0070681_10310801 | 3300005458 | Bacteria | 1485 |
| 91 | Ga0068867_100046992 | 3300005459 | Bacteria | 3172 |
| 92 | Ga0068867_100939027 | 3300005459 | Bacteria | 781 |
| 93 | Ga0070685_10041774 | 3300005466 | Bacteria | 2614 |
| 94 | Ga0070685_10344842 | 3300005466 | Bacteria | 1017 |
| 95 | Ga0070706_100011590 | 3300005467 | Bacteria | 8192 |
| 96 | Ga0070706_100069880 | 3300005467 | Bacteria | 3248 |
| 97 | Ga0070706_100085852 | 3300005467 | Bacteria | 2916 |
| 98 | Ga0070706_100549996 | 3300005467 | Bacteria | 1074 |
| 99 | Ga0070707_100002669 | 3300005468 | Bacteria | 16963 |
| 100 | Ga0070707_100108471 | 3300005468 | Unclassified | 2693 |
| 101 | Ga0070698_100011138 | 3300005471 | Bacteria | 9554 |
| 102 | Ga0070698_100076853 | 3300005471 | Bacteria | 3340 |
| 103 | Ga0070698_100115313 | 3300005471 | Unclassified | 2651 |
| 104 | Ga0070698_100204402 | 3300005471 | Bacteria | 1910 |
| 105 | Ga0070698_100219202 | 3300005471 | Bacteria | 1836 |
| 106 | Ga0070699_100018106 | 3300005518 | Bacteria | 6051 |
| 107 | Ga0070699_100036512 | 3300005518 | Bacteria | 4251 |
| 108 | Ga0070699_100103341 | 3300005518 | Bacteria | 2499 |
| 109 | Ga0070699_100186295 | 3300005518 | Unclassified | 1843 |
| 110 | Ga0070699_100346313 | 3300005518 | Unclassified | 1338 |
| 111 | Ga0070679_100016373 | 3300005530 | Bacteria | 7149 |
| 112 | Ga0070679_100037003 | 3300005530 | Bacteria | 4845 |
| 113 | Ga0070679_100260899 | 3300005530 | Bacteria | 1688 |
| 114 | Ga0070679_100351530 | 3300005530 | Bacteria | 1421 |
| 115 | Ga0070679_100478419 | 3300005530 | Bacteria | 1189 |
| 116 | Ga0070679_100800146 | 3300005530 | Bacteria | 886 |
| 117 | Ga0070684_100539616 | 3300005535 | Bacteria | 1082 |
| 118 | Ga0070697_101096430 | 3300005536 | Unclassified | 708 |
| 119 | Ga0068853_100028152 | 3300005539 | Bacteria | 4724 |
| 120 | Ga0068853_100198572 | 3300005539 | Bacteria | 1825 |
| 121 | Ga0070672_100021137 | 3300005543 | Bacteria | 4758 |
| 122 | Ga0070672_100455037 | 3300005543 | Bacteria | 1103 |
| 123 | Ga0070672_100929416 | 3300005543 | Bacteria | 769 |
| 124 | Ga0070686_100000882 | 3300005544 | Bacteria | 17415 |
| 125 | Ga0070686_100023069 | 3300005544 | Bacteria | 3715 |
| 126 | Ga0070686_100525262 | 3300005544 | Bacteria | 922 |
| 127 | Ga0070695_100051044 | 3300005545 | Bacteria | 2652 |
| 128 | Ga0070695_100070078 | 3300005545 | Bacteria | 2292 |
| 129 | Ga0070695_100227027 | 3300005545 | Bacteria | 1348 |
| 130 | Ga0070695_100326240 | 3300005545 | Bacteria | 1143 |
| 131 | Ga0070695_100352879 | 3300005545 | Bacteria | 1102 |
| 132 | Ga0070696_100008256 | 3300005546 | Bacteria | 6968 |
| 133 | Ga0070696_100069478 | 3300005546 | Bacteria | 2475 |
| 134 | Ga0070696_100201125 | 3300005546 | Bacteria | 1487 |
| 135 | Ga0070693_100047654 | 3300005547 | Unclassified | 2439 |
| 136 | Ga0070665_100010320 | 3300005548 | Bacteria | 9447 |
| 137 | Ga0070665_100206147 | 3300005548 | Bacteria | 1967 |
| 138 | Ga0070665_100569254 | 3300005548 | Bacteria | 1146 |
| 139 | Ga0070704_100010856 | 3300005549 | Bacteria | 5556 |
| 140 | Ga0070704_100270603 | 3300005549 | Bacteria | 1403 |
| 141 | Ga0070704_100327601 | 3300005549 | Bacteria | 1285 |
| 142 | Ga0070704_100417911 | 3300005549 | Bacteria | 1148 |
| 143 | Ga0070704_100939291 | 3300005549 | Bacteria | 780 |
| 144 | Ga0070704_101053859 | 3300005549 | Bacteria | 737 |
| 145 | Ga0068855_100038674 | 3300005563 | Bacteria | 5668 |
| 146 | Ga0068855_100112391 | 3300005563 | Bacteria | 3126 |
| 147 | Ga0068855_100115906 | 3300005563 | Bacteria | 3071 |
| 148 | Ga0068855_100175811 | 3300005563 | Bacteria | 2422 |
| 149 | Ga0068855_100234908 | 3300005563 | Unclassified | 2051 |
| 150 | Ga0070664_100068038 | 3300005564 | Bacteria | 3044 |
| 151 | Ga0068854_100020771 | 3300005578 | Bacteria | 4450 |
| 152 | Ga0068854_100047929 | 3300005578 | Bacteria | 3046 |
| 153 | Ga0068854_100187343 | 3300005578 | Bacteria | 1620 |
| 154 | Ga0068854_100829078 | 3300005578 | Bacteria | 808 |
| 155 | Ga0068856_100069312 | 3300005614 | Bacteria | 3487 |
| 156 | Ga0068856_100082251 | 3300005614 | Bacteria | 3195 |
| 157 | Ga0068856_100178116 | 3300005614 | Bacteria | 2138 |
| 158 | Ga0068856_100208784 | 3300005614 | Bacteria | 1968 |
| 159 | Ga0068856_101457102 | 3300005614 | Bacteria | 699 |
| 160 | Ga0070702_100013355 | 3300005615 | Bacteria | 4145 |
| 161 | Ga0070702_100027086 | 3300005615 | Bacteria | 3089 |
| 162 | Ga0070702_100077789 | 3300005615 | Bacteria | 1978 |
| 163 | Ga0068852_100037277 | 3300005616 | Bacteria | 4075 |
| 164 | Ga0068852_101917035 | 3300005616 | Unclassified | 615 |
| 165 | Ga0068859_100010964 | 3300005617 | Bacteria | 9123 |
| 166 | Ga0068859_101564939 | 3300005617 | Bacteria | 728 |
| 167 | Ga0068864_100120931 | 3300005618 | Bacteria | 2341 |
| 168 | Ga0068864_101087043 | 3300005618 | Bacteria | 796 |
| 169 | Ga0068866_10001081 | 3300005718 | Bacteria | 12016 |
| 170 | Ga0068866_10095708 | 3300005718 | Bacteria | 1627 |
| 171 | Ga0068866_10214755 | 3300005718 | Bacteria | 1157 |
| 172 | Ga0068866_10500642 | 3300005718 | Bacteria | 804 |
| 173 | Ga0068861_100001828 | 3300005719 | Bacteria | 13692 |
| 174 | Ga0068861_100626197 | 3300005719 | Bacteria | 991 |
| 175 | Ga0068870_10076962 | 3300005840 | Unclassified | 1834 |
| 176 | Ga0068870_10111641 | 3300005840 | Unclassified | 1562 |
| 177 | Ga0068870_10381887 | 3300005840 | Unclassified | 912 |
| 178 | Ga0068858_100245228 | 3300005842 | Bacteria | 1700 |
| 179 | Ga0068860_100196134 | 3300005843 | Bacteria | 1955 |
| 180 | Ga0068860_100760288 | 3300005843 | Bacteria | 981 |
| 181 | Ga0068862_100273813 | 3300005844 | Unclassified | 1545 |
| 182 | Ga0068862_100342719 | 3300005844 | Bacteria | 1385 |
| 183 | Ga0081455_10028160 | 3300005937 | Bacteria | 5136 |
| 184 | Ga0081455_10342307 | 3300005937 | Bacteria | 1058 |
| 185 | Ga0081455_10631958 | 3300005937 | Bacteria | 693 |
| 186 | Ga0081540_1044621 | 3300005983 | Unclassified | 2261 |
| 187 | Ga0081540_1052743 | 3300005983 | Bacteria | 1999 |
| 188 | Ga0081539_10000244 | 3300005985 | Bacteria | 127514 |
| 189 | Ga0070717_10027511 | 3300006028 | Bacteria | 4545 |
| 190 | Ga0070717_10063126 | 3300006028 | Bacteria | 3073 |
| 191 | Ga0070717_10217929 | 3300006028 | Bacteria | 1677 |
| 192 | Ga0075368_10223069 | 3300006042 | Bacteria | 801 |
| 193 | Ga0075364_10014011 | 3300006051 | Bacteria | 4944 |
| 194 | Ga0070715_10061757 | 3300006163 | Bacteria | 1646 |
| 195 | Ga0070715_10067441 | 3300006163 | Bacteria | 1589 |
| 196 | Ga0070715_10097362 | 3300006163 | Bacteria | 1366 |
| 197 | Ga0070715_10303790 | 3300006163 | Bacteria | 855 |
| 198 | Ga0070716_100057721 | 3300006173 | Bacteria | 2231 |
| 199 | Ga0070716_100076912 | 3300006173 | Bacteria | 1979 |
| 200 | Ga0070712_100003509 | 3300006175 | Bacteria | 9649 |
| 201 | Ga0070712_100171733 | 3300006175 | Unclassified | 1683 |
| 202 | Ga0075367_10200229 | 3300006178 | Bacteria | 1247 |
| 203 | Ga0097621_100071216 | 3300006237 | Bacteria | 2872 |
| 204 | Ga0068871_100210197 | 3300006358 | Bacteria | 1683 |
| 205 | Ga0068871_100252426 | 3300006358 | Bacteria | 1536 |
| 206 | Ga0075428_100437092 | 3300006844 | Bacteria | 1402 |
| 207 | Ga0075430_100331436 | 3300006846 | Unclassified | 1257 |
| 208 | Ga0075433_10110977 | 3300006852 | Bacteria | 2433 |
| 209 | Ga0075433_10383810 | 3300006852 | Bacteria | 1240 |
| 210 | Ga0075433_10418195 | 3300006852 | Unclassified | 1182 |
| 211 | Ga0075433_10422201 | 3300006852 | Bacteria | 1176 |
| 212 | Ga0075434_100018813 | 3300006871 | Bacteria | 6676 |
| 213 | Ga0075434_100045370 | 3300006871 | Bacteria | 4360 |
| 214 | Ga0075434_100051638 | 3300006871 | Bacteria | 4086 |
| 215 | Ga0075434_100101209 | 3300006871 | Bacteria | 2888 |
| 216 | Ga0075434_100169144 | 3300006871 | Bacteria | 2206 |
| 217 | Ga0075434_100331174 | 3300006871 | Bacteria | 1543 |
| 218 | Ga0075434_100511236 | 3300006871 | Bacteria | 1222 |
| 219 | Ga0075434_100908911 | 3300006871 | Archaea | 895 |
| 220 | Ga0075434_101071296 | 3300006871 | Bacteria | 819 |
| 221 | Ga0068865_100015869 | 3300006881 | Bacteria | 4808 |
| 222 | Ga0068865_100031314 | 3300006881 | Bacteria | 3546 |
| 223 | Ga0068865_100040875 | 3300006881 | Bacteria | 3153 |
| 224 | Ga0068865_100666064 | 3300006881 | Bacteria | 886 |
| 225 | Ga0075436_100009027 | 3300006914 | Bacteria | 6821 |
| 226 | Ga0075436_100041829 | 3300006914 | Bacteria | 3161 |
| 227 | Ga0075436_100055833 | 3300006914 | Bacteria | 2728 |
| 228 | Ga0075436_100468441 | 3300006914 | Bacteria | 919 |
| 229 | Ga0097620_100010964 | 3300006931 | Bacteria | 9123 |
| 230 | Ga0097620_101564529 | 3300006931 | Bacteria | 728 |
| 231 | Ga0075435_100003250 | 3300007076 | Bacteria | 11007 |
| 232 | Ga0075435_100008644 | 3300007076 | Bacteria | 7320 |
| 233 | Ga0105240_10460868 | 3300009093 | Bacteria | 1420 |
| 234 | Ga0111539_10028822 | 3300009094 | Bacteria | 6771 |
| 235 | Ga0111539_10049073 | 3300009094 | Bacteria | 5037 |
| 236 | Ga0111539_10259573 | 3300009094 | Bacteria | 2023 |
| 237 | Ga0111539_10630775 | 3300009094 | Unclassified | 1248 |
| 238 | Ga0105245_10018421 | 3300009098 | Bacteria | 6105 |
| 239 | Ga0105245_10056080 | 3300009098 | Bacteria | 3540 |
| 240 | Ga0105245_10150066 | 3300009098 | Bacteria | 2203 |
| 241 | Ga0105245_10151529 | 3300009098 | Bacteria | 2193 |
| 242 | Ga0105245_10157812 | 3300009098 | Unclassified | 2150 |
| 243 | Ga0105245_10339084 | 3300009098 | Bacteria | 1486 |
| 244 | Ga0105245_12026694 | 3300009098 | Unclassified | 629 |
| 245 | Ga0105247_10066842 | 3300009101 | Bacteria | 2239 |
| 246 | Ga0114129_10005270 | 3300009147 | Bacteria | 18233 |
| 247 | Ga0114129_10023401 | 3300009147 | Bacteria | 8759 |
| 248 | Ga0114129_10073882 | 3300009147 | Bacteria | 4750 |
| 249 | Ga0114129_10128030 | 3300009147 | Bacteria | 3490 |
| 250 | Ga0114129_10392907 | 3300009147 | Bacteria | 1829 |
| 251 | Ga0114129_10448852 | 3300009147 | Unclassified | 1691 |
| 252 | Ga0114129_10916030 | 3300009147 | Bacteria | 1110 |
| 253 | Ga0105243_10146266 | 3300009148 | Bacteria | 2022 |
| 254 | Ga0105243_10190701 | 3300009148 | Bacteria | 1790 |
| 255 | Ga0105243_10384716 | 3300009148 | Bacteria | 1299 |
| 256 | Ga0105243_10415135 | 3300009148 | Bacteria | 1254 |
| 257 | Ga0105243_12165255 | 3300009148 | Bacteria | 592 |
| 258 | Ga0105241_10022578 | 3300009174 | Bacteria | 4661 |
| 259 | Ga0105241_10258044 | 3300009174 | Bacteria | 1480 |
| 260 | Ga0105241_10277810 | 3300009174 | Bacteria | 1429 |
| 261 | Ga0105242_10060046 | 3300009176 | Bacteria | 3122 |
| 262 | Ga0105242_10082332 | 3300009176 | Bacteria | 2693 |
| 263 | Ga0105242_10399848 | 3300009176 | Bacteria | 1282 |
| 264 | Ga0105242_10797506 | 3300009176 | Bacteria | 935 |
| 265 | Ga0105242_11024862 | 3300009176 | Bacteria | 835 |
| 266 | Ga0105242_11198522 | 3300009176 | Bacteria | 778 |
| 267 | Ga0105248_10012896 | 3300009177 | Bacteria | 9217 |
| 268 | Ga0105248_10366094 | 3300009177 | Bacteria | 1623 |
| 269 | Ga0105248_10587248 | 3300009177 | Bacteria | 1257 |
| 270 | Ga0105237_10562850 | 3300009545 | Unclassified | 1147 |
| 271 | Ga0105238_10259438 | 3300009551 | Bacteria | 1717 |
| 272 | Ga0105249_10020725 | 3300009553 | Bacteria | 5879 |
| 273 | Ga0105249_10044407 | 3300009553 | Bacteria | 4041 |
| 274 | Ga0105249_10630106 | 3300009553 | Bacteria | 1129 |
| 275 | Ga0105249_10981919 | 3300009553 | Bacteria | 913 |
| 276 | Ga0105249_11389145 | 3300009553 | Bacteria | 774 |
| 277 | Ga0105239_10020697 | 3300010375 | Bacteria | 7258 |
| 278 | Ga0105239_10024112 | 3300010375 | Bacteria | 6701 |
| 279 | Ga0105239_10041352 | 3300010375 | Bacteria | 5052 |
| 280 | Ga0105239_10105840 | 3300010375 | Bacteria | 3116 |
| 281 | Ga0105239_10407733 | 3300010375 | Bacteria | 1539 |
| 282 | Ga0105239_10677893 | 3300010375 | Unclassified | 1178 |
| 283 | Ga0105239_10913642 | 3300010375 | Bacteria | 1008 |
| 284 | Ga0105239_12315362 | 3300010375 | Bacteria | 625 |
| 285 | Ga0105246_10256966 | 3300011119 | Unclassified | 1390 |
| 286 | Ga0105246_10394379 | 3300011119 | Bacteria | 1148 |
| 287 | Ga0157338_1056488 | 3300012515 | Unclassified | 578 |
| 288 | Ga0157371_10611753 | 3300013102 | Bacteria | 811 |
| 289 | Ga0157371_10994964 | 3300013102 | Bacteria | 639 |
| 290 | Ga0157369_10393221 | 3300013105 | Bacteria | 1438 |
| 291 | Ga0157369_11459807 | 3300013105 | Bacteria | 696 |
| 292 | Ga0157374_10007613 | 3300013296 | Bacteria | 9243 |
| 293 | Ga0157374_10137582 | 3300013296 | Bacteria | 2369 |
| 294 | Ga0157374_12290095 | 3300013296 | Bacteria | 567 |
| 295 | Ga0157378_10581495 | 3300013297 | Bacteria | 1129 |
| 296 | Ga0157378_11428035 | 3300013297 | Bacteria | 735 |
| 297 | Ga0163162_10035104 | 3300013306 | Bacteria | 4994 |
| 298 | Ga0163162_12020892 | 3300013306 | Bacteria | 661 |
| 299 | Ga0157372_10017259 | 3300013307 | Bacteria | 7749 |
| 300 | Ga0157372_10094646 | 3300013307 | Bacteria | 3402 |
| 301 | Ga0157372_10153284 | 3300013307 | Bacteria | 2661 |
| 302 | Ga0157372_10155893 | 3300013307 | Bacteria | 2638 |
| 303 | Ga0157372_10257955 | 3300013307 | Unclassified | 2024 |
| 304 | Ga0157372_11660211 | 3300013307 | Bacteria | 735 |
| 305 | Ga0157372_13060604 | 3300013307 | Unclassified | 534 |
| 306 | Ga0157375_10033334 | 3300013308 | Bacteria | 4892 |
| 307 | Ga0157375_10067358 | 3300013308 | Bacteria | 3577 |
| 308 | Ga0157375_10551758 | 3300013308 | Bacteria | 1314 |
| 309 | Ga0157375_10865496 | 3300013308 | Bacteria | 1049 |
| 310 | Ga0163163_10015486 | 3300014325 | Bacteria | 7050 |
| 311 | Ga0163163_10261549 | 3300014325 | Bacteria | 1781 |
| 312 | Ga0163163_11118424 | 3300014325 | Unclassified | 851 |
| 313 | Ga0157380_10006389 | 3300014326 | Bacteria | 8297 |
| 314 | Ga0157380_10070318 | 3300014326 | Bacteria | 2828 |
| 315 | Ga0182008_10211009 | 3300014497 | Bacteria | 991 |
| 316 | Ga0157377_10002098 | 3300014745 | Bacteria | 8763 |
| 317 | Ga0157377_10149032 | 3300014745 | Bacteria | 1445 |
| 318 | Ga0157377_10177095 | 3300014745 | Bacteria | 1338 |
| 319 | Ga0157377_10495565 | 3300014745 | Bacteria | 853 |
| 320 | Ga0157379_10723063 | 3300014968 | Bacteria | 936 |
| 321 | Ga0157376_10007389 | 3300014969 | Bacteria | 7838 |
| 322 | Ga0157376_10514803 | 3300014969 | Bacteria | 1178 |
| 323 | Ga0197907_10782037 | 3300020069 | Bacteria | 2082 |
| 324 | Ga0206354_10058836 | 3300020081 | Bacteria | 2225 |
| 325 | Ga0206353_12058779 | 3300020082 | Bacteria | 3211 |
| 326 | Ga0213876_10101192 | 3300021384 | Bacteria | 1528 |
| 327 | Ga0207653_10005086 | 3300025885 | Bacteria | 4107 |
| 328 | Ga0207653_10034893 | 3300025885 | Bacteria | 1635 |
| 329 | Ga0207692_10091654 | 3300025898 | Bacteria | 1649 |
| 330 | Ga0207692_10155989 | 3300025898 | Bacteria | 1311 |
| 331 | Ga0207692_10880203 | 3300025898 | Bacteria | 588 |
| 332 | Ga0207642_10160294 | 3300025899 | Bacteria | 1207 |
| 333 | Ga0207642_10345519 | 3300025899 | Bacteria | 876 |
| 334 | Ga0207688_10042562 | 3300025901 | Bacteria | 2528 |
| 335 | Ga0207680_10125828 | 3300025903 | Bacteria | 1682 |
| 336 | Ga0207680_10840421 | 3300025903 | Bacteria | 658 |
| 337 | Ga0207647_10164380 | 3300025904 | Bacteria | 1294 |
| 338 | Ga0207685_10105531 | 3300025905 | Bacteria | 1212 |
| 339 | Ga0207685_10236337 | 3300025905 | Bacteria | 877 |
| 340 | Ga0207685_10514758 | 3300025905 | Unclassified | 632 |
| 341 | Ga0207699_10027324 | 3300025906 | Bacteria | 3158 |
| 342 | Ga0207699_10034959 | 3300025906 | Bacteria | 2855 |
| 343 | Ga0207699_10800776 | 3300025906 | Unclassified | 693 |
| 344 | Ga0207645_10068497 | 3300025907 | Bacteria | 2269 |
| 345 | Ga0207643_10113388 | 3300025908 | Unclassified | 1599 |
| 346 | Ga0207684_10053940 | 3300025910 | Bacteria | 3411 |
| 347 | Ga0207684_10065501 | 3300025910 | Bacteria | 3085 |
| 348 | Ga0207707_10005223 | 3300025912 | Bacteria | 11380 |
| 349 | Ga0207707_10030586 | 3300025912 | Bacteria | 4711 |
| 350 | Ga0207707_10070999 | 3300025912 | Bacteria | 3034 |
| 351 | Ga0207707_10189464 | 3300025912 | Bacteria | 1794 |
| 352 | Ga0207671_10481182 | 3300025914 | Unclassified | 989 |
| 353 | Ga0207693_10002384 | 3300025915 | Bacteria | 16305 |
| 354 | Ga0207693_10010783 | 3300025915 | Bacteria | 7419 |
| 355 | Ga0207693_10083357 | 3300025915 | Bacteria | 2504 |
| 356 | Ga0207693_10133293 | 3300025915 | Unclassified | 1953 |
| 357 | Ga0207693_10260561 | 3300025915 | Bacteria | 1360 |
| 358 | Ga0207663_10018537 | 3300025916 | Bacteria | 3903 |
| 359 | Ga0207663_10206541 | 3300025916 | Bacteria | 1420 |
| 360 | Ga0207663_10591227 | 3300025916 | Bacteria | 871 |
| 361 | Ga0207660_10166044 | 3300025917 | Bacteria | 1706 |
| 362 | Ga0207660_10389185 | 3300025917 | Bacteria | 1121 |
| 363 | Ga0207660_10531442 | 3300025917 | Unclassified | 956 |
| 364 | Ga0207660_10598292 | 3300025917 | Bacteria | 898 |
| 365 | Ga0207662_10052521 | 3300025918 | Bacteria | 2426 |
| 366 | Ga0207662_10113565 | 3300025918 | Bacteria | 1691 |
| 367 | Ga0207657_10018316 | 3300025919 | Bacteria | 6690 |
| 368 | Ga0207657_10035789 | 3300025919 | Bacteria | 4448 |
| 369 | Ga0207657_10154981 | 3300025919 | Unclassified | 1863 |
| 370 | Ga0207657_10263094 | 3300025919 | Bacteria | 1372 |
| 371 | Ga0207657_10265363 | 3300025919 | Unclassified | 1366 |
| 372 | Ga0207652_10033976 | 3300025921 | Bacteria | 4296 |
| 373 | Ga0207652_10085498 | 3300025921 | Bacteria | 2764 |
| 374 | Ga0207652_10095554 | 3300025921 | Bacteria | 2618 |
| 375 | Ga0207652_10222279 | 3300025921 | Bacteria | 1702 |
| 376 | Ga0207652_10395808 | 3300025921 | Bacteria | 1247 |
| 377 | Ga0207652_10544131 | 3300025921 | Bacteria | 1044 |
| 378 | Ga0207652_10781251 | 3300025921 | Bacteria | 849 |
| 379 | Ga0207646_10004754 | 3300025922 | Bacteria | 14617 |
| 380 | Ga0207681_10075384 | 3300025923 | Bacteria | 2366 |
| 381 | Ga0207681_10275352 | 3300025923 | Unclassified | 1323 |
| 382 | Ga0207694_10206046 | 3300025924 | Bacteria | 1601 |
| 383 | Ga0207659_10786129 | 3300025926 | Unclassified | 817 |
| 384 | Ga0207687_10032741 | 3300025927 | Bacteria | 3522 |
| 385 | Ga0207687_10095930 | 3300025927 | Unclassified | 2173 |
| 386 | Ga0207687_10425650 | 3300025927 | Bacteria | 1096 |
| 387 | Ga0207687_10468041 | 3300025927 | Bacteria | 1048 |
| 388 | Ga0207687_10700497 | 3300025927 | Bacteria | 860 |
| 389 | Ga0207687_10771112 | 3300025927 | Unclassified | 819 |
| 390 | Ga0207700_10000012 | 3300025928 | Bacteria | 231712 |
| 391 | Ga0207700_10027791 | 3300025928 | Bacteria | 3967 |
| 392 | Ga0207700_10261855 | 3300025928 | Bacteria | 1481 |
| 393 | Ga0207700_10814211 | 3300025928 | Unclassified | 835 |
| 394 | Ga0207700_10903141 | 3300025928 | Bacteria | 790 |
| 395 | Ga0207664_10104993 | 3300025929 | Unclassified | 2340 |
| 396 | Ga0207664_10367602 | 3300025929 | Bacteria | 1275 |
| 397 | Ga0207644_10032820 | 3300025931 | Bacteria | 3625 |
| 398 | Ga0207644_10564591 | 3300025931 | Bacteria | 943 |
| 399 | Ga0207644_10712363 | 3300025931 | Unclassified | 837 |
| 400 | Ga0207644_10765776 | 3300025931 | Bacteria | 807 |
| 401 | Ga0207690_10142735 | 3300025932 | Bacteria | 1766 |
| 402 | Ga0207690_10177891 | 3300025932 | Unclassified | 1599 |
| 403 | Ga0207690_10265516 | 3300025932 | Bacteria | 1331 |
| 404 | Ga0207706_10013777 | 3300025933 | Bacteria | 7338 |
| 405 | Ga0207706_10019694 | 3300025933 | Bacteria | 6070 |
| 406 | Ga0207706_10074063 | 3300025933 | Bacteria | 2994 |
| 407 | Ga0207706_10100925 | 3300025933 | Bacteria | 2538 |
| 408 | Ga0207686_10020162 | 3300025934 | Bacteria | 3805 |
| 409 | Ga0207686_10183325 | 3300025934 | Bacteria | 1486 |
| 410 | Ga0207686_10223699 | 3300025934 | Bacteria | 1360 |
| 411 | Ga0207709_10023590 | 3300025935 | Bacteria | 3504 |
| 412 | Ga0207709_10719549 | 3300025935 | Bacteria | 800 |
| 413 | Ga0207669_10049378 | 3300025937 | Bacteria | 2507 |
| 414 | Ga0207669_10316787 | 3300025937 | Bacteria | 1192 |
| 415 | Ga0207669_10411852 | 3300025937 | Bacteria | 1061 |
| 416 | Ga0207704_10349596 | 3300025938 | Unclassified | 1151 |
| 417 | Ga0207704_10397694 | 3300025938 | Unclassified | 1086 |
| 418 | Ga0207704_10554091 | 3300025938 | Bacteria | 935 |
| 419 | Ga0207665_10002331 | 3300025939 | Bacteria | 12821 |
| 420 | Ga0207665_10133745 | 3300025939 | Bacteria | 1763 |
| 421 | Ga0207665_10143417 | 3300025939 | Bacteria | 1705 |
| 422 | Ga0207691_10012724 | 3300025940 | Bacteria | 8060 |
| 423 | Ga0207691_10152850 | 3300025940 | Bacteria | 2028 |
| 424 | Ga0207691_10461791 | 3300025940 | Bacteria | 1080 |
| 425 | Ga0207711_10043564 | 3300025941 | Bacteria | 3829 |
| 426 | Ga0207711_10103030 | 3300025941 | Unclassified | 2527 |
| 427 | Ga0207711_10286584 | 3300025941 | Bacteria | 1517 |
| 428 | Ga0207689_10237562 | 3300025942 | Bacteria | 1506 |
| 429 | Ga0207689_10776620 | 3300025942 | Bacteria | 809 |
| 430 | Ga0207661_10021791 | 3300025944 | Bacteria | 4809 |
| 431 | Ga0207661_10027531 | 3300025944 | Bacteria | 4343 |
| 432 | Ga0207661_10146769 | 3300025944 | Unclassified | 2036 |
| 433 | Ga0207661_10865088 | 3300025944 | Bacteria | 832 |
| 434 | Ga0207667_10079951 | 3300025949 | Bacteria | 3388 |
| 435 | Ga0207667_10260540 | 3300025949 | Unclassified | 1773 |
| 436 | Ga0207667_10616796 | 3300025949 | Bacteria | 1093 |
| 437 | Ga0207651_10113534 | 3300025960 | Bacteria | 2039 |
| 438 | Ga0207651_10170961 | 3300025960 | Bacteria | 1714 |
| 439 | Ga0207712_10019116 | 3300025961 | Bacteria | 4470 |
| 440 | Ga0207712_10271035 | 3300025961 | Bacteria | 1381 |
| 441 | Ga0207712_10501378 | 3300025961 | Unclassified | 1038 |
| 442 | Ga0207712_10508820 | 3300025961 | Bacteria | 1030 |
| 443 | Ga0207668_10016734 | 3300025972 | Bacteria | 4583 |
| 444 | Ga0207668_10103536 | 3300025972 | Unclassified | 2120 |
| 445 | Ga0207668_10147700 | 3300025972 | Bacteria | 1816 |
| 446 | Ga0207668_10592327 | 3300025972 | Bacteria | 965 |
| 447 | Ga0207640_10020585 | 3300025981 | Bacteria | 3919 |
| 448 | Ga0207640_10148026 | 3300025981 | Bacteria | 1721 |
| 449 | Ga0207640_10388094 | 3300025981 | Unclassified | 1133 |
| 450 | Ga0207640_10761636 | 3300025981 | Bacteria | 836 |
| 451 | Ga0207658_10027533 | 3300025986 | Bacteria | 3994 |
| 452 | Ga0207677_10042661 | 3300026023 | Bacteria | 3010 |
| 453 | Ga0207677_10081964 | 3300026023 | Bacteria | 2317 |
| 454 | Ga0207677_10401355 | 3300026023 | Bacteria | 1163 |
| 455 | Ga0207677_10640420 | 3300026023 | Unclassified | 937 |
| 456 | Ga0207677_10677628 | 3300026023 | Bacteria | 913 |
| 457 | Ga0207639_10146947 | 3300026041 | Bacteria | 1970 |
| 458 | Ga0207639_10432293 | 3300026041 | Bacteria | 1192 |
| 459 | Ga0207639_11570071 | 3300026041 | Unclassified | 617 |
| 460 | Ga0207678_10056638 | 3300026067 | Bacteria | 3374 |
| 461 | Ga0207678_10109148 | 3300026067 | Bacteria | 2360 |
| 462 | Ga0207708_10000175 | 3300026075 | Bacteria | 51009 |
| 463 | Ga0207708_10006370 | 3300026075 | Bacteria | 8744 |
| 464 | Ga0207708_10183328 | 3300026075 | Unclassified | 1663 |
| 465 | Ga0207702_10003163 | 3300026078 | Bacteria | 15239 |
| 466 | Ga0207702_10084845 | 3300026078 | Bacteria | 2758 |
| 467 | Ga0207702_10691744 | 3300026078 | Bacteria | 1005 |
| 468 | Ga0207702_11206376 | 3300026078 | Bacteria | 751 |
| 469 | Ga0207648_10003615 | 3300026089 | Bacteria | 16166 |
| 470 | Ga0207648_10007149 | 3300026089 | Bacteria | 11008 |
| 471 | Ga0207648_10047623 | 3300026089 | Bacteria | 3757 |
| 472 | Ga0207648_10229797 | 3300026089 | Bacteria | 1650 |
| 473 | Ga0207675_100009257 | 3300026118 | Bacteria | 9237 |
| 474 | Ga0207675_100027540 | 3300026118 | Bacteria | 5293 |
| 475 | Ga0207675_100049930 | 3300026118 | Bacteria | 3904 |
| 476 | Ga0207675_100402352 | 3300026118 | Unclassified | 1349 |
| 477 | Ga0207675_101179540 | 3300026118 | Bacteria | 786 |
| 478 | Ga0207683_10000262 | 3300026121 | Bacteria | 47039 |
| 479 | Ga0207683_10015746 | 3300026121 | Bacteria | 6435 |
| 480 | Ga0207683_10019455 | 3300026121 | Bacteria | 5798 |
| 481 | Ga0207698_10125935 | 3300026142 | Bacteria | 2178 |
| 482 | Ga0207698_10326450 | 3300026142 | Bacteria | 1440 |
| 483 | Ga0207698_10682998 | 3300026142 | Bacteria | 1020 |
| 484 | Ga0209966_1023984 | 3300027695 | Bacteria | 1202 |
| 485 | Ga0209998_10054456 | 3300027717 | Bacteria | 932 |
| 486 | Ga0207428_10000393 | 3300027907 | Bacteria | 54718 |
| 487 | Ga0207428_10214372 | 3300027907 | Unclassified | 1446 |
| 488 | Ga0207428_10220516 | 3300027907 | Bacteria | 1422 |
| 489 | Ga0268266_10074578 | 3300028379 | Bacteria | 2946 |
| 490 | Ga0268266_10835382 | 3300028379 | Unclassified | 890 |
| 491 | Ga0268265_10147929 | 3300028380 | Bacteria | 1977 |
| 492 | Ga0268265_10249917 | 3300028380 | Unclassified | 1570 |
| 493 | Ga0268265_10291215 | 3300028380 | Bacteria | 1466 |
| 494 | Ga0265326_10020351 | 3300028558 | Bacteria | 1902 |
| 495 | Ga0265319_1001962 | 3300028563 | Bacteria | 11635 |
| 496 | Ga0265319_1039328 | 3300028563 | Bacteria | 1604 |
| 497 | Ga0265334_10003181 | 3300028573 | Bacteria | 7491 |
| 498 | Ga0265318_10000763 | 3300028577 | Bacteria | 21445 |
| 499 | Ga0265318_10024911 | 3300028577 | Bacteria | 2368 |
| 500 | Ga0265322_10005010 | 3300028654 | Bacteria | 3929 |
| 501 | Ga0265336_10106903 | 3300028666 | Bacteria | 833 |
| 502 | Ga0265338_10011874 | 3300028800 | Bacteria | 10003 |
| 503 | Ga0265330_10001649 | 3300031235 | Bacteria | 12689 |
| 504 | Ga0265332_10012147 | 3300031238 | Bacteria | 3821 |
| 505 | Ga0265328_10001855 | 3300031239 | Bacteria | 9615 |
| 506 | Ga0265320_10174264 | 3300031240 | Bacteria | 966 |
| 507 | Ga0265325_10000898 | 3300031241 | Bacteria | 21506 |
| 508 | Ga0265329_10000962 | 3300031242 | Bacteria | 14473 |
| 509 | Ga0265340_10190656 | 3300031247 | Bacteria | 924 |
| 510 | Ga0265339_10001348 | 3300031249 | Bacteria | 18335 |
| 511 | Ga0265331_10027555 | 3300031250 | Bacteria | 2847 |
| 512 | Ga0265327_10006633 | 3300031251 | Bacteria | 9196 |
| 513 | Ga0265316_10003611 | 3300031344 | Bacteria | 15598 |
| 514 | Ga0307408_100299234 | 3300031548 | Bacteria | 1347 |
| 515 | Ga0265313_10009137 | 3300031595 | Bacteria | 6475 |
| 516 | Ga0265314_10023334 | 3300031711 | Bacteria | 4718 |
| 517 | Ga0265342_10005695 | 3300031712 | Bacteria | 9422 |
| 518 | Ga0307409_100022466 | 3300031995 | Bacteria | 4351 |
| 519 | Ga0307409_100283998 | 3300031995 | Bacteria | 1531 |
| 520 | Ga0307416_100225927 | 3300032002 | Bacteria | 1800 |
| 521 | Ga0307416_101164789 | 3300032002 | Bacteria | 876 |
| 522 | Ga0373959_0005884 | 3300034820 | Unclassified | 2019 |
| 523 | Ga0373938_0010597 | 3300034957 | Unclassified | 1698 |
| 524 | Ga0373944_0181984 | 3300035089 | Unclassified | 754 |
| 525 | Ga0373949_0056289 | 3300035090 | Bacteria | 1002 |
| 526 | Ga0373952_0095273 | 3300035092 | Unclassified | 778 |
| 527 | Ga0373923_0099444 | 3300035111 | Bacteria | 1281 |
| 528 | Ga0373932_0000805 | 3300035112 | Bacteria | 9305 |
| 529 | Ga0373939_0012636 | 3300035114 | Bacteria | 2156 |
| 530 | Ga0373941_0015840 | 3300035115 | Unclassified | 2039 |
| 531 | Ga0373945_0011615 | 3300035116 | Bacteria | 2914 |
| 532 | Ga0373954_0051622 | 3300035118 | Bacteria | 1932 |
| 533 | Ga0373943_0003634 | 3300035170 | Bacteria | 7015 |
| 534 | Ga0373943_0229323 | 3300035170 | Bacteria | 1037 |
| 535 | Ga0373946_0022000 | 3300035171 | Bacteria | 2478 |
| 536 | Ga0373942_0005122 | 3300035207 | Bacteria | 3038 |
| 537 | Ga0373961_0004135 | 3300035241 | Bacteria | 3528 |
| 538 | Ga0373961_0085988 | 3300035241 | Bacteria | 997 |
| 539 | Ga0373962_0001785 | 3300035242 | Bacteria | 5122 |
| 540 | Ga0373931_0024324 | 3300035691 | Bacteria | 3067 |
| 541 | Ga0373935_0027777 | 3300035692 | Bacteria | 3497 |
| 542 | Ga0373935_0375447 | 3300035692 | Bacteria | 1017 |
| 543 | Ga0373927_0365112 | 3300035695 | Bacteria | 952 |
| 544 | Ga0373933_0075452 | 3300035724 | Bacteria | 2058 |
| 545 | Ga0373947_0000314 | 3300035725 | Bacteria | 27460 |
| 546 | Ga0373937_0014786 | 3300036401 | Bacteria | 6891 |
| 547 | Ga0373925_0086199 | 3300037068 | Bacteria | 2395 |
| 548 | Ga0395899_0002328 | 3300037312 | Bacteria | 15466 |
| 549 | Ga0395899_0008848 | 3300037312 | Bacteria | 7751 |
| 550 | Ga0395899_0017197 | 3300037312 | Bacteria | 5509 |
| 551 | Ga0395899_0019160 | 3300037312 | Bacteria | 5200 |
| 552 | Ga0395899_0034736 | 3300037312 | Bacteria | 3787 |
| 553 | Ga0395899_0048925 | 3300037312 | Bacteria | 3144 |
| 554 | Ga0395899_0082840 | 3300037312 | Bacteria | 2333 |
| 555 | Ga0395899_0597288 | 3300037312 | Bacteria | 703 |
| 556 | Ga0395900_0001263 | 3300037418 | Bacteria | 30958 |
| 557 | Ga0395900_0003884 | 3300037418 | Bacteria | 15963 |
| 558 | Ga0395900_0012108 | 3300037418 | Bacteria | 8813 |
| 559 | Ga0395900_0013277 | 3300037418 | Bacteria | 8421 |
| 560 | Ga0395900_0015920 | 3300037418 | Bacteria | 7662 |
| 561 | Ga0395900_0016765 | 3300037418 | Bacteria | 7474 |
| 562 | Ga0395900_0017668 | 3300037418 | Bacteria | 7280 |
| 563 | Ga0395900_0032176 | 3300037418 | Bacteria | 5392 |
| 564 | Ga0395900_0057474 | 3300037418 | Bacteria | 4005 |
| 565 | Ga0395900_0073073 | 3300037418 | Bacteria | 3525 |
| 566 | Ga0395900_0084621 | 3300037418 | Bacteria | 3259 |
| 567 | Ga0395900_0147603 | 3300037418 | Bacteria | 2404 |
| 568 | Ga0395900_0163328 | 3300037418 | Bacteria | 2271 |
| 569 | Ga0395900_0165407 | 3300037418 | Bacteria | 2254 |
| 570 | Ga0395900_0272331 | 3300037418 | Unclassified | 1687 |
| 571 | Ga0395900_0308994 | 3300037418 | Bacteria | 1565 |
| 572 | Ga0395900_0342518 | 3300037418 | Bacteria | 1470 |
| 573 | Ga0395900_0488439 | 3300037418 | Bacteria | 1183 |
| 574 | Ga0395898_0000795 | 3300037466 | Bacteria | 53570 |
| 575 | Ga0395898_0003109 | 3300037466 | Bacteria | 18756 |
| 576 | Ga0395898_0005023 | 3300037466 | Bacteria | 14355 |
| 577 | Ga0395898_0008806 | 3300037466 | Bacteria | 10635 |
| 578 | Ga0395898_0011621 | 3300037466 | Bacteria | 9138 |
| 579 | Ga0395898_0021770 | 3300037466 | Bacteria | 6496 |
| 580 | Ga0395898_0046693 | 3300037466 | Bacteria | 4253 |
| 581 | Ga0395898_0047124 | 3300037466 | Bacteria | 4231 |
| 582 | Ga0395898_0050550 | 3300037466 | Bacteria | 4068 |
| 583 | Ga0395898_0057602 | 3300037466 | Bacteria | 3786 |
| 584 | Ga0395898_0074401 | 3300037466 | Bacteria | 3281 |
| 585 | Ga0395898_0114970 | 3300037466 | Bacteria | 2578 |
| 586 | Ga0395898_0133857 | 3300037466 | Bacteria | 2373 |
| 587 | Ga0395898_0140341 | 3300037466 | Bacteria | 2313 |
| 588 | Ga0395898_0181598 | 3300037466 | Bacteria | 2011 |
| 589 | Ga0395898_0196714 | 3300037466 | Bacteria | 1925 |
| 590 | Ga0395898_0816790 | 3300037466 | Bacteria | 872 |
| 591 | Ga0395898_1111471 | 3300037466 | Bacteria | 723 |
| 592 | Ga0395905_0001754 | 3300037471 | Bacteria | 25323 |
| 593 | Ga0395905_0008400 | 3300037471 | Bacteria | 10183 |
| 594 | Ga0395905_0009628 | 3300037471 | Bacteria | 9434 |
| 595 | Ga0395905_0040397 | 3300037471 | Unclassified | 4376 |
| 596 | Ga0395905_0089682 | 3300037471 | Bacteria | 2882 |
| 597 | Ga0395905_0114307 | 3300037471 | Bacteria | 2536 |
| 598 | Ga0395905_0166755 | 3300037471 | Bacteria | 2070 |
| 599 | Ga0395905_0174670 | 3300037471 | Bacteria | 2017 |
| 600 | Ga0395905_0176858 | 3300037471 | Unclassified | 2003 |
| 601 | Ga0395905_0209834 | 3300037471 | Unclassified | 1825 |
| 602 | Ga0395905_0454544 | 3300037471 | Bacteria | 1179 |
| 603 | Ga0395905_0647638 | 3300037471 | Bacteria | 958 |
| 604 | Ga0395905_1182152 | 3300037471 | Bacteria | 668 |
| 605 | Ga0395901_0001285 | 3300038443 | Bacteria | 26611 |
| 606 | Ga0395901_0002495 | 3300038443 | Bacteria | 18640 |
| 607 | Ga0395901_0002904 | 3300038443 | Bacteria | 17304 |
| 608 | Ga0395901_0003483 | 3300038443 | Bacteria | 15858 |
| 609 | Ga0395901_0004004 | 3300038443 | Bacteria | 14844 |
| 610 | Ga0395901_0007931 | 3300038443 | Bacteria | 10713 |
| 611 | Ga0395901_0008757 | 3300038443 | Bacteria | 10236 |
| 612 | Ga0395901_0017247 | 3300038443 | Bacteria | 7369 |
| 613 | Ga0395901_0033342 | 3300038443 | Bacteria | 5316 |
| 614 | Ga0395901_0033907 | 3300038443 | Bacteria | 5271 |
| 615 | Ga0395901_0048456 | 3300038443 | Bacteria | 4412 |
| 616 | Ga0395901_0105912 | 3300038443 | Bacteria | 2951 |
| 617 | Ga0395901_0107438 | 3300038443 | Unclassified | 2929 |
| 618 | Ga0395901_0165489 | 3300038443 | Bacteria | 2322 |
| 619 | Ga0395901_0169402 | 3300038443 | Bacteria | 2291 |
| 620 | Ga0395901_0190263 | 3300038443 | Bacteria | 2152 |
| 621 | Ga0395901_0219304 | 3300038443 | Bacteria | 1989 |
| 622 | Ga0395901_0320523 | 3300038443 | Bacteria | 1604 |
| 623 | Ga0395901_0346395 | 3300038443 | Unclassified | 1534 |
| 624 | Ga0395901_0357515 | 3300038443 | Bacteria | 1506 |
| 625 | Ga0395901_0605572 | 3300038443 | Unclassified | 1104 |
| 626 | Ga0395901_0620698 | 3300038443 | Bacteria | 1088 |
| 627 | Ga0395901_0815729 | 3300038443 | Archaea | 921 |
| 628 | Ga0242420_049641 | 3300038996 | Bacteria | 818 |
| 629 | Ga0436365_0743313 | 3300039437 | Bacteria | 1309 |
| 630 | Ga0436365_1798734 | 3300039437 | Bacteria | 4490 |
| 631 | Ga0436365_1801267 | 3300039437 | Bacteria | 1213 |
| 632 | Ga0436363_1520249 | 3300039450 | Bacteria | 677 |
| 633 | Ga0439439_0008244 | 3300041406 | Bacteria | 2456 |
| 634 | Ga0439466_0037571 | 3300041411 | Bacteria | 1630 |
| 635 | Ga0439466_0063809 | 3300041411 | Bacteria | 1182 |
| 636 | Ga0451789_0065020 | 3300041443 | Unclassified | 752 |
| 637 | Ga0451807_1348963 | 3300041486 | Bacteria | 625 |
| 638 | Ga0451839_1592671 | 3300041496 | Bacteria | 906 |
| 639 | Ga0451847_0201225 | 3300041503 | Bacteria | 720 |
| 640 | Ga0451855_0694291 | 3300041511 | Bacteria | 804 |
| 641 | Ga0451853_0760541 | 3300041512 | Bacteria | 1436 |
| 642 | Ga0451853_1207260 | 3300041512 | Bacteria | 1125 |
| 643 | Ga0451853_2700457 | 3300041512 | Bacteria | 3479 |
| 644 | Ga0439431_0006929 | 3300041997 | Bacteria | 2520 |
| 645 | Ga0439433_0002716 | 3300041999 | Bacteria | 3764 |
| 646 | Ga0439442_027482 | 3300042002 | Bacteria | 1186 |
| 647 | Ga0439442_071850 | 3300042002 | Unclassified | 737 |
| 648 | Ga0439449_0194821 | 3300042007 | Bacteria | 758 |
| 649 | Ga0439450_130448 | 3300042008 | Bacteria | 651 |
| 650 | Ga0439455_0125063 | 3300042012 | Bacteria | 723 |
| 651 | Ga0439457_016954 | 3300042014 | Bacteria | 1620 |
| 652 | Ga0439462_0038104 | 3300042015 | Bacteria | 1282 |
| 653 | Ga0450923_005503 | 3300042125 | Bacteria | 2050 |
| 654 | Ga0450907_006695 | 3300042146 | Unclassified | 1925 |
| 655 | Ga0439446_0006813 | 3300042156 | Bacteria | 2990 |
| 656 | Ga0439434_0006921 | 3300042435 | Bacteria | 3313 |
| 657 | Ga0439460_0193438 | 3300042461 | Bacteria | 691 |
| 658 | Ga0450918_029320 | 3300042531 | Archaea | 970 |
| 659 | Ga0450893_0065350 | 3300042532 | Bacteria | 700 |
| 660 | Ga0466966_0002893 | 3300044684 | Bacteria | 11315 |
| 661 | Ga0466963_0006122 | 3300044694 | Bacteria | 7096 |
| 662 | Ga0466963_0015890 | 3300044694 | Bacteria | 4673 |
| 663 | Ga0466963_0021546 | 3300044694 | Bacteria | 4068 |
| 664 | Ga0466963_0177524 | 3300044694 | Bacteria | 1486 |
| 665 | Ga0466963_0455803 | 3300044694 | Bacteria | 902 |
| 666 | Ga0466964_0002308 | 3300044706 | Bacteria | 6760 |
| 667 | Ga0466964_0058017 | 3300044706 | Bacteria | 1604 |
| 668 | Ga0466964_0403521 | 3300044706 | Bacteria | 715 |
| 669 | Ga0466971_0001183 | 3300044719 | Bacteria | 10830 |
| 670 | Ga0466968_0040251 | 3300044735 | Bacteria | 1970 |
| 671 | Ga0466968_0174154 | 3300044735 | Bacteria | 998 |
| 672 | Ga0466970_0190855 | 3300044765 | Bacteria | 1138 |
| 673 | Ga0466957_0000172 | 3300044842 | Bacteria | 28816 |
| 674 | Ga0466957_0018676 | 3300044842 | Bacteria | 4073 |
| 675 | Ga0466957_0179364 | 3300044842 | Bacteria | 1383 |
| 676 | Ga0466957_0477779 | 3300044842 | Bacteria | 862 |
| 677 | Ga0466959_0087372 | 3300045049 | Bacteria | 2243 |
| 678 | Ga0451576_0095820 | 3300045051 | Bacteria | 3086 |
| 679 | Ga0451576_1079197 | 3300045051 | Bacteria | 840 |
| 680 | Ga0466958_0008417 | 3300045836 | Bacteria | 5720 |
| 681 | Ga0466958_0252451 | 3300045836 | Bacteria | 1128 |
| 682 | Ga0466958_0575119 | 3300045836 | Bacteria | 732 |
| 683 | Ga0466967_0000062 | 3300045976 | Bacteria | 39900 |
| 684 | Ga0466967_0001217 | 3300045976 | Bacteria | 14516 |
| 685 | Ga0466967_0012745 | 3300045976 | Bacteria | 6455 |
| 686 | Ga0466967_0055963 | 3300045976 | Bacteria | 3476 |
| 687 | Ga0466967_0110465 | 3300045976 | Bacteria | 2525 |
| 688 | Ga0466967_0115688 | 3300045976 | Bacteria | 2470 |
| 689 | Ga0466967_0232036 | 3300045976 | Bacteria | 1757 |
| 690 | Ga0495592_0154936 | 3300046454 | Bacteria | 1581 |
| 691 | Ga0495603_0013665 | 3300046455 | Bacteria | 4913 |
| 692 | Ga0495603_0187507 | 3300046455 | Unclassified | 1196 |
| 693 | Ga0495603_0425400 | 3300046455 | Bacteria | 761 |
| 694 | Ga0495590_0083959 | 3300046457 | Bacteria | 1123 |
| 695 | Ga0495629_0058452 | 3300046459 | Bacteria | 2696 |
| 696 | Ga0495641_0002427 | 3300046461 | Bacteria | 14724 |
| 697 | Ga0495641_0056794 | 3300046461 | Bacteria | 1774 |
| 698 | Ga0495641_0133491 | 3300046461 | Bacteria | 1108 |
| 699 | Ga0495641_0478505 | 3300046461 | Bacteria | 567 |
| 700 | Ga0495651_0013217 | 3300046462 | Bacteria | 6382 |
| 701 | Ga0495653_0011531 | 3300046463 | Bacteria | 7219 |
| 702 | Ga0495580_0259824 | 3300046472 | Bacteria | 1188 |
| 703 | Ga0495582_0055905 | 3300046473 | Bacteria | 2175 |
| 704 | Ga0495582_0099260 | 3300046473 | Bacteria | 1629 |
| 705 | Ga0495605_0009094 | 3300046474 | Bacteria | 5590 |
| 706 | Ga0495605_0143886 | 3300046474 | Bacteria | 1068 |
| 707 | Ga0495605_0435386 | 3300046474 | Bacteria | 542 |
| 708 | Ga0495639_0065322 | 3300046475 | Unclassified | 1673 |
| 709 | Ga0495639_0196383 | 3300046475 | Bacteria | 986 |
| 710 | Ga0495662_0020522 | 3300046476 | Bacteria | 3197 |
| 711 | Ga0495584_0045644 | 3300046491 | Bacteria | 2210 |
| 712 | Ga0495584_0082068 | 3300046491 | Bacteria | 1623 |
| 713 | Ga0495584_0460903 | 3300046491 | Bacteria | 647 |
| 714 | Ga0495594_0000171 | 3300046499 | Bacteria | 31144 |
| 715 | Ga0495594_0085494 | 3300046499 | Bacteria | 1764 |
| 716 | Ga0495596_0021456 | 3300046500 | Unclassified | 2636 |
| 717 | Ga0495596_0315405 | 3300046500 | Unclassified | 608 |
| 718 | Ga0495607_0219680 | 3300046501 | Bacteria | 930 |
| 719 | Ga0495583_0220418 | 3300046506 | Bacteria | 767 |
| 720 | Ga0495608_0020844 | 3300046511 | Bacteria | 4503 |
| 721 | Ga0495616_0472862 | 3300046513 | Unclassified | 505 |
| 722 | Ga0495630_0009471 | 3300046517 | Bacteria | 7008 |
| 723 | Ga0495630_0015958 | 3300046517 | Bacteria | 5487 |
| 724 | Ga0495630_0345578 | 3300046517 | Bacteria | 1139 |
| 725 | Ga0495630_0346281 | 3300046517 | Bacteria | 1137 |
| 726 | Ga0495630_0418887 | 3300046517 | Bacteria | 1026 |
| 727 | Ga0495631_0193216 | 3300046518 | Bacteria | 871 |
| 728 | Ga0495631_0253030 | 3300046518 | Bacteria | 751 |
| 729 | Ga0495644_0060146 | 3300046523 | Bacteria | 1428 |
| 730 | Ga0495644_0278303 | 3300046523 | Bacteria | 652 |
| 731 | Ga0495663_0003027 | 3300046525 | Bacteria | 4932 |
| 732 | Ga0495663_0045348 | 3300046525 | Bacteria | 1348 |
| 733 | Ga0495663_0122039 | 3300046525 | Unclassified | 873 |
| 734 | Ga0495666_0296326 | 3300046526 | Unclassified | 732 |
| 735 | Ga0495642_0002088 | 3300046528 | Bacteria | 8279 |
| 736 | Ga0495642_0099725 | 3300046528 | Bacteria | 1235 |
| 737 | Ga0495642_0156571 | 3300046528 | Bacteria | 987 |
| 738 | Ga0495642_0303545 | 3300046528 | Unclassified | 700 |
| 739 | Ga0495652_0002840 | 3300046529 | Bacteria | 17452 |
| 740 | Ga0495640_0068395 | 3300046533 | Bacteria | 2390 |
| 741 | Ga0495587_0007924 | 3300046536 | Bacteria | 6861 |
| 742 | Ga0495587_0552710 | 3300046536 | Bacteria | 635 |
| 743 | Ga0495609_0045743 | 3300046538 | Bacteria | 1961 |
| 744 | Ga0495609_0123002 | 3300046538 | Bacteria | 1115 |
| 745 | Ga0495609_0224140 | 3300046538 | Bacteria | 780 |
| 746 | Ga0495609_0365385 | 3300046538 | Bacteria | 581 |
| 747 | Ga0495645_0023584 | 3300046543 | Bacteria | 4457 |
| 748 | Ga0495645_0346611 | 3300046543 | Bacteria | 958 |
| 749 | Ga0495667_0038593 | 3300046559 | Bacteria | 3179 |
| 750 | Ga0495656_0026254 | 3300046615 | Bacteria | 2317 |
| 751 | Ga0495656_0394153 | 3300046615 | Bacteria | 723 |
| 752 | Ga0495668_0720180 | 3300046616 | Bacteria | 552 |
| 753 | Ga0495611_0248735 | 3300046648 | Bacteria | 824 |
| 754 | Ga0495635_0031752 | 3300046663 | Bacteria | 3665 |
| 755 | Ga0495659_0190149 | 3300046664 | Bacteria | 839 |
| 756 | Ga0495661_0104833 | 3300046665 | Bacteria | 1585 |
| 757 | Ga0495588_0000386 | 3300046674 | Bacteria | 25212 |
| 758 | Ga0495657_0003397 | 3300046675 | Bacteria | 13004 |
| 759 | Ga0495657_0194305 | 3300046675 | Bacteria | 1239 |
| 760 | Ga0495599_0010250 | 3300046678 | Bacteria | 5735 |
| 761 | Ga0495599_0515971 | 3300046678 | Bacteria | 702 |
| 762 | Ga0495623_0034680 | 3300046679 | Bacteria | 3235 |
| 763 | Ga0495646_0022243 | 3300046680 | Bacteria | 4000 |
| 764 | Ga0495647_0045355 | 3300046681 | Bacteria | 1688 |
| 765 | Ga0495658_0028785 | 3300046683 | Bacteria | 3001 |
| 766 | Ga0495658_0048880 | 3300046683 | Unclassified | 2387 |
| 767 | Ga0495658_0353203 | 3300046683 | Bacteria | 934 |
| 768 | Ga0495669_0334383 | 3300046684 | Bacteria | 732 |
| 769 | Ga0495613_0103944 | 3300046689 | Bacteria | 2051 |
| 770 | Ga0495613_0184033 | 3300046689 | Bacteria | 1479 |
| 771 | Ga0495624_0076333 | 3300046690 | Bacteria | 2079 |
| 772 | Ga0495624_0145038 | 3300046690 | Bacteria | 1453 |
| 773 | Ga0495624_0221241 | 3300046690 | Bacteria | 1148 |
| 774 | Ga0495624_0821159 | 3300046690 | Bacteria | 549 |
| 775 | Ga0495624_0823505 | 3300046690 | Bacteria | 548 |
| 776 | Ga0495670_0315457 | 3300046691 | Unclassified | 839 |
| 777 | Ga0495671_0084333 | 3300046692 | Bacteria | 1557 |
| 778 | Ga0495671_0226442 | 3300046692 | Bacteria | 905 |
| 779 | Ga0495589_0010061 | 3300046794 | Bacteria | 4915 |
| 780 | Ga0495589_0135727 | 3300046794 | Bacteria | 1180 |
| 781 | Ga0495589_0335318 | 3300046794 | Bacteria | 698 |
| 782 | Ga0495589_0449170 | 3300046794 | Unclassified | 590 |
| 783 | Ga0495600_0044372 | 3300046809 | Bacteria | 2900 |
| 784 | Ga0495660_0229894 | 3300046810 | Bacteria | 870 |
| 785 | Ga0495581_0017359 | 3300047315 | Bacteria | 4179 |
| 786 | Ga0495581_0331462 | 3300047315 | Bacteria | 889 |
| 787 | Ga0495604_0001936 | 3300047317 | Bacteria | 16754 |
| 788 | Ga0495636_0173937 | 3300047318 | Bacteria | 975 |
| 789 | Ga0495674_0069254 | 3300047319 | Bacteria | 3051 |
| 790 | Ga0495676_0003527 | 3300047321 | Bacteria | 14179 |
| 791 | Ga0495676_0017547 | 3300047321 | Bacteria | 6325 |
| 792 | Ga0495676_0182116 | 3300047321 | Bacteria | 1472 |
| 793 | Ga0495680_0033080 | 3300047322 | Bacteria | 4190 |
| 794 | Ga0495680_0195194 | 3300047322 | Bacteria | 1455 |
| 795 | Ga0495675_0063810 | 3300047444 | Bacteria | 2330 |
| 796 | Ga0495677_0055792 | 3300047445 | Bacteria | 1458 |
| 797 | Ga0495677_0056263 | 3300047445 | Bacteria | 1453 |
| 798 | Ga0495677_0064247 | 3300047445 | Bacteria | 1364 |
| 799 | Ga0495685_016530 | 3300047447 | Bacteria | 2521 |
| 800 | Ga0495685_076222 | 3300047447 | Bacteria | 1120 |
| 801 | Ga0495685_092487 | 3300047447 | Bacteria | 1002 |
| 802 | Ga0495684_0029798 | 3300047471 | Bacteria | 4188 |
| 803 | Ga0495684_0765781 | 3300047471 | Bacteria | 634 |
| 804 | Ga0495602_0132456 | 3300048088 | Bacteria | 1985 |
| 805 | Ga0495615_0163234 | 3300048090 | Bacteria | 670 |
| 806 | Ga0496100_0011431 | 3300048903 | Bacteria | 5053 |
| 807 | Ga0496100_0018009 | 3300048903 | Bacteria | 4182 |
| 808 | Ga0496100_0024431 | 3300048903 | Bacteria | 3686 |
| 809 | Ga0496100_0066596 | 3300048903 | Unclassified | 2389 |
| 810 | Ga0496100_0236310 | 3300048903 | Bacteria | 1347 |
| 811 | Ga0496100_0243878 | 3300048903 | Bacteria | 1327 |
| 812 | Ga0496100_0316776 | 3300048903 | Bacteria | 1171 |
| 813 | Ga0496100_0561418 | 3300048903 | Unclassified | 884 |
| 814 | Ga0496101_0004718 | 3300048904 | Bacteria | 8634 |
| 815 | Ga0496101_0012082 | 3300048904 | Bacteria | 5754 |
| 816 | Ga0496101_0014818 | 3300048904 | Bacteria | 5245 |
| 817 | Ga0496101_0036178 | 3300048904 | Bacteria | 3496 |
| 818 | Ga0496101_0072202 | 3300048904 | Bacteria | 2533 |
| 819 | Ga0496101_0109334 | 3300048904 | Unclassified | 2079 |
| 820 | Ga0496101_0136164 | 3300048904 | Bacteria | 1869 |
| 821 | Ga0496101_0438588 | 3300048904 | Bacteria | 1030 |
| 822 | Ga0496102_0007615 | 3300048905 | Bacteria | 9252 |
| 823 | Ga0496102_0056788 | 3300048905 | Bacteria | 3572 |
| 824 | Ga0496102_0064400 | 3300048905 | Bacteria | 3357 |
| 825 | Ga0496102_0139887 | 3300048905 | Bacteria | 2269 |
| 826 | Ga0496102_0182774 | 3300048905 | Unclassified | 1975 |
| 827 | Ga0496102_0254501 | 3300048905 | Bacteria | 1655 |
| 828 | Ga0496102_0279178 | 3300048905 | Bacteria | 1575 |
| 829 | Ga0496102_0497953 | 3300048905 | Bacteria | 1140 |
| 830 | Ga0496102_0791465 | 3300048905 | Bacteria | 871 |
| 831 | Ga0496103_0065922 | 3300048906 | Bacteria | 2259 |
| 832 | Ga0496103_0121703 | 3300048906 | Bacteria | 1662 |
| 833 | Ga0496103_0184821 | 3300048906 | Bacteria | 1340 |
| 834 | Ga0496103_0257787 | 3300048906 | Unclassified | 1122 |
| 835 | Ga0496103_0349534 | 3300048906 | Bacteria | 951 |
| 836 | Ga0496104_0006223 | 3300048907 | Bacteria | 10489 |
| 837 | Ga0496104_0016554 | 3300048907 | Bacteria | 6700 |
| 838 | Ga0496104_0076463 | 3300048907 | Bacteria | 3189 |
| 839 | Ga0496104_0178052 | 3300048907 | Bacteria | 2036 |
| 840 | Ga0496104_0225149 | 3300048907 | Unclassified | 1788 |
| 841 | Ga0496105_0001344 | 3300048908 | Bacteria | 17249 |
| 842 | Ga0496105_0015285 | 3300048908 | Bacteria | 6113 |
| 843 | Ga0496105_0025035 | 3300048908 | Bacteria | 4852 |
| 844 | Ga0496105_0063251 | 3300048908 | Bacteria | 3053 |
| 845 | Ga0496105_0135422 | 3300048908 | Bacteria | 2029 |
| 846 | Ga0496105_0159657 | 3300048908 | Unclassified | 1851 |
| 847 | Ga0496105_0293192 | 3300048908 | Bacteria | 1309 |
| 848 | Ga0496105_0600874 | 3300048908 | Bacteria | 854 |
| 849 | Ga0496106_0001942 | 3300048909 | Bacteria | 15504 |
| 850 | Ga0496106_0009234 | 3300048909 | Bacteria | 7285 |
| 851 | Ga0496106_0020978 | 3300048909 | Bacteria | 4848 |
| 852 | Ga0496106_0056148 | 3300048909 | Bacteria | 2976 |
| 853 | Ga0496106_0123737 | 3300048909 | Bacteria | 2023 |
| 854 | Ga0496106_0252282 | 3300048909 | Bacteria | 1411 |
| 855 | Ga0496106_0300110 | 3300048909 | Bacteria | 1288 |
| 856 | Ga0496106_0333159 | 3300048909 | Bacteria | 1219 |
| 857 | Ga0496106_0351089 | 3300048909 | Bacteria | 1185 |
| 858 | Ga0496106_0739175 | 3300048909 | Bacteria | 783 |
| 859 | Ga0496106_1071500 | 3300048909 | Bacteria | 632 |
| 860 | Ga0496107_0010877 | 3300048910 | Bacteria | 6332 |
| 861 | Ga0496107_0020567 | 3300048910 | Bacteria | 4663 |
| 862 | Ga0496107_0025458 | 3300048910 | Bacteria | 4189 |
| 863 | Ga0496107_0028248 | 3300048910 | Bacteria | 3985 |
| 864 | Ga0496107_0039630 | 3300048910 | Bacteria | 3380 |
| 865 | Ga0496107_0056470 | 3300048910 | Bacteria | 2837 |
| 866 | Ga0496107_0089664 | 3300048910 | Unclassified | 2245 |
| 867 | Ga0496108_0011862 | 3300048911 | Bacteria | 7088 |
| 868 | Ga0496108_0015161 | 3300048911 | Bacteria | 6287 |
| 869 | Ga0496108_0024664 | 3300048911 | Bacteria | 4953 |
| 870 | Ga0496108_0104465 | 3300048911 | Bacteria | 2417 |
| 871 | Ga0496108_0157744 | 3300048911 | Bacteria | 1960 |
| 872 | Ga0496108_0261670 | 3300048911 | Bacteria | 1505 |
| 873 | Ga0496108_0267253 | 3300048911 | Bacteria | 1489 |
| 874 | Ga0496108_0900127 | 3300048911 | Bacteria | 759 |
| 875 | Ga0496109_0000913 | 3300048912 | Bacteria | 24554 |
| 876 | Ga0496109_0058013 | 3300048912 | Bacteria | 3535 |
| 877 | Ga0496109_0064688 | 3300048912 | Bacteria | 3347 |
| 878 | Ga0496109_0075434 | 3300048912 | Bacteria | 3100 |
| 879 | Ga0496109_0083517 | 3300048912 | Bacteria | 2945 |
| 880 | Ga0496109_0097449 | 3300048912 | Bacteria | 2726 |
| 881 | Ga0496109_0854787 | 3300048912 | Bacteria | 848 |
| 882 | Ga0496109_1399886 | 3300048912 | Bacteria | 635 |
| 883 | Ga0496109_1493330 | 3300048912 | Bacteria | 611 |
| 884 | Ga0496110_0001323 | 3300048913 | Bacteria | 17783 |
| 885 | Ga0496110_0005540 | 3300048913 | Bacteria | 9913 |
| 886 | Ga0496110_0013468 | 3300048913 | Bacteria | 6763 |
| 887 | Ga0496110_0015440 | 3300048913 | Bacteria | 6355 |
| 888 | Ga0496110_0025466 | 3300048913 | Bacteria | 5056 |
| 889 | Ga0496110_0104457 | 3300048913 | Unclassified | 2541 |
| 890 | Ga0496110_0113523 | 3300048913 | Bacteria | 2437 |
| 891 | Ga0496110_0174569 | 3300048913 | Unclassified | 1950 |
| 892 | Ga0496110_0217762 | 3300048913 | Bacteria | 1736 |
| 893 | Ga0496110_0245990 | 3300048913 | Bacteria | 1628 |
| 894 | Ga0496111_0000279 | 3300048914 | Bacteria | 24824 |
| 895 | Ga0496111_0006459 | 3300048914 | Bacteria | 7615 |
| 896 | Ga0496111_0020698 | 3300048914 | Bacteria | 4584 |
| 897 | Ga0496111_0062988 | 3300048914 | Bacteria | 2689 |
| 898 | Ga0496111_0143221 | 3300048914 | Bacteria | 1771 |
| 899 | Ga0496111_0209134 | 3300048914 | Unclassified | 1449 |
| 900 | Ga0496111_0269679 | 3300048914 | Bacteria | 1263 |
| 901 | Ga0496112_0001437 | 3300048915 | Bacteria | 18279 |
| 902 | Ga0496112_0002718 | 3300048915 | Bacteria | 14318 |
| 903 | Ga0496112_0010447 | 3300048915 | Bacteria | 8421 |
| 904 | Ga0496112_0041781 | 3300048915 | Bacteria | 4486 |
| 905 | Ga0496112_0043018 | 3300048915 | Bacteria | 4421 |
| 906 | Ga0496112_0083847 | 3300048915 | Bacteria | 3153 |
| 907 | Ga0496112_0103471 | 3300048915 | Bacteria | 2817 |
| 908 | Ga0496112_0127625 | 3300048915 | Bacteria | 2514 |
| 909 | Ga0496112_0179421 | 3300048915 | Bacteria | 2081 |
| 910 | Ga0496112_0197406 | 3300048915 | Unclassified | 1972 |
| 911 | Ga0496112_0745717 | 3300048915 | Unclassified | 906 |
| 912 | Ga0496112_0794256 | 3300048915 | Bacteria | 871 |
| 913 | Ga0496113_0014893 | 3300048916 | Bacteria | 5322 |
| 914 | Ga0496113_0061308 | 3300048916 | Bacteria | 2838 |
| 915 | Ga0496113_0068556 | 3300048916 | Bacteria | 2692 |
| 916 | Ga0496113_0074370 | 3300048916 | Bacteria | 2590 |
| 917 | Ga0496113_0104151 | 3300048916 | Bacteria | 2201 |
| 918 | Ga0496114_0011516 | 3300048917 | Bacteria | 7068 |
| 919 | Ga0496114_0029095 | 3300048917 | Bacteria | 4538 |
| 920 | Ga0496114_0034791 | 3300048917 | Bacteria | 4158 |
| 921 | Ga0496114_0062537 | 3300048917 | Bacteria | 3115 |
| 922 | Ga0496114_0073940 | 3300048917 | Unclassified | 2869 |
| 923 | Ga0496114_0116183 | 3300048917 | Bacteria | 2297 |
| 924 | Ga0496114_0194111 | 3300048917 | Bacteria | 1777 |
| 925 | Ga0496114_0536939 | 3300048917 | Bacteria | 1034 |
| 926 | Ga0496114_0763085 | 3300048917 | Bacteria | 845 |
| 927 | Ga0496115_0017636 | 3300048918 | Bacteria | 5465 |
| 928 | Ga0496115_0113172 | 3300048918 | Bacteria | 2230 |
| 929 | Ga0496115_0113700 | 3300048918 | Bacteria | 2224 |
| 930 | Ga0496115_0219767 | 3300048918 | Bacteria | 1568 |
| 931 | Ga0496115_0560883 | 3300048918 | Bacteria | 912 |
| 932 | Ga0496115_0937954 | 3300048918 | Bacteria | 665 |
| 933 | Ga0501031_0001876 | 3300049568 | Bacteria | 13227 |
| 934 | Ga0501031_0007046 | 3300049568 | Bacteria | 7338 |
| 935 | Ga0501032_0024392 | 3300049569 | Bacteria | 4177 |
| 936 | Ga0501032_0372007 | 3300049569 | Unclassified | 919 |
| 937 | Ga0501033_0032602 | 3300049570 | Bacteria | 3912 |
| 938 | Ga0501033_0068194 | 3300049570 | Bacteria | 2616 |
| 939 | Ga0501033_0648617 | 3300049570 | Bacteria | 721 |
| 940 | Ga0501034_0448665 | 3300049571 | Unclassified | 1208 |
| 941 | Ga0501034_0513907 | 3300049571 | Unclassified | 1110 |
| 942 | Ga0501036_0001385 | 3300049572 | Bacteria | 18625 |
| 943 | Ga0501036_0003628 | 3300049572 | Bacteria | 12345 |
| 944 | Ga0501036_0004340 | 3300049572 | Bacteria | 11447 |
| 945 | Ga0501036_0103810 | 3300049572 | Unclassified | 2403 |
| 946 | Ga0501036_0146505 | 3300049572 | Unclassified | 1992 |
| 947 | Ga0501037_0033208 | 3300049573 | Bacteria | 3812 |
| 948 | Ga0501037_0098213 | 3300049573 | Bacteria | 2115 |
| 949 | Ga0501038_0004936 | 3300049574 | Bacteria | 12387 |
| 950 | Ga0501038_0056573 | 3300049574 | Bacteria | 3368 |
| 951 | Ga0501038_0106549 | 3300049574 | Bacteria | 2326 |
| 952 | Ga0501039_0006146 | 3300049575 | Bacteria | 9118 |
| 953 | Ga0501039_0008532 | 3300049575 | Bacteria | 7814 |
| 954 | Ga0501039_0017649 | 3300049575 | Bacteria | 5474 |
| 955 | Ga0501039_0033282 | 3300049575 | Bacteria | 3975 |
| 956 | Ga0501040_0008104 | 3300049576 | Bacteria | 6824 |
| 957 | Ga0501040_0013666 | 3300049576 | Bacteria | 5338 |
| 958 | Ga0501040_0017114 | 3300049576 | Bacteria | 4810 |
| 959 | Ga0501040_0052337 | 3300049576 | Bacteria | 2794 |
| 960 | Ga0501040_0731299 | 3300049576 | Unclassified | 716 |
| 961 | Ga0501041_0014081 | 3300049577 | Bacteria | 4746 |
| 962 | Ga0501041_0024075 | 3300049577 | Bacteria | 3653 |
| 963 | Ga0501041_0430070 | 3300049577 | Bacteria | 837 |
| 964 | Ga0501042_0000412 | 3300049578 | Bacteria | 21669 |
| 965 | Ga0501042_0009943 | 3300049578 | Bacteria | 6356 |
| 966 | Ga0501042_0012097 | 3300049578 | Bacteria | 5839 |
| 967 | Ga0501042_0016310 | 3300049578 | Bacteria | 5098 |
| 968 | Ga0501043_0049860 | 3300049579 | Bacteria | 3291 |
| 969 | Ga0501043_0057401 | 3300049579 | Bacteria | 3057 |
| 970 | Ga0501043_0773551 | 3300049579 | Bacteria | 696 |
| 971 | Ga0501046_0003352 | 3300049580 | Bacteria | 14708 |
| 972 | Ga0501046_0013147 | 3300049580 | Bacteria | 7023 |
| 973 | Ga0501046_0037038 | 3300049580 | Bacteria | 3922 |
| 974 | Ga0501046_0218132 | 3300049580 | Bacteria | 1414 |
| 975 | Ga0501046_0294009 | 3300049580 | Bacteria | 1187 |
| 976 | Ga0501048_0003166 | 3300049582 | Bacteria | 12540 |
| 977 | Ga0501048_0005109 | 3300049582 | Bacteria | 9999 |
| 978 | Ga0501048_0166344 | 3300049582 | Bacteria | 1561 |
| 979 | Ga0501048_0246324 | 3300049582 | Bacteria | 1268 |
| 980 | Ga0501067_0002988 | 3300049583 | Bacteria | 9331 |
| 981 | Ga0501067_0012242 | 3300049583 | Bacteria | 4754 |
| 982 | Ga0501067_0034820 | 3300049583 | Unclassified | 2796 |
| 983 | Ga0501067_0083810 | 3300049583 | Bacteria | 1768 |
| 984 | Ga0501067_0444767 | 3300049583 | Bacteria | 724 |
| 985 | Ga0501068_0002166 | 3300049584 | Bacteria | 10463 |
| 986 | Ga0501068_0012742 | 3300049584 | Bacteria | 4773 |
| 987 | Ga0501068_0144879 | 3300049584 | Unclassified | 1491 |
| 988 | Ga0501069_0001301 | 3300049585 | Bacteria | 12241 |
| 989 | Ga0501069_0005039 | 3300049585 | Bacteria | 6848 |
| 990 | Ga0501069_0016049 | 3300049585 | Bacteria | 4019 |
| 991 | Ga0501069_0287703 | 3300049585 | Unclassified | 962 |
| 992 | Ga0501069_0323969 | 3300049585 | Unclassified | 906 |
| 993 | Ga0501070_0003825 | 3300049586 | Bacteria | 12997 |
| 994 | Ga0501070_0046485 | 3300049586 | Bacteria | 3610 |
| 995 | Ga0501070_0413826 | 3300049586 | Bacteria | 1089 |
| 996 | Ga0501071_0000488 | 3300049587 | Bacteria | 20060 |
| 997 | Ga0501071_0002874 | 3300049587 | Bacteria | 10619 |
| 998 | Ga0501071_0107542 | 3300049587 | Bacteria | 2059 |
| 999 | Ga0501071_0117624 | 3300049587 | Bacteria | 1968 |
| 1000 | Ga0501071_0204958 | 3300049587 | Bacteria | 1482 |
| 1001 | Ga0501071_0515576 | 3300049587 | Bacteria | 917 |
| 1002 | Ga0501071_1111487 | 3300049587 | Bacteria | 611 |
| 1003 | Ga0501072_0000766 | 3300049588 | Bacteria | 23429 |
| 1004 | Ga0501072_0001800 | 3300049588 | Bacteria | 15961 |
| 1005 | Ga0501072_0018797 | 3300049588 | Bacteria | 5330 |
| 1006 | Ga0501072_0041626 | 3300049588 | Bacteria | 3609 |
| 1007 | Ga0501072_0365771 | 3300049588 | Bacteria | 1145 |
| 1008 | Ga0501073_0000419 | 3300049589 | Bacteria | 29081 |
| 1009 | Ga0501073_0129286 | 3300049589 | Bacteria | 1750 |
| 1010 | Ga0501073_0166702 | 3300049589 | Bacteria | 1525 |
| 1011 | Ga0501074_0004161 | 3300049590 | Bacteria | 10331 |
| 1012 | Ga0501074_0025974 | 3300049590 | Bacteria | 4247 |
| 1013 | Ga0501074_0050692 | 3300049590 | Bacteria | 2997 |
| 1014 | Ga0501075_0003121 | 3300049591 | Bacteria | 11077 |
| 1015 | Ga0501075_0003840 | 3300049591 | Bacteria | 10117 |
| 1016 | Ga0501075_0003953 | 3300049591 | Bacteria | 9988 |
| 1017 | Ga0501075_0014706 | 3300049591 | Bacteria | 5608 |
| 1018 | Ga0501075_0611634 | 3300049591 | Unclassified | 831 |
| 1019 | Ga0501076_0000345 | 3300049592 | Bacteria | 28556 |
| 1020 | Ga0501076_0002631 | 3300049592 | Bacteria | 12381 |
| 1021 | Ga0501076_0019913 | 3300049592 | Bacteria | 5132 |
| 1022 | Ga0501076_0343380 | 3300049592 | Unclassified | 1225 |
| 1023 | Ga0501077_0004326 | 3300049593 | Bacteria | 8602 |
| 1024 | Ga0501077_0008459 | 3300049593 | Bacteria | 6376 |
| 1025 | Ga0501077_0016290 | 3300049593 | Bacteria | 4683 |
| 1026 | Ga0501077_0125833 | 3300049593 | Bacteria | 1624 |
| 1027 | Ga0501079_0000772 | 3300049741 | Bacteria | 21906 |
| 1028 | Ga0501079_0005276 | 3300049741 | Bacteria | 9611 |
| 1029 | Ga0501079_0017541 | 3300049741 | Bacteria | 5467 |
| 1030 | Ga0501079_0041811 | 3300049741 | Bacteria | 3539 |
| 1031 | Ga0501080_0003745 | 3300049742 | Bacteria | 13425 |
| 1032 | Ga0501080_0005615 | 3300049742 | Bacteria | 11214 |
| 1033 | Ga0501080_0047054 | 3300049742 | Bacteria | 4016 |
| 1034 | Ga0501080_0077269 | 3300049742 | Bacteria | 3096 |
| 1035 | Ga0501081_0000859 | 3300049743 | Bacteria | 17955 |
| 1036 | Ga0501081_0010667 | 3300049743 | Bacteria | 6004 |
| 1037 | Ga0501081_0031719 | 3300049743 | Bacteria | 3581 |
| 1038 | Ga0501081_0048479 | 3300049743 | Bacteria | 2923 |
| 1039 | Ga0501081_0243490 | 3300049743 | Bacteria | 1312 |
| 1040 | Ga0501081_0527847 | 3300049743 | Unclassified | 881 |
| 1041 | Ga0501083_0040852 | 3300049744 | Bacteria | 3148 |
| 1042 | Ga0501083_0103100 | 3300049744 | Bacteria | 1880 |
| 1043 | Ga0501035_0006535 | 3300049822 | Bacteria | 10942 |
| 1044 | Ga0501035_0063583 | 3300049822 | Bacteria | 3282 |
| 1045 | Ga0501035_0141331 | 3300049822 | Bacteria | 2093 |
| 1046 | Ga0501044_0255432 | 3300049823 | Bacteria | 1692 |
| 1047 | Ga0501044_0754596 | 3300049823 | Bacteria | 855 |
| 1048 | Ga0501044_0986598 | 3300049823 | Bacteria | 715 |
| 1049 | Ga0501045_0017695 | 3300049824 | Bacteria | 5061 |
| 1050 | Ga0501045_0026721 | 3300049824 | Bacteria | 4154 |
| 1051 | Ga0501045_0030695 | 3300049824 | Bacteria | 3890 |
| 1052 | nmdc:mga00v17_36670_c1 | 3300050491 | Bacteria | 2924 |
| 1053 | nmdc:mga00v17_807287_c1 | 3300050491 | Bacteria | 597 |
| 1054 | nmdc:mga0yw44_26546_c1 | 3300050492 | Bacteria | 3310 |
| 1055 | nmdc:mga0yw44_55927_c1 | 3300050492 | Bacteria | 2402 |
| 1056 | nmdc:mga0yw44_68342_c1 | 3300050492 | Bacteria | 2198 |
| 1057 | nmdc:mga06z11_33288_c1 | 3300050494 | Bacteria | 2520 |
| 1058 | nmdc:mga05p37_165682_c1 | 3300050507 | Unclassified | 2351 |
| 1059 | nmdc:mga05p37_231176_c1 | 3300050507 | Bacteria | 2228 |
| 1060 | nmdc:mga05p37_317944_c1 | 3300050507 | Bacteria | 1843 |
| 1061 | nmdc:mga05p37_42775_c1 | 3300050507 | Bacteria | 5568 |
| 1062 | nmdc:mga05p37_435738_c1 | 3300050507 | Bacteria | 1521 |
| 1063 | nmdc:mga05p37_60118_c1 | 3300050507 | Bacteria | 4679 |
| 1064 | nmdc:mga05p37_67442_c1 | 3300050507 | Bacteria | 4402 |
| 1065 | nmdc:mga05p37_67769_c1 | 3300050507 | Bacteria | 4067 |
| 1066 | nmdc:mga09592_700990_c1 | 3300050508 | Unclassified | 862 |
| 1067 | nmdc:mga09592_702626_c1 | 3300050508 | Archaea | 860 |
| 1068 | nmdc:mga0qj67_427493_c1 | 3300050509 | Unclassified | 1068 |
| 1069 | nmdc:mga06r32_85077_c1 | 3300050510 | Bacteria | 3083 |
| 1070 | nmdc:mga08y16_1758599_c1 | 3300050511 | Unclassified | 574 |
| 1071 | nmdc:mga08y16_365182_c1 | 3300050511 | Unclassified | 1482 |
| 1072 | nmdc:mga08y16_444147_c1 | 3300050511 | Bacteria | 1323 |
| 1073 | nmdc:mga08y16_56922_c1 | 3300050511 | Bacteria | 4086 |
| 1074 | nmdc:mga08y16_570626_c1 | 3300050511 | Bacteria | 1143 |
| 1075 | nmdc:mga08y16_75325_c1 | 3300050511 | Bacteria | 3518 |
| 1076 | nmdc:mga08y16_896069_c1 | 3300050511 | Unclassified | 873 |
| 1077 | nmdc:mga0n895_105949_c1 | 3300050512 | Bacteria | 2824 |
| 1078 | nmdc:mga0n895_37840_c1 | 3300050512 | Bacteria | 4670 |
| 1079 | nmdc:mga0n895_802817_c1 | 3300050512 | Bacteria | 931 |
| 1080 | nmdc:mga0rr50_173476_c1 | 3300050513 | Bacteria | 1759 |
| 1081 | nmdc:mga0rr50_3884_c1 | 3300050513 | Bacteria | 8694 |
| 1082 | nmdc:mga0rr50_62134_c1 | 3300050513 | Bacteria | 2817 |
| 1083 | nmdc:mga08x19_39707_c1 | 3300050514 | Bacteria | 2993 |
| 1084 | nmdc:mga08x19_4071_c1 | 3300050514 | Bacteria | 8679 |
| 1085 | nmdc:mga08x19_59867_c1 | 3300050514 | Bacteria | 2466 |
| 1086 | nmdc:mga0a205_122863_c1 | 3300050515 | Bacteria | 2496 |
| 1087 | nmdc:mga0a205_238993_c1 | 3300050515 | Unclassified | 1697 |
| 1088 | nmdc:mga0a205_307415_c1 | 3300050515 | Unclassified | 1458 |
| 1089 | nmdc:mga0a205_47338_c1 | 3300050515 | Bacteria | 4149 |
| 1090 | nmdc:mga0a205_475142_c1 | 3300050515 | Bacteria | 1108 |
| 1091 | nmdc:mga0a205_635472_c1 | 3300050515 | Bacteria | 919 |
| 1092 | Ga0495601_0181209 | 3300053077 | Bacteria | 1377 |
| 1093 | Ga0495601_0219131 | 3300053077 | Bacteria | 1243 |
| 1094 | Ga0495612_0024451 | 3300053078 | Bacteria | 2425 |
| 1095 | Ga0495655_0189269 | 3300053083 | Bacteria | 668 |
| 1096 | Ga0495595_0004985 | 3300053084 | Bacteria | 5360 |
| 1097 | Ga0495595_0190918 | 3300053084 | Bacteria | 1018 |
| 1098 | Ga0495619_0038345 | 3300053085 | Bacteria | 3125 |
| 1099 | Ga0501084_0000701 | 3300054114 | Bacteria | 25651 |
| 1100 | Ga0501084_0070325 | 3300054114 | Bacteria | 2931 |
| 1101 | Ga0501084_0180964 | 3300054114 | Unclassified | 1779 |
| 1102 | Ga0590075_006807 | 3300059424 | Bacteria | 2706 |
| 1103 | Ga0501082_0000579 | 3300060353 | Bacteria | 32433 |
| 1104 | Ga0501082_0004171 | 3300060353 | Bacteria | 12629 |
| 1105 | Ga0501082_0041777 | 3300060353 | Bacteria | 3953 |
| 1106 | Ga0501082_0258206 | 3300060353 | Unclassified | 1516 |
| 1107 | Ga0501082_0292731 | 3300060353 | Bacteria | 1417 |
| 1108 | Ga0501082_0340526 | 3300060353 | Bacteria | 1307 |
| 1109 | Ga0466962_0012499 | 3300061719 | Bacteria | 4081 |
| 1110 | Ga0466962_0012709 | 3300061719 | Bacteria | 4050 |
| 1111 | Ga0466962_0013426 | 3300061719 | Bacteria | 3943 |
| 1112 | Ga0466962_0033032 | 3300061719 | Bacteria | 2476 |
| 1113 | Ga0466962_0053350 | 3300061719 | Bacteria | 1933 |
| 1114 | Ga0530510_0005529 | 3300061734 | Bacteria | 8753 |
| 1115 | Ga0530510_0010515 | 3300061734 | Bacteria | 6487 |
| 1116 | Ga0530510_0019740 | 3300061734 | Bacteria | 4787 |
| 1117 | Ga0530510_0023690 | 3300061734 | Bacteria | 4377 |
| 1118 | Ga0530510_0030559 | 3300061734 | Bacteria | 3869 |
| 1119 | Ga0530510_0069211 | 3300061734 | Bacteria | 2561 |
| 1120 | Ga0530510_0576435 | 3300061734 | Unclassified | 855 |
| 1121 | Ga0163162_12083366 | |||
| 1122 | JGI24737J22298_10062174 | |||
| 1123 | JGI24744J21845_10004005 | |||
| 1124 | JGI25406J46586_10019807 | |||
| 1125 | Ga0070683_100054315 | |||
| 1126 | Ga0070683_100380230 | |||
| 1127 | Ga0070690_100051674 | |||
| 1128 | Ga0068869_101361970 | |||
| 1129 | Ga0070666_10042015 | |||
| 1130 | Ga0070680_100573206 | |||
| 1131 | Ga0068868_100033217 | |||
| 1132 | Ga0068868_100080858 | |||
| 1133 | Ga0068868_100190637 | |||
| 1134 | Ga0068868_100733022 | |||
| 1135 | Ga0068868_100736586 | |||
| 1136 | Ga0068868_100815719 | |||
| 1137 | Ga0070660_100097819 | |||
| 1138 | Ga0070660_100135766 | |||
| 1139 | Ga0070689_100006043 | |||
| 1140 | Ga0070691_10011849 | |||
| 1141 | Ga0070691_10116750 | |||
| 1142 | Ga0070687_100010557 | |||
| 1143 | Ga0070687_100507548 | |||
| 1144 | Ga0070692_10008869 | |||
| 1145 | Ga0070692_10246331 | |||
| 1146 | Ga0070668_100016130 | |||
| 1147 | Ga0070668_100101819 | |||
| 1148 | Ga0070668_100465875 | |||
| 1149 | Ga0070669_100497258 | |||
| 1150 | Ga0070675_100850420 | |||
| 1151 | Ga0070671_100718069 | |||
| 1152 | Ga0070671_100771857 | |||
| 1153 | Ga0070671_100891465 | |||
| 1154 | Ga0070674_100027492 | |||
| 1155 | Ga0070674_100145636 | |||
| 1156 | Ga0070673_100138761 | |||
| 1157 | Ga0070673_100256321 | |||
| 1158 | Ga0070688_100081762 | |||
| 1159 | Ga0070688_100523484 | |||
| 1160 | Ga0070659_100058074 | |||
| 1161 | Ga0070659_100084348 | |||
| 1162 | Ga0070659_100283899 | |||
| 1163 | Ga0070659_100825940 | |||
| 1164 | Ga0070667_100009269 | |||
| 1165 | Ga0070703_10004128 | |||
| 1166 | Ga0070709_10118357 | |||
| 1167 | Ga0070709_10380545 | |||
| 1168 | Ga0070714_100013978 | |||
| 1169 | Ga0070713_100094275 | |||
| 1170 | Ga0070713_100126996 | |||
| 1171 | Ga0070713_100194509 | |||
| 1172 | Ga0070713_101060234 | |||
| 1173 | Ga0070710_10003456 | |||
| 1174 | Ga0070710_10227327 | |||
| 1175 | Ga0070710_10270137 | |||
| 1176 | Ga0070701_10038274 | |||
| 1177 | Ga0070701_10041770 | |||
| 1178 | Ga0070711_100005669 | |||
| 1179 | Ga0070711_100043303 | |||
| 1180 | Ga0070711_100061427 | |||
| 1181 | Ga0070711_100124043 | |||
| 1182 | Ga0070711_100208263 | |||
| 1183 | Ga0070705_100008491 | |||
| 1184 | Ga0070705_100021380 | |||
| 1185 | Ga0070705_100030381 | |||
| 1186 | Ga0070705_100272905 | |||
| 1187 | Ga0070705_101020023 | |||
| 1188 | Ga0070700_100007462 | |||
| 1189 | Ga0070700_100185205 | |||
| 1190 | Ga0070700_100349027 | |||
| 1191 | Ga0070694_100008799 | |||
| 1192 | Ga0070694_100046114 | |||
| 1193 | Ga0070694_100449229 | |||
| 1194 | Ga0070708_100006986 | |||
| 1195 | Ga0070708_100092441 | |||
| 1196 | Ga0070708_100971190 | |||
| 1197 | Ga0070708_101064386 | |||
| 1198 | Ga0070663_100028914 | |||
| 1199 | Ga0070678_100012006 | |||
| 1200 | Ga0070678_100024949 | |||
| 1201 | Ga0070678_100285679 | |||
| 1202 | Ga0070678_100841054 | |||
| 1203 | Ga0070662_100058460 | |||
| 1204 | Ga0070662_100134020 | |||
| 1205 | Ga0070662_100324726 | |||
| 1206 | Ga0070662_100425769 | |||
| 1207 | Ga0070662_100831817 | |||
| 1208 | Ga0070681_10029536 | |||
| 1209 | Ga0070681_10140062 | |||
| 1210 | Ga0070681_10310801 | |||
| 1211 | Ga0068867_100046992 | |||
| 1212 | Ga0068867_100939027 | |||
| 1213 | Ga0070685_10041774 | |||
| 1214 | Ga0070685_10344842 | |||
| 1215 | Ga0070706_100011590 | |||
| 1216 | Ga0070706_100069880 | |||
| 1217 | Ga0070706_100085852 | |||
| 1218 | Ga0070706_100549996 | |||
| 1219 | Ga0070707_100002669 | |||
| 1220 | Ga0070707_100108471 | |||
| 1221 | Ga0070698_100011138 | |||
| 1222 | Ga0070698_100076853 | |||
| 1223 | Ga0070698_100115313 | |||
| 1224 | Ga0070698_100204402 | |||
| 1225 | Ga0070698_100219202 | |||
| 1226 | Ga0070699_100018106 | |||
| 1227 | Ga0070699_100036512 | |||
| 1228 | Ga0070699_100103341 | |||
| 1229 | Ga0070699_100186295 | |||
| 1230 | Ga0070699_100346313 | |||
| 1231 | Ga0070679_100016373 | |||
| 1232 | Ga0070679_100037003 | |||
| 1233 | Ga0070679_100260899 | |||
| 1234 | Ga0070679_100351530 | |||
| 1235 | Ga0070679_100478419 | |||
| 1236 | Ga0070679_100800146 | |||
| 1237 | Ga0070684_100539616 | |||
| 1238 | Ga0070697_101096430 | |||
| 1239 | Ga0068853_100028152 | |||
| 1240 | Ga0068853_100198572 | |||
| 1241 | Ga0070672_100021137 | |||
| 1242 | Ga0070672_100455037 | |||
| 1243 | Ga0070672_100929416 | |||
| 1244 | Ga0070686_100000882 | |||
| 1245 | Ga0070686_100023069 | |||
| 1246 | Ga0070686_100525262 | |||
| 1247 | Ga0070695_100051044 | |||
| 1248 | Ga0070695_100070078 | |||
| 1249 | Ga0070695_100227027 | |||
| 1250 | Ga0070695_100326240 | |||
| 1251 | Ga0070695_100352879 | |||
| 1252 | Ga0070696_100008256 | |||
| 1253 | Ga0070696_100069478 | |||
| 1254 | Ga0070696_100201125 | |||
| 1255 | Ga0070693_100047654 | |||
| 1256 | Ga0070665_100010320 | |||
| 1257 | Ga0070665_100206147 | |||
| 1258 | Ga0070665_100569254 | |||
| 1259 | Ga0070704_100010856 | |||
| 1260 | Ga0070704_100270603 | |||
| 1261 | Ga0070704_100327601 | |||
| 1262 | Ga0070704_100417911 | |||
| 1263 | Ga0070704_100939291 | |||
| 1264 | Ga0070704_101053859 | |||
| 1265 | Ga0068855_100038674 | |||
| 1266 | Ga0068855_100112391 | |||
| 1267 | Ga0068855_100115906 | |||
| 1268 | Ga0068855_100175811 | |||
| 1269 | Ga0068855_100234908 | |||
| 1270 | Ga0070664_100068038 | |||
| 1271 | Ga0068854_100020771 | |||
| 1272 | Ga0068854_100047929 | |||
| 1273 | Ga0068854_100187343 | |||
| 1274 | Ga0068854_100829078 | |||
| 1275 | Ga0068856_100069312 | |||
| 1276 | Ga0068856_100082251 | |||
| 1277 | Ga0068856_100178116 | |||
| 1278 | Ga0068856_100208784 | |||
| 1279 | Ga0068856_101457102 | |||
| 1280 | Ga0070702_100013355 | |||
| 1281 | Ga0070702_100027086 | |||
| 1282 | Ga0070702_100077789 | |||
| 1283 | Ga0068852_100037277 | |||
| 1284 | Ga0068852_101917035 | |||
| 1285 | Ga0068859_100010964 | |||
| 1286 | Ga0068859_101564939 | |||
| 1287 | Ga0068864_100120931 | |||
| 1288 | Ga0068864_101087043 | |||
| 1289 | Ga0068866_10001081 | |||
| 1290 | Ga0068866_10095708 | |||
| 1291 | Ga0068866_10214755 | |||
| 1292 | Ga0068866_10500642 | |||
| 1293 | Ga0068861_100001828 | |||
| 1294 | Ga0068861_100626197 | |||
| 1295 | Ga0068870_10076962 | |||
| 1296 | Ga0068870_10111641 | |||
| 1297 | Ga0068870_10381887 | |||
| 1298 | Ga0068858_100245228 | |||
| 1299 | Ga0068860_100196134 | |||
| 1300 | Ga0068860_100760288 | |||
| 1301 | Ga0068862_100273813 | |||
| 1302 | Ga0068862_100342719 | |||
| 1303 | Ga0081455_10028160 | |||
| 1304 | Ga0081455_10342307 | |||
| 1305 | Ga0081455_10631958 | |||
| 1306 | Ga0081540_1044621 | |||
| 1307 | Ga0081540_1052743 | |||
| 1308 | Ga0081539_10000244 | |||
| 1309 | Ga0070717_10027511 | |||
| 1310 | Ga0070717_10063126 | |||
| 1311 | Ga0070717_10217929 | |||
| 1312 | Ga0075368_10223069 | |||
| 1313 | Ga0075364_10014011 | |||
| 1314 | Ga0070715_10061757 | |||
| 1315 | Ga0070715_10067441 | |||
| 1316 | Ga0070715_10097362 | |||
| 1317 | Ga0070715_10303790 | |||
| 1318 | Ga0070716_100057721 | |||
| 1319 | Ga0070716_100076912 | |||
| 1320 | Ga0070712_100003509 | |||
| 1321 | Ga0070712_100171733 | |||
| 1322 | Ga0075367_10200229 | |||
| 1323 | Ga0097621_100071216 | |||
| 1324 | Ga0068871_100210197 | |||
| 1325 | Ga0068871_100252426 | |||
| 1326 | Ga0075428_100437092 | |||
| 1327 | Ga0075430_100331436 | |||
| 1328 | Ga0075433_10110977 | |||
| 1329 | Ga0075433_10383810 | |||
| 1330 | Ga0075433_10418195 | |||
| 1331 | Ga0075433_10422201 | |||
| 1332 | Ga0075434_100018813 | |||
| 1333 | Ga0075434_100045370 | |||
| 1334 | Ga0075434_100051638 | |||
| 1335 | Ga0075434_100101209 | |||
| 1336 | Ga0075434_100169144 | |||
| 1337 | Ga0075434_100331174 | |||
| 1338 | Ga0075434_100511236 | |||
| 1339 | Ga0075434_100908911 | |||
| 1340 | Ga0075434_101071296 | |||
| 1341 | Ga0068865_100015869 | |||
| 1342 | Ga0068865_100031314 | |||
| 1343 | Ga0068865_100040875 | |||
| 1344 | Ga0068865_100666064 | |||
| 1345 | Ga0075436_100009027 | |||
| 1346 | Ga0075436_100041829 | |||
| 1347 | Ga0075436_100055833 | |||
| 1348 | Ga0075436_100468441 | |||
| 1349 | Ga0097620_100010964 | |||
| 1350 | Ga0097620_101564529 | |||
| 1351 | Ga0075435_100003250 | |||
| 1352 | Ga0075435_100008644 | |||
| 1353 | Ga0105240_10460868 | |||
| 1354 | Ga0111539_10028822 | |||
| 1355 | Ga0111539_10049073 | |||
| 1356 | Ga0111539_10259573 | |||
| 1357 | Ga0111539_10630775 | |||
| 1358 | Ga0105245_10018421 | |||
| 1359 | Ga0105245_10056080 | |||
| 1360 | Ga0105245_10150066 | |||
| 1361 | Ga0105245_10151529 | |||
| 1362 | Ga0105245_10157812 | |||
| 1363 | Ga0105245_10339084 | |||
| 1364 | Ga0105245_12026694 | |||
| 1365 | Ga0105247_10066842 | |||
| 1366 | Ga0114129_10005270 | |||
| 1367 | Ga0114129_10023401 | |||
| 1368 | Ga0114129_10073882 | |||
| 1369 | Ga0114129_10128030 | |||
| 1370 | Ga0114129_10392907 | |||
| 1371 | Ga0114129_10448852 | |||
| 1372 | Ga0114129_10916030 | |||
| 1373 | Ga0105243_10146266 | |||
| 1374 | Ga0105243_10190701 | |||
| 1375 | Ga0105243_10384716 | |||
| 1376 | Ga0105243_10415135 | |||
| 1377 | Ga0105243_12165255 | |||
| 1378 | Ga0105241_10022578 | |||
| 1379 | Ga0105241_10258044 | |||
| 1380 | Ga0105241_10277810 | |||
| 1381 | Ga0105242_10060046 | |||
| 1382 | Ga0105242_10082332 | |||
| 1383 | Ga0105242_10399848 | |||
| 1384 | Ga0105242_10797506 | |||
| 1385 | Ga0105242_11024862 | |||
| 1386 | Ga0105242_11198522 | |||
| 1387 | Ga0105248_10012896 | |||
| 1388 | Ga0105248_10366094 | |||
| 1389 | Ga0105248_10587248 | |||
| 1390 | Ga0105237_10562850 | |||
| 1391 | Ga0105238_10259438 | |||
| 1392 | Ga0105249_10020725 | |||
| 1393 | Ga0105249_10044407 | |||
| 1394 | Ga0105249_10630106 | |||
| 1395 | Ga0105249_10981919 | |||
| 1396 | Ga0105249_11389145 | |||
| 1397 | Ga0105239_10020697 | |||
| 1398 | Ga0105239_10024112 | |||
| 1399 | Ga0105239_10041352 | |||
| 1400 | Ga0105239_10105840 | |||
| 1401 | Ga0105239_10407733 | |||
| 1402 | Ga0105239_10677893 | |||
| 1403 | Ga0105239_10913642 | |||
| 1404 | Ga0105239_12315362 | |||
| 1405 | Ga0105246_10256966 | |||
| 1406 | Ga0105246_10394379 | |||
| 1407 | Ga0157338_1056488 | |||
| 1408 | Ga0157371_10611753 | |||
| 1409 | Ga0157371_10994964 | |||
| 1410 | Ga0157369_10393221 | |||
| 1411 | Ga0157369_11459807 | |||
| 1412 | Ga0157374_10007613 | |||
| 1413 | Ga0157374_10137582 | |||
| 1414 | Ga0157374_12290095 | |||
| 1415 | Ga0157378_10581495 | |||
| 1416 | Ga0157378_11428035 | |||
| 1417 | Ga0163162_10035104 | |||
| 1418 | Ga0163162_12020892 | |||
| 1419 | Ga0157372_10017259 | |||
| 1420 | Ga0157372_10094646 | |||
| 1421 | Ga0157372_10153284 | |||
| 1422 | Ga0157372_10155893 | |||
| 1423 | Ga0157372_10257955 | |||
| 1424 | Ga0157372_11660211 | |||
| 1425 | Ga0157372_13060604 | |||
| 1426 | Ga0157375_10033334 | |||
| 1427 | Ga0157375_10067358 | |||
| 1428 | Ga0157375_10551758 | |||
| 1429 | Ga0157375_10865496 | |||
| 1430 | Ga0163163_10015486 | |||
| 1431 | Ga0163163_10261549 | |||
| 1432 | Ga0163163_11118424 | |||
| 1433 | Ga0157380_10006389 | |||
| 1434 | Ga0157380_10070318 | |||
| 1435 | Ga0182008_10211009 | |||
| 1436 | Ga0157377_10002098 | |||
| 1437 | Ga0157377_10149032 | |||
| 1438 | Ga0157377_10177095 | |||
| 1439 | Ga0157377_10495565 | |||
| 1440 | Ga0157379_10723063 | |||
| 1441 | Ga0157376_10007389 | |||
| 1442 | Ga0157376_10514803 | |||
| 1443 | Ga0197907_10782037 | |||
| 1444 | Ga0206354_10058836 | |||
| 1445 | Ga0206353_12058779 | |||
| 1446 | Ga0213876_10101192 | |||
| 1447 | Ga0207653_10005086 | |||
| 1448 | Ga0207653_10034893 | |||
| 1449 | Ga0207692_10091654 | |||
| 1450 | Ga0207692_10155989 | |||
| 1451 | Ga0207692_10880203 | |||
| 1452 | Ga0207642_10160294 | |||
| 1453 | Ga0207642_10345519 | |||
| 1454 | Ga0207688_10042562 | |||
| 1455 | Ga0207680_10125828 | |||
| 1456 | Ga0207680_10840421 | |||
| 1457 | Ga0207647_10164380 | |||
| 1458 | Ga0207685_10105531 | |||
| 1459 | Ga0207685_10236337 | |||
| 1460 | Ga0207685_10514758 | |||
| 1461 | Ga0207699_10027324 | |||
| 1462 | Ga0207699_10034959 | |||
| 1463 | Ga0207699_10800776 | |||
| 1464 | Ga0207645_10068497 | |||
| 1465 | Ga0207643_10113388 | |||
| 1466 | Ga0207684_10053940 | |||
| 1467 | Ga0207684_10065501 | |||
| 1468 | Ga0207707_10005223 | |||
| 1469 | Ga0207707_10030586 | |||
| 1470 | Ga0207707_10070999 | |||
| 1471 | Ga0207707_10189464 | |||
| 1472 | Ga0207671_10481182 | |||
| 1473 | Ga0207693_10002384 | |||
| 1474 | Ga0207693_10010783 | |||
| 1475 | Ga0207693_10083357 | |||
| 1476 | Ga0207693_10133293 | |||
| 1477 | Ga0207693_10260561 | |||
| 1478 | Ga0207663_10018537 | |||
| 1479 | Ga0207663_10206541 | |||
| 1480 | Ga0207663_10591227 | |||
| 1481 | Ga0207660_10166044 | |||
| 1482 | Ga0207660_10389185 | |||
| 1483 | Ga0207660_10531442 | |||
| 1484 | Ga0207660_10598292 | |||
| 1485 | Ga0207662_10052521 | |||
| 1486 | Ga0207662_10113565 | |||
| 1487 | Ga0207657_10018316 | |||
| 1488 | Ga0207657_10035789 | |||
| 1489 | Ga0207657_10154981 | |||
| 1490 | Ga0207657_10263094 | |||
| 1491 | Ga0207657_10265363 | |||
| 1492 | Ga0207652_10033976 | |||
| 1493 | Ga0207652_10085498 | |||
| 1494 | Ga0207652_10095554 | |||
| 1495 | Ga0207652_10222279 | |||
| 1496 | Ga0207652_10395808 | |||
| 1497 | Ga0207652_10544131 | |||
| 1498 | Ga0207652_10781251 | |||
| 1499 | Ga0207646_10004754 | |||
| 1500 | Ga0207681_10075384 | |||
| 1501 | Ga0207681_10275352 | |||
| 1502 | Ga0207694_10206046 | |||
| 1503 | Ga0207659_10786129 | |||
| 1504 | Ga0207687_10032741 | |||
| 1505 | Ga0207687_10095930 | |||
| 1506 | Ga0207687_10425650 | |||
| 1507 | Ga0207687_10468041 | |||
| 1508 | Ga0207687_10700497 | |||
| 1509 | Ga0207687_10771112 | |||
| 1510 | Ga0207700_10000012 | |||
| 1511 | Ga0207700_10027791 | |||
| 1512 | Ga0207700_10261855 | |||
| 1513 | Ga0207700_10814211 | |||
| 1514 | Ga0207700_10903141 | |||
| 1515 | Ga0207664_10104993 | |||
| 1516 | Ga0207664_10367602 | |||
| 1517 | Ga0207644_10032820 | |||
| 1518 | Ga0207644_10564591 | |||
| 1519 | Ga0207644_10712363 | |||
| 1520 | Ga0207644_10765776 | |||
| 1521 | Ga0207690_10142735 | |||
| 1522 | Ga0207690_10177891 | |||
| 1523 | Ga0207690_10265516 | |||
| 1524 | Ga0207706_10013777 | |||
| 1525 | Ga0207706_10019694 | |||
| 1526 | Ga0207706_10074063 | |||
| 1527 | Ga0207706_10100925 | |||
| 1528 | Ga0207686_10020162 | |||
| 1529 | Ga0207686_10183325 | |||
| 1530 | Ga0207686_10223699 | |||
| 1531 | Ga0207709_10023590 | |||
| 1532 | Ga0207709_10719549 | |||
| 1533 | Ga0207669_10049378 | |||
| 1534 | Ga0207669_10316787 | |||
| 1535 | Ga0207669_10411852 | |||
| 1536 | Ga0207704_10349596 | |||
| 1537 | Ga0207704_10397694 | |||
| 1538 | Ga0207704_10554091 | |||
| 1539 | Ga0207665_10002331 | |||
| 1540 | Ga0207665_10133745 | |||
| 1541 | Ga0207665_10143417 | |||
| 1542 | Ga0207691_10012724 | |||
| 1543 | Ga0207691_10152850 | |||
| 1544 | Ga0207691_10461791 | |||
| 1545 | Ga0207711_10043564 | |||
| 1546 | Ga0207711_10103030 | |||
| 1547 | Ga0207711_10286584 | |||
| 1548 | Ga0207689_10237562 | |||
| 1549 | Ga0207689_10776620 | |||
| 1550 | Ga0207661_10021791 | |||
| 1551 | Ga0207661_10027531 | |||
| 1552 | Ga0207661_10146769 | |||
| 1553 | Ga0207661_10865088 | |||
| 1554 | Ga0207667_10079951 | |||
| 1555 | Ga0207667_10260540 | |||
| 1556 | Ga0207667_10616796 | |||
| 1557 | Ga0207651_10113534 | |||
| 1558 | Ga0207651_10170961 | |||
| 1559 | Ga0207712_10019116 | |||
| 1560 | Ga0207712_10271035 | |||
| 1561 | Ga0207712_10501378 | |||
| 1562 | Ga0207712_10508820 | |||
| 1563 | Ga0207668_10016734 | |||
| 1564 | Ga0207668_10103536 | |||
| 1565 | Ga0207668_10147700 | |||
| 1566 | Ga0207668_10592327 | |||
| 1567 | Ga0207640_10020585 | |||
| 1568 | Ga0207640_10148026 | |||
| 1569 | Ga0207640_10388094 | |||
| 1570 | Ga0207640_10761636 | |||
| 1571 | Ga0207658_10027533 | |||
| 1572 | Ga0207677_10042661 | |||
| 1573 | Ga0207677_10081964 | |||
| 1574 | Ga0207677_10401355 | |||
| 1575 | Ga0207677_10640420 | |||
| 1576 | Ga0207677_10677628 | |||
| 1577 | Ga0207639_10146947 | |||
| 1578 | Ga0207639_10432293 | |||
| 1579 | Ga0207639_11570071 | |||
| 1580 | Ga0207678_10056638 | |||
| 1581 | Ga0207678_10109148 | |||
| 1582 | Ga0207708_10000175 | |||
| 1583 | Ga0207708_10006370 | |||
| 1584 | Ga0207708_10183328 | |||
| 1585 | Ga0207702_10003163 | |||
| 1586 | Ga0207702_10084845 | |||
| 1587 | Ga0207702_10691744 | |||
| 1588 | Ga0207702_11206376 | |||
| 1589 | Ga0207648_10003615 | |||
| 1590 | Ga0207648_10007149 | |||
| 1591 | Ga0207648_10047623 | |||
| 1592 | Ga0207648_10229797 | |||
| 1593 | Ga0207675_100009257 | |||
| 1594 | Ga0207675_100027540 | |||
| 1595 | Ga0207675_100049930 | |||
| 1596 | Ga0207675_100402352 | |||
| 1597 | Ga0207675_101179540 | |||
| 1598 | Ga0207683_10000262 | |||
| 1599 | Ga0207683_10015746 | |||
| 1600 | Ga0207683_10019455 | |||
| 1601 | Ga0207698_10125935 | |||
| 1602 | Ga0207698_10326450 | |||
| 1603 | Ga0207698_10682998 | |||
| 1604 | Ga0209966_1023984 | |||
| 1605 | Ga0209998_10054456 | |||
| 1606 | Ga0207428_10000393 | |||
| 1607 | Ga0207428_10214372 | |||
| 1608 | Ga0207428_10220516 | |||
| 1609 | Ga0268266_10074578 | |||
| 1610 | Ga0268266_10835382 | |||
| 1611 | Ga0268265_10147929 | |||
| 1612 | Ga0268265_10249917 | |||
| 1613 | Ga0268265_10291215 | |||
| 1614 | Ga0265326_10020351 | |||
| 1615 | Ga0265319_1001962 | |||
| 1616 | Ga0265319_1039328 | |||
| 1617 | Ga0265334_10003181 | |||
| 1618 | Ga0265318_10000763 | |||
| 1619 | Ga0265318_10024911 | |||
| 1620 | Ga0265322_10005010 | |||
| 1621 | Ga0265336_10106903 | |||
| 1622 | Ga0265338_10011874 | |||
| 1623 | Ga0265330_10001649 | |||
| 1624 | Ga0265332_10012147 | |||
| 1625 | Ga0265328_10001855 | |||
| 1626 | Ga0265320_10174264 | |||
| 1627 | Ga0265325_10000898 | |||
| 1628 | Ga0265329_10000962 | |||
| 1629 | Ga0265340_10190656 | |||
| 1630 | Ga0265339_10001348 | |||
| 1631 | Ga0265331_10027555 | |||
| 1632 | Ga0265327_10006633 | |||
| 1633 | Ga0265316_10003611 | |||
| 1634 | Ga0307408_100299234 | |||
| 1635 | Ga0265313_10009137 | |||
| 1636 | Ga0265314_10023334 | |||
| 1637 | Ga0265342_10005695 | |||
| 1638 | Ga0307409_100022466 | |||
| 1639 | Ga0307409_100283998 | |||
| 1640 | Ga0307416_100225927 | |||
| 1641 | Ga0307416_101164789 | |||
| 1642 | Ga0373959_0005884 | |||
| 1643 | Ga0373938_0010597 | |||
| 1644 | Ga0373944_0181984 | |||
| 1645 | Ga0373949_0056289 | |||
| 1646 | Ga0373952_0095273 | |||
| 1647 | Ga0373923_0099444 | |||
| 1648 | Ga0373932_0000805 | |||
| 1649 | Ga0373939_0012636 | |||
| 1650 | Ga0373941_0015840 | |||
| 1651 | Ga0373945_0011615 | |||
| 1652 | Ga0373954_0051622 | |||
| 1653 | Ga0373943_0003634 | |||
| 1654 | Ga0373943_0229323 | |||
| 1655 | Ga0373946_0022000 | |||
| 1656 | Ga0373942_0005122 | |||
| 1657 | Ga0373961_0004135 | |||
| 1658 | Ga0373961_0085988 | |||
| 1659 | Ga0373962_0001785 | |||
| 1660 | Ga0373931_0024324 | |||
| 1661 | Ga0373935_0027777 | |||
| 1662 | Ga0373935_0375447 | |||
| 1663 | Ga0373927_0365112 | |||
| 1664 | Ga0373933_0075452 | |||
| 1665 | Ga0373947_0000314 | |||
| 1666 | Ga0373937_0014786 | |||
| 1667 | Ga0373925_0086199 | |||
| 1668 | Ga0395899_0002328 | |||
| 1669 | Ga0395899_0008848 | |||
| 1670 | Ga0395899_0017197 | |||
| 1671 | Ga0395899_0019160 | |||
| 1672 | Ga0395899_0034736 | |||
| 1673 | Ga0395899_0048925 | |||
| 1674 | Ga0395899_0082840 | |||
| 1675 | Ga0395899_0597288 | |||
| 1676 | Ga0395900_0001263 | |||
| 1677 | Ga0395900_0003884 | |||
| 1678 | Ga0395900_0012108 | |||
| 1679 | Ga0395900_0013277 | |||
| 1680 | Ga0395900_0015920 | |||
| 1681 | Ga0395900_0016765 | |||
| 1682 | Ga0395900_0017668 | |||
| 1683 | Ga0395900_0032176 | |||
| 1684 | Ga0395900_0057474 | |||
| 1685 | Ga0395900_0073073 | |||
| 1686 | Ga0395900_0084621 | |||
| 1687 | Ga0395900_0147603 | |||
| 1688 | Ga0395900_0163328 | |||
| 1689 | Ga0395900_0165407 | |||
| 1690 | Ga0395900_0272331 | |||
| 1691 | Ga0395900_0308994 | |||
| 1692 | Ga0395900_0342518 | |||
| 1693 | Ga0395900_0488439 | |||
| 1694 | Ga0395898_0000795 | |||
| 1695 | Ga0395898_0003109 | |||
| 1696 | Ga0395898_0005023 | |||
| 1697 | Ga0395898_0008806 | |||
| 1698 | Ga0395898_0011621 | |||
| 1699 | Ga0395898_0021770 | |||
| 1700 | Ga0395898_0046693 | |||
| 1701 | Ga0395898_0047124 | |||
| 1702 | Ga0395898_0050550 | |||
| 1703 | Ga0395898_0057602 | |||
| 1704 | Ga0395898_0074401 | |||
| 1705 | Ga0395898_0114970 | |||
| 1706 | Ga0395898_0133857 | |||
| 1707 | Ga0395898_0140341 | |||
| 1708 | Ga0395898_0181598 | |||
| 1709 | Ga0395898_0196714 | |||
| 1710 | Ga0395898_0816790 | |||
| 1711 | Ga0395898_1111471 | |||
| 1712 | Ga0395905_0001754 | |||
| 1713 | Ga0395905_0008400 | |||
| 1714 | Ga0395905_0009628 | |||
| 1715 | Ga0395905_0040397 | |||
| 1716 | Ga0395905_0089682 | |||
| 1717 | Ga0395905_0114307 | |||
| 1718 | Ga0395905_0166755 | |||
| 1719 | Ga0395905_0174670 | |||
| 1720 | Ga0395905_0176858 | |||
| 1721 | Ga0395905_0209834 | |||
| 1722 | Ga0395905_0454544 | |||
| 1723 | Ga0395905_0647638 | |||
| 1724 | Ga0395905_1182152 | |||
| 1725 | Ga0395901_0001285 | |||
| 1726 | Ga0395901_0002495 | |||
| 1727 | Ga0395901_0002904 | |||
| 1728 | Ga0395901_0003483 | |||
| 1729 | Ga0395901_0004004 | |||
| 1730 | Ga0395901_0007931 | |||
| 1731 | Ga0395901_0008757 | |||
| 1732 | Ga0395901_0017247 | |||
| 1733 | Ga0395901_0033342 | |||
| 1734 | Ga0395901_0033907 | |||
| 1735 | Ga0395901_0048456 | |||
| 1736 | Ga0395901_0105912 | |||
| 1737 | Ga0395901_0107438 | |||
| 1738 | Ga0395901_0165489 | |||
| 1739 | Ga0395901_0169402 | |||
| 1740 | Ga0395901_0190263 | |||
| 1741 | Ga0395901_0219304 | |||
| 1742 | Ga0395901_0320523 | |||
| 1743 | Ga0395901_0346395 | |||
| 1744 | Ga0395901_0357515 | |||
| 1745 | Ga0395901_0605572 | |||
| 1746 | Ga0395901_0620698 | |||
| 1747 | Ga0395901_0815729 | |||
| 1748 | Ga0242420_049641 | |||
| 1749 | Ga0436365_0743313 | |||
| 1750 | Ga0436365_1798734 | |||
| 1751 | Ga0436365_1801267 | |||
| 1752 | Ga0436363_1520249 | |||
| 1753 | Ga0439439_0008244 | |||
| 1754 | Ga0439466_0037571 | |||
| 1755 | Ga0439466_0063809 | |||
| 1756 | Ga0451789_0065020 | |||
| 1757 | Ga0451807_1348963 | |||
| 1758 | Ga0451839_1592671 | |||
| 1759 | Ga0451847_0201225 | |||
| 1760 | Ga0451855_0694291 | |||
| 1761 | Ga0451853_0760541 | |||
| 1762 | Ga0451853_1207260 | |||
| 1763 | Ga0451853_2700457 | |||
| 1764 | Ga0439431_0006929 | |||
| 1765 | Ga0439433_0002716 | |||
| 1766 | Ga0439442_027482 | |||
| 1767 | Ga0439442_071850 | |||
| 1768 | Ga0439449_0194821 | |||
| 1769 | Ga0439450_130448 | |||
| 1770 | Ga0439455_0125063 | |||
| 1771 | Ga0439457_016954 | |||
| 1772 | Ga0439462_0038104 | |||
| 1773 | Ga0450923_005503 | |||
| 1774 | Ga0450907_006695 | |||
| 1775 | Ga0439446_0006813 | |||
| 1776 | Ga0439434_0006921 | |||
| 1777 | Ga0439460_0193438 | |||
| 1778 | Ga0450918_029320 | |||
| 1779 | Ga0450893_0065350 | |||
| 1780 | Ga0466966_0002893 | |||
| 1781 | Ga0466963_0006122 | |||
| 1782 | Ga0466963_0015890 | |||
| 1783 | Ga0466963_0021546 | |||
| 1784 | Ga0466963_0177524 | |||
| 1785 | Ga0466963_0455803 | |||
| 1786 | Ga0466964_0002308 | |||
| 1787 | Ga0466964_0058017 | |||
| 1788 | Ga0466964_0403521 | |||
| 1789 | Ga0466971_0001183 | |||
| 1790 | Ga0466968_0040251 | |||
| 1791 | Ga0466968_0174154 | |||
| 1792 | Ga0466970_0190855 | |||
| 1793 | Ga0466957_0000172 | |||
| 1794 | Ga0466957_0018676 | |||
| 1795 | Ga0466957_0179364 | |||
| 1796 | Ga0466957_0477779 | |||
| 1797 | Ga0466959_0087372 | |||
| 1798 | Ga0451576_0095820 | |||
| 1799 | Ga0451576_1079197 | |||
| 1800 | Ga0466958_0008417 | |||
| 1801 | Ga0466958_0252451 | |||
| 1802 | Ga0466958_0575119 | |||
| 1803 | Ga0466967_0000062 | |||
| 1804 | Ga0466967_0001217 | |||
| 1805 | Ga0466967_0012745 | |||
| 1806 | Ga0466967_0055963 | |||
| 1807 | Ga0466967_0110465 | |||
| 1808 | Ga0466967_0115688 | |||
| 1809 | Ga0466967_0232036 | |||
| 1810 | Ga0495592_0154936 | |||
| 1811 | Ga0495603_0013665 | |||
| 1812 | Ga0495603_0187507 | |||
| 1813 | Ga0495603_0425400 | |||
| 1814 | Ga0495590_0083959 | |||
| 1815 | Ga0495629_0058452 | |||
| 1816 | Ga0495641_0002427 | |||
| 1817 | Ga0495641_0056794 | |||
| 1818 | Ga0495641_0133491 | |||
| 1819 | Ga0495641_0478505 | |||
| 1820 | Ga0495651_0013217 | |||
| 1821 | Ga0495653_0011531 | |||
| 1822 | Ga0495580_0259824 | |||
| 1823 | Ga0495582_0055905 | |||
| 1824 | Ga0495582_0099260 | |||
| 1825 | Ga0495605_0009094 | |||
| 1826 | Ga0495605_0143886 | |||
| 1827 | Ga0495605_0435386 | |||
| 1828 | Ga0495639_0065322 | |||
| 1829 | Ga0495639_0196383 | |||
| 1830 | Ga0495662_0020522 | |||
| 1831 | Ga0495584_0045644 | |||
| 1832 | Ga0495584_0082068 | |||
| 1833 | Ga0495584_0460903 | |||
| 1834 | Ga0495594_0000171 | |||
| 1835 | Ga0495594_0085494 | |||
| 1836 | Ga0495596_0021456 | |||
| 1837 | Ga0495596_0315405 | |||
| 1838 | Ga0495607_0219680 | |||
| 1839 | Ga0495583_0220418 | |||
| 1840 | Ga0495608_0020844 | |||
| 1841 | Ga0495616_0472862 | |||
| 1842 | Ga0495630_0009471 | |||
| 1843 | Ga0495630_0015958 | |||
| 1844 | Ga0495630_0345578 | |||
| 1845 | Ga0495630_0346281 | |||
| 1846 | Ga0495630_0418887 | |||
| 1847 | Ga0495631_0193216 | |||
| 1848 | Ga0495631_0253030 | |||
| 1849 | Ga0495644_0060146 | |||
| 1850 | Ga0495644_0278303 | |||
| 1851 | Ga0495663_0003027 | |||
| 1852 | Ga0495663_0045348 | |||
| 1853 | Ga0495663_0122039 | |||
| 1854 | Ga0495666_0296326 | |||
| 1855 | Ga0495642_0002088 | |||
| 1856 | Ga0495642_0099725 | |||
| 1857 | Ga0495642_0156571 | |||
| 1858 | Ga0495642_0303545 | |||
| 1859 | Ga0495652_0002840 | |||
| 1860 | Ga0495640_0068395 | |||
| 1861 | Ga0495587_0007924 | |||
| 1862 | Ga0495587_0552710 | |||
| 1863 | Ga0495609_0045743 | |||
| 1864 | Ga0495609_0123002 | |||
| 1865 | Ga0495609_0224140 | |||
| 1866 | Ga0495609_0365385 | |||
| 1867 | Ga0495645_0023584 | |||
| 1868 | Ga0495645_0346611 | |||
| 1869 | Ga0495667_0038593 | |||
| 1870 | Ga0495656_0026254 | |||
| 1871 | Ga0495656_0394153 | |||
| 1872 | Ga0495668_0720180 | |||
| 1873 | Ga0495611_0248735 | |||
| 1874 | Ga0495635_0031752 | |||
| 1875 | Ga0495659_0190149 | |||
| 1876 | Ga0495661_0104833 | |||
| 1877 | Ga0495588_0000386 | |||
| 1878 | Ga0495657_0003397 | |||
| 1879 | Ga0495657_0194305 | |||
| 1880 | Ga0495599_0010250 | |||
| 1881 | Ga0495599_0515971 | |||
| 1882 | Ga0495623_0034680 | |||
| 1883 | Ga0495646_0022243 | |||
| 1884 | Ga0495647_0045355 | |||
| 1885 | Ga0495658_0028785 | |||
| 1886 | Ga0495658_0048880 | |||
| 1887 | Ga0495658_0353203 | |||
| 1888 | Ga0495669_0334383 | |||
| 1889 | Ga0495613_0103944 | |||
| 1890 | Ga0495613_0184033 | |||
| 1891 | Ga0495624_0076333 | |||
| 1892 | Ga0495624_0145038 | |||
| 1893 | Ga0495624_0221241 | |||
| 1894 | Ga0495624_0821159 | |||
| 1895 | Ga0495624_0823505 | |||
| 1896 | Ga0495670_0315457 | |||
| 1897 | Ga0495671_0084333 | |||
| 1898 | Ga0495671_0226442 | |||
| 1899 | Ga0495589_0010061 | |||
| 1900 | Ga0495589_0135727 | |||
| 1901 | Ga0495589_0335318 | |||
| 1902 | Ga0495589_0449170 | |||
| 1903 | Ga0495600_0044372 | |||
| 1904 | Ga0495660_0229894 | |||
| 1905 | Ga0495581_0017359 | |||
| 1906 | Ga0495581_0331462 | |||
| 1907 | Ga0495604_0001936 | |||
| 1908 | Ga0495636_0173937 | |||
| 1909 | Ga0495674_0069254 | |||
| 1910 | Ga0495676_0003527 | |||
| 1911 | Ga0495676_0017547 | |||
| 1912 | Ga0495676_0182116 | |||
| 1913 | Ga0495680_0033080 | |||
| 1914 | Ga0495680_0195194 | |||
| 1915 | Ga0495675_0063810 | |||
| 1916 | Ga0495677_0055792 | |||
| 1917 | Ga0495677_0056263 | |||
| 1918 | Ga0495677_0064247 | |||
| 1919 | Ga0495685_016530 | |||
| 1920 | Ga0495685_076222 | |||
| 1921 | Ga0495685_092487 | |||
| 1922 | Ga0495684_0029798 | |||
| 1923 | Ga0495684_0765781 | |||
| 1924 | Ga0495602_0132456 | |||
| 1925 | Ga0495615_0163234 | |||
| 1926 | Ga0496100_0011431 | |||
| 1927 | Ga0496100_0018009 | |||
| 1928 | Ga0496100_0024431 | |||
| 1929 | Ga0496100_0066596 | |||
| 1930 | Ga0496100_0236310 | |||
| 1931 | Ga0496100_0243878 | |||
| 1932 | Ga0496100_0316776 | |||
| 1933 | Ga0496100_0561418 | |||
| 1934 | Ga0496101_0004718 | |||
| 1935 | Ga0496101_0012082 | |||
| 1936 | Ga0496101_0014818 | |||
| 1937 | Ga0496101_0036178 | |||
| 1938 | Ga0496101_0072202 | |||
| 1939 | Ga0496101_0109334 | |||
| 1940 | Ga0496101_0136164 | |||
| 1941 | Ga0496101_0438588 | |||
| 1942 | Ga0496102_0007615 | |||
| 1943 | Ga0496102_0056788 | |||
| 1944 | Ga0496102_0064400 | |||
| 1945 | Ga0496102_0139887 | |||
| 1946 | Ga0496102_0182774 | |||
| 1947 | Ga0496102_0254501 | |||
| 1948 | Ga0496102_0279178 | |||
| 1949 | Ga0496102_0497953 | |||
| 1950 | Ga0496102_0791465 | |||
| 1951 | Ga0496103_0065922 | |||
| 1952 | Ga0496103_0121703 | |||
| 1953 | Ga0496103_0184821 | |||
| 1954 | Ga0496103_0257787 | |||
| 1955 | Ga0496103_0349534 | |||
| 1956 | Ga0496104_0006223 | |||
| 1957 | Ga0496104_0016554 | |||
| 1958 | Ga0496104_0076463 | |||
| 1959 | Ga0496104_0178052 | |||
| 1960 | Ga0496104_0225149 | |||
| 1961 | Ga0496105_0001344 | |||
| 1962 | Ga0496105_0015285 | |||
| 1963 | Ga0496105_0025035 | |||
| 1964 | Ga0496105_0063251 | |||
| 1965 | Ga0496105_0135422 | |||
| 1966 | Ga0496105_0159657 | |||
| 1967 | Ga0496105_0293192 | |||
| 1968 | Ga0496105_0600874 | |||
| 1969 | Ga0496106_0001942 | |||
| 1970 | Ga0496106_0009234 | |||
| 1971 | Ga0496106_0020978 | |||
| 1972 | Ga0496106_0056148 | |||
| 1973 | Ga0496106_0123737 | |||
| 1974 | Ga0496106_0252282 | |||
| 1975 | Ga0496106_0300110 | |||
| 1976 | Ga0496106_0333159 | |||
| 1977 | Ga0496106_0351089 | |||
| 1978 | Ga0496106_0739175 | |||
| 1979 | Ga0496106_1071500 | |||
| 1980 | Ga0496107_0010877 | |||
| 1981 | Ga0496107_0020567 | |||
| 1982 | Ga0496107_0025458 | |||
| 1983 | Ga0496107_0028248 | |||
| 1984 | Ga0496107_0039630 | |||
| 1985 | Ga0496107_0056470 | |||
| 1986 | Ga0496107_0089664 | |||
| 1987 | Ga0496108_0011862 | |||
| 1988 | Ga0496108_0015161 | |||
| 1989 | Ga0496108_0024664 | |||
| 1990 | Ga0496108_0104465 | |||
| 1991 | Ga0496108_0157744 | |||
| 1992 | Ga0496108_0261670 | |||
| 1993 | Ga0496108_0267253 | |||
| 1994 | Ga0496108_0900127 | |||
| 1995 | Ga0496109_0000913 | |||
| 1996 | Ga0496109_0058013 | |||
| 1997 | Ga0496109_0064688 | |||
| 1998 | Ga0496109_0075434 | |||
| 1999 | Ga0496109_0083517 | |||
| 2000 | Ga0496109_0097449 | |||
| 2001 | Ga0496109_0854787 | |||
| 2002 | Ga0496109_1399886 | |||
| 2003 | Ga0496109_1493330 | |||
| 2004 | Ga0496110_0001323 | |||
| 2005 | Ga0496110_0005540 | |||
| 2006 | Ga0496110_0013468 | |||
| 2007 | Ga0496110_0015440 | |||
| 2008 | Ga0496110_0025466 | |||
| 2009 | Ga0496110_0104457 | |||
| 2010 | Ga0496110_0113523 | |||
| 2011 | Ga0496110_0174569 | |||
| 2012 | Ga0496110_0217762 | |||
| 2013 | Ga0496110_0245990 | |||
| 2014 | Ga0496111_0000279 | |||
| 2015 | Ga0496111_0006459 | |||
| 2016 | Ga0496111_0020698 | |||
| 2017 | Ga0496111_0062988 | |||
| 2018 | Ga0496111_0143221 | |||
| 2019 | Ga0496111_0209134 | |||
| 2020 | Ga0496111_0269679 | |||
| 2021 | Ga0496112_0001437 | |||
| 2022 | Ga0496112_0002718 | |||
| 2023 | Ga0496112_0010447 | |||
| 2024 | Ga0496112_0041781 | |||
| 2025 | Ga0496112_0043018 | |||
| 2026 | Ga0496112_0083847 | |||
| 2027 | Ga0496112_0103471 | |||
| 2028 | Ga0496112_0127625 | |||
| 2029 | Ga0496112_0179421 | |||
| 2030 | Ga0496112_0197406 | |||
| 2031 | Ga0496112_0745717 | |||
| 2032 | Ga0496112_0794256 | |||
| 2033 | Ga0496113_0014893 | |||
| 2034 | Ga0496113_0061308 | |||
| 2035 | Ga0496113_0068556 | |||
| 2036 | Ga0496113_0074370 | |||
| 2037 | Ga0496113_0104151 | |||
| 2038 | Ga0496114_0011516 | |||
| 2039 | Ga0496114_0029095 | |||
| 2040 | Ga0496114_0034791 | |||
| 2041 | Ga0496114_0062537 | |||
| 2042 | Ga0496114_0073940 | |||
| 2043 | Ga0496114_0116183 | |||
| 2044 | Ga0496114_0194111 | |||
| 2045 | Ga0496114_0536939 | |||
| 2046 | Ga0496114_0763085 | |||
| 2047 | Ga0496115_0017636 | |||
| 2048 | Ga0496115_0113172 | |||
| 2049 | Ga0496115_0113700 | |||
| 2050 | Ga0496115_0219767 | |||
| 2051 | Ga0496115_0560883 | |||
| 2052 | Ga0496115_0937954 | |||
| 2053 | Ga0501031_0001876 | |||
| 2054 | Ga0501031_0007046 | |||
| 2055 | Ga0501032_0024392 | |||
| 2056 | Ga0501032_0372007 | |||
| 2057 | Ga0501033_0032602 | |||
| 2058 | Ga0501033_0068194 | |||
| 2059 | Ga0501033_0648617 | |||
| 2060 | Ga0501034_0448665 | |||
| 2061 | Ga0501034_0513907 | |||
| 2062 | Ga0501036_0001385 | |||
| 2063 | Ga0501036_0003628 | |||
| 2064 | Ga0501036_0004340 | |||
| 2065 | Ga0501036_0103810 | |||
| 2066 | Ga0501036_0146505 | |||
| 2067 | Ga0501037_0033208 | |||
| 2068 | Ga0501037_0098213 | |||
| 2069 | Ga0501038_0004936 | |||
| 2070 | Ga0501038_0056573 | |||
| 2071 | Ga0501038_0106549 | |||
| 2072 | Ga0501039_0006146 | |||
| 2073 | Ga0501039_0008532 | |||
| 2074 | Ga0501039_0017649 | |||
| 2075 | Ga0501039_0033282 | |||
| 2076 | Ga0501040_0008104 | |||
| 2077 | Ga0501040_0013666 | |||
| 2078 | Ga0501040_0017114 | |||
| 2079 | Ga0501040_0052337 | |||
| 2080 | Ga0501040_0731299 | |||
| 2081 | Ga0501041_0014081 | |||
| 2082 | Ga0501041_0024075 | |||
| 2083 | Ga0501041_0430070 | |||
| 2084 | Ga0501042_0000412 | |||
| 2085 | Ga0501042_0009943 | |||
| 2086 | Ga0501042_0012097 | |||
| 2087 | Ga0501042_0016310 | |||
| 2088 | Ga0501043_0049860 | |||
| 2089 | Ga0501043_0057401 | |||
| 2090 | Ga0501043_0773551 | |||
| 2091 | Ga0501046_0003352 | |||
| 2092 | Ga0501046_0013147 | |||
| 2093 | Ga0501046_0037038 | |||
| 2094 | Ga0501046_0218132 | |||
| 2095 | Ga0501046_0294009 | |||
| 2096 | Ga0501048_0003166 | |||
| 2097 | Ga0501048_0005109 | |||
| 2098 | Ga0501048_0166344 | |||
| 2099 | Ga0501048_0246324 | |||
| 2100 | Ga0501067_0002988 | |||
| 2101 | Ga0501067_0012242 | |||
| 2102 | Ga0501067_0034820 | |||
| 2103 | Ga0501067_0083810 | |||
| 2104 | Ga0501067_0444767 | |||
| 2105 | Ga0501068_0002166 | |||
| 2106 | Ga0501068_0012742 | |||
| 2107 | Ga0501068_0144879 | |||
| 2108 | Ga0501069_0001301 | |||
| 2109 | Ga0501069_0005039 | |||
| 2110 | Ga0501069_0016049 | |||
| 2111 | Ga0501069_0287703 | |||
| 2112 | Ga0501069_0323969 | |||
| 2113 | Ga0501070_0003825 | |||
| 2114 | Ga0501070_0046485 | |||
| 2115 | Ga0501070_0413826 | |||
| 2116 | Ga0501071_0000488 | |||
| 2117 | Ga0501071_0002874 | |||
| 2118 | Ga0501071_0107542 | |||
| 2119 | Ga0501071_0117624 | |||
| 2120 | Ga0501071_0204958 | |||
| 2121 | Ga0501071_0515576 | |||
| 2122 | Ga0501071_1111487 | |||
| 2123 | Ga0501072_0000766 | |||
| 2124 | Ga0501072_0001800 | |||
| 2125 | Ga0501072_0018797 | |||
| 2126 | Ga0501072_0041626 | |||
| 2127 | Ga0501072_0365771 | |||
| 2128 | Ga0501073_0000419 | |||
| 2129 | Ga0501073_0129286 | |||
| 2130 | Ga0501073_0166702 | |||
| 2131 | Ga0501074_0004161 | |||
| 2132 | Ga0501074_0025974 | |||
| 2133 | Ga0501074_0050692 | |||
| 2134 | Ga0501075_0003121 | |||
| 2135 | Ga0501075_0003840 | |||
| 2136 | Ga0501075_0003953 | |||
| 2137 | Ga0501075_0014706 | |||
| 2138 | Ga0501075_0611634 | |||
| 2139 | Ga0501076_0000345 | |||
| 2140 | Ga0501076_0002631 | |||
| 2141 | Ga0501076_0019913 | |||
| 2142 | Ga0501076_0343380 | |||
| 2143 | Ga0501077_0004326 | |||
| 2144 | Ga0501077_0008459 | |||
| 2145 | Ga0501077_0016290 | |||
| 2146 | Ga0501077_0125833 | |||
| 2147 | Ga0501079_0000772 | |||
| 2148 | Ga0501079_0005276 | |||
| 2149 | Ga0501079_0017541 | |||
| 2150 | Ga0501079_0041811 | |||
| 2151 | Ga0501080_0003745 | |||
| 2152 | Ga0501080_0005615 | |||
| 2153 | Ga0501080_0047054 | |||
| 2154 | Ga0501080_0077269 | |||
| 2155 | Ga0501081_0000859 | |||
| 2156 | Ga0501081_0010667 | |||
| 2157 | Ga0501081_0031719 | |||
| 2158 | Ga0501081_0048479 | |||
| 2159 | Ga0501081_0243490 | |||
| 2160 | Ga0501081_0527847 | |||
| 2161 | Ga0501083_0040852 | |||
| 2162 | Ga0501083_0103100 | |||
| 2163 | Ga0501035_0006535 | |||
| 2164 | Ga0501035_0063583 | |||
| 2165 | Ga0501035_0141331 | |||
| 2166 | Ga0501044_0255432 | |||
| 2167 | Ga0501044_0754596 | |||
| 2168 | Ga0501044_0986598 | |||
| 2169 | Ga0501045_0017695 | |||
| 2170 | Ga0501045_0026721 | |||
| 2171 | Ga0501045_0030695 | |||
| 2172 | nmdc:mga00v17_36670_c1 | |||
| 2173 | nmdc:mga00v17_807287_c1 | |||
| 2174 | nmdc:mga0yw44_26546_c1 | |||
| 2175 | nmdc:mga0yw44_55927_c1 | |||
| 2176 | nmdc:mga0yw44_68342_c1 | |||
| 2177 | nmdc:mga06z11_33288_c1 | |||
| 2178 | nmdc:mga05p37_165682_c1 | |||
| 2179 | nmdc:mga05p37_231176_c1 | |||
| 2180 | nmdc:mga05p37_317944_c1 | |||
| 2181 | nmdc:mga05p37_42775_c1 | |||
| 2182 | nmdc:mga05p37_435738_c1 | |||
| 2183 | nmdc:mga05p37_60118_c1 | |||
| 2184 | nmdc:mga05p37_67442_c1 | |||
| 2185 | nmdc:mga05p37_67769_c1 | |||
| 2186 | nmdc:mga09592_700990_c1 | |||
| 2187 | nmdc:mga09592_702626_c1 | |||
| 2188 | nmdc:mga0qj67_427493_c1 | |||
| 2189 | nmdc:mga06r32_85077_c1 | |||
| 2190 | nmdc:mga08y16_1758599_c1 | |||
| 2191 | nmdc:mga08y16_365182_c1 | |||
| 2192 | nmdc:mga08y16_444147_c1 | |||
| 2193 | nmdc:mga08y16_56922_c1 | |||
| 2194 | nmdc:mga08y16_570626_c1 | |||
| 2195 | nmdc:mga08y16_75325_c1 | |||
| 2196 | nmdc:mga08y16_896069_c1 | |||
| 2197 | nmdc:mga0n895_105949_c1 | |||
| 2198 | nmdc:mga0n895_37840_c1 | |||
| 2199 | nmdc:mga0n895_802817_c1 | |||
| 2200 | nmdc:mga0rr50_173476_c1 | |||
| 2201 | nmdc:mga0rr50_3884_c1 | |||
| 2202 | nmdc:mga0rr50_62134_c1 | |||
| 2203 | nmdc:mga08x19_39707_c1 | |||
| 2204 | nmdc:mga08x19_4071_c1 | |||
| 2205 | nmdc:mga08x19_59867_c1 | |||
| 2206 | nmdc:mga0a205_122863_c1 | |||
| 2207 | nmdc:mga0a205_238993_c1 | |||
| 2208 | nmdc:mga0a205_307415_c1 | |||
| 2209 | nmdc:mga0a205_47338_c1 | |||
| 2210 | nmdc:mga0a205_475142_c1 | |||
| 2211 | nmdc:mga0a205_635472_c1 | |||
| 2212 | Ga0495601_0181209 | |||
| 2213 | Ga0495601_0219131 | |||
| 2214 | Ga0495612_0024451 | |||
| 2215 | Ga0495655_0189269 | |||
| 2216 | Ga0495595_0004985 | |||
| 2217 | Ga0495595_0190918 | |||
| 2218 | Ga0495619_0038345 | |||
| 2219 | Ga0501084_0000701 | |||
| 2220 | Ga0501084_0070325 | |||
| 2221 | Ga0501084_0180964 | |||
| 2222 | Ga0590075_006807 | |||
| 2223 | Ga0501082_0000579 | |||
| 2224 | Ga0501082_0004171 | |||
| 2225 | Ga0501082_0041777 | |||
| 2226 | Ga0501082_0258206 | |||
| 2227 | Ga0501082_0292731 | |||
| 2228 | Ga0501082_0340526 | |||
| 2229 | Ga0466962_0012499 | |||
| 2230 | Ga0466962_0012709 | |||
| 2231 | Ga0466962_0013426 | |||
| 2232 | Ga0466962_0033032 | |||
| 2233 | Ga0466962_0053350 | |||
| 2234 | Ga0530510_0005529 | |||
| 2235 | Ga0530510_0010515 | |||
| 2236 | Ga0530510_0019740 | |||
| 2237 | Ga0530510_0023690 | |||
| 2238 | Ga0530510_0030559 | |||
| 2239 | Ga0530510_0069211 | |||
| 2240 | Ga0530510_0576435 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hwd-assembly3.cif.gz_C | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.7163 | 81 | 112 |
| 8h8p-assembly1.cif.gz_D | crystal structure of thiomorpholine-carboxylate dehydrogenase from candida parapsilosis. | 0.7156 | 68 | 115 |
| 3o6u-assembly2.cif.gz_B | crystal structure of cpe2226 protein from clostridium perfringens. northeast structural genomics consortium target cpr195 | 0.6277 | 62 | 108 |
| 2gjt-assembly3.cif.gz_B | crystal structure of the human receptor phosphatase ptpro | 0.624 | 78 | 110 |
| 8bzl-assembly1.cif.gz_b | human 20s proteasome in complex with peptide activator peptide blm42 | 0.6222 | 94 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1R696_138_249_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8017 | 93 | 114 | 2.60.40.10 |
| af_Q54XQ5_20_313_2.40.160.10 | Mainly Beta;Beta Barrel;Porin;Porin | 0.759 | 68 | 114 | 2.40.160.10 |
| 1h2hA02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.7138 | 95 | 114 | 3.30.360.10 |
| af_K7L833_59_297_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.6966 | 66 | 113 | 2.120.10.30 |
| 3rbvA02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.6963 | 66 | 110 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G4G6T0-F1-model_v4 | DUF4446 family protein | 0.9201 | 44 | 134 |
|
| AF-A0A538E1L8-F1-model_v4 | DUF4446 family protein | 0.9116 | 49 | 136 |
|
| AF-A0A645A3S3-F1-model_v4 | DUF4446 domain-containing protein | 0.903 | 65 | 136 |
|
| AF-A0A2H0FF07-F1-model_v4 | DUF4446 domain-containing protein | 0.9002 | 62 | 135 |
|
| AF-A0A6J7FEE6-F1-model_v4 | Unannotated protein | 0.8984 | 57 | 135 |
|