F490273
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1114 | 596 | 2228 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_100000750|Ga0068860_10000075030 |
| Length | 120 |
| Sequence | VIRKLSIWTAAHFAAVAVFVMVLAIAQTATPSAAQQPAASDPRIDQGKVTYAQKCSHCHGPNMLNAGTITPDLRTFPDDRDRFTTTVKLGKNNRMPPWADLLSDDEIADLWAFVSSRRNP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 137 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 138 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 139 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 219 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 220 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 221 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 222 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 223 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 224 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 225 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 227 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 228 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 229 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 232 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 233 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 234 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 237 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 243 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 246 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 251 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 258 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 259 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 260 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 261 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 262 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 266 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 267 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 268 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 269 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 270 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 271 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 272 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 273 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 274 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 275 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 276 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 279 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 364 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 365 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 366 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 367 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 368 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 369 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 372 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 373 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 374 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 378 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 379 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 380 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 381 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 382 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 383 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 384 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 385 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 386 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 393 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 394 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 395 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 396 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 398 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 405 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 406 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 407 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 409 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 410 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 411 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 412 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 413 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 414 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 415 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 416 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 417 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 418 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 419 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 420 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 421 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 423 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 424 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 425 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 426 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 427 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 428 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 429 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 430 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 432 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 433 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 434 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 435 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 436 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 437 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 438 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 439 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 440 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 441 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 442 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 445 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 446 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 447 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 448 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 449 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 450 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 451 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 452 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 453 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 454 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 455 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 456 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 457 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 458 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 459 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 460 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 461 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 462 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 463 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 464 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 465 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 466 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 467 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 468 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 469 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 470 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 471 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 472 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 473 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 474 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 475 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 476 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 477 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 478 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 479 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 480 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 481 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 482 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 483 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 484 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 485 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 486 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 487 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 488 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 489 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 490 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 491 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 492 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 493 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 494 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 495 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 496 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 497 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 498 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 499 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 500 | 2922368715 | |||
| 501 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 502 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 503 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 504 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 505 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 506 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 507 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 508 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 509 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 510 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 511 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 512 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 513 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 514 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 515 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 516 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 517 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 518 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 519 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 520 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 521 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 522 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 523 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 524 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 525 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 526 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 527 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 528 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 529 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 530 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 531 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 532 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 533 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 534 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 535 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 536 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 537 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 538 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 539 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 540 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 541 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 542 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 543 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 544 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 545 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 546 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 547 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 548 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 549 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 550 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 551 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 552 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 553 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 554 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 555 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 556 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 557 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 558 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 559 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 560 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 561 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 562 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 563 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 564 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 565 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 566 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 567 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 568 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 569 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 570 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 571 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 572 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 573 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 574 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 575 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 576 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 577 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 578 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 579 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 580 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 581 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 582 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 583 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 584 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 585 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 586 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 587 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 588 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 589 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 590 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 591 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 592 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 593 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 594 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 595 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 596 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.98 |
| Metatranscriptomes | 0.36 |
| Isolates | 13.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.95 |
| Nodule | 11.67 |
| Rhizoplane | 4.67 |
| Rhizosphere | 63.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068860_100000750 | 3300005843 | Bacteria | 36885 |
| 2 | JGI24739J22299_10174530 | 3300001989 | Bacteria | 633 |
| 3 | JGI24750J21931_1073513 | 3300002070 | Bacteria | 561 |
| 4 | JGI25153J46596_10000843 | 3300003215 | Bacteria | 18762 |
| 5 | JGI25153J46596_10021234 | 3300003215 | Bacteria | 2425 |
| 6 | rootL2_10055505 | 3300003322 | Bacteria | 1178 |
| 7 | rootH1_10060569 | 3300003323 | Bacteria | 1144 |
| 8 | JGI25160J50197_1026031 | 3300003354 | Bacteria | 1621 |
| 9 | JGI25404J52841_10001353 | 3300003659 | Bacteria | 4278 |
| 10 | JGI25404J52841_10004360 | 3300003659 | Bacteria | 2861 |
| 11 | Ga0055528_1082334 | 3300003790 | Bacteria | 563 |
| 12 | Ga0055543_1020090 | 3300004625 | Bacteria | 1230 |
| 13 | Ga0065165_1038053 | 3300005262 | Bacteria | 1453 |
| 14 | Ga0065165_1038358 | 3300005262 | Bacteria | 1445 |
| 15 | Ga0070658_10107170 | 3300005327 | Bacteria | 2312 |
| 16 | Ga0070658_10553576 | 3300005327 | Bacteria | 995 |
| 17 | Ga0070676_10025880 | 3300005328 | Bacteria | 3320 |
| 18 | Ga0070676_10338105 | 3300005328 | Bacteria | 1032 |
| 19 | Ga0070683_100023716 | 3300005329 | Bacteria | 5491 |
| 20 | Ga0070683_100876709 | 3300005329 | Bacteria | 861 |
| 21 | Ga0070690_100884968 | 3300005330 | Bacteria | 698 |
| 22 | Ga0070690_101055014 | 3300005330 | Bacteria | 643 |
| 23 | Ga0070670_100250549 | 3300005331 | Bacteria | 1543 |
| 24 | Ga0068869_100121583 | 3300005334 | Bacteria | 1997 |
| 25 | Ga0068869_100267459 | 3300005334 | Bacteria | 1371 |
| 26 | Ga0068869_100426135 | 3300005334 | Bacteria | 1095 |
| 27 | Ga0070666_10291684 | 3300005335 | Bacteria | 1161 |
| 28 | Ga0070666_10827191 | 3300005335 | Bacteria | 683 |
| 29 | Ga0070680_100004777 | 3300005336 | Bacteria | 10200 |
| 30 | Ga0070680_100543344 | 3300005336 | Bacteria | 996 |
| 31 | Ga0070682_100031944 | 3300005337 | Bacteria | 3188 |
| 32 | Ga0070682_100437133 | 3300005337 | Bacteria | 999 |
| 33 | Ga0070682_100695615 | 3300005337 | Bacteria | 815 |
| 34 | Ga0068868_100141581 | 3300005338 | Bacteria | 1974 |
| 35 | Ga0068868_100621024 | 3300005338 | Bacteria | 959 |
| 36 | Ga0070660_100498857 | 3300005339 | Bacteria | 1012 |
| 37 | Ga0070660_101522759 | 3300005339 | Bacteria | 569 |
| 38 | Ga0070689_100700055 | 3300005340 | Bacteria | 885 |
| 39 | Ga0070687_100402922 | 3300005343 | Bacteria | 898 |
| 40 | Ga0070661_100156504 | 3300005344 | Bacteria | 1724 |
| 41 | Ga0070661_100799065 | 3300005344 | Bacteria | 774 |
| 42 | Ga0070692_10376038 | 3300005345 | Bacteria | 890 |
| 43 | Ga0070692_10676437 | 3300005345 | Bacteria | 692 |
| 44 | Ga0070668_100055099 | 3300005347 | Bacteria | 3068 |
| 45 | Ga0070668_100084489 | 3300005347 | Bacteria | 2493 |
| 46 | Ga0070668_100252158 | 3300005347 | Bacteria | 1465 |
| 47 | Ga0070668_100257843 | 3300005347 | Bacteria | 1449 |
| 48 | Ga0070668_100754749 | 3300005347 | Bacteria | 861 |
| 49 | Ga0070668_100986344 | 3300005347 | Bacteria | 757 |
| 50 | Ga0070668_101716920 | 3300005347 | Bacteria | 576 |
| 51 | Ga0070669_100304580 | 3300005353 | Bacteria | 1282 |
| 52 | Ga0070669_100335148 | 3300005353 | Bacteria | 1224 |
| 53 | Ga0070675_101822876 | 3300005354 | Bacteria | 561 |
| 54 | Ga0070671_100015685 | 3300005355 | Bacteria | 6123 |
| 55 | Ga0070671_100535186 | 3300005355 | Bacteria | 1010 |
| 56 | Ga0070671_100610857 | 3300005355 | Bacteria | 943 |
| 57 | Ga0070671_100669016 | 3300005355 | Bacteria | 900 |
| 58 | Ga0070674_100132979 | 3300005356 | Bacteria | 1857 |
| 59 | Ga0070674_100162288 | 3300005356 | Bacteria | 1696 |
| 60 | Ga0070674_100502260 | 3300005356 | Bacteria | 1010 |
| 61 | Ga0070673_100207106 | 3300005364 | Bacteria | 1692 |
| 62 | Ga0070688_100670027 | 3300005365 | Bacteria | 801 |
| 63 | Ga0070659_100332715 | 3300005366 | Bacteria | 1271 |
| 64 | Ga0070667_100189101 | 3300005367 | Bacteria | 1823 |
| 65 | Ga0070667_100379012 | 3300005367 | Bacteria | 1285 |
| 66 | Ga0070667_100381448 | 3300005367 | Bacteria | 1280 |
| 67 | Ga0070703_10028631 | 3300005406 | Bacteria | 1667 |
| 68 | Ga0070701_10124376 | 3300005438 | Bacteria | 1457 |
| 69 | Ga0070711_100600866 | 3300005439 | Bacteria | 918 |
| 70 | Ga0070711_101418067 | 3300005439 | Bacteria | 605 |
| 71 | Ga0070705_100880836 | 3300005440 | Bacteria | 719 |
| 72 | Ga0070700_100040996 | 3300005441 | Bacteria | 2837 |
| 73 | Ga0070700_100246793 | 3300005441 | Bacteria | 1279 |
| 74 | Ga0070700_100559845 | 3300005441 | Bacteria | 889 |
| 75 | Ga0070700_100830728 | 3300005441 | Bacteria | 746 |
| 76 | Ga0070700_100913979 | 3300005441 | Bacteria | 715 |
| 77 | Ga0070694_100413650 | 3300005444 | Bacteria | 1058 |
| 78 | Ga0070663_100009162 | 3300005455 | Bacteria | 6119 |
| 79 | Ga0070663_100246854 | 3300005455 | Bacteria | 1411 |
| 80 | Ga0070663_100465253 | 3300005455 | Bacteria | 1045 |
| 81 | Ga0070663_100508816 | 3300005455 | Bacteria | 1001 |
| 82 | Ga0070663_100667781 | 3300005455 | Bacteria | 881 |
| 83 | Ga0070663_101087753 | 3300005455 | Bacteria | 698 |
| 84 | Ga0070678_100021931 | 3300005456 | Bacteria | 4221 |
| 85 | Ga0070678_100221283 | 3300005456 | Bacteria | 1574 |
| 86 | Ga0070678_100779224 | 3300005456 | Bacteria | 867 |
| 87 | Ga0070678_101145000 | 3300005456 | Bacteria | 720 |
| 88 | Ga0070662_100142055 | 3300005457 | Bacteria | 1861 |
| 89 | Ga0070662_100294048 | 3300005457 | Bacteria | 1317 |
| 90 | Ga0070662_100430657 | 3300005457 | Bacteria | 1093 |
| 91 | Ga0070681_10469658 | 3300005458 | Bacteria | 1170 |
| 92 | Ga0068867_100048504 | 3300005459 | Bacteria | 3124 |
| 93 | Ga0068867_100138539 | 3300005459 | Bacteria | 1900 |
| 94 | Ga0068867_100525795 | 3300005459 | Bacteria | 1021 |
| 95 | Ga0070685_10160444 | 3300005466 | Bacteria | 1433 |
| 96 | Ga0070685_10274246 | 3300005466 | Bacteria | 1127 |
| 97 | Ga0070685_10693705 | 3300005466 | Bacteria | 742 |
| 98 | Ga0070698_100126600 | 3300005471 | Bacteria | 2511 |
| 99 | Ga0070699_101350453 | 3300005518 | Bacteria | 654 |
| 100 | Ga0070684_100016830 | 3300005535 | Bacteria | 5988 |
| 101 | Ga0070684_101467372 | 3300005535 | Bacteria | 643 |
| 102 | Ga0068853_100214742 | 3300005539 | Bacteria | 1754 |
| 103 | Ga0068853_101783340 | 3300005539 | Bacteria | 597 |
| 104 | Ga0070672_100174547 | 3300005543 | Bacteria | 1789 |
| 105 | Ga0070672_100380821 | 3300005543 | Bacteria | 1207 |
| 106 | Ga0070672_101009408 | 3300005543 | Bacteria | 737 |
| 107 | Ga0070686_100050955 | 3300005544 | Bacteria | 2633 |
| 108 | Ga0070695_101105884 | 3300005545 | Bacteria | 649 |
| 109 | Ga0070696_100941657 | 3300005546 | Bacteria | 718 |
| 110 | Ga0070693_100149081 | 3300005547 | Bacteria | 1480 |
| 111 | Ga0070693_100496949 | 3300005547 | Bacteria | 864 |
| 112 | Ga0070665_100029422 | 3300005548 | Bacteria | 5529 |
| 113 | Ga0070665_100030432 | 3300005548 | Bacteria | 5431 |
| 114 | Ga0070665_100195114 | 3300005548 | Bacteria | 2025 |
| 115 | Ga0070665_100217409 | 3300005548 | Bacteria | 1911 |
| 116 | Ga0070665_100226356 | 3300005548 | Bacteria | 1870 |
| 117 | Ga0070665_100748299 | 3300005548 | Bacteria | 990 |
| 118 | Ga0070665_100839117 | 3300005548 | Bacteria | 932 |
| 119 | Ga0070704_101907666 | 3300005549 | Bacteria | 551 |
| 120 | Ga0068855_100088885 | 3300005563 | Bacteria | 3568 |
| 121 | Ga0068855_100102387 | 3300005563 | Bacteria | 3296 |
| 122 | Ga0068857_100238698 | 3300005577 | Bacteria | 1664 |
| 123 | Ga0068857_100498259 | 3300005577 | Bacteria | 1143 |
| 124 | Ga0068857_101152947 | 3300005577 | Bacteria | 749 |
| 125 | Ga0068854_100104129 | 3300005578 | Bacteria | 2131 |
| 126 | Ga0068854_100171858 | 3300005578 | Bacteria | 1687 |
| 127 | Ga0068854_100817197 | 3300005578 | Bacteria | 814 |
| 128 | Ga0068856_100007648 | 3300005614 | Bacteria | 10544 |
| 129 | Ga0068856_100139603 | 3300005614 | Bacteria | 2430 |
| 130 | Ga0068856_101282933 | 3300005614 | Bacteria | 748 |
| 131 | Ga0068856_101346862 | 3300005614 | Bacteria | 729 |
| 132 | Ga0070702_100076314 | 3300005615 | Bacteria | 1994 |
| 133 | Ga0070702_100137210 | 3300005615 | Bacteria | 1553 |
| 134 | Ga0070702_100521353 | 3300005615 | Bacteria | 876 |
| 135 | Ga0070702_100556064 | 3300005615 | Bacteria | 853 |
| 136 | Ga0068852_100231763 | 3300005616 | Bacteria | 1760 |
| 137 | Ga0068852_100465069 | 3300005616 | Bacteria | 1254 |
| 138 | Ga0068852_101863612 | 3300005616 | Bacteria | 624 |
| 139 | Ga0068859_100766262 | 3300005617 | Bacteria | 1053 |
| 140 | Ga0068864_100080457 | 3300005618 | Bacteria | 2854 |
| 141 | Ga0068864_100336155 | 3300005618 | Bacteria | 1422 |
| 142 | Ga0068864_100713276 | 3300005618 | Bacteria | 980 |
| 143 | Ga0068866_10060197 | 3300005718 | Bacteria | 1967 |
| 144 | Ga0068866_10220698 | 3300005718 | Bacteria | 1143 |
| 145 | Ga0068861_100033062 | 3300005719 | Bacteria | 3813 |
| 146 | Ga0068861_100148087 | 3300005719 | Bacteria | 1923 |
| 147 | Ga0068861_100153790 | 3300005719 | Bacteria | 1890 |
| 148 | Ga0068861_100164450 | 3300005719 | Bacteria | 1833 |
| 149 | Ga0068861_100263513 | 3300005719 | Bacteria | 1476 |
| 150 | Ga0068861_100494476 | 3300005719 | Bacteria | 1104 |
| 151 | Ga0068861_100676157 | 3300005719 | Bacteria | 956 |
| 152 | Ga0068851_10175090 | 3300005834 | Bacteria | 1186 |
| 153 | Ga0068851_10357824 | 3300005834 | Bacteria | 851 |
| 154 | Ga0068870_10066579 | 3300005840 | Bacteria | 1952 |
| 155 | Ga0068870_10519275 | 3300005840 | Bacteria | 797 |
| 156 | Ga0068870_10892336 | 3300005840 | Bacteria | 627 |
| 157 | Ga0068870_10959185 | 3300005840 | Bacteria | 608 |
| 158 | Ga0068863_100314915 | 3300005841 | Bacteria | 1519 |
| 159 | Ga0068863_100392291 | 3300005841 | Bacteria | 1357 |
| 160 | Ga0068863_100404399 | 3300005841 | Bacteria | 1336 |
| 161 | Ga0068863_100564274 | 3300005841 | Bacteria | 1125 |
| 162 | Ga0068863_102493045 | 3300005841 | Bacteria | 526 |
| 163 | Ga0068858_100048903 | 3300005842 | Bacteria | 3916 |
| 164 | Ga0068858_100397065 | 3300005842 | Bacteria | 1325 |
| 165 | Ga0068858_100461786 | 3300005842 | Bacteria | 1224 |
| 166 | Ga0068858_100718171 | 3300005842 | Bacteria | 973 |
| 167 | Ga0068858_100999822 | 3300005842 | Bacteria | 819 |
| 168 | Ga0068858_101207399 | 3300005842 | Bacteria | 743 |
| 169 | Ga0068858_101242402 | 3300005842 | Bacteria | 733 |
| 170 | Ga0068860_100086071 | 3300005843 | Bacteria | 2990 |
| 171 | Ga0068860_100150847 | 3300005843 | Bacteria | 2238 |
| 172 | Ga0068860_100353972 | 3300005843 | Bacteria | 1445 |
| 173 | Ga0068860_100492909 | 3300005843 | Bacteria | 1222 |
| 174 | Ga0068860_100834988 | 3300005843 | Bacteria | 936 |
| 175 | Ga0068860_100956299 | 3300005843 | Bacteria | 874 |
| 176 | Ga0068862_100077665 | 3300005844 | Bacteria | 2875 |
| 177 | Ga0068862_100766978 | 3300005844 | Bacteria | 939 |
| 178 | Ga0068862_101014097 | 3300005844 | Bacteria | 821 |
| 179 | Ga0081455_10109710 | 3300005937 | Bacteria | 2196 |
| 180 | Ga0081455_10230722 | 3300005937 | Bacteria | 1366 |
| 181 | Ga0081455_10690504 | 3300005937 | Bacteria | 652 |
| 182 | Ga0081538_10043620 | 3300005981 | Bacteria | 2812 |
| 183 | Ga0081540_1007986 | 3300005983 | Bacteria | 7452 |
| 184 | Ga0081540_1008303 | 3300005983 | Bacteria | 7267 |
| 185 | Ga0081540_1010128 | 3300005983 | Bacteria | 6417 |
| 186 | Ga0081540_1139209 | 3300005983 | Bacteria | 977 |
| 187 | Ga0081539_10037212 | 3300005985 | Bacteria | 2901 |
| 188 | Ga0070717_10911795 | 3300006028 | Bacteria | 800 |
| 189 | Ga0070717_11769401 | 3300006028 | Bacteria | 559 |
| 190 | Ga0075365_10099467 | 3300006038 | Bacteria | 1990 |
| 191 | Ga0075365_10182715 | 3300006038 | Bacteria | 1466 |
| 192 | Ga0075368_10085864 | 3300006042 | Bacteria | 1284 |
| 193 | Ga0075368_10093095 | 3300006042 | Bacteria | 1233 |
| 194 | Ga0075368_10093219 | 3300006042 | Bacteria | 1233 |
| 195 | Ga0075363_100061563 | 3300006048 | Bacteria | 2023 |
| 196 | Ga0075363_100697926 | 3300006048 | Bacteria | 613 |
| 197 | Ga0075364_10141851 | 3300006051 | Bacteria | 1616 |
| 198 | Ga0075364_10222313 | 3300006051 | Bacteria | 1282 |
| 199 | Ga0075364_11087969 | 3300006051 | Bacteria | 543 |
| 200 | Ga0075432_10029052 | 3300006058 | Bacteria | 1908 |
| 201 | Ga0070715_10642989 | 3300006163 | Bacteria | 627 |
| 202 | Ga0070712_101772162 | 3300006175 | Bacteria | 541 |
| 203 | Ga0075362_10162900 | 3300006177 | Bacteria | 1075 |
| 204 | Ga0075362_10167615 | 3300006177 | Bacteria | 1060 |
| 205 | Ga0075362_10459219 | 3300006177 | Bacteria | 648 |
| 206 | Ga0075367_10126989 | 3300006178 | Bacteria | 1574 |
| 207 | Ga0075367_10149598 | 3300006178 | Bacteria | 1448 |
| 208 | Ga0075367_10222054 | 3300006178 | Bacteria | 1182 |
| 209 | Ga0075367_10392288 | 3300006178 | Bacteria | 878 |
| 210 | Ga0075369_10019837 | 3300006186 | Bacteria | 2748 |
| 211 | Ga0075369_10046941 | 3300006186 | Bacteria | 1861 |
| 212 | Ga0075369_10170822 | 3300006186 | Bacteria | 998 |
| 213 | Ga0075369_10382273 | 3300006186 | Bacteria | 663 |
| 214 | Ga0075366_10075614 | 3300006195 | Bacteria | 2009 |
| 215 | Ga0075366_10484225 | 3300006195 | Bacteria | 764 |
| 216 | Ga0075366_10505068 | 3300006195 | Bacteria | 748 |
| 217 | Ga0097621_100526415 | 3300006237 | Bacteria | 1074 |
| 218 | Ga0097621_100763233 | 3300006237 | Bacteria | 894 |
| 219 | Ga0097621_102252735 | 3300006237 | Bacteria | 521 |
| 220 | Ga0075370_10201049 | 3300006353 | Bacteria | 1175 |
| 221 | Ga0075370_10371090 | 3300006353 | Bacteria | 856 |
| 222 | Ga0068871_100199476 | 3300006358 | Bacteria | 1727 |
| 223 | Ga0068871_100591327 | 3300006358 | Bacteria | 1008 |
| 224 | Ga0068871_100995393 | 3300006358 | Bacteria | 780 |
| 225 | Ga0068871_101916123 | 3300006358 | Bacteria | 563 |
| 226 | Ga0075428_100818139 | 3300006844 | Bacteria | 990 |
| 227 | Ga0075430_101069197 | 3300006846 | Bacteria | 665 |
| 228 | Ga0075433_10013684 | 3300006852 | Bacteria | 6606 |
| 229 | Ga0075433_10566706 | 3300006852 | Bacteria | 998 |
| 230 | Ga0075434_100034640 | 3300006871 | Bacteria | 4987 |
| 231 | Ga0075429_101656210 | 3300006880 | Bacteria | 556 |
| 232 | Ga0068865_100131258 | 3300006881 | Bacteria | 1877 |
| 233 | Ga0097620_100212218 | 3300006931 | Bacteria | 2022 |
| 234 | Ga0097620_100766282 | 3300006931 | Bacteria | 1053 |
| 235 | Ga0099825_1019614 | 3300006941 | Bacteria | 5000 |
| 236 | Ga0075435_100413813 | 3300007076 | Bacteria | 1161 |
| 237 | Ga0075435_101383387 | 3300007076 | Bacteria | 617 |
| 238 | Ga0105251_10637227 | 3300009011 | Bacteria | 509 |
| 239 | Ga0105250_10108560 | 3300009092 | Bacteria | 1135 |
| 240 | Ga0105250_10290180 | 3300009092 | Bacteria | 705 |
| 241 | Ga0105240_10004507 | 3300009093 | Bacteria | 21175 |
| 242 | Ga0105240_10545640 | 3300009093 | Bacteria | 1283 |
| 243 | Ga0111539_10180571 | 3300009094 | Bacteria | 2465 |
| 244 | Ga0111539_10305309 | 3300009094 | Bacteria | 1852 |
| 245 | Ga0111539_11715413 | 3300009094 | Bacteria | 728 |
| 246 | Ga0105245_10081822 | 3300009098 | Bacteria | 2953 |
| 247 | Ga0105245_10263703 | 3300009098 | Bacteria | 1677 |
| 248 | Ga0105245_11638310 | 3300009098 | Bacteria | 695 |
| 249 | Ga0105245_12061105 | 3300009098 | Bacteria | 624 |
| 250 | Ga0105245_12155643 | 3300009098 | Bacteria | 611 |
| 251 | Ga0105247_10251934 | 3300009101 | Bacteria | 1207 |
| 252 | Ga0105247_10442116 | 3300009101 | Bacteria | 935 |
| 253 | Ga0105247_10899207 | 3300009101 | Unclassified | 684 |
| 254 | Ga0114129_10336223 | 3300009147 | Bacteria | 2004 |
| 255 | Ga0105243_10023215 | 3300009148 | Bacteria | 4721 |
| 256 | Ga0105243_10229227 | 3300009148 | Bacteria | 1647 |
| 257 | Ga0105243_11888124 | 3300009148 | Bacteria | 630 |
| 258 | Ga0105243_12654867 | 3300009148 | Bacteria | 541 |
| 259 | Ga0105241_10025959 | 3300009174 | Bacteria | 4357 |
| 260 | Ga0105241_10207196 | 3300009174 | Bacteria | 1641 |
| 261 | Ga0105241_10218818 | 3300009174 | Bacteria | 1599 |
| 262 | Ga0105241_10400965 | 3300009174 | Bacteria | 1203 |
| 263 | Ga0105241_10624340 | 3300009174 | Bacteria | 976 |
| 264 | Ga0105241_10935976 | 3300009174 | Bacteria | 807 |
| 265 | Ga0105242_10282942 | 3300009176 | Bacteria | 1507 |
| 266 | Ga0105242_12384550 | 3300009176 | Bacteria | 576 |
| 267 | Ga0105248_10110058 | 3300009177 | Bacteria | 3106 |
| 268 | Ga0105248_10124986 | 3300009177 | Bacteria | 2902 |
| 269 | Ga0105248_12416744 | 3300009177 | Bacteria | 599 |
| 270 | Ga0105248_12431553 | 3300009177 | Bacteria | 597 |
| 271 | Ga0105237_10011480 | 3300009545 | Bacteria | 9372 |
| 272 | Ga0105237_10073042 | 3300009545 | Bacteria | 3423 |
| 273 | Ga0105237_10177502 | 3300009545 | Bacteria | 2130 |
| 274 | Ga0105238_10145174 | 3300009551 | Bacteria | 2349 |
| 275 | Ga0105238_10433183 | 3300009551 | Bacteria | 1311 |
| 276 | Ga0105238_10454349 | 3300009551 | Bacteria | 1278 |
| 277 | Ga0105238_10553048 | 3300009551 | Bacteria | 1155 |
| 278 | Ga0105238_12102871 | 3300009551 | Bacteria | 599 |
| 279 | Ga0105249_10194003 | 3300009553 | Bacteria | 1984 |
| 280 | Ga0105249_10283008 | 3300009553 | Bacteria | 1657 |
| 281 | Ga0105249_10811517 | 3300009553 | Bacteria | 1000 |
| 282 | Ga0105249_10921351 | 3300009553 | Bacteria | 941 |
| 283 | Ga0105249_12084693 | 3300009553 | Bacteria | 640 |
| 284 | Ga0105239_10065781 | 3300010375 | Bacteria | 3982 |
| 285 | Ga0105239_10131251 | 3300010375 | Bacteria | 2787 |
| 286 | Ga0105239_10184048 | 3300010375 | Bacteria | 2337 |
| 287 | Ga0105239_10550402 | 3300010375 | Bacteria | 1314 |
| 288 | Ga0105239_10595403 | 3300010375 | Bacteria | 1261 |
| 289 | Ga0105239_10653309 | 3300010375 | Bacteria | 1201 |
| 290 | Ga0105239_11068166 | 3300010375 | Bacteria | 929 |
| 291 | Ga0105239_11215918 | 3300010375 | Bacteria | 868 |
| 292 | Ga0105246_10100197 | 3300011119 | Bacteria | 2107 |
| 293 | Ga0105246_10836084 | 3300011119 | Bacteria | 820 |
| 294 | Ga0105246_11356407 | 3300011119 | Bacteria | 661 |
| 295 | Ga0105246_12245218 | 3300011119 | Bacteria | 532 |
| 296 | Ga0157314_1019146 | 3300012500 | Bacteria | 682 |
| 297 | Ga0157371_11530784 | 3300013102 | Bacteria | 521 |
| 298 | Ga0157370_11611522 | 3300013104 | Bacteria | 583 |
| 299 | Ga0157369_10084765 | 3300013105 | Bacteria | 3386 |
| 300 | Ga0157369_10912182 | 3300013105 | Bacteria | 901 |
| 301 | Ga0157374_11143790 | 3300013296 | Bacteria | 799 |
| 302 | Ga0157374_11292578 | 3300013296 | Bacteria | 751 |
| 303 | Ga0157374_11528414 | 3300013296 | Bacteria | 691 |
| 304 | Ga0157374_11717939 | 3300013296 | Bacteria | 652 |
| 305 | Ga0157378_10033626 | 3300013297 | Bacteria | 4534 |
| 306 | Ga0157378_10412529 | 3300013297 | Bacteria | 1333 |
| 307 | Ga0163162_10134241 | 3300013306 | Bacteria | 2585 |
| 308 | Ga0163162_10308160 | 3300013306 | Bacteria | 1716 |
| 309 | Ga0163162_10450553 | 3300013306 | Bacteria | 1419 |
| 310 | Ga0163162_11906468 | 3300013306 | Bacteria | 680 |
| 311 | Ga0157372_10267332 | 3300013307 | Bacteria | 1986 |
| 312 | Ga0157372_10623061 | 3300013307 | Bacteria | 1257 |
| 313 | Ga0157375_10354662 | 3300013308 | Bacteria | 1633 |
| 314 | Ga0157375_10526432 | 3300013308 | Bacteria | 1345 |
| 315 | Ga0157375_11794801 | 3300013308 | Bacteria | 727 |
| 316 | Ga0163163_10087935 | 3300014325 | Bacteria | 3118 |
| 317 | Ga0163163_10590413 | 3300014325 | Bacteria | 1174 |
| 318 | Ga0163163_11097196 | 3300014325 | Bacteria | 859 |
| 319 | Ga0157380_10141244 | 3300014326 | Bacteria | 2069 |
| 320 | Ga0157380_10476978 | 3300014326 | Bacteria | 1205 |
| 321 | Ga0157380_10628878 | 3300014326 | Bacteria | 1067 |
| 322 | Ga0157380_10678003 | 3300014326 | Bacteria | 1032 |
| 323 | Ga0157377_10081157 | 3300014745 | Bacteria | 1896 |
| 324 | Ga0157377_10858488 | 3300014745 | Bacteria | 675 |
| 325 | Ga0157379_10508380 | 3300014968 | Bacteria | 1117 |
| 326 | Ga0157379_10605933 | 3300014968 | Bacteria | 1023 |
| 327 | Ga0157379_10730083 | 3300014968 | Bacteria | 931 |
| 328 | Ga0157379_11173454 | 3300014968 | Bacteria | 738 |
| 329 | Ga0157376_10211162 | 3300014969 | Bacteria | 1792 |
| 330 | Ga0157376_10292146 | 3300014969 | Bacteria | 1539 |
| 331 | Ga0157376_10471476 | 3300014969 | Bacteria | 1228 |
| 332 | Ga0157376_11116764 | 3300014969 | Bacteria | 814 |
| 333 | Ga0182007_10035964 | 3300015262 | Bacteria | 1668 |
| 334 | Ga0163161_10023451 | 3300017792 | Bacteria | 4353 |
| 335 | Ga0163161_10735540 | 3300017792 | Bacteria | 824 |
| 336 | Ga0163161_10929358 | 3300017792 | Bacteria | 739 |
| 337 | Ga0163161_11614981 | 3300017792 | Bacteria | 572 |
| 338 | Ga0206356_11821617 | 3300020070 | Bacteria | 885 |
| 339 | Ga0206353_11062936 | 3300020082 | Bacteria | 1232 |
| 340 | Ga0214544_1000013 | 3300021320 | Bacteria | 228947 |
| 341 | Ga0214542_1000013 | 3300021321 | Bacteria | 234019 |
| 342 | Ga0214545_1000012 | 3300021324 | Bacteria | 187898 |
| 343 | Ga0214543_1000065 | 3300021327 | Bacteria | 126516 |
| 344 | Ga0213876_10021294 | 3300021384 | Bacteria | 3429 |
| 345 | Ga0209563_115804 | 3300025230 | Bacteria | 940 |
| 346 | Ga0209026_1060825 | 3300025250 | Bacteria | 531 |
| 347 | Ga0209677_110702 | 3300025253 | Bacteria | 1499 |
| 348 | Ga0209148_1000319 | 3300025254 | Bacteria | 67129 |
| 349 | Ga0209148_1024638 | 3300025254 | Bacteria | 948 |
| 350 | Ga0209233_1004008 | 3300025261 | Bacteria | 5102 |
| 351 | Ga0209233_1068717 | 3300025261 | Bacteria | 662 |
| 352 | Ga0209455_1003084 | 3300025272 | Bacteria | 6083 |
| 353 | Ga0209455_1020243 | 3300025272 | Bacteria | 1321 |
| 354 | Ga0209673_1038344 | 3300025273 | Bacteria | 1396 |
| 355 | Ga0209564_1004362 | 3300025295 | Bacteria | 8702 |
| 356 | Ga0209758_1001334 | 3300025297 | Bacteria | 29905 |
| 357 | Ga0209758_1001430 | 3300025297 | Bacteria | 28210 |
| 358 | Ga0209758_1010151 | 3300025297 | Bacteria | 5694 |
| 359 | Ga0209758_1060114 | 3300025297 | Bacteria | 1260 |
| 360 | Ga0209256_1016536 | 3300025299 | Bacteria | 2506 |
| 361 | Ga0207426_1019126 | 3300025302 | Bacteria | 2400 |
| 362 | Ga0207426_1040571 | 3300025302 | Bacteria | 1449 |
| 363 | Ga0207697_10042628 | 3300025315 | Bacteria | 1865 |
| 364 | Ga0207697_10088841 | 3300025315 | Bacteria | 1308 |
| 365 | Ga0207697_10344185 | 3300025315 | Bacteria | 662 |
| 366 | Ga0207656_10032151 | 3300025321 | Bacteria | 2178 |
| 367 | Ga0207696_1036713 | 3300025711 | Bacteria | 1454 |
| 368 | Ga0207682_10283300 | 3300025893 | Bacteria | 775 |
| 369 | Ga0207710_10091825 | 3300025900 | Bacteria | 1422 |
| 370 | Ga0207710_10238009 | 3300025900 | Bacteria | 908 |
| 371 | Ga0207710_10245697 | 3300025900 | Bacteria | 894 |
| 372 | Ga0207688_10014273 | 3300025901 | Bacteria | 4322 |
| 373 | Ga0207688_10020081 | 3300025901 | Bacteria | 3645 |
| 374 | Ga0207680_10120789 | 3300025903 | Bacteria | 1713 |
| 375 | Ga0207680_10206093 | 3300025903 | Bacteria | 1342 |
| 376 | Ga0207680_10590501 | 3300025903 | Bacteria | 794 |
| 377 | Ga0207647_10001937 | 3300025904 | Bacteria | 15820 |
| 378 | Ga0207647_10070938 | 3300025904 | Bacteria | 2103 |
| 379 | Ga0207685_10186238 | 3300025905 | Bacteria | 966 |
| 380 | Ga0207645_10106103 | 3300025907 | Bacteria | 1816 |
| 381 | Ga0207645_10227334 | 3300025907 | Bacteria | 1231 |
| 382 | Ga0207643_10040804 | 3300025908 | Bacteria | 2614 |
| 383 | Ga0207643_10336806 | 3300025908 | Bacteria | 945 |
| 384 | Ga0207643_11035280 | 3300025908 | Bacteria | 530 |
| 385 | Ga0207705_10088803 | 3300025909 | Bacteria | 2261 |
| 386 | Ga0207705_10796273 | 3300025909 | Bacteria | 734 |
| 387 | Ga0207654_10011983 | 3300025911 | Bacteria | 4435 |
| 388 | Ga0207654_10036092 | 3300025911 | Bacteria | 2760 |
| 389 | Ga0207654_10410139 | 3300025911 | Bacteria | 944 |
| 390 | Ga0207654_10897793 | 3300025911 | Bacteria | 642 |
| 391 | Ga0207707_10000478 | 3300025912 | Bacteria | 41482 |
| 392 | Ga0207707_10057426 | 3300025912 | Bacteria | 3387 |
| 393 | Ga0207695_10000240 | 3300025913 | Bacteria | 143196 |
| 394 | Ga0207695_10322570 | 3300025913 | Bacteria | 1434 |
| 395 | Ga0207671_10002558 | 3300025914 | Bacteria | 19311 |
| 396 | Ga0207671_10052054 | 3300025914 | Bacteria | 3034 |
| 397 | Ga0207671_10115950 | 3300025914 | Bacteria | 2043 |
| 398 | Ga0207671_10155073 | 3300025914 | Bacteria | 1771 |
| 399 | Ga0207671_10989369 | 3300025914 | Bacteria | 663 |
| 400 | Ga0207663_10896480 | 3300025916 | Bacteria | 709 |
| 401 | Ga0207660_10020143 | 3300025917 | Bacteria | 4473 |
| 402 | Ga0207660_10027527 | 3300025917 | Bacteria | 3880 |
| 403 | Ga0207662_10062100 | 3300025918 | Bacteria | 2244 |
| 404 | Ga0207662_10743184 | 3300025918 | Bacteria | 689 |
| 405 | Ga0207657_10110081 | 3300025919 | Bacteria | 2275 |
| 406 | Ga0207657_10207786 | 3300025919 | Bacteria | 1572 |
| 407 | Ga0207657_10638567 | 3300025919 | Bacteria | 829 |
| 408 | Ga0207657_11254369 | 3300025919 | Bacteria | 561 |
| 409 | Ga0207649_11226632 | 3300025920 | Bacteria | 593 |
| 410 | Ga0207652_10308075 | 3300025921 | Bacteria | 1429 |
| 411 | Ga0207681_10229584 | 3300025923 | Bacteria | 1440 |
| 412 | Ga0207681_10573408 | 3300025923 | Bacteria | 930 |
| 413 | Ga0207694_10710797 | 3300025924 | Bacteria | 847 |
| 414 | Ga0207694_10715636 | 3300025924 | Bacteria | 844 |
| 415 | Ga0207650_10028309 | 3300025925 | Bacteria | 4017 |
| 416 | Ga0207650_10123908 | 3300025925 | Bacteria | 2015 |
| 417 | Ga0207659_10514272 | 3300025926 | Bacteria | 1015 |
| 418 | Ga0207659_10774291 | 3300025926 | Bacteria | 824 |
| 419 | Ga0207687_10011179 | 3300025927 | Bacteria | 5863 |
| 420 | Ga0207687_10028107 | 3300025927 | Bacteria | 3778 |
| 421 | Ga0207687_10041102 | 3300025927 | Bacteria | 3173 |
| 422 | Ga0207644_10020411 | 3300025931 | Bacteria | 4505 |
| 423 | Ga0207644_10213911 | 3300025931 | Bacteria | 1525 |
| 424 | Ga0207644_10259509 | 3300025931 | Bacteria | 1389 |
| 425 | Ga0207644_10523805 | 3300025931 | Bacteria | 979 |
| 426 | Ga0207690_10222175 | 3300025932 | Bacteria | 1446 |
| 427 | Ga0207690_10691854 | 3300025932 | Bacteria | 838 |
| 428 | Ga0207690_11249689 | 3300025932 | Bacteria | 620 |
| 429 | Ga0207706_10104072 | 3300025933 | Bacteria | 2497 |
| 430 | Ga0207686_10204210 | 3300025934 | Bacteria | 1417 |
| 431 | Ga0207709_10013704 | 3300025935 | Bacteria | 4473 |
| 432 | Ga0207709_10527947 | 3300025935 | Bacteria | 925 |
| 433 | Ga0207709_10535462 | 3300025935 | Bacteria | 919 |
| 434 | Ga0207670_10836763 | 3300025936 | Bacteria | 768 |
| 435 | Ga0207670_11163308 | 3300025936 | Bacteria | 652 |
| 436 | Ga0207670_11843814 | 3300025936 | Bacteria | 514 |
| 437 | Ga0207704_11093415 | 3300025938 | Bacteria | 677 |
| 438 | Ga0207691_10009643 | 3300025940 | Bacteria | 9262 |
| 439 | Ga0207691_10655611 | 3300025940 | Bacteria | 887 |
| 440 | Ga0207691_10784162 | 3300025940 | Bacteria | 801 |
| 441 | Ga0207711_10064934 | 3300025941 | Bacteria | 3154 |
| 442 | Ga0207711_11200408 | 3300025941 | Bacteria | 700 |
| 443 | Ga0207689_10040232 | 3300025942 | Bacteria | 3869 |
| 444 | Ga0207689_10063086 | 3300025942 | Bacteria | 3048 |
| 445 | Ga0207689_10304415 | 3300025942 | Bacteria | 1321 |
| 446 | Ga0207661_10009026 | 3300025944 | Bacteria | 7143 |
| 447 | Ga0207679_11027688 | 3300025945 | Bacteria | 756 |
| 448 | Ga0207667_10022463 | 3300025949 | Bacteria | 6968 |
| 449 | Ga0207667_10382338 | 3300025949 | Bacteria | 1434 |
| 450 | Ga0207667_11266069 | 3300025949 | Bacteria | 715 |
| 451 | Ga0207651_10135535 | 3300025960 | Bacteria | 1893 |
| 452 | Ga0207651_10669418 | 3300025960 | Bacteria | 912 |
| 453 | Ga0207651_11585282 | 3300025960 | Bacteria | 590 |
| 454 | Ga0207712_10147159 | 3300025961 | Bacteria | 1815 |
| 455 | Ga0207712_10321395 | 3300025961 | Bacteria | 1277 |
| 456 | Ga0207712_11119652 | 3300025961 | Bacteria | 701 |
| 457 | Ga0207668_10034775 | 3300025972 | Bacteria | 3349 |
| 458 | Ga0207668_10052349 | 3300025972 | Bacteria | 2824 |
| 459 | Ga0207668_10340680 | 3300025972 | Bacteria | 1250 |
| 460 | Ga0207668_10395125 | 3300025972 | Bacteria | 1167 |
| 461 | Ga0207668_10904641 | 3300025972 | Bacteria | 785 |
| 462 | Ga0207668_11153740 | 3300025972 | Bacteria | 695 |
| 463 | Ga0207668_11838032 | 3300025972 | Bacteria | 546 |
| 464 | Ga0207640_10563802 | 3300025981 | Bacteria | 959 |
| 465 | Ga0207640_11506351 | 3300025981 | Bacteria | 604 |
| 466 | Ga0207658_10201951 | 3300025986 | Bacteria | 1660 |
| 467 | Ga0207658_10658323 | 3300025986 | Bacteria | 944 |
| 468 | Ga0207658_11801995 | 3300025986 | Bacteria | 558 |
| 469 | Ga0207677_10053550 | 3300026023 | Bacteria | 2747 |
| 470 | Ga0207677_10229190 | 3300026023 | Bacteria | 1495 |
| 471 | Ga0207677_11801406 | 3300026023 | Bacteria | 568 |
| 472 | Ga0207677_12139832 | 3300026023 | Bacteria | 520 |
| 473 | Ga0207703_10126988 | 3300026035 | Bacteria | 2197 |
| 474 | Ga0207703_10511544 | 3300026035 | Bacteria | 1128 |
| 475 | Ga0207703_11461328 | 3300026035 | Bacteria | 658 |
| 476 | Ga0207703_12032092 | 3300026035 | Bacteria | 551 |
| 477 | Ga0207639_10344819 | 3300026041 | Bacteria | 1329 |
| 478 | Ga0207639_10468293 | 3300026041 | Bacteria | 1147 |
| 479 | Ga0207639_10502570 | 3300026041 | Bacteria | 1108 |
| 480 | Ga0207639_11203013 | 3300026041 | Bacteria | 711 |
| 481 | Ga0207678_10012818 | 3300026067 | Bacteria | 7360 |
| 482 | Ga0207678_10471447 | 3300026067 | Bacteria | 1093 |
| 483 | Ga0207678_10580622 | 3300026067 | Bacteria | 982 |
| 484 | Ga0207678_10645133 | 3300026067 | Bacteria | 930 |
| 485 | Ga0207678_10681004 | 3300026067 | Bacteria | 904 |
| 486 | Ga0207678_11066325 | 3300026067 | Bacteria | 715 |
| 487 | Ga0207708_10022932 | 3300026075 | Bacteria | 4715 |
| 488 | Ga0207708_10252280 | 3300026075 | Bacteria | 1422 |
| 489 | Ga0207702_10456464 | 3300026078 | Bacteria | 1240 |
| 490 | Ga0207702_10530225 | 3300026078 | Bacteria | 1150 |
| 491 | Ga0207641_10310055 | 3300026088 | Bacteria | 1493 |
| 492 | Ga0207641_10314699 | 3300026088 | Bacteria | 1483 |
| 493 | Ga0207641_10795253 | 3300026088 | Bacteria | 935 |
| 494 | Ga0207641_10917072 | 3300026088 | Bacteria | 870 |
| 495 | Ga0207641_11245702 | 3300026088 | Bacteria | 744 |
| 496 | Ga0207641_12111748 | 3300026088 | Bacteria | 564 |
| 497 | Ga0207648_10072960 | 3300026089 | Bacteria | 2992 |
| 498 | Ga0207648_10118811 | 3300026089 | Bacteria | 2324 |
| 499 | Ga0207676_10025018 | 3300026095 | Bacteria | 4426 |
| 500 | Ga0207676_10272374 | 3300026095 | Bacteria | 1534 |
| 501 | Ga0207674_10083021 | 3300026116 | Bacteria | 3204 |
| 502 | Ga0207674_10181900 | 3300026116 | Bacteria | 2054 |
| 503 | Ga0207675_100154218 | 3300026118 | Bacteria | 2188 |
| 504 | Ga0207675_100175572 | 3300026118 | Bacteria | 2050 |
| 505 | Ga0207675_100193299 | 3300026118 | Bacteria | 1952 |
| 506 | Ga0207675_100194966 | 3300026118 | Bacteria | 1944 |
| 507 | Ga0207675_100261644 | 3300026118 | Bacteria | 1677 |
| 508 | Ga0207675_101072413 | 3300026118 | Bacteria | 825 |
| 509 | Ga0207683_10059172 | 3300026121 | Bacteria | 3366 |
| 510 | Ga0207683_10125988 | 3300026121 | Bacteria | 2302 |
| 511 | Ga0207683_10263047 | 3300026121 | Bacteria | 1575 |
| 512 | Ga0207683_10648522 | 3300026121 | Bacteria | 978 |
| 513 | Ga0207683_10740354 | 3300026121 | Bacteria | 912 |
| 514 | Ga0207698_10180256 | 3300026142 | Bacteria | 1870 |
| 515 | Ga0207698_10616640 | 3300026142 | Bacteria | 1071 |
| 516 | Ga0207698_11542925 | 3300026142 | Bacteria | 679 |
| 517 | Ga0207698_11597216 | 3300026142 | Bacteria | 668 |
| 518 | Ga0209389_1000188 | 3300027296 | Bacteria | 46884 |
| 519 | Ga0209489_110855 | 3300027361 | Bacteria | 9831 |
| 520 | Ga0209700_100437 | 3300027363 | Bacteria | 76868 |
| 521 | Ga0209813_10002512 | 3300027866 | Bacteria | 4201 |
| 522 | Ga0209813_10097645 | 3300027866 | Bacteria | 995 |
| 523 | Ga0209813_10460358 | 3300027866 | Bacteria | 522 |
| 524 | Ga0207428_10024068 | 3300027907 | Bacteria | 5113 |
| 525 | Ga0268266_10000466 | 3300028379 | Bacteria | 58721 |
| 526 | Ga0268266_10012380 | 3300028379 | Bacteria | 7373 |
| 527 | Ga0268266_10027532 | 3300028379 | Bacteria | 4832 |
| 528 | Ga0268266_10586296 | 3300028379 | Bacteria | 1070 |
| 529 | Ga0268266_11183041 | 3300028379 | Bacteria | 739 |
| 530 | Ga0268265_10031314 | 3300028380 | Bacteria | 3840 |
| 531 | Ga0268265_10044494 | 3300028380 | Bacteria | 3306 |
| 532 | Ga0268265_10246585 | 3300028380 | Bacteria | 1579 |
| 533 | Ga0268265_10659584 | 3300028380 | Bacteria | 1006 |
| 534 | Ga0268265_12055668 | 3300028380 | Bacteria | 578 |
| 535 | Ga0268264_10000073 | 3300028381 | Bacteria | 260615 |
| 536 | Ga0268264_10175182 | 3300028381 | Bacteria | 1943 |
| 537 | Ga0268264_10402731 | 3300028381 | Bacteria | 1315 |
| 538 | Ga0268264_10532285 | 3300028381 | Bacteria | 1150 |
| 539 | Ga0268264_10563134 | 3300028381 | Bacteria | 1119 |
| 540 | Ga0268264_10731562 | 3300028381 | Bacteria | 985 |
| 541 | Ga0307517_10494170 | 3300028786 | Bacteria | 624 |
| 542 | Ga0307511_10171616 | 3300030521 | Bacteria | 1190 |
| 543 | Ga0265316_10148218 | 3300031344 | Bacteria | 1759 |
| 544 | Ga0307513_10430971 | 3300031456 | Bacteria | 1047 |
| 545 | Ga0307509_10036522 | 3300031507 | Bacteria | 5378 |
| 546 | Ga0307509_10089522 | 3300031507 | Bacteria | 3156 |
| 547 | Ga0307509_10146091 | 3300031507 | Bacteria | 2290 |
| 548 | Ga0307509_10189770 | 3300031507 | Bacteria | 1907 |
| 549 | Ga0307509_10223145 | 3300031507 | Bacteria | 1695 |
| 550 | Ga0307408_100185954 | 3300031548 | Bacteria | 1670 |
| 551 | Ga0307508_10885365 | 3300031616 | Bacteria | 517 |
| 552 | Ga0265314_10177011 | 3300031711 | Bacteria | 1282 |
| 553 | Ga0307516_10556250 | 3300031730 | Bacteria | 801 |
| 554 | Ga0307516_10698180 | 3300031730 | Bacteria | 671 |
| 555 | Ga0307516_10774113 | 3300031730 | Bacteria | 620 |
| 556 | Ga0307518_10346217 | 3300031838 | Bacteria | 869 |
| 557 | Ga0307407_10336850 | 3300031903 | Bacteria | 1064 |
| 558 | Ga0307412_12286827 | 3300031911 | Bacteria | 504 |
| 559 | Ga0307416_100541436 | 3300032002 | Bacteria | 1236 |
| 560 | Ga0307415_100187236 | 3300032126 | Bacteria | 1630 |
| 561 | Ga0307507_10144079 | 3300033179 | Bacteria | 1816 |
| 562 | Ga0307510_10036477 | 3300033180 | Bacteria | 5470 |
| 563 | Ga0307510_10129996 | 3300033180 | Bacteria | 2195 |
| 564 | Ga0373958_0001988 | 3300034819 | Bacteria | 2815 |
| 565 | Ga0373928_0036118 | 3300035084 | Bacteria | 1116 |
| 566 | Ga0373929_0029014 | 3300035085 | Bacteria | 1172 |
| 567 | Ga0373949_0121630 | 3300035090 | Bacteria | 733 |
| 568 | Ga0373951_0047234 | 3300035091 | Bacteria | 1052 |
| 569 | Ga0373952_0090821 | 3300035092 | Bacteria | 793 |
| 570 | Ga0373923_0129565 | 3300035111 | Bacteria | 1133 |
| 571 | Ga0373932_0076071 | 3300035112 | Bacteria | 1051 |
| 572 | Ga0373939_0234899 | 3300035114 | Bacteria | 707 |
| 573 | Ga0373939_0418046 | 3300035114 | Bacteria | 559 |
| 574 | Ga0373941_0144968 | 3300035115 | Bacteria | 866 |
| 575 | Ga0373954_0360536 | 3300035118 | Bacteria | 718 |
| 576 | Ga0373957_0299243 | 3300035120 | Bacteria | 682 |
| 577 | Ga0373960_0019472 | 3300035121 | Bacteria | 1783 |
| 578 | Ga0373960_0341758 | 3300035121 | Bacteria | 566 |
| 579 | Ga0373962_0076424 | 3300035242 | Bacteria | 1009 |
| 580 | Ga0373931_0217236 | 3300035691 | Bacteria | 1149 |
| 581 | Ga0373935_0026726 | 3300035692 | Bacteria | 3565 |
| 582 | Ga0373927_0241510 | 3300035695 | Bacteria | 1187 |
| 583 | Ga0373927_0275021 | 3300035695 | Bacteria | 1107 |
| 584 | Ga0373933_0089850 | 3300035724 | Bacteria | 1894 |
| 585 | Ga0373937_0306843 | 3300036401 | Bacteria | 1501 |
| 586 | Ga0373925_0013597 | 3300037068 | Bacteria | 5893 |
| 587 | Ga0373925_0647629 | 3300037068 | Bacteria | 871 |
| 588 | Ga0395900_0000394 | 3300037418 | Bacteria | 63170 |
| 589 | Ga0395898_0011041 | 3300037466 | Bacteria | 9410 |
| 590 | Ga0395905_0362238 | 3300037471 | Bacteria | 1343 |
| 591 | Ga0395905_0623811 | 3300037471 | Bacteria | 980 |
| 592 | Ga0395905_1264088 | 3300037471 | Bacteria | 642 |
| 593 | Ga0436364_0163528 | 3300037853 | Bacteria | 1055 |
| 594 | Ga0395901_0125444 | 3300038443 | Bacteria | 2698 |
| 595 | Ga0436365_0394164 | 3300039437 | Bacteria | 13789 |
| 596 | Ga0436365_1900573 | 3300039437 | Bacteria | 1113 |
| 597 | Ga0436363_0822942 | 3300039450 | Bacteria | 703 |
| 598 | Ga0436362_0044086 | 3300039453 | Bacteria | 1547 |
| 599 | Ga0451789_0546568 | 3300041443 | Bacteria | 652 |
| 600 | Ga0451793_1203669 | 3300041452 | Bacteria | 1038 |
| 601 | Ga0451793_1654678 | 3300041452 | Bacteria | 609 |
| 602 | Ga0451795_0738676 | 3300041456 | Bacteria | 1279 |
| 603 | Ga0451835_0046854 | 3300041492 | Bacteria | 570 |
| 604 | Ga0451839_0396340 | 3300041496 | Bacteria | 590 |
| 605 | Ga0451839_0706751 | 3300041496 | Bacteria | 813 |
| 606 | Ga0451843_1565422 | 3300041509 | Bacteria | 790 |
| 607 | Ga0451853_0703402 | 3300041512 | Bacteria | 2049 |
| 608 | Ga0466969_0158289 | 3300044656 | Bacteria | 1041 |
| 609 | Ga0466972_0000576 | 3300044658 | Bacteria | 17815 |
| 610 | Ga0466972_0000829 | 3300044658 | Bacteria | 14802 |
| 611 | Ga0466972_0051840 | 3300044658 | Bacteria | 1979 |
| 612 | Ga0466972_0465207 | 3300044658 | Bacteria | 594 |
| 613 | Ga0466965_0047681 | 3300044683 | Bacteria | 2121 |
| 614 | Ga0466965_0432140 | 3300044683 | Bacteria | 731 |
| 615 | Ga0466966_0001892 | 3300044684 | Bacteria | 13590 |
| 616 | Ga0466961_0000016 | 3300044693 | Bacteria | 111421 |
| 617 | Ga0466963_0060568 | 3300044694 | Bacteria | 2528 |
| 618 | Ga0466964_0116894 | 3300044706 | Bacteria | 1197 |
| 619 | Ga0466964_0463375 | 3300044706 | Bacteria | 674 |
| 620 | Ga0466968_0002646 | 3300044735 | Bacteria | 6592 |
| 621 | Ga0466968_0055352 | 3300044735 | Bacteria | 1702 |
| 622 | Ga0466957_0070058 | 3300044842 | Bacteria | 2167 |
| 623 | Ga0466960_0002702 | 3300044901 | Bacteria | 6704 |
| 624 | Ga0466960_0385823 | 3300044901 | Bacteria | 805 |
| 625 | Ga0466960_0628537 | 3300044901 | Bacteria | 639 |
| 626 | Ga0466959_0014272 | 3300045049 | Bacteria | 5766 |
| 627 | Ga0466959_0984979 | 3300045049 | Bacteria | 562 |
| 628 | Ga0466967_0111185 | 3300045976 | Bacteria | 2517 |
| 629 | Ga0495617_005506 | 3300046452 | Bacteria | 4483 |
| 630 | Ga0495617_050771 | 3300046452 | Bacteria | 1380 |
| 631 | Ga0495617_112171 | 3300046452 | Bacteria | 882 |
| 632 | Ga0495592_0017226 | 3300046454 | Bacteria | 5488 |
| 633 | Ga0495592_0486425 | 3300046454 | Bacteria | 768 |
| 634 | Ga0495603_0009571 | 3300046455 | Bacteria | 5857 |
| 635 | Ga0495603_0247025 | 3300046455 | Bacteria | 1027 |
| 636 | Ga0495590_0087600 | 3300046457 | Bacteria | 1100 |
| 637 | Ga0495590_0161955 | 3300046457 | Bacteria | 814 |
| 638 | Ga0495590_0234684 | 3300046457 | Bacteria | 680 |
| 639 | Ga0495590_0342438 | 3300046457 | Bacteria | 567 |
| 640 | Ga0495591_118921 | 3300046458 | Bacteria | 646 |
| 641 | Ga0495629_0123577 | 3300046459 | Bacteria | 1803 |
| 642 | Ga0495629_0160170 | 3300046459 | Bacteria | 1563 |
| 643 | Ga0495629_0713273 | 3300046459 | Bacteria | 665 |
| 644 | Ga0495638_0056812 | 3300046460 | Bacteria | 2428 |
| 645 | Ga0495638_0057598 | 3300046460 | Bacteria | 2409 |
| 646 | Ga0495641_0105202 | 3300046461 | Bacteria | 1259 |
| 647 | Ga0495651_0003955 | 3300046462 | Bacteria | 11338 |
| 648 | Ga0495651_0004024 | 3300046462 | Bacteria | 11236 |
| 649 | Ga0495650_0100173 | 3300046471 | Bacteria | 1089 |
| 650 | Ga0495605_0062663 | 3300046474 | Bacteria | 1776 |
| 651 | Ga0495605_0249715 | 3300046474 | Bacteria | 759 |
| 652 | Ga0495639_0021929 | 3300046475 | Bacteria | 2799 |
| 653 | Ga0495664_0108404 | 3300046477 | Bacteria | 1675 |
| 654 | Ga0495584_0133303 | 3300046491 | Bacteria | 1261 |
| 655 | Ga0495584_0189537 | 3300046491 | Bacteria | 1045 |
| 656 | Ga0495584_0534936 | 3300046491 | Bacteria | 597 |
| 657 | Ga0495585_0276589 | 3300046492 | Bacteria | 831 |
| 658 | Ga0495585_0376873 | 3300046492 | Bacteria | 686 |
| 659 | Ga0495585_0485432 | 3300046492 | Bacteria | 588 |
| 660 | Ga0495594_0019047 | 3300046499 | Bacteria | 3644 |
| 661 | Ga0495596_0216225 | 3300046500 | Bacteria | 744 |
| 662 | Ga0495596_0303239 | 3300046500 | Bacteria | 621 |
| 663 | Ga0495607_0342425 | 3300046501 | Bacteria | 692 |
| 664 | Ga0495606_0082372 | 3300046507 | Bacteria | 1997 |
| 665 | Ga0495606_0411648 | 3300046507 | Bacteria | 701 |
| 666 | Ga0495606_0444541 | 3300046507 | Bacteria | 665 |
| 667 | Ga0495608_0088051 | 3300046511 | Bacteria | 2010 |
| 668 | Ga0495608_0099737 | 3300046511 | Bacteria | 1873 |
| 669 | Ga0495610_0032441 | 3300046512 | Bacteria | 2712 |
| 670 | Ga0495616_0024995 | 3300046513 | Bacteria | 3196 |
| 671 | Ga0495616_0185804 | 3300046513 | Bacteria | 921 |
| 672 | Ga0495618_0491840 | 3300046514 | Bacteria | 740 |
| 673 | Ga0495618_0866145 | 3300046514 | Bacteria | 523 |
| 674 | Ga0495620_0045961 | 3300046515 | Bacteria | 1888 |
| 675 | Ga0495620_0075873 | 3300046515 | Bacteria | 1367 |
| 676 | Ga0495628_0030495 | 3300046516 | Bacteria | 4366 |
| 677 | Ga0495630_0101141 | 3300046517 | Bacteria | 2181 |
| 678 | Ga0495631_0150038 | 3300046518 | Bacteria | 1000 |
| 679 | Ga0495631_0164998 | 3300046518 | Bacteria | 950 |
| 680 | Ga0495631_0481188 | 3300046518 | Bacteria | 529 |
| 681 | Ga0495632_0249599 | 3300046519 | Bacteria | 796 |
| 682 | Ga0495643_0073363 | 3300046522 | Bacteria | 1793 |
| 683 | Ga0495643_0256449 | 3300046522 | Bacteria | 814 |
| 684 | Ga0495643_0343234 | 3300046522 | Bacteria | 670 |
| 685 | Ga0495644_0265228 | 3300046523 | Bacteria | 668 |
| 686 | Ga0495648_0112696 | 3300046524 | Bacteria | 1477 |
| 687 | Ga0495648_0263521 | 3300046524 | Bacteria | 825 |
| 688 | Ga0495648_0278276 | 3300046524 | Bacteria | 794 |
| 689 | Ga0495663_0107021 | 3300046525 | Bacteria | 926 |
| 690 | Ga0495666_0203094 | 3300046526 | Bacteria | 911 |
| 691 | Ga0495652_0026602 | 3300046529 | Bacteria | 5108 |
| 692 | Ga0495652_0386975 | 3300046529 | Bacteria | 993 |
| 693 | Ga0495665_0371894 | 3300046531 | Bacteria | 727 |
| 694 | Ga0495640_0006053 | 3300046533 | Bacteria | 9594 |
| 695 | Ga0495587_0007178 | 3300046536 | Bacteria | 7232 |
| 696 | Ga0495587_0637738 | 3300046536 | Bacteria | 586 |
| 697 | Ga0495598_0043774 | 3300046537 | Bacteria | 1320 |
| 698 | Ga0495609_0017043 | 3300046538 | Bacteria | 3379 |
| 699 | Ga0495609_0105173 | 3300046538 | Bacteria | 1221 |
| 700 | Ga0495609_0212452 | 3300046538 | Bacteria | 806 |
| 701 | Ga0495621_0296646 | 3300046539 | Bacteria | 669 |
| 702 | Ga0495645_0007485 | 3300046543 | Bacteria | 7601 |
| 703 | Ga0495622_0016496 | 3300046557 | Bacteria | 3440 |
| 704 | Ga0495622_0042578 | 3300046557 | Bacteria | 2111 |
| 705 | Ga0495622_0070962 | 3300046557 | Bacteria | 1607 |
| 706 | Ga0495667_0003371 | 3300046559 | Bacteria | 10691 |
| 707 | Ga0495656_0016609 | 3300046615 | Bacteria | 2795 |
| 708 | Ga0495656_0036339 | 3300046615 | Bacteria | 2028 |
| 709 | Ga0495656_0143295 | 3300046615 | Bacteria | 1148 |
| 710 | Ga0495656_0159526 | 3300046615 | Bacteria | 1095 |
| 711 | Ga0495656_0296052 | 3300046615 | Bacteria | 828 |
| 712 | Ga0495656_0764037 | 3300046615 | Bacteria | 521 |
| 713 | Ga0495668_0027417 | 3300046616 | Bacteria | 3227 |
| 714 | Ga0495668_0054002 | 3300046616 | Bacteria | 2221 |
| 715 | Ga0495668_0283635 | 3300046616 | Bacteria | 907 |
| 716 | Ga0495634_0020124 | 3300046642 | Bacteria | 4734 |
| 717 | Ga0495634_0027702 | 3300046642 | Bacteria | 3941 |
| 718 | Ga0495611_0245574 | 3300046648 | Bacteria | 830 |
| 719 | Ga0495611_0332229 | 3300046648 | Bacteria | 699 |
| 720 | Ga0495625_0068192 | 3300046660 | Bacteria | 2501 |
| 721 | Ga0495625_0182994 | 3300046660 | Bacteria | 1392 |
| 722 | Ga0495625_0298530 | 3300046660 | Bacteria | 1031 |
| 723 | Ga0495625_0309833 | 3300046660 | Bacteria | 1008 |
| 724 | Ga0495625_0358165 | 3300046660 | Bacteria | 920 |
| 725 | Ga0495625_0695993 | 3300046660 | Bacteria | 601 |
| 726 | Ga0495635_0000802 | 3300046663 | Bacteria | 20534 |
| 727 | Ga0495659_0021517 | 3300046664 | Bacteria | 2174 |
| 728 | Ga0495659_0059789 | 3300046664 | Bacteria | 1405 |
| 729 | Ga0495659_0150488 | 3300046664 | Bacteria | 934 |
| 730 | Ga0495659_0512110 | 3300046664 | Bacteria | 527 |
| 731 | Ga0495661_0066273 | 3300046665 | Bacteria | 2126 |
| 732 | Ga0495661_0069841 | 3300046665 | Bacteria | 2057 |
| 733 | Ga0495588_0013908 | 3300046674 | Bacteria | 3842 |
| 734 | Ga0495588_0035826 | 3300046674 | Bacteria | 2516 |
| 735 | Ga0495588_0615626 | 3300046674 | Bacteria | 568 |
| 736 | Ga0495657_0002404 | 3300046675 | Bacteria | 15754 |
| 737 | Ga0495657_0029407 | 3300046675 | Bacteria | 3854 |
| 738 | Ga0495599_0019977 | 3300046678 | Bacteria | 4171 |
| 739 | Ga0495599_0495678 | 3300046678 | Bacteria | 719 |
| 740 | Ga0495623_0002269 | 3300046679 | Bacteria | 12799 |
| 741 | Ga0495647_0083452 | 3300046681 | Bacteria | 1299 |
| 742 | Ga0495669_0021548 | 3300046684 | Bacteria | 2797 |
| 743 | Ga0495669_0038661 | 3300046684 | Bacteria | 2113 |
| 744 | Ga0495669_0067239 | 3300046684 | Bacteria | 1628 |
| 745 | Ga0495613_0102632 | 3300046689 | Bacteria | 2065 |
| 746 | Ga0495624_0110949 | 3300046690 | Bacteria | 1687 |
| 747 | Ga0495624_0480375 | 3300046690 | Bacteria | 744 |
| 748 | Ga0495670_0026042 | 3300046691 | Bacteria | 2895 |
| 749 | Ga0495649_0019021 | 3300046694 | Bacteria | 3859 |
| 750 | Ga0495649_0130513 | 3300046694 | Bacteria | 1326 |
| 751 | Ga0495649_0197727 | 3300046694 | Bacteria | 1045 |
| 752 | Ga0495589_0277902 | 3300046794 | Bacteria | 779 |
| 753 | Ga0495589_0311943 | 3300046794 | Bacteria | 728 |
| 754 | Ga0495589_0338087 | 3300046794 | Bacteria | 694 |
| 755 | Ga0495589_0410466 | 3300046794 | Bacteria | 621 |
| 756 | Ga0495600_0003267 | 3300046809 | Bacteria | 9496 |
| 757 | Ga0495600_0016450 | 3300046809 | Bacteria | 4694 |
| 758 | Ga0495581_0039503 | 3300047315 | Bacteria | 2732 |
| 759 | Ga0495581_0098788 | 3300047315 | Bacteria | 1696 |
| 760 | Ga0495604_0000420 | 3300047317 | Bacteria | 38211 |
| 761 | Ga0495604_0016406 | 3300047317 | Bacteria | 5920 |
| 762 | Ga0495604_0305546 | 3300047317 | Bacteria | 1067 |
| 763 | Ga0495604_0528485 | 3300047317 | Bacteria | 763 |
| 764 | Ga0495636_0364049 | 3300047318 | Bacteria | 684 |
| 765 | Ga0495674_0050231 | 3300047319 | Bacteria | 3681 |
| 766 | Ga0495674_0519370 | 3300047319 | Bacteria | 951 |
| 767 | Ga0495672_0293264 | 3300047320 | Bacteria | 773 |
| 768 | Ga0495676_0020250 | 3300047321 | Bacteria | 5842 |
| 769 | Ga0495676_0125668 | 3300047321 | Bacteria | 1859 |
| 770 | Ga0495680_0001714 | 3300047322 | Bacteria | 23262 |
| 771 | Ga0495680_0787681 | 3300047322 | Bacteria | 622 |
| 772 | Ga0495683_0207572 | 3300047323 | Bacteria | 880 |
| 773 | Ga0495683_0382543 | 3300047323 | Bacteria | 588 |
| 774 | Ga0495687_015494 | 3300047443 | Bacteria | 3874 |
| 775 | Ga0495687_091254 | 3300047443 | Bacteria | 1166 |
| 776 | Ga0495675_0078222 | 3300047444 | Bacteria | 2083 |
| 777 | Ga0495677_0051520 | 3300047445 | Bacteria | 1516 |
| 778 | Ga0495677_0096336 | 3300047445 | Bacteria | 1118 |
| 779 | Ga0495685_026230 | 3300047447 | Bacteria | 2005 |
| 780 | Ga0495673_0175865 | 3300047469 | Bacteria | 813 |
| 781 | Ga0495673_0266012 | 3300047469 | Bacteria | 622 |
| 782 | Ga0495684_0718322 | 3300047471 | Bacteria | 661 |
| 783 | Ga0495686_0393349 | 3300047472 | Bacteria | 745 |
| 784 | Ga0495602_0045327 | 3300048088 | Bacteria | 3980 |
| 785 | Ga0495602_0361174 | 3300048088 | Bacteria | 1045 |
| 786 | Ga0495615_0019659 | 3300048090 | Bacteria | 1503 |
| 787 | Ga0495615_0329960 | 3300048090 | Bacteria | 500 |
| 788 | Ga0496100_0110992 | 3300048903 | Bacteria | 1905 |
| 789 | Ga0496100_0519332 | 3300048903 | Bacteria | 919 |
| 790 | Ga0496100_0796568 | 3300048903 | Bacteria | 740 |
| 791 | Ga0496101_0532717 | 3300048904 | Bacteria | 928 |
| 792 | Ga0496101_0913439 | 3300048904 | Bacteria | 691 |
| 793 | Ga0496101_0954275 | 3300048904 | Bacteria | 675 |
| 794 | Ga0496102_0016889 | 3300048905 | Bacteria | 6386 |
| 795 | Ga0496102_0058823 | 3300048905 | Bacteria | 3513 |
| 796 | Ga0496102_0369010 | 3300048905 | Bacteria | 1351 |
| 797 | Ga0496102_0406365 | 3300048905 | Bacteria | 1280 |
| 798 | Ga0496103_0026103 | 3300048906 | Bacteria | 3535 |
| 799 | Ga0496103_0211012 | 3300048906 | Bacteria | 1249 |
| 800 | Ga0496103_0325780 | 3300048906 | Bacteria | 988 |
| 801 | Ga0496104_0004495 | 3300048907 | Bacteria | 12150 |
| 802 | Ga0496104_0213685 | 3300048907 | Bacteria | 1840 |
| 803 | Ga0496104_0389271 | 3300048907 | Bacteria | 1306 |
| 804 | Ga0496105_0000450 | 3300048908 | Bacteria | 27125 |
| 805 | Ga0496105_0159112 | 3300048908 | Bacteria | 1854 |
| 806 | Ga0496105_0552093 | 3300048908 | Bacteria | 899 |
| 807 | Ga0496106_0001765 | 3300048909 | Bacteria | 16152 |
| 808 | Ga0496106_0155935 | 3300048909 | Bacteria | 1803 |
| 809 | Ga0496106_0178101 | 3300048909 | Bacteria | 1687 |
| 810 | Ga0496106_0224327 | 3300048909 | Bacteria | 1499 |
| 811 | Ga0496106_0615217 | 3300048909 | Bacteria | 869 |
| 812 | Ga0496106_0756664 | 3300048909 | Bacteria | 772 |
| 813 | Ga0496107_0146004 | 3300048910 | Bacteria | 1749 |
| 814 | Ga0496107_0198028 | 3300048910 | Bacteria | 1493 |
| 815 | Ga0496107_0249019 | 3300048910 | Bacteria | 1322 |
| 816 | Ga0496107_0310916 | 3300048910 | Bacteria | 1173 |
| 817 | Ga0496107_0363199 | 3300048910 | Bacteria | 1077 |
| 818 | Ga0496108_0031474 | 3300048911 | Bacteria | 4403 |
| 819 | Ga0496108_0083019 | 3300048911 | Bacteria | 2717 |
| 820 | Ga0496108_0525779 | 3300048911 | Bacteria | 1033 |
| 821 | Ga0496108_1244075 | 3300048911 | Bacteria | 628 |
| 822 | Ga0496109_0372705 | 3300048912 | Bacteria | 1348 |
| 823 | Ga0496109_0517248 | 3300048912 | Bacteria | 1126 |
| 824 | Ga0496110_0218896 | 3300048913 | Bacteria | 1731 |
| 825 | Ga0496110_0501973 | 3300048913 | Bacteria | 1104 |
| 826 | Ga0496110_1106724 | 3300048913 | Bacteria | 700 |
| 827 | Ga0496111_0304646 | 3300048914 | Bacteria | 1181 |
| 828 | Ga0496112_0036617 | 3300048915 | Bacteria | 4787 |
| 829 | Ga0496112_0235828 | 3300048915 | Bacteria | 1783 |
| 830 | Ga0496113_0056733 | 3300048916 | Bacteria | 2942 |
| 831 | Ga0496113_0057770 | 3300048916 | Bacteria | 2917 |
| 832 | Ga0496113_1221636 | 3300048916 | Bacteria | 586 |
| 833 | Ga0496114_0014151 | 3300048917 | Bacteria | 6398 |
| 834 | Ga0496114_0309860 | 3300048917 | Bacteria | 1394 |
| 835 | Ga0496115_0368681 | 3300048918 | Bacteria | 1169 |
| 836 | Ga0496116_0021451 | 3300048919 | Bacteria | 4872 |
| 837 | Ga0496116_0181305 | 3300048919 | Bacteria | 1127 |
| 838 | Ga0496116_0227967 | 3300048919 | Bacteria | 948 |
| 839 | Ga0496117_0009249 | 3300048920 | Bacteria | 9210 |
| 840 | Ga0496117_0241781 | 3300048920 | Bacteria | 991 |
| 841 | Ga0496118_0010771 | 3300048921 | Bacteria | 9013 |
| 842 | Ga0496118_0019813 | 3300048921 | Bacteria | 5999 |
| 843 | Ga0496118_0121508 | 3300048921 | Bacteria | 1701 |
| 844 | Ga0496118_0285017 | 3300048921 | Bacteria | 917 |
| 845 | Ga0496118_0631313 | 3300048921 | Bacteria | 507 |
| 846 | Ga0496119_0002327 | 3300048922 | Bacteria | 20938 |
| 847 | Ga0496119_0019511 | 3300048922 | Bacteria | 4990 |
| 848 | Ga0496119_0155572 | 3300048922 | Bacteria | 1221 |
| 849 | Ga0496119_0271356 | 3300048922 | Bacteria | 847 |
| 850 | Ga0496119_0464475 | 3300048922 | Bacteria | 594 |
| 851 | Ga0496120_0013616 | 3300048923 | Bacteria | 5465 |
| 852 | Ga0496120_0094719 | 3300048923 | Bacteria | 1589 |
| 853 | Ga0496121_0000218 | 3300048924 | Bacteria | 126175 |
| 854 | Ga0496121_0036054 | 3300048924 | Bacteria | 4416 |
| 855 | Ga0496121_0059772 | 3300048924 | Bacteria | 3140 |
| 856 | Ga0496121_0084438 | 3300048924 | Bacteria | 2503 |
| 857 | Ga0496121_0085839 | 3300048924 | Bacteria | 2476 |
| 858 | Ga0496121_0093040 | 3300048924 | Bacteria | 2348 |
| 859 | Ga0496121_0158219 | 3300048924 | Bacteria | 1660 |
| 860 | Ga0496121_0185671 | 3300048924 | Bacteria | 1496 |
| 861 | Ga0496121_0343395 | 3300048924 | Bacteria | 997 |
| 862 | Ga0496121_0470250 | 3300048924 | Bacteria | 805 |
| 863 | Ga0496124_0001579 | 3300048927 | Bacteria | 32910 |
| 864 | Ga0496124_0197564 | 3300048927 | Bacteria | 1533 |
| 865 | Ga0496124_0238592 | 3300048927 | Bacteria | 1354 |
| 866 | Ga0496124_0287818 | 3300048927 | Bacteria | 1194 |
| 867 | Ga0496124_0472283 | 3300048927 | Bacteria | 849 |
| 868 | Ga0496125_0016330 | 3300048928 | Bacteria | 7134 |
| 869 | Ga0496125_0040078 | 3300048928 | Bacteria | 4023 |
| 870 | Ga0496125_0114617 | 3300048928 | Bacteria | 1941 |
| 871 | Ga0496125_0258420 | 3300048928 | Bacteria | 1093 |
| 872 | Ga0496126_0021157 | 3300048929 | Bacteria | 6360 |
| 873 | Ga0496126_0050772 | 3300048929 | Bacteria | 3778 |
| 874 | Ga0496126_0263474 | 3300048929 | Bacteria | 1432 |
| 875 | Ga0496126_0452308 | 3300048929 | Bacteria | 1033 |
| 876 | Ga0496126_0896951 | 3300048929 | Bacteria | 672 |
| 877 | Ga0495682_0273227 | 3300049460 | Bacteria | 597 |
| 878 | Ga0495682_0315231 | 3300049460 | Bacteria | 551 |
| 879 | Ga0501067_0192603 | 3300049583 | Bacteria | 1136 |
| 880 | Ga0501069_0095952 | 3300049585 | Bacteria | 1680 |
| 881 | Ga0501071_0626498 | 3300049587 | Bacteria | 827 |
| 882 | Ga0501081_0417058 | 3300049743 | Bacteria | 995 |
| 883 | nmdc:mga03683_26959_c1 | 3300050489 | Bacteria | 2271 |
| 884 | nmdc:mga03n38_111245_c1 | 3300050490 | Bacteria | 1334 |
| 885 | nmdc:mga03n38_321600_c1 | 3300050490 | Bacteria | 835 |
| 886 | nmdc:mga03n38_538479_c1 | 3300050490 | Bacteria | 659 |
| 887 | nmdc:mga00v17_234290_c1 | 3300050491 | Bacteria | 1190 |
| 888 | nmdc:mga00v17_471885_c1 | 3300050491 | Bacteria | 814 |
| 889 | nmdc:mga00v17_8593_c1 | 3300050491 | Bacteria | 5498 |
| 890 | nmdc:mga0yw44_241757_c1 | 3300050492 | Bacteria | 1200 |
| 891 | nmdc:mga0yw44_507846_c1 | 3300050492 | Bacteria | 818 |
| 892 | nmdc:mga0yw44_74854_c1 | 3300050492 | Bacteria | 2110 |
| 893 | nmdc:mga0k408_333468_c1 | 3300050493 | Bacteria | 905 |
| 894 | nmdc:mga0k408_48578_c1 | 3300050493 | Bacteria | 2455 |
| 895 | nmdc:mga06z11_246755_c1 | 3300050494 | Bacteria | 1050 |
| 896 | nmdc:mga06z11_47440_c1 | 3300050494 | Bacteria | 2182 |
| 897 | nmdc:mga06z11_90175_c1 | 3300050494 | Bacteria | 1663 |
| 898 | nmdc:mga04h51_129297_c1 | 3300050495 | Bacteria | 948 |
| 899 | nmdc:mga04h51_55158_c1 | 3300050495 | Bacteria | 1346 |
| 900 | nmdc:mga07m45_265884_c1 | 3300050496 | Bacteria | 998 |
| 901 | nmdc:mga07m45_85220_c1 | 3300050496 | Bacteria | 1807 |
| 902 | nmdc:mga05p37_1606391_c1 | 3300050507 | Bacteria | 640 |
| 903 | nmdc:mga08y16_1152388_c1 | 3300050511 | Bacteria | 748 |
| 904 | nmdc:mga08y16_168220_c1 | 3300050511 | Bacteria | 2278 |
| 905 | nmdc:mga0n895_90315_c1 | 3300050512 | Bacteria | 3065 |
| 906 | nmdc:mga0rr50_91695_c1 | 3300050513 | Bacteria | 2367 |
| 907 | nmdc:mga0a205_11483_c1 | 3300050515 | Bacteria | 8156 |
| 908 | nmdc:mga0a205_484773_c1 | 3300050515 | Bacteria | 1094 |
| 909 | nmdc:mga0sz30_227651_c1 | 3300050516 | Bacteria | 829 |
| 910 | nmdc:mga0sz30_448206_c1 | 3300050516 | Bacteria | 579 |
| 911 | Ga0500610_0225658 | 3300053079 | Bacteria | 883 |
| 912 | Ga0500635_0162024 | 3300053080 | Bacteria | 858 |
| 913 | Ga0495595_0056594 | 3300053084 | Bacteria | 1828 |
| 914 | Ga0500583_0151298 | 3300053092 | Bacteria | 1155 |
| 915 | Ga0500566_0200001 | 3300053094 | Bacteria | 1010 |
| 916 | Ga0500566_0488435 | 3300053094 | Bacteria | 532 |
| 917 | Ga0500640_076091 | 3300053095 | Bacteria | 1432 |
| 918 | Ga0500641_0060693 | 3300053096 | Bacteria | 1574 |
| 919 | Ga0500650_0117657 | 3300053098 | Bacteria | 1240 |
| 920 | Ga0500650_0279891 | 3300053098 | Bacteria | 742 |
| 921 | Ga0500556_0098360 | 3300053104 | Bacteria | 1124 |
| 922 | Ga0500569_006929 | 3300053109 | Bacteria | 2516 |
| 923 | Ga0500572_025316 | 3300053111 | Bacteria | 1608 |
| 924 | Ga0500594_0067539 | 3300053118 | Bacteria | 1045 |
| 925 | Ga0500595_000781 | 3300053119 | Bacteria | 18598 |
| 926 | Ga0500595_174302 | 3300053119 | Bacteria | 597 |
| 927 | Ga0500607_056108 | 3300053121 | Bacteria | 2080 |
| 928 | Ga0500621_201440 | 3300053126 | Bacteria | 705 |
| 929 | Ga0500626_212931 | 3300053128 | Bacteria | 751 |
| 930 | Ga0500658_0144677 | 3300053134 | Bacteria | 1068 |
| 931 | Ga0500559_0042173 | 3300053136 | Bacteria | 1990 |
| 932 | Ga0500559_0051602 | 3300053136 | Bacteria | 1816 |
| 933 | Ga0500568_0071365 | 3300053139 | Bacteria | 1329 |
| 934 | Ga0500577_0402999 | 3300053142 | Bacteria | 598 |
| 935 | Ga0500588_0166520 | 3300053146 | Bacteria | 805 |
| 936 | Ga0500590_049823 | 3300053148 | Bacteria | 2131 |
| 937 | Ga0500590_203985 | 3300053148 | Bacteria | 833 |
| 938 | Ga0500590_371381 | 3300053148 | Bacteria | 501 |
| 939 | Ga0500616_0029003 | 3300053153 | Bacteria | 3047 |
| 940 | Ga0500619_130219 | 3300053154 | Bacteria | 857 |
| 941 | Ga0500624_007578 | 3300053157 | Bacteria | 1497 |
| 942 | Ga0500627_0106212 | 3300053158 | Bacteria | 1262 |
| 943 | Ga0500634_0215329 | 3300053161 | Bacteria | 830 |
| 944 | Ga0500634_0224958 | 3300053161 | Bacteria | 802 |
| 945 | Ga0500638_184129 | 3300053162 | Bacteria | 898 |
| 946 | Ga0500638_332306 | 3300053162 | Bacteria | 572 |
| 947 | Ga0500636_0000160 | 3300053177 | Bacteria | 35228 |
| 948 | Ga0500637_0061113 | 3300053178 | Bacteria | 2158 |
| 949 | Ga0500637_0388736 | 3300053178 | Bacteria | 729 |
| 950 | Ga0500637_0396660 | 3300053178 | Bacteria | 718 |
| 951 | Ga0500649_195563 | 3300053722 | Bacteria | 661 |
| 952 | Ga0500657_208816 | 3300053728 | Bacteria | 637 |
| 953 | Ga0500609_015225 | 3300053731 | Bacteria | 1041 |
| 954 | Ga0500596_009479 | 3300053735 | Bacteria | 1519 |
| 955 | Ga0500596_054490 | 3300053735 | Bacteria | 659 |
| 956 | Ga0500599_000996 | 3300053736 | Bacteria | 3172 |
| 957 | Ga0500601_000253 | 3300053737 | Bacteria | 10247 |
| 958 | Ga0500661_016452 | 3300055283 | Bacteria | 1322 |
| 959 | Ga0500661_031259 | 3300055283 | Bacteria | 939 |
| 960 | Ga0587086_097612 | 3300059507 | Bacteria | 538 |
| 961 | Ga0587079_046617 | 3300059647 | Bacteria | 895 |
| 962 | 2507510734 | 2507262055 | Bacteria | 8048963 |
| 963 | 2508544534 | 2508501009 | Bacteria | 7784016 |
| 964 | 2511398701 | 2511231028 | Bacteria | 8046582 |
| 965 | 2513643094 | 2513237094 | Bacteria | 8789602 |
| 966 | 2513721181 | 2513237104 | Bacteria | 10034502 |
| 967 | 2513877886 | 2513237139 | Bacteria | 8737671 |
| 968 | 2514016261 | 2513237161 | Bacteria | 8871253 |
| 969 | 2515627985 | 2515154112 | Bacteria | 8294334 |
| 970 | 2517105108 | 2517093001 | Bacteria | 9002274 |
| 971 | 2528854294 | 2528768022 | Bacteria | 10457665 |
| 972 | 2617353765 | 2617270735 | Bacteria | 9163226 |
| 973 | 2617378832 | 2617270741 | Bacteria | 8201522 |
| 974 | 2818242613 | 2816332527 | Bacteria | 8933356 |
| 975 | 2824601885 | 2824600985 | Bacteria | 8488197 |
| 976 | 2824612801 | 2824609381 | Bacteria | 8672835 |
| 977 | 2824653220 | 2824653114 | Bacteria | 8493680 |
| 978 | 2824662562 | 2824661429 | Bacteria | 9877870 |
| 979 | 2824673415 | 2824671348 | Bacteria | 8369588 |
| 980 | 2824680994 | 2824679649 | Bacteria | 8248951 |
| 981 | 2824689543 | 2824687955 | Bacteria | 8360029 |
| 982 | 2824697324 | 2824696289 | Bacteria | 8335049 |
| 983 | 2824707893 | 2824704595 | Bacteria | 9667483 |
| 984 | 2824734676 | 2824732956 | Bacteria | 7810675 |
| 985 | 2824747806 | 2824746037 | Bacteria | 7911610 |
| 986 | 2824759015 | 2824753945 | Bacteria | 9787441 |
| 987 | 2824763921 | 2824763712 | Bacteria | 9792355 |
| 988 | 2838125258 | 2838122688 | Bacteria | 8803140 |
| 989 | 2841948605 | 2841941048 | Bacteria | 8688029 |
| 990 | 2841951501 | 2841949485 | Bacteria | 8680857 |
| 991 | 2841960503 | 2841957949 | Bacteria | 8652217 |
| 992 | 2841968483 | 2841966195 | Bacteria | 8673214 |
| 993 | 2841976317 | 2841974524 | Bacteria | 8931498 |
| 994 | 2841987679 | 2841983080 | Bacteria | 8395090 |
| 995 | 2844317181 | 2844315083 | Bacteria | 8138177 |
| 996 | 2847933875 | 2847930680 | Bacteria | 9342022 |
| 997 | 2847944551 | 2847939898 | Bacteria | 8606328 |
| 998 | 2874592313 | 2874590934 | Bacteria | 8299676 |
| 999 | 2874634591 | 2874628541 | Bacteria | 8630250 |
| 1000 | 2874650080 | 2874645413 | Bacteria | 8214782 |
| 1001 | 2876775391 | 2876771140 | Bacteria | 8287509 |
| 1002 | 2876826256 | 2876818435 | Bacteria | 8274608 |
| 1003 | 2879079521 | 2879074833 | Bacteria | 8279565 |
| 1004 | 2879087405 | 2879083081 | Bacteria | 8587928 |
| 1005 | 2879109628 | 2879099564 | Bacteria | 10442239 |
| 1006 | 2879132232 | 2879127579 | Bacteria | 8294491 |
| 1007 | 2879146881 | 2879142872 | Bacteria | 8267021 |
| 1008 | 2885367288 | 2885366525 | Bacteria | 8326213 |
| 1009 | 2885418434 | 2885409591 | Bacteria | 9235467 |
| 1010 | 2888381869 | 2888378607 | Bacteria | 9652610 |
| 1011 | 2888388769 | 2888388044 | Bacteria | 7304136 |
| 1012 | 2888422490 | 2888419890 | Bacteria | 7857137 |
| 1013 | 2903735165 | 2903727486 | Bacteria | 8281579 |
| 1014 | 2904720495 | 2904711408 | Bacteria | 9771557 |
| 1015 | 2906607220 | 2906602504 | Bacteria | 8295279 |
| 1016 | 2906643819 | 2906643746 | Bacteria | 8722424 |
| 1017 | 2908778122 | 2908775508 | Bacteria | 8092255 |
| 1018 | 2922371820 | |||
| 1019 | 2922389281 | 2922386360 | Bacteria | 7017218 |
| 1020 | 2922399472 | 2922393267 | Bacteria | 8285685 |
| 1021 | 2929616830 | 2929615660 | Bacteria | 9193770 |
| 1022 | 2929625573 | 2929624759 | Bacteria | 9339455 |
| 1023 | 2932791146 | 2932784394 | Bacteria | 9704911 |
| 1024 | 2932799197 | 2932794094 | Bacteria | 7915132 |
| 1025 | 2932803808 | 2932801729 | Bacteria | 7987968 |
| 1026 | 2932811671 | 2932809354 | Bacteria | 9135765 |
| 1027 | 2932826613 | 2932818245 | Bacteria | 9955613 |
| 1028 | 2932834241 | 2932828146 | Bacteria | 9745859 |
| 1029 | 2933577888 | 2933577622 | Bacteria | 9116884 |
| 1030 | 2935616088 | 2935608549 | Bacteria | 8203142 |
| 1031 | 2935623937 | 2935616580 | Bacteria | 9032984 |
| 1032 | 2935646935 | 2935638405 | Bacteria | 10015038 |
| 1033 | 2935654894 | 2935648319 | Bacteria | 8801166 |
| 1034 | 2935663836 | 2935656913 | Bacteria | 8965014 |
| 1035 | 2935674085 | 2935665750 | Bacteria | 9571747 |
| 1036 | 2935684724 | 2935675223 | Bacteria | 9928132 |
| 1037 | 2935691578 | 2935684952 | Bacteria | 9590419 |
| 1038 | 2935699453 | 2935694250 | Bacteria | 9291695 |
| 1039 | 2935707680 | 2935703347 | Bacteria | 10242284 |
| 1040 | 2935719412 | 2935713505 | Bacteria | 9608509 |
| 1041 | 2935728988 | 2935722832 | Bacteria | 9608746 |
| 1042 | 2935737771 | 2935732158 | Bacteria | 9706831 |
| 1043 | 2935747147 | 2935741537 | Bacteria | 9707219 |
| 1044 | 2935758053 | 2935750917 | Bacteria | 9590372 |
| 1045 | 2935766689 | 2935760218 | Bacteria | 9817913 |
| 1046 | 2935770680 | 2935769743 | Bacteria | 7878163 |
| 1047 | 2935782913 | 2935777560 | Bacteria | 8077691 |
| 1048 | 2935787034 | 2935785616 | Bacteria | 7962367 |
| 1049 | 2935795082 | 2935793552 | Bacteria | 8012592 |
| 1050 | 2935809298 | 2935801545 | Bacteria | 9301974 |
| 1051 | 2935817811 | 2935810662 | Bacteria | 9401221 |
| 1052 | 2935819984 | 2935819856 | Bacteria | 8261050 |
| 1053 | 2935836250 | 2935827899 | Bacteria | 10038562 |
| 1054 | 2935845159 | 2935837841 | Bacteria | 9454360 |
| 1055 | 2935850006 | 2935847175 | Bacteria | 8228321 |
| 1056 | 2935862213 | 2935855204 | Bacteria | 9035059 |
| 1057 | 2935870860 | 2935864058 | Bacteria | 9784707 |
| 1058 | 2935881253 | 2935873716 | Bacteria | 9632195 |
| 1059 | 2935884314 | 2935883170 | Bacteria | 7964738 |
| 1060 | 2935915159 | 2935908558 | Bacteria | 8568796 |
| 1061 | 2935923836 | 2935916978 | Bacteria | 9113783 |
| 1062 | 2935932656 | 2935926038 | Bacteria | 8601059 |
| 1063 | 2935941260 | 2935934488 | Bacteria | 8602579 |
| 1064 | 2935949326 | 2935942939 | Bacteria | 8599779 |
| 1065 | 2935958021 | 2935951376 | Bacteria | 8602333 |
| 1066 | 2935963771 | 2935959822 | Bacteria | 7869783 |
| 1067 | 2935974337 | 2935967501 | Bacteria | 8603075 |
| 1068 | 2935979527 | 2935975950 | Bacteria | 8347125 |
| 1069 | 2935991612 | 2935984226 | Bacteria | 8302647 |
| 1070 | 2935999155 | 2935992306 | Bacteria | 9802711 |
| 1071 | 2936005576 | 2936002035 | Bacteria | 9362176 |
| 1072 | 2936017992 | 2936011229 | Bacteria | 8801034 |
| 1073 | 2936026495 | 2936019824 | Bacteria | 8804134 |
| 1074 | 2936035098 | 2936028420 | Bacteria | 8965941 |
| 1075 | 2936042104 | 2936037263 | Bacteria | 9446081 |
| 1076 | 2936053248 | 2936046547 | Bacteria | 8903709 |
| 1077 | 2936059231 | 2936055302 | Bacteria | 8785755 |
| 1078 | 2940564036 | 2940556831 | Bacteria | 9590747 |
| 1079 | 2941535026 | 2941531003 | Bacteria | 7653939 |
| 1080 | 2941545488 | 2941538514 | Bacteria | 9402094 |
| 1081 | 3005508201 | 3005506211 | Bacteria | 6943378 |
| 1082 | 3005596883 | 3005594810 | Bacteria | 8716512 |
| 1083 | 3005720288 | 3005718088 | Bacteria | 8283608 |
| 1084 | 8006966418 | 8006964411 | Bacteria | 8966052 |
| 1085 | 8016515869 | 8016511872 | Bacteria | 9921665 |
| 1086 | 8016523412 | 8016522445 | Bacteria | 8156687 |
| 1087 | 8016541182 | 8016539877 | Bacteria | 8155419 |
| 1088 | 8016552070 | 8016548790 | Bacteria | 8155074 |
| 1089 | 8016560448 | 8016557553 | Bacteria | 8154380 |
| 1090 | 8016566573 | 8016566248 | Bacteria | 8158151 |
| 1091 | 8016589882 | 8016583857 | Bacteria | 10421953 |
| 1092 | 8016598350 | 8016595262 | Bacteria | 8149947 |
| 1093 | 8016604451 | 8016603502 | Bacteria | 8731218 |
| 1094 | 8016621030 | 8016613128 | Bacteria | 8794220 |
| 1095 | 8016628974 | 8016622563 | Bacteria | 7999408 |
| 1096 | 8016633549 | 8016630954 | Bacteria | 9217207 |
| 1097 | 8017060642 | 8017057580 | Bacteria | 10023680 |
| 1098 | 8019536613 | 8019530166 | Bacteria | 8155624 |
| 1099 | 8019542848 | 8019538911 | Bacteria | 7872763 |
| 1100 | 8019547898 | 8019547302 | Bacteria | 7996444 |
| 1101 | 8019580154 | 8019576017 | Bacteria | 10049540 |
| 1102 | 8019587873 | 8019586578 | Bacteria | 10212056 |
| 1103 | 8019603454 | 8019597564 | Bacteria | 10041141 |
| 1104 | 8019615073 | 8019608314 | Bacteria | 10042931 |
| 1105 | 8019625627 | 8019619141 | Bacteria | 9218857 |
| 1106 | 8019636663 | 8019629233 | Bacteria | 8687553 |
| 1107 | 8019642962 | 8019638758 | Bacteria | 9062356 |
| 1108 | 8019664464 | 8019659431 | Bacteria | 8577854 |
| 1109 | 8019674056 | 8019668869 | Bacteria | 8791617 |
| 1110 | 8019682068 | 8019678201 | Bacteria | 8863603 |
| 1111 | 8019693527 | 8019687851 | Bacteria | 8712826 |
| 1112 | 8055748476 | 8055742211 | Bacteria | 9226248 |
| 1113 | 8056678277 | 8056673599 | Bacteria | 7871253 |
| 1114 | 8056976278 | 8056967851 | Bacteria | 9038162 |
| 1115 | Ga0068860_100000750 | |||
| 1116 | JGI24739J22299_10174530 | |||
| 1117 | JGI24750J21931_1073513 | |||
| 1118 | JGI25153J46596_10000843 | |||
| 1119 | JGI25153J46596_10021234 | |||
| 1120 | rootL2_10055505 | |||
| 1121 | rootH1_10060569 | |||
| 1122 | JGI25160J50197_1026031 | |||
| 1123 | JGI25404J52841_10001353 | |||
| 1124 | JGI25404J52841_10004360 | |||
| 1125 | Ga0055528_1082334 | |||
| 1126 | Ga0055543_1020090 | |||
| 1127 | Ga0065165_1038053 | |||
| 1128 | Ga0065165_1038358 | |||
| 1129 | Ga0070658_10107170 | |||
| 1130 | Ga0070658_10553576 | |||
| 1131 | Ga0070676_10025880 | |||
| 1132 | Ga0070676_10338105 | |||
| 1133 | Ga0070683_100023716 | |||
| 1134 | Ga0070683_100876709 | |||
| 1135 | Ga0070690_100884968 | |||
| 1136 | Ga0070690_101055014 | |||
| 1137 | Ga0070670_100250549 | |||
| 1138 | Ga0068869_100121583 | |||
| 1139 | Ga0068869_100267459 | |||
| 1140 | Ga0068869_100426135 | |||
| 1141 | Ga0070666_10291684 | |||
| 1142 | Ga0070666_10827191 | |||
| 1143 | Ga0070680_100004777 | |||
| 1144 | Ga0070680_100543344 | |||
| 1145 | Ga0070682_100031944 | |||
| 1146 | Ga0070682_100437133 | |||
| 1147 | Ga0070682_100695615 | |||
| 1148 | Ga0068868_100141581 | |||
| 1149 | Ga0068868_100621024 | |||
| 1150 | Ga0070660_100498857 | |||
| 1151 | Ga0070660_101522759 | |||
| 1152 | Ga0070689_100700055 | |||
| 1153 | Ga0070687_100402922 | |||
| 1154 | Ga0070661_100156504 | |||
| 1155 | Ga0070661_100799065 | |||
| 1156 | Ga0070692_10376038 | |||
| 1157 | Ga0070692_10676437 | |||
| 1158 | Ga0070668_100055099 | |||
| 1159 | Ga0070668_100084489 | |||
| 1160 | Ga0070668_100252158 | |||
| 1161 | Ga0070668_100257843 | |||
| 1162 | Ga0070668_100754749 | |||
| 1163 | Ga0070668_100986344 | |||
| 1164 | Ga0070668_101716920 | |||
| 1165 | Ga0070669_100304580 | |||
| 1166 | Ga0070669_100335148 | |||
| 1167 | Ga0070675_101822876 | |||
| 1168 | Ga0070671_100015685 | |||
| 1169 | Ga0070671_100535186 | |||
| 1170 | Ga0070671_100610857 | |||
| 1171 | Ga0070671_100669016 | |||
| 1172 | Ga0070674_100132979 | |||
| 1173 | Ga0070674_100162288 | |||
| 1174 | Ga0070674_100502260 | |||
| 1175 | Ga0070673_100207106 | |||
| 1176 | Ga0070688_100670027 | |||
| 1177 | Ga0070659_100332715 | |||
| 1178 | Ga0070667_100189101 | |||
| 1179 | Ga0070667_100379012 | |||
| 1180 | Ga0070667_100381448 | |||
| 1181 | Ga0070703_10028631 | |||
| 1182 | Ga0070701_10124376 | |||
| 1183 | Ga0070711_100600866 | |||
| 1184 | Ga0070711_101418067 | |||
| 1185 | Ga0070705_100880836 | |||
| 1186 | Ga0070700_100040996 | |||
| 1187 | Ga0070700_100246793 | |||
| 1188 | Ga0070700_100559845 | |||
| 1189 | Ga0070700_100830728 | |||
| 1190 | Ga0070700_100913979 | |||
| 1191 | Ga0070694_100413650 | |||
| 1192 | Ga0070663_100009162 | |||
| 1193 | Ga0070663_100246854 | |||
| 1194 | Ga0070663_100465253 | |||
| 1195 | Ga0070663_100508816 | |||
| 1196 | Ga0070663_100667781 | |||
| 1197 | Ga0070663_101087753 | |||
| 1198 | Ga0070678_100021931 | |||
| 1199 | Ga0070678_100221283 | |||
| 1200 | Ga0070678_100779224 | |||
| 1201 | Ga0070678_101145000 | |||
| 1202 | Ga0070662_100142055 | |||
| 1203 | Ga0070662_100294048 | |||
| 1204 | Ga0070662_100430657 | |||
| 1205 | Ga0070681_10469658 | |||
| 1206 | Ga0068867_100048504 | |||
| 1207 | Ga0068867_100138539 | |||
| 1208 | Ga0068867_100525795 | |||
| 1209 | Ga0070685_10160444 | |||
| 1210 | Ga0070685_10274246 | |||
| 1211 | Ga0070685_10693705 | |||
| 1212 | Ga0070698_100126600 | |||
| 1213 | Ga0070699_101350453 | |||
| 1214 | Ga0070684_100016830 | |||
| 1215 | Ga0070684_101467372 | |||
| 1216 | Ga0068853_100214742 | |||
| 1217 | Ga0068853_101783340 | |||
| 1218 | Ga0070672_100174547 | |||
| 1219 | Ga0070672_100380821 | |||
| 1220 | Ga0070672_101009408 | |||
| 1221 | Ga0070686_100050955 | |||
| 1222 | Ga0070695_101105884 | |||
| 1223 | Ga0070696_100941657 | |||
| 1224 | Ga0070693_100149081 | |||
| 1225 | Ga0070693_100496949 | |||
| 1226 | Ga0070665_100029422 | |||
| 1227 | Ga0070665_100030432 | |||
| 1228 | Ga0070665_100195114 | |||
| 1229 | Ga0070665_100217409 | |||
| 1230 | Ga0070665_100226356 | |||
| 1231 | Ga0070665_100748299 | |||
| 1232 | Ga0070665_100839117 | |||
| 1233 | Ga0070704_101907666 | |||
| 1234 | Ga0068855_100088885 | |||
| 1235 | Ga0068855_100102387 | |||
| 1236 | Ga0068857_100238698 | |||
| 1237 | Ga0068857_100498259 | |||
| 1238 | Ga0068857_101152947 | |||
| 1239 | Ga0068854_100104129 | |||
| 1240 | Ga0068854_100171858 | |||
| 1241 | Ga0068854_100817197 | |||
| 1242 | Ga0068856_100007648 | |||
| 1243 | Ga0068856_100139603 | |||
| 1244 | Ga0068856_101282933 | |||
| 1245 | Ga0068856_101346862 | |||
| 1246 | Ga0070702_100076314 | |||
| 1247 | Ga0070702_100137210 | |||
| 1248 | Ga0070702_100521353 | |||
| 1249 | Ga0070702_100556064 | |||
| 1250 | Ga0068852_100231763 | |||
| 1251 | Ga0068852_100465069 | |||
| 1252 | Ga0068852_101863612 | |||
| 1253 | Ga0068859_100766262 | |||
| 1254 | Ga0068864_100080457 | |||
| 1255 | Ga0068864_100336155 | |||
| 1256 | Ga0068864_100713276 | |||
| 1257 | Ga0068866_10060197 | |||
| 1258 | Ga0068866_10220698 | |||
| 1259 | Ga0068861_100033062 | |||
| 1260 | Ga0068861_100148087 | |||
| 1261 | Ga0068861_100153790 | |||
| 1262 | Ga0068861_100164450 | |||
| 1263 | Ga0068861_100263513 | |||
| 1264 | Ga0068861_100494476 | |||
| 1265 | Ga0068861_100676157 | |||
| 1266 | Ga0068851_10175090 | |||
| 1267 | Ga0068851_10357824 | |||
| 1268 | Ga0068870_10066579 | |||
| 1269 | Ga0068870_10519275 | |||
| 1270 | Ga0068870_10892336 | |||
| 1271 | Ga0068870_10959185 | |||
| 1272 | Ga0068863_100314915 | |||
| 1273 | Ga0068863_100392291 | |||
| 1274 | Ga0068863_100404399 | |||
| 1275 | Ga0068863_100564274 | |||
| 1276 | Ga0068863_102493045 | |||
| 1277 | Ga0068858_100048903 | |||
| 1278 | Ga0068858_100397065 | |||
| 1279 | Ga0068858_100461786 | |||
| 1280 | Ga0068858_100718171 | |||
| 1281 | Ga0068858_100999822 | |||
| 1282 | Ga0068858_101207399 | |||
| 1283 | Ga0068858_101242402 | |||
| 1284 | Ga0068860_100086071 | |||
| 1285 | Ga0068860_100150847 | |||
| 1286 | Ga0068860_100353972 | |||
| 1287 | Ga0068860_100492909 | |||
| 1288 | Ga0068860_100834988 | |||
| 1289 | Ga0068860_100956299 | |||
| 1290 | Ga0068862_100077665 | |||
| 1291 | Ga0068862_100766978 | |||
| 1292 | Ga0068862_101014097 | |||
| 1293 | Ga0081455_10109710 | |||
| 1294 | Ga0081455_10230722 | |||
| 1295 | Ga0081455_10690504 | |||
| 1296 | Ga0081538_10043620 | |||
| 1297 | Ga0081540_1007986 | |||
| 1298 | Ga0081540_1008303 | |||
| 1299 | Ga0081540_1010128 | |||
| 1300 | Ga0081540_1139209 | |||
| 1301 | Ga0081539_10037212 | |||
| 1302 | Ga0070717_10911795 | |||
| 1303 | Ga0070717_11769401 | |||
| 1304 | Ga0075365_10099467 | |||
| 1305 | Ga0075365_10182715 | |||
| 1306 | Ga0075368_10085864 | |||
| 1307 | Ga0075368_10093095 | |||
| 1308 | Ga0075368_10093219 | |||
| 1309 | Ga0075363_100061563 | |||
| 1310 | Ga0075363_100697926 | |||
| 1311 | Ga0075364_10141851 | |||
| 1312 | Ga0075364_10222313 | |||
| 1313 | Ga0075364_11087969 | |||
| 1314 | Ga0075432_10029052 | |||
| 1315 | Ga0070715_10642989 | |||
| 1316 | Ga0070712_101772162 | |||
| 1317 | Ga0075362_10162900 | |||
| 1318 | Ga0075362_10167615 | |||
| 1319 | Ga0075362_10459219 | |||
| 1320 | Ga0075367_10126989 | |||
| 1321 | Ga0075367_10149598 | |||
| 1322 | Ga0075367_10222054 | |||
| 1323 | Ga0075367_10392288 | |||
| 1324 | Ga0075369_10019837 | |||
| 1325 | Ga0075369_10046941 | |||
| 1326 | Ga0075369_10170822 | |||
| 1327 | Ga0075369_10382273 | |||
| 1328 | Ga0075366_10075614 | |||
| 1329 | Ga0075366_10484225 | |||
| 1330 | Ga0075366_10505068 | |||
| 1331 | Ga0097621_100526415 | |||
| 1332 | Ga0097621_100763233 | |||
| 1333 | Ga0097621_102252735 | |||
| 1334 | Ga0075370_10201049 | |||
| 1335 | Ga0075370_10371090 | |||
| 1336 | Ga0068871_100199476 | |||
| 1337 | Ga0068871_100591327 | |||
| 1338 | Ga0068871_100995393 | |||
| 1339 | Ga0068871_101916123 | |||
| 1340 | Ga0075428_100818139 | |||
| 1341 | Ga0075430_101069197 | |||
| 1342 | Ga0075433_10013684 | |||
| 1343 | Ga0075433_10566706 | |||
| 1344 | Ga0075434_100034640 | |||
| 1345 | Ga0075429_101656210 | |||
| 1346 | Ga0068865_100131258 | |||
| 1347 | Ga0097620_100212218 | |||
| 1348 | Ga0097620_100766282 | |||
| 1349 | Ga0099825_1019614 | |||
| 1350 | Ga0075435_100413813 | |||
| 1351 | Ga0075435_101383387 | |||
| 1352 | Ga0105251_10637227 | |||
| 1353 | Ga0105250_10108560 | |||
| 1354 | Ga0105250_10290180 | |||
| 1355 | Ga0105240_10004507 | |||
| 1356 | Ga0105240_10545640 | |||
| 1357 | Ga0111539_10180571 | |||
| 1358 | Ga0111539_10305309 | |||
| 1359 | Ga0111539_11715413 | |||
| 1360 | Ga0105245_10081822 | |||
| 1361 | Ga0105245_10263703 | |||
| 1362 | Ga0105245_11638310 | |||
| 1363 | Ga0105245_12061105 | |||
| 1364 | Ga0105245_12155643 | |||
| 1365 | Ga0105247_10251934 | |||
| 1366 | Ga0105247_10442116 | |||
| 1367 | Ga0105247_10899207 | |||
| 1368 | Ga0114129_10336223 | |||
| 1369 | Ga0105243_10023215 | |||
| 1370 | Ga0105243_10229227 | |||
| 1371 | Ga0105243_11888124 | |||
| 1372 | Ga0105243_12654867 | |||
| 1373 | Ga0105241_10025959 | |||
| 1374 | Ga0105241_10207196 | |||
| 1375 | Ga0105241_10218818 | |||
| 1376 | Ga0105241_10400965 | |||
| 1377 | Ga0105241_10624340 | |||
| 1378 | Ga0105241_10935976 | |||
| 1379 | Ga0105242_10282942 | |||
| 1380 | Ga0105242_12384550 | |||
| 1381 | Ga0105248_10110058 | |||
| 1382 | Ga0105248_10124986 | |||
| 1383 | Ga0105248_12416744 | |||
| 1384 | Ga0105248_12431553 | |||
| 1385 | Ga0105237_10011480 | |||
| 1386 | Ga0105237_10073042 | |||
| 1387 | Ga0105237_10177502 | |||
| 1388 | Ga0105238_10145174 | |||
| 1389 | Ga0105238_10433183 | |||
| 1390 | Ga0105238_10454349 | |||
| 1391 | Ga0105238_10553048 | |||
| 1392 | Ga0105238_12102871 | |||
| 1393 | Ga0105249_10194003 | |||
| 1394 | Ga0105249_10283008 | |||
| 1395 | Ga0105249_10811517 | |||
| 1396 | Ga0105249_10921351 | |||
| 1397 | Ga0105249_12084693 | |||
| 1398 | Ga0105239_10065781 | |||
| 1399 | Ga0105239_10131251 | |||
| 1400 | Ga0105239_10184048 | |||
| 1401 | Ga0105239_10550402 | |||
| 1402 | Ga0105239_10595403 | |||
| 1403 | Ga0105239_10653309 | |||
| 1404 | Ga0105239_11068166 | |||
| 1405 | Ga0105239_11215918 | |||
| 1406 | Ga0105246_10100197 | |||
| 1407 | Ga0105246_10836084 | |||
| 1408 | Ga0105246_11356407 | |||
| 1409 | Ga0105246_12245218 | |||
| 1410 | Ga0157314_1019146 | |||
| 1411 | Ga0157371_11530784 | |||
| 1412 | Ga0157370_11611522 | |||
| 1413 | Ga0157369_10084765 | |||
| 1414 | Ga0157369_10912182 | |||
| 1415 | Ga0157374_11143790 | |||
| 1416 | Ga0157374_11292578 | |||
| 1417 | Ga0157374_11528414 | |||
| 1418 | Ga0157374_11717939 | |||
| 1419 | Ga0157378_10033626 | |||
| 1420 | Ga0157378_10412529 | |||
| 1421 | Ga0163162_10134241 | |||
| 1422 | Ga0163162_10308160 | |||
| 1423 | Ga0163162_10450553 | |||
| 1424 | Ga0163162_11906468 | |||
| 1425 | Ga0157372_10267332 | |||
| 1426 | Ga0157372_10623061 | |||
| 1427 | Ga0157375_10354662 | |||
| 1428 | Ga0157375_10526432 | |||
| 1429 | Ga0157375_11794801 | |||
| 1430 | Ga0163163_10087935 | |||
| 1431 | Ga0163163_10590413 | |||
| 1432 | Ga0163163_11097196 | |||
| 1433 | Ga0157380_10141244 | |||
| 1434 | Ga0157380_10476978 | |||
| 1435 | Ga0157380_10628878 | |||
| 1436 | Ga0157380_10678003 | |||
| 1437 | Ga0157377_10081157 | |||
| 1438 | Ga0157377_10858488 | |||
| 1439 | Ga0157379_10508380 | |||
| 1440 | Ga0157379_10605933 | |||
| 1441 | Ga0157379_10730083 | |||
| 1442 | Ga0157379_11173454 | |||
| 1443 | Ga0157376_10211162 | |||
| 1444 | Ga0157376_10292146 | |||
| 1445 | Ga0157376_10471476 | |||
| 1446 | Ga0157376_11116764 | |||
| 1447 | Ga0182007_10035964 | |||
| 1448 | Ga0163161_10023451 | |||
| 1449 | Ga0163161_10735540 | |||
| 1450 | Ga0163161_10929358 | |||
| 1451 | Ga0163161_11614981 | |||
| 1452 | Ga0206356_11821617 | |||
| 1453 | Ga0206353_11062936 | |||
| 1454 | Ga0214544_1000013 | |||
| 1455 | Ga0214542_1000013 | |||
| 1456 | Ga0214545_1000012 | |||
| 1457 | Ga0214543_1000065 | |||
| 1458 | Ga0213876_10021294 | |||
| 1459 | Ga0209563_115804 | |||
| 1460 | Ga0209026_1060825 | |||
| 1461 | Ga0209677_110702 | |||
| 1462 | Ga0209148_1000319 | |||
| 1463 | Ga0209148_1024638 | |||
| 1464 | Ga0209233_1004008 | |||
| 1465 | Ga0209233_1068717 | |||
| 1466 | Ga0209455_1003084 | |||
| 1467 | Ga0209455_1020243 | |||
| 1468 | Ga0209673_1038344 | |||
| 1469 | Ga0209564_1004362 | |||
| 1470 | Ga0209758_1001334 | |||
| 1471 | Ga0209758_1001430 | |||
| 1472 | Ga0209758_1010151 | |||
| 1473 | Ga0209758_1060114 | |||
| 1474 | Ga0209256_1016536 | |||
| 1475 | Ga0207426_1019126 | |||
| 1476 | Ga0207426_1040571 | |||
| 1477 | Ga0207697_10042628 | |||
| 1478 | Ga0207697_10088841 | |||
| 1479 | Ga0207697_10344185 | |||
| 1480 | Ga0207656_10032151 | |||
| 1481 | Ga0207696_1036713 | |||
| 1482 | Ga0207682_10283300 | |||
| 1483 | Ga0207710_10091825 | |||
| 1484 | Ga0207710_10238009 | |||
| 1485 | Ga0207710_10245697 | |||
| 1486 | Ga0207688_10014273 | |||
| 1487 | Ga0207688_10020081 | |||
| 1488 | Ga0207680_10120789 | |||
| 1489 | Ga0207680_10206093 | |||
| 1490 | Ga0207680_10590501 | |||
| 1491 | Ga0207647_10001937 | |||
| 1492 | Ga0207647_10070938 | |||
| 1493 | Ga0207685_10186238 | |||
| 1494 | Ga0207645_10106103 | |||
| 1495 | Ga0207645_10227334 | |||
| 1496 | Ga0207643_10040804 | |||
| 1497 | Ga0207643_10336806 | |||
| 1498 | Ga0207643_11035280 | |||
| 1499 | Ga0207705_10088803 | |||
| 1500 | Ga0207705_10796273 | |||
| 1501 | Ga0207654_10011983 | |||
| 1502 | Ga0207654_10036092 | |||
| 1503 | Ga0207654_10410139 | |||
| 1504 | Ga0207654_10897793 | |||
| 1505 | Ga0207707_10000478 | |||
| 1506 | Ga0207707_10057426 | |||
| 1507 | Ga0207695_10000240 | |||
| 1508 | Ga0207695_10322570 | |||
| 1509 | Ga0207671_10002558 | |||
| 1510 | Ga0207671_10052054 | |||
| 1511 | Ga0207671_10115950 | |||
| 1512 | Ga0207671_10155073 | |||
| 1513 | Ga0207671_10989369 | |||
| 1514 | Ga0207663_10896480 | |||
| 1515 | Ga0207660_10020143 | |||
| 1516 | Ga0207660_10027527 | |||
| 1517 | Ga0207662_10062100 | |||
| 1518 | Ga0207662_10743184 | |||
| 1519 | Ga0207657_10110081 | |||
| 1520 | Ga0207657_10207786 | |||
| 1521 | Ga0207657_10638567 | |||
| 1522 | Ga0207657_11254369 | |||
| 1523 | Ga0207649_11226632 | |||
| 1524 | Ga0207652_10308075 | |||
| 1525 | Ga0207681_10229584 | |||
| 1526 | Ga0207681_10573408 | |||
| 1527 | Ga0207694_10710797 | |||
| 1528 | Ga0207694_10715636 | |||
| 1529 | Ga0207650_10028309 | |||
| 1530 | Ga0207650_10123908 | |||
| 1531 | Ga0207659_10514272 | |||
| 1532 | Ga0207659_10774291 | |||
| 1533 | Ga0207687_10011179 | |||
| 1534 | Ga0207687_10028107 | |||
| 1535 | Ga0207687_10041102 | |||
| 1536 | Ga0207644_10020411 | |||
| 1537 | Ga0207644_10213911 | |||
| 1538 | Ga0207644_10259509 | |||
| 1539 | Ga0207644_10523805 | |||
| 1540 | Ga0207690_10222175 | |||
| 1541 | Ga0207690_10691854 | |||
| 1542 | Ga0207690_11249689 | |||
| 1543 | Ga0207706_10104072 | |||
| 1544 | Ga0207686_10204210 | |||
| 1545 | Ga0207709_10013704 | |||
| 1546 | Ga0207709_10527947 | |||
| 1547 | Ga0207709_10535462 | |||
| 1548 | Ga0207670_10836763 | |||
| 1549 | Ga0207670_11163308 | |||
| 1550 | Ga0207670_11843814 | |||
| 1551 | Ga0207704_11093415 | |||
| 1552 | Ga0207691_10009643 | |||
| 1553 | Ga0207691_10655611 | |||
| 1554 | Ga0207691_10784162 | |||
| 1555 | Ga0207711_10064934 | |||
| 1556 | Ga0207711_11200408 | |||
| 1557 | Ga0207689_10040232 | |||
| 1558 | Ga0207689_10063086 | |||
| 1559 | Ga0207689_10304415 | |||
| 1560 | Ga0207661_10009026 | |||
| 1561 | Ga0207679_11027688 | |||
| 1562 | Ga0207667_10022463 | |||
| 1563 | Ga0207667_10382338 | |||
| 1564 | Ga0207667_11266069 | |||
| 1565 | Ga0207651_10135535 | |||
| 1566 | Ga0207651_10669418 | |||
| 1567 | Ga0207651_11585282 | |||
| 1568 | Ga0207712_10147159 | |||
| 1569 | Ga0207712_10321395 | |||
| 1570 | Ga0207712_11119652 | |||
| 1571 | Ga0207668_10034775 | |||
| 1572 | Ga0207668_10052349 | |||
| 1573 | Ga0207668_10340680 | |||
| 1574 | Ga0207668_10395125 | |||
| 1575 | Ga0207668_10904641 | |||
| 1576 | Ga0207668_11153740 | |||
| 1577 | Ga0207668_11838032 | |||
| 1578 | Ga0207640_10563802 | |||
| 1579 | Ga0207640_11506351 | |||
| 1580 | Ga0207658_10201951 | |||
| 1581 | Ga0207658_10658323 | |||
| 1582 | Ga0207658_11801995 | |||
| 1583 | Ga0207677_10053550 | |||
| 1584 | Ga0207677_10229190 | |||
| 1585 | Ga0207677_11801406 | |||
| 1586 | Ga0207677_12139832 | |||
| 1587 | Ga0207703_10126988 | |||
| 1588 | Ga0207703_10511544 | |||
| 1589 | Ga0207703_11461328 | |||
| 1590 | Ga0207703_12032092 | |||
| 1591 | Ga0207639_10344819 | |||
| 1592 | Ga0207639_10468293 | |||
| 1593 | Ga0207639_10502570 | |||
| 1594 | Ga0207639_11203013 | |||
| 1595 | Ga0207678_10012818 | |||
| 1596 | Ga0207678_10471447 | |||
| 1597 | Ga0207678_10580622 | |||
| 1598 | Ga0207678_10645133 | |||
| 1599 | Ga0207678_10681004 | |||
| 1600 | Ga0207678_11066325 | |||
| 1601 | Ga0207708_10022932 | |||
| 1602 | Ga0207708_10252280 | |||
| 1603 | Ga0207702_10456464 | |||
| 1604 | Ga0207702_10530225 | |||
| 1605 | Ga0207641_10310055 | |||
| 1606 | Ga0207641_10314699 | |||
| 1607 | Ga0207641_10795253 | |||
| 1608 | Ga0207641_10917072 | |||
| 1609 | Ga0207641_11245702 | |||
| 1610 | Ga0207641_12111748 | |||
| 1611 | Ga0207648_10072960 | |||
| 1612 | Ga0207648_10118811 | |||
| 1613 | Ga0207676_10025018 | |||
| 1614 | Ga0207676_10272374 | |||
| 1615 | Ga0207674_10083021 | |||
| 1616 | Ga0207674_10181900 | |||
| 1617 | Ga0207675_100154218 | |||
| 1618 | Ga0207675_100175572 | |||
| 1619 | Ga0207675_100193299 | |||
| 1620 | Ga0207675_100194966 | |||
| 1621 | Ga0207675_100261644 | |||
| 1622 | Ga0207675_101072413 | |||
| 1623 | Ga0207683_10059172 | |||
| 1624 | Ga0207683_10125988 | |||
| 1625 | Ga0207683_10263047 | |||
| 1626 | Ga0207683_10648522 | |||
| 1627 | Ga0207683_10740354 | |||
| 1628 | Ga0207698_10180256 | |||
| 1629 | Ga0207698_10616640 | |||
| 1630 | Ga0207698_11542925 | |||
| 1631 | Ga0207698_11597216 | |||
| 1632 | Ga0209389_1000188 | |||
| 1633 | Ga0209489_110855 | |||
| 1634 | Ga0209700_100437 | |||
| 1635 | Ga0209813_10002512 | |||
| 1636 | Ga0209813_10097645 | |||
| 1637 | Ga0209813_10460358 | |||
| 1638 | Ga0207428_10024068 | |||
| 1639 | Ga0268266_10000466 | |||
| 1640 | Ga0268266_10012380 | |||
| 1641 | Ga0268266_10027532 | |||
| 1642 | Ga0268266_10586296 | |||
| 1643 | Ga0268266_11183041 | |||
| 1644 | Ga0268265_10031314 | |||
| 1645 | Ga0268265_10044494 | |||
| 1646 | Ga0268265_10246585 | |||
| 1647 | Ga0268265_10659584 | |||
| 1648 | Ga0268265_12055668 | |||
| 1649 | Ga0268264_10000073 | |||
| 1650 | Ga0268264_10175182 | |||
| 1651 | Ga0268264_10402731 | |||
| 1652 | Ga0268264_10532285 | |||
| 1653 | Ga0268264_10563134 | |||
| 1654 | Ga0268264_10731562 | |||
| 1655 | Ga0307517_10494170 | |||
| 1656 | Ga0307511_10171616 | |||
| 1657 | Ga0265316_10148218 | |||
| 1658 | Ga0307513_10430971 | |||
| 1659 | Ga0307509_10036522 | |||
| 1660 | Ga0307509_10089522 | |||
| 1661 | Ga0307509_10146091 | |||
| 1662 | Ga0307509_10189770 | |||
| 1663 | Ga0307509_10223145 | |||
| 1664 | Ga0307408_100185954 | |||
| 1665 | Ga0307508_10885365 | |||
| 1666 | Ga0265314_10177011 | |||
| 1667 | Ga0307516_10556250 | |||
| 1668 | Ga0307516_10698180 | |||
| 1669 | Ga0307516_10774113 | |||
| 1670 | Ga0307518_10346217 | |||
| 1671 | Ga0307407_10336850 | |||
| 1672 | Ga0307412_12286827 | |||
| 1673 | Ga0307416_100541436 | |||
| 1674 | Ga0307415_100187236 | |||
| 1675 | Ga0307507_10144079 | |||
| 1676 | Ga0307510_10036477 | |||
| 1677 | Ga0307510_10129996 | |||
| 1678 | Ga0373958_0001988 | |||
| 1679 | Ga0373928_0036118 | |||
| 1680 | Ga0373929_0029014 | |||
| 1681 | Ga0373949_0121630 | |||
| 1682 | Ga0373951_0047234 | |||
| 1683 | Ga0373952_0090821 | |||
| 1684 | Ga0373923_0129565 | |||
| 1685 | Ga0373932_0076071 | |||
| 1686 | Ga0373939_0234899 | |||
| 1687 | Ga0373939_0418046 | |||
| 1688 | Ga0373941_0144968 | |||
| 1689 | Ga0373954_0360536 | |||
| 1690 | Ga0373957_0299243 | |||
| 1691 | Ga0373960_0019472 | |||
| 1692 | Ga0373960_0341758 | |||
| 1693 | Ga0373962_0076424 | |||
| 1694 | Ga0373931_0217236 | |||
| 1695 | Ga0373935_0026726 | |||
| 1696 | Ga0373927_0241510 | |||
| 1697 | Ga0373927_0275021 | |||
| 1698 | Ga0373933_0089850 | |||
| 1699 | Ga0373937_0306843 | |||
| 1700 | Ga0373925_0013597 | |||
| 1701 | Ga0373925_0647629 | |||
| 1702 | Ga0395900_0000394 | |||
| 1703 | Ga0395898_0011041 | |||
| 1704 | Ga0395905_0362238 | |||
| 1705 | Ga0395905_0623811 | |||
| 1706 | Ga0395905_1264088 | |||
| 1707 | Ga0436364_0163528 | |||
| 1708 | Ga0395901_0125444 | |||
| 1709 | Ga0436365_0394164 | |||
| 1710 | Ga0436365_1900573 | |||
| 1711 | Ga0436363_0822942 | |||
| 1712 | Ga0436362_0044086 | |||
| 1713 | Ga0451789_0546568 | |||
| 1714 | Ga0451793_1203669 | |||
| 1715 | Ga0451793_1654678 | |||
| 1716 | Ga0451795_0738676 | |||
| 1717 | Ga0451835_0046854 | |||
| 1718 | Ga0451839_0396340 | |||
| 1719 | Ga0451839_0706751 | |||
| 1720 | Ga0451843_1565422 | |||
| 1721 | Ga0451853_0703402 | |||
| 1722 | Ga0466969_0158289 | |||
| 1723 | Ga0466972_0000576 | |||
| 1724 | Ga0466972_0000829 | |||
| 1725 | Ga0466972_0051840 | |||
| 1726 | Ga0466972_0465207 | |||
| 1727 | Ga0466965_0047681 | |||
| 1728 | Ga0466965_0432140 | |||
| 1729 | Ga0466966_0001892 | |||
| 1730 | Ga0466961_0000016 | |||
| 1731 | Ga0466963_0060568 | |||
| 1732 | Ga0466964_0116894 | |||
| 1733 | Ga0466964_0463375 | |||
| 1734 | Ga0466968_0002646 | |||
| 1735 | Ga0466968_0055352 | |||
| 1736 | Ga0466957_0070058 | |||
| 1737 | Ga0466960_0002702 | |||
| 1738 | Ga0466960_0385823 | |||
| 1739 | Ga0466960_0628537 | |||
| 1740 | Ga0466959_0014272 | |||
| 1741 | Ga0466959_0984979 | |||
| 1742 | Ga0466967_0111185 | |||
| 1743 | Ga0495617_005506 | |||
| 1744 | Ga0495617_050771 | |||
| 1745 | Ga0495617_112171 | |||
| 1746 | Ga0495592_0017226 | |||
| 1747 | Ga0495592_0486425 | |||
| 1748 | Ga0495603_0009571 | |||
| 1749 | Ga0495603_0247025 | |||
| 1750 | Ga0495590_0087600 | |||
| 1751 | Ga0495590_0161955 | |||
| 1752 | Ga0495590_0234684 | |||
| 1753 | Ga0495590_0342438 | |||
| 1754 | Ga0495591_118921 | |||
| 1755 | Ga0495629_0123577 | |||
| 1756 | Ga0495629_0160170 | |||
| 1757 | Ga0495629_0713273 | |||
| 1758 | Ga0495638_0056812 | |||
| 1759 | Ga0495638_0057598 | |||
| 1760 | Ga0495641_0105202 | |||
| 1761 | Ga0495651_0003955 | |||
| 1762 | Ga0495651_0004024 | |||
| 1763 | Ga0495650_0100173 | |||
| 1764 | Ga0495605_0062663 | |||
| 1765 | Ga0495605_0249715 | |||
| 1766 | Ga0495639_0021929 | |||
| 1767 | Ga0495664_0108404 | |||
| 1768 | Ga0495584_0133303 | |||
| 1769 | Ga0495584_0189537 | |||
| 1770 | Ga0495584_0534936 | |||
| 1771 | Ga0495585_0276589 | |||
| 1772 | Ga0495585_0376873 | |||
| 1773 | Ga0495585_0485432 | |||
| 1774 | Ga0495594_0019047 | |||
| 1775 | Ga0495596_0216225 | |||
| 1776 | Ga0495596_0303239 | |||
| 1777 | Ga0495607_0342425 | |||
| 1778 | Ga0495606_0082372 | |||
| 1779 | Ga0495606_0411648 | |||
| 1780 | Ga0495606_0444541 | |||
| 1781 | Ga0495608_0088051 | |||
| 1782 | Ga0495608_0099737 | |||
| 1783 | Ga0495610_0032441 | |||
| 1784 | Ga0495616_0024995 | |||
| 1785 | Ga0495616_0185804 | |||
| 1786 | Ga0495618_0491840 | |||
| 1787 | Ga0495618_0866145 | |||
| 1788 | Ga0495620_0045961 | |||
| 1789 | Ga0495620_0075873 | |||
| 1790 | Ga0495628_0030495 | |||
| 1791 | Ga0495630_0101141 | |||
| 1792 | Ga0495631_0150038 | |||
| 1793 | Ga0495631_0164998 | |||
| 1794 | Ga0495631_0481188 | |||
| 1795 | Ga0495632_0249599 | |||
| 1796 | Ga0495643_0073363 | |||
| 1797 | Ga0495643_0256449 | |||
| 1798 | Ga0495643_0343234 | |||
| 1799 | Ga0495644_0265228 | |||
| 1800 | Ga0495648_0112696 | |||
| 1801 | Ga0495648_0263521 | |||
| 1802 | Ga0495648_0278276 | |||
| 1803 | Ga0495663_0107021 | |||
| 1804 | Ga0495666_0203094 | |||
| 1805 | Ga0495652_0026602 | |||
| 1806 | Ga0495652_0386975 | |||
| 1807 | Ga0495665_0371894 | |||
| 1808 | Ga0495640_0006053 | |||
| 1809 | Ga0495587_0007178 | |||
| 1810 | Ga0495587_0637738 | |||
| 1811 | Ga0495598_0043774 | |||
| 1812 | Ga0495609_0017043 | |||
| 1813 | Ga0495609_0105173 | |||
| 1814 | Ga0495609_0212452 | |||
| 1815 | Ga0495621_0296646 | |||
| 1816 | Ga0495645_0007485 | |||
| 1817 | Ga0495622_0016496 | |||
| 1818 | Ga0495622_0042578 | |||
| 1819 | Ga0495622_0070962 | |||
| 1820 | Ga0495667_0003371 | |||
| 1821 | Ga0495656_0016609 | |||
| 1822 | Ga0495656_0036339 | |||
| 1823 | Ga0495656_0143295 | |||
| 1824 | Ga0495656_0159526 | |||
| 1825 | Ga0495656_0296052 | |||
| 1826 | Ga0495656_0764037 | |||
| 1827 | Ga0495668_0027417 | |||
| 1828 | Ga0495668_0054002 | |||
| 1829 | Ga0495668_0283635 | |||
| 1830 | Ga0495634_0020124 | |||
| 1831 | Ga0495634_0027702 | |||
| 1832 | Ga0495611_0245574 | |||
| 1833 | Ga0495611_0332229 | |||
| 1834 | Ga0495625_0068192 | |||
| 1835 | Ga0495625_0182994 | |||
| 1836 | Ga0495625_0298530 | |||
| 1837 | Ga0495625_0309833 | |||
| 1838 | Ga0495625_0358165 | |||
| 1839 | Ga0495625_0695993 | |||
| 1840 | Ga0495635_0000802 | |||
| 1841 | Ga0495659_0021517 | |||
| 1842 | Ga0495659_0059789 | |||
| 1843 | Ga0495659_0150488 | |||
| 1844 | Ga0495659_0512110 | |||
| 1845 | Ga0495661_0066273 | |||
| 1846 | Ga0495661_0069841 | |||
| 1847 | Ga0495588_0013908 | |||
| 1848 | Ga0495588_0035826 | |||
| 1849 | Ga0495588_0615626 | |||
| 1850 | Ga0495657_0002404 | |||
| 1851 | Ga0495657_0029407 | |||
| 1852 | Ga0495599_0019977 | |||
| 1853 | Ga0495599_0495678 | |||
| 1854 | Ga0495623_0002269 | |||
| 1855 | Ga0495647_0083452 | |||
| 1856 | Ga0495669_0021548 | |||
| 1857 | Ga0495669_0038661 | |||
| 1858 | Ga0495669_0067239 | |||
| 1859 | Ga0495613_0102632 | |||
| 1860 | Ga0495624_0110949 | |||
| 1861 | Ga0495624_0480375 | |||
| 1862 | Ga0495670_0026042 | |||
| 1863 | Ga0495649_0019021 | |||
| 1864 | Ga0495649_0130513 | |||
| 1865 | Ga0495649_0197727 | |||
| 1866 | Ga0495589_0277902 | |||
| 1867 | Ga0495589_0311943 | |||
| 1868 | Ga0495589_0338087 | |||
| 1869 | Ga0495589_0410466 | |||
| 1870 | Ga0495600_0003267 | |||
| 1871 | Ga0495600_0016450 | |||
| 1872 | Ga0495581_0039503 | |||
| 1873 | Ga0495581_0098788 | |||
| 1874 | Ga0495604_0000420 | |||
| 1875 | Ga0495604_0016406 | |||
| 1876 | Ga0495604_0305546 | |||
| 1877 | Ga0495604_0528485 | |||
| 1878 | Ga0495636_0364049 | |||
| 1879 | Ga0495674_0050231 | |||
| 1880 | Ga0495674_0519370 | |||
| 1881 | Ga0495672_0293264 | |||
| 1882 | Ga0495676_0020250 | |||
| 1883 | Ga0495676_0125668 | |||
| 1884 | Ga0495680_0001714 | |||
| 1885 | Ga0495680_0787681 | |||
| 1886 | Ga0495683_0207572 | |||
| 1887 | Ga0495683_0382543 | |||
| 1888 | Ga0495687_015494 | |||
| 1889 | Ga0495687_091254 | |||
| 1890 | Ga0495675_0078222 | |||
| 1891 | Ga0495677_0051520 | |||
| 1892 | Ga0495677_0096336 | |||
| 1893 | Ga0495685_026230 | |||
| 1894 | Ga0495673_0175865 | |||
| 1895 | Ga0495673_0266012 | |||
| 1896 | Ga0495684_0718322 | |||
| 1897 | Ga0495686_0393349 | |||
| 1898 | Ga0495602_0045327 | |||
| 1899 | Ga0495602_0361174 | |||
| 1900 | Ga0495615_0019659 | |||
| 1901 | Ga0495615_0329960 | |||
| 1902 | Ga0496100_0110992 | |||
| 1903 | Ga0496100_0519332 | |||
| 1904 | Ga0496100_0796568 | |||
| 1905 | Ga0496101_0532717 | |||
| 1906 | Ga0496101_0913439 | |||
| 1907 | Ga0496101_0954275 | |||
| 1908 | Ga0496102_0016889 | |||
| 1909 | Ga0496102_0058823 | |||
| 1910 | Ga0496102_0369010 | |||
| 1911 | Ga0496102_0406365 | |||
| 1912 | Ga0496103_0026103 | |||
| 1913 | Ga0496103_0211012 | |||
| 1914 | Ga0496103_0325780 | |||
| 1915 | Ga0496104_0004495 | |||
| 1916 | Ga0496104_0213685 | |||
| 1917 | Ga0496104_0389271 | |||
| 1918 | Ga0496105_0000450 | |||
| 1919 | Ga0496105_0159112 | |||
| 1920 | Ga0496105_0552093 | |||
| 1921 | Ga0496106_0001765 | |||
| 1922 | Ga0496106_0155935 | |||
| 1923 | Ga0496106_0178101 | |||
| 1924 | Ga0496106_0224327 | |||
| 1925 | Ga0496106_0615217 | |||
| 1926 | Ga0496106_0756664 | |||
| 1927 | Ga0496107_0146004 | |||
| 1928 | Ga0496107_0198028 | |||
| 1929 | Ga0496107_0249019 | |||
| 1930 | Ga0496107_0310916 | |||
| 1931 | Ga0496107_0363199 | |||
| 1932 | Ga0496108_0031474 | |||
| 1933 | Ga0496108_0083019 | |||
| 1934 | Ga0496108_0525779 | |||
| 1935 | Ga0496108_1244075 | |||
| 1936 | Ga0496109_0372705 | |||
| 1937 | Ga0496109_0517248 | |||
| 1938 | Ga0496110_0218896 | |||
| 1939 | Ga0496110_0501973 | |||
| 1940 | Ga0496110_1106724 | |||
| 1941 | Ga0496111_0304646 | |||
| 1942 | Ga0496112_0036617 | |||
| 1943 | Ga0496112_0235828 | |||
| 1944 | Ga0496113_0056733 | |||
| 1945 | Ga0496113_0057770 | |||
| 1946 | Ga0496113_1221636 | |||
| 1947 | Ga0496114_0014151 | |||
| 1948 | Ga0496114_0309860 | |||
| 1949 | Ga0496115_0368681 | |||
| 1950 | Ga0496116_0021451 | |||
| 1951 | Ga0496116_0181305 | |||
| 1952 | Ga0496116_0227967 | |||
| 1953 | Ga0496117_0009249 | |||
| 1954 | Ga0496117_0241781 | |||
| 1955 | Ga0496118_0010771 | |||
| 1956 | Ga0496118_0019813 | |||
| 1957 | Ga0496118_0121508 | |||
| 1958 | Ga0496118_0285017 | |||
| 1959 | Ga0496118_0631313 | |||
| 1960 | Ga0496119_0002327 | |||
| 1961 | Ga0496119_0019511 | |||
| 1962 | Ga0496119_0155572 | |||
| 1963 | Ga0496119_0271356 | |||
| 1964 | Ga0496119_0464475 | |||
| 1965 | Ga0496120_0013616 | |||
| 1966 | Ga0496120_0094719 | |||
| 1967 | Ga0496121_0000218 | |||
| 1968 | Ga0496121_0036054 | |||
| 1969 | Ga0496121_0059772 | |||
| 1970 | Ga0496121_0084438 | |||
| 1971 | Ga0496121_0085839 | |||
| 1972 | Ga0496121_0093040 | |||
| 1973 | Ga0496121_0158219 | |||
| 1974 | Ga0496121_0185671 | |||
| 1975 | Ga0496121_0343395 | |||
| 1976 | Ga0496121_0470250 | |||
| 1977 | Ga0496124_0001579 | |||
| 1978 | Ga0496124_0197564 | |||
| 1979 | Ga0496124_0238592 | |||
| 1980 | Ga0496124_0287818 | |||
| 1981 | Ga0496124_0472283 | |||
| 1982 | Ga0496125_0016330 | |||
| 1983 | Ga0496125_0040078 | |||
| 1984 | Ga0496125_0114617 | |||
| 1985 | Ga0496125_0258420 | |||
| 1986 | Ga0496126_0021157 | |||
| 1987 | Ga0496126_0050772 | |||
| 1988 | Ga0496126_0263474 | |||
| 1989 | Ga0496126_0452308 | |||
| 1990 | Ga0496126_0896951 | |||
| 1991 | Ga0495682_0273227 | |||
| 1992 | Ga0495682_0315231 | |||
| 1993 | Ga0501067_0192603 | |||
| 1994 | Ga0501069_0095952 | |||
| 1995 | Ga0501071_0626498 | |||
| 1996 | Ga0501081_0417058 | |||
| 1997 | nmdc:mga03683_26959_c1 | |||
| 1998 | nmdc:mga03n38_111245_c1 | |||
| 1999 | nmdc:mga03n38_321600_c1 | |||
| 2000 | nmdc:mga03n38_538479_c1 | |||
| 2001 | nmdc:mga00v17_234290_c1 | |||
| 2002 | nmdc:mga00v17_471885_c1 | |||
| 2003 | nmdc:mga00v17_8593_c1 | |||
| 2004 | nmdc:mga0yw44_241757_c1 | |||
| 2005 | nmdc:mga0yw44_507846_c1 | |||
| 2006 | nmdc:mga0yw44_74854_c1 | |||
| 2007 | nmdc:mga0k408_333468_c1 | |||
| 2008 | nmdc:mga0k408_48578_c1 | |||
| 2009 | nmdc:mga06z11_246755_c1 | |||
| 2010 | nmdc:mga06z11_47440_c1 | |||
| 2011 | nmdc:mga06z11_90175_c1 | |||
| 2012 | nmdc:mga04h51_129297_c1 | |||
| 2013 | nmdc:mga04h51_55158_c1 | |||
| 2014 | nmdc:mga07m45_265884_c1 | |||
| 2015 | nmdc:mga07m45_85220_c1 | |||
| 2016 | nmdc:mga05p37_1606391_c1 | |||
| 2017 | nmdc:mga08y16_1152388_c1 | |||
| 2018 | nmdc:mga08y16_168220_c1 | |||
| 2019 | nmdc:mga0n895_90315_c1 | |||
| 2020 | nmdc:mga0rr50_91695_c1 | |||
| 2021 | nmdc:mga0a205_11483_c1 | |||
| 2022 | nmdc:mga0a205_484773_c1 | |||
| 2023 | nmdc:mga0sz30_227651_c1 | |||
| 2024 | nmdc:mga0sz30_448206_c1 | |||
| 2025 | Ga0500610_0225658 | |||
| 2026 | Ga0500635_0162024 | |||
| 2027 | Ga0495595_0056594 | |||
| 2028 | Ga0500583_0151298 | |||
| 2029 | Ga0500566_0200001 | |||
| 2030 | Ga0500566_0488435 | |||
| 2031 | Ga0500640_076091 | |||
| 2032 | Ga0500641_0060693 | |||
| 2033 | Ga0500650_0117657 | |||
| 2034 | Ga0500650_0279891 | |||
| 2035 | Ga0500556_0098360 | |||
| 2036 | Ga0500569_006929 | |||
| 2037 | Ga0500572_025316 | |||
| 2038 | Ga0500594_0067539 | |||
| 2039 | Ga0500595_000781 | |||
| 2040 | Ga0500595_174302 | |||
| 2041 | Ga0500607_056108 | |||
| 2042 | Ga0500621_201440 | |||
| 2043 | Ga0500626_212931 | |||
| 2044 | Ga0500658_0144677 | |||
| 2045 | Ga0500559_0042173 | |||
| 2046 | Ga0500559_0051602 | |||
| 2047 | Ga0500568_0071365 | |||
| 2048 | Ga0500577_0402999 | |||
| 2049 | Ga0500588_0166520 | |||
| 2050 | Ga0500590_049823 | |||
| 2051 | Ga0500590_203985 | |||
| 2052 | Ga0500590_371381 | |||
| 2053 | Ga0500616_0029003 | |||
| 2054 | Ga0500619_130219 | |||
| 2055 | Ga0500624_007578 | |||
| 2056 | Ga0500627_0106212 | |||
| 2057 | Ga0500634_0215329 | |||
| 2058 | Ga0500634_0224958 | |||
| 2059 | Ga0500638_184129 | |||
| 2060 | Ga0500638_332306 | |||
| 2061 | Ga0500636_0000160 | |||
| 2062 | Ga0500637_0061113 | |||
| 2063 | Ga0500637_0388736 | |||
| 2064 | Ga0500637_0396660 | |||
| 2065 | Ga0500649_195563 | |||
| 2066 | Ga0500657_208816 | |||
| 2067 | Ga0500609_015225 | |||
| 2068 | Ga0500596_009479 | |||
| 2069 | Ga0500596_054490 | |||
| 2070 | Ga0500599_000996 | |||
| 2071 | Ga0500601_000253 | |||
| 2072 | Ga0500661_016452 | |||
| 2073 | Ga0500661_031259 | |||
| 2074 | Ga0587086_097612 | |||
| 2075 | Ga0587079_046617 | |||
| 2076 | 2507510734 | |||
| 2077 | 2508544534 | |||
| 2078 | 2511398701 | |||
| 2079 | 2513643094 | |||
| 2080 | 2513721181 | |||
| 2081 | 2513877886 | |||
| 2082 | 2514016261 | |||
| 2083 | 2515627985 | |||
| 2084 | 2517105108 | |||
| 2085 | 2528854294 | |||
| 2086 | 2617353765 | |||
| 2087 | 2617378832 | |||
| 2088 | 2818242613 | |||
| 2089 | 2824601885 | |||
| 2090 | 2824612801 | |||
| 2091 | 2824653220 | |||
| 2092 | 2824662562 | |||
| 2093 | 2824673415 | |||
| 2094 | 2824680994 | |||
| 2095 | 2824689543 | |||
| 2096 | 2824697324 | |||
| 2097 | 2824707893 | |||
| 2098 | 2824734676 | |||
| 2099 | 2824747806 | |||
| 2100 | 2824759015 | |||
| 2101 | 2824763921 | |||
| 2102 | 2838125258 | |||
| 2103 | 2841948605 | |||
| 2104 | 2841951501 | |||
| 2105 | 2841960503 | |||
| 2106 | 2841968483 | |||
| 2107 | 2841976317 | |||
| 2108 | 2841987679 | |||
| 2109 | 2844317181 | |||
| 2110 | 2847933875 | |||
| 2111 | 2847944551 | |||
| 2112 | 2874592313 | |||
| 2113 | 2874634591 | |||
| 2114 | 2874650080 | |||
| 2115 | 2876775391 | |||
| 2116 | 2876826256 | |||
| 2117 | 2879079521 | |||
| 2118 | 2879087405 | |||
| 2119 | 2879109628 | |||
| 2120 | 2879132232 | |||
| 2121 | 2879146881 | |||
| 2122 | 2885367288 | |||
| 2123 | 2885418434 | |||
| 2124 | 2888381869 | |||
| 2125 | 2888388769 | |||
| 2126 | 2888422490 | |||
| 2127 | 2903735165 | |||
| 2128 | 2904720495 | |||
| 2129 | 2906607220 | |||
| 2130 | 2906643819 | |||
| 2131 | 2908778122 | |||
| 2132 | 2922371820 | |||
| 2133 | 2922389281 | |||
| 2134 | 2922399472 | |||
| 2135 | 2929616830 | |||
| 2136 | 2929625573 | |||
| 2137 | 2932791146 | |||
| 2138 | 2932799197 | |||
| 2139 | 2932803808 | |||
| 2140 | 2932811671 | |||
| 2141 | 2932826613 | |||
| 2142 | 2932834241 | |||
| 2143 | 2933577888 | |||
| 2144 | 2935616088 | |||
| 2145 | 2935623937 | |||
| 2146 | 2935646935 | |||
| 2147 | 2935654894 | |||
| 2148 | 2935663836 | |||
| 2149 | 2935674085 | |||
| 2150 | 2935684724 | |||
| 2151 | 2935691578 | |||
| 2152 | 2935699453 | |||
| 2153 | 2935707680 | |||
| 2154 | 2935719412 | |||
| 2155 | 2935728988 | |||
| 2156 | 2935737771 | |||
| 2157 | 2935747147 | |||
| 2158 | 2935758053 | |||
| 2159 | 2935766689 | |||
| 2160 | 2935770680 | |||
| 2161 | 2935782913 | |||
| 2162 | 2935787034 | |||
| 2163 | 2935795082 | |||
| 2164 | 2935809298 | |||
| 2165 | 2935817811 | |||
| 2166 | 2935819984 | |||
| 2167 | 2935836250 | |||
| 2168 | 2935845159 | |||
| 2169 | 2935850006 | |||
| 2170 | 2935862213 | |||
| 2171 | 2935870860 | |||
| 2172 | 2935881253 | |||
| 2173 | 2935884314 | |||
| 2174 | 2935915159 | |||
| 2175 | 2935923836 | |||
| 2176 | 2935932656 | |||
| 2177 | 2935941260 | |||
| 2178 | 2935949326 | |||
| 2179 | 2935958021 | |||
| 2180 | 2935963771 | |||
| 2181 | 2935974337 | |||
| 2182 | 2935979527 | |||
| 2183 | 2935991612 | |||
| 2184 | 2935999155 | |||
| 2185 | 2936005576 | |||
| 2186 | 2936017992 | |||
| 2187 | 2936026495 | |||
| 2188 | 2936035098 | |||
| 2189 | 2936042104 | |||
| 2190 | 2936053248 | |||
| 2191 | 2936059231 | |||
| 2192 | 2940564036 | |||
| 2193 | 2941535026 | |||
| 2194 | 2941545488 | |||
| 2195 | 3005508201 | |||
| 2196 | 3005596883 | |||
| 2197 | 3005720288 | |||
| 2198 | 8006966418 | |||
| 2199 | 8016515869 | |||
| 2200 | 8016523412 | |||
| 2201 | 8016541182 | |||
| 2202 | 8016552070 | |||
| 2203 | 8016560448 | |||
| 2204 | 8016566573 | |||
| 2205 | 8016589882 | |||
| 2206 | 8016598350 | |||
| 2207 | 8016604451 | |||
| 2208 | 8016621030 | |||
| 2209 | 8016628974 | |||
| 2210 | 8016633549 | |||
| 2211 | 8017060642 | |||
| 2212 | 8019536613 | |||
| 2213 | 8019542848 | |||
| 2214 | 8019547898 | |||
| 2215 | 8019580154 | |||
| 2216 | 8019587873 | |||
| 2217 | 8019603454 | |||
| 2218 | 8019615073 | |||
| 2219 | 8019625627 | |||
| 2220 | 8019636663 | |||
| 2221 | 8019642962 | |||
| 2222 | 8019664464 | |||
| 2223 | 8019674056 | |||
| 2224 | 8019682068 | |||
| 2225 | 8019693527 | |||
| 2226 | 8055748476 | |||
| 2227 | 8056678277 | |||
| 2228 | 8056976278 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d0w-assembly2.cif.gz_B | crystal structure of cytochrome cl from hyphomicrobium denitrificans | 0.7852 | 38 | 112 |
| 7c90-assembly1.cif.gz_C | crystal structure of cytochrome cl from the marine methylotrophic bacterium methylophaga aminisulfidivorans mpt (ma-cytcl) | 0.7654 | 39 | 114 |
| 7c90-assembly1.cif.gz_D | crystal structure of cytochrome cl from the marine methylotrophic bacterium methylophaga aminisulfidivorans mpt (ma-cytcl) | 0.7639 | 41 | 114 |
| 1yiq-assembly1.cif.gz_A | molecular cloning and structural analysis of quinohemoprotein alcohol dehydrogenase adhiig from pseudomonas putida hk5. compariison to the other quinohemoprotein alcohol dehydrogenase adhiib found in the same microorganism. | 0.7616 | 39 | 115 |
| 5mxy-assembly1.cif.gz_A | kustc0563 c-type cytochrome | 0.7451 | 45 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d0wB00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7852 | 38 | 112 | 1.10.760.10 |
| 1yiqA02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.764 | 39 | 115 | 1.10.760.10 |
| 1kv9A02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.724 | 41 | 115 | 1.10.760.10 |
| 1n15B01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7145 | 40 | 113 | 1.10.760.10 |
| 4eifA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7126 | 44 | 115 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y8UIS6-F1-model_v4 | deleted | 0.8533 | 30 | 118 |
|
| AF-A0A537N7Y1-F1-model_v4 | Cytochrome c | 0.8311 | 33 | 114 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A1Q3WW55-F1-model_v4 | Cytochrome c domain-containing protein | 0.827 | 32 | 118 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-E8X6B0-F1-model_v4 | Cytochrome c class I | 0.8252 | 33 | 117 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A537V2L3-F1-model_v4 | Cytochrome c | 0.824 | 27 | 114 |
GO:0009055
GO:0020037 GO:0046872 |