F490273

General Info

Members Datasets Scaffolds Average Seq Length
1114 596 2228 109

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100000750|Ga0068860_10000075030
Length 120
Sequence VIRKLSIWTAAHFAAVAVFVMVLAIAQTATPSAAQQPAASDPRIDQGKVTYAQKCSHCHGPNMLNAGTITPDLRTFPDDRDRFTTTVKLGKNNRMPPWADLLSDDEIADLWAFVSSRRNP

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
137 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
138 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
139 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
143 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
211 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
212 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
213 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
219 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
227 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
228 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
229 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
233 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
234 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
235 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
238 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
239 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
243 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
244 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
245 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
246 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
247 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
261 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
262 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
263 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
264 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
265 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
266 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
267 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
268 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
269 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
270 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
271 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
272 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
273 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
276 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
277 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
278 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
279 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
285 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
291 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
294 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
295 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
296 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
297 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
298 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
299 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
300 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
301 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
302 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
305 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
306 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
307 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
308 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
309 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
310 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
311 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
312 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
313 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
314 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
315 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
316 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
317 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
318 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
319 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
320 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
321 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
322 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
323 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
324 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
325 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
326 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
327 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
330 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
331 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
332 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
333 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
334 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
335 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
336 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
337 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
338 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
339 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
340 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
341 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
342 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
347 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
348 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
349 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
350 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
351 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
352 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
353 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
354 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
355 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
356 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
357 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
358 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
378 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
379 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
380 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
381 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
382 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
383 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
384 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
385 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
386 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
387 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
388 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
389 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
390 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
391 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
392 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
393 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
394 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
395 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
396 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
397 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
398 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
399 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
400 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
401 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
402 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
403 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
404 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
405 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
406 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
407 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
408 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
409 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
410 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
411 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
412 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
413 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
414 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
415 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
416 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
417 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
418 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
419 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
420 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
421 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
422 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
423 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
424 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
425 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
426 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
427 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
428 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
429 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
430 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
431 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
432 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
433 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
434 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
435 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
436 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
437 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
438 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
439 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
440 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
441 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
442 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
445 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
446 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
447 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
448 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
449 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
450 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
451 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
452 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
453 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
454 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
455 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
456 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
457 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
458 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
459 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
460 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
461 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
462 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
463 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
464 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
465 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
466 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
467 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
468 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
469 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
470 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
471 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
472 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
473 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
474 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
475 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
476 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
477 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
478 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
479 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
480 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
481 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
482 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
483 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
484 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
485 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
486 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
487 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
488 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
489 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
490 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
491 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
492 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
493 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
494 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
495 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
496 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
497 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
498 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
499 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
500 2922368715
501 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
502 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
503 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
504 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
505 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
506 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
507 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
508 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
509 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
510 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
511 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
512 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
513 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
514 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
515 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
516 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
517 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
518 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
519 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
520 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
521 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
522 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
523 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
524 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
525 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
526 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
527 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
528 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
529 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
530 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
531 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
532 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
533 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
534 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
535 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
536 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
537 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
538 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
539 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
540 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
541 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
542 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
543 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
544 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
545 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
546 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
547 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
548 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
549 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
550 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
551 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
552 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
553 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
554 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
555 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
556 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
557 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
558 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
559 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
560 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
561 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
562 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
563 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
564 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
565 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
566 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
567 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
568 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
569 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
570 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
571 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
572 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
573 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
574 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
575 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
576 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
577 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
578 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
579 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
580 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
581 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
582 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
583 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
584 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
585 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
586 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
587 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
588 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
589 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
590 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
591 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
592 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
593 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
594 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
595 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
596 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.98
Metatranscriptomes 0.36
Isolates 13.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.95
Nodule 11.67
Rhizoplane 4.67
Rhizosphere 63.73
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100000750 3300005843 Bacteria 36885
2 JGI24739J22299_10174530 3300001989 Bacteria 633
3 JGI24750J21931_1073513 3300002070 Bacteria 561
4 JGI25153J46596_10000843 3300003215 Bacteria 18762
5 JGI25153J46596_10021234 3300003215 Bacteria 2425
6 rootL2_10055505 3300003322 Bacteria 1178
7 rootH1_10060569 3300003323 Bacteria 1144
8 JGI25160J50197_1026031 3300003354 Bacteria 1621
9 JGI25404J52841_10001353 3300003659 Bacteria 4278
10 JGI25404J52841_10004360 3300003659 Bacteria 2861
11 Ga0055528_1082334 3300003790 Bacteria 563
12 Ga0055543_1020090 3300004625 Bacteria 1230
13 Ga0065165_1038053 3300005262 Bacteria 1453
14 Ga0065165_1038358 3300005262 Bacteria 1445
15 Ga0070658_10107170 3300005327 Bacteria 2312
16 Ga0070658_10553576 3300005327 Bacteria 995
17 Ga0070676_10025880 3300005328 Bacteria 3320
18 Ga0070676_10338105 3300005328 Bacteria 1032
19 Ga0070683_100023716 3300005329 Bacteria 5491
20 Ga0070683_100876709 3300005329 Bacteria 861
21 Ga0070690_100884968 3300005330 Bacteria 698
22 Ga0070690_101055014 3300005330 Bacteria 643
23 Ga0070670_100250549 3300005331 Bacteria 1543
24 Ga0068869_100121583 3300005334 Bacteria 1997
25 Ga0068869_100267459 3300005334 Bacteria 1371
26 Ga0068869_100426135 3300005334 Bacteria 1095
27 Ga0070666_10291684 3300005335 Bacteria 1161
28 Ga0070666_10827191 3300005335 Bacteria 683
29 Ga0070680_100004777 3300005336 Bacteria 10200
30 Ga0070680_100543344 3300005336 Bacteria 996
31 Ga0070682_100031944 3300005337 Bacteria 3188
32 Ga0070682_100437133 3300005337 Bacteria 999
33 Ga0070682_100695615 3300005337 Bacteria 815
34 Ga0068868_100141581 3300005338 Bacteria 1974
35 Ga0068868_100621024 3300005338 Bacteria 959
36 Ga0070660_100498857 3300005339 Bacteria 1012
37 Ga0070660_101522759 3300005339 Bacteria 569
38 Ga0070689_100700055 3300005340 Bacteria 885
39 Ga0070687_100402922 3300005343 Bacteria 898
40 Ga0070661_100156504 3300005344 Bacteria 1724
41 Ga0070661_100799065 3300005344 Bacteria 774
42 Ga0070692_10376038 3300005345 Bacteria 890
43 Ga0070692_10676437 3300005345 Bacteria 692
44 Ga0070668_100055099 3300005347 Bacteria 3068
45 Ga0070668_100084489 3300005347 Bacteria 2493
46 Ga0070668_100252158 3300005347 Bacteria 1465
47 Ga0070668_100257843 3300005347 Bacteria 1449
48 Ga0070668_100754749 3300005347 Bacteria 861
49 Ga0070668_100986344 3300005347 Bacteria 757
50 Ga0070668_101716920 3300005347 Bacteria 576
51 Ga0070669_100304580 3300005353 Bacteria 1282
52 Ga0070669_100335148 3300005353 Bacteria 1224
53 Ga0070675_101822876 3300005354 Bacteria 561
54 Ga0070671_100015685 3300005355 Bacteria 6123
55 Ga0070671_100535186 3300005355 Bacteria 1010
56 Ga0070671_100610857 3300005355 Bacteria 943
57 Ga0070671_100669016 3300005355 Bacteria 900
58 Ga0070674_100132979 3300005356 Bacteria 1857
59 Ga0070674_100162288 3300005356 Bacteria 1696
60 Ga0070674_100502260 3300005356 Bacteria 1010
61 Ga0070673_100207106 3300005364 Bacteria 1692
62 Ga0070688_100670027 3300005365 Bacteria 801
63 Ga0070659_100332715 3300005366 Bacteria 1271
64 Ga0070667_100189101 3300005367 Bacteria 1823
65 Ga0070667_100379012 3300005367 Bacteria 1285
66 Ga0070667_100381448 3300005367 Bacteria 1280
67 Ga0070703_10028631 3300005406 Bacteria 1667
68 Ga0070701_10124376 3300005438 Bacteria 1457
69 Ga0070711_100600866 3300005439 Bacteria 918
70 Ga0070711_101418067 3300005439 Bacteria 605
71 Ga0070705_100880836 3300005440 Bacteria 719
72 Ga0070700_100040996 3300005441 Bacteria 2837
73 Ga0070700_100246793 3300005441 Bacteria 1279
74 Ga0070700_100559845 3300005441 Bacteria 889
75 Ga0070700_100830728 3300005441 Bacteria 746
76 Ga0070700_100913979 3300005441 Bacteria 715
77 Ga0070694_100413650 3300005444 Bacteria 1058
78 Ga0070663_100009162 3300005455 Bacteria 6119
79 Ga0070663_100246854 3300005455 Bacteria 1411
80 Ga0070663_100465253 3300005455 Bacteria 1045
81 Ga0070663_100508816 3300005455 Bacteria 1001
82 Ga0070663_100667781 3300005455 Bacteria 881
83 Ga0070663_101087753 3300005455 Bacteria 698
84 Ga0070678_100021931 3300005456 Bacteria 4221
85 Ga0070678_100221283 3300005456 Bacteria 1574
86 Ga0070678_100779224 3300005456 Bacteria 867
87 Ga0070678_101145000 3300005456 Bacteria 720
88 Ga0070662_100142055 3300005457 Bacteria 1861
89 Ga0070662_100294048 3300005457 Bacteria 1317
90 Ga0070662_100430657 3300005457 Bacteria 1093
91 Ga0070681_10469658 3300005458 Bacteria 1170
92 Ga0068867_100048504 3300005459 Bacteria 3124
93 Ga0068867_100138539 3300005459 Bacteria 1900
94 Ga0068867_100525795 3300005459 Bacteria 1021
95 Ga0070685_10160444 3300005466 Bacteria 1433
96 Ga0070685_10274246 3300005466 Bacteria 1127
97 Ga0070685_10693705 3300005466 Bacteria 742
98 Ga0070698_100126600 3300005471 Bacteria 2511
99 Ga0070699_101350453 3300005518 Bacteria 654
100 Ga0070684_100016830 3300005535 Bacteria 5988
101 Ga0070684_101467372 3300005535 Bacteria 643
102 Ga0068853_100214742 3300005539 Bacteria 1754
103 Ga0068853_101783340 3300005539 Bacteria 597
104 Ga0070672_100174547 3300005543 Bacteria 1789
105 Ga0070672_100380821 3300005543 Bacteria 1207
106 Ga0070672_101009408 3300005543 Bacteria 737
107 Ga0070686_100050955 3300005544 Bacteria 2633
108 Ga0070695_101105884 3300005545 Bacteria 649
109 Ga0070696_100941657 3300005546 Bacteria 718
110 Ga0070693_100149081 3300005547 Bacteria 1480
111 Ga0070693_100496949 3300005547 Bacteria 864
112 Ga0070665_100029422 3300005548 Bacteria 5529
113 Ga0070665_100030432 3300005548 Bacteria 5431
114 Ga0070665_100195114 3300005548 Bacteria 2025
115 Ga0070665_100217409 3300005548 Bacteria 1911
116 Ga0070665_100226356 3300005548 Bacteria 1870
117 Ga0070665_100748299 3300005548 Bacteria 990
118 Ga0070665_100839117 3300005548 Bacteria 932
119 Ga0070704_101907666 3300005549 Bacteria 551
120 Ga0068855_100088885 3300005563 Bacteria 3568
121 Ga0068855_100102387 3300005563 Bacteria 3296
122 Ga0068857_100238698 3300005577 Bacteria 1664
123 Ga0068857_100498259 3300005577 Bacteria 1143
124 Ga0068857_101152947 3300005577 Bacteria 749
125 Ga0068854_100104129 3300005578 Bacteria 2131
126 Ga0068854_100171858 3300005578 Bacteria 1687
127 Ga0068854_100817197 3300005578 Bacteria 814
128 Ga0068856_100007648 3300005614 Bacteria 10544
129 Ga0068856_100139603 3300005614 Bacteria 2430
130 Ga0068856_101282933 3300005614 Bacteria 748
131 Ga0068856_101346862 3300005614 Bacteria 729
132 Ga0070702_100076314 3300005615 Bacteria 1994
133 Ga0070702_100137210 3300005615 Bacteria 1553
134 Ga0070702_100521353 3300005615 Bacteria 876
135 Ga0070702_100556064 3300005615 Bacteria 853
136 Ga0068852_100231763 3300005616 Bacteria 1760
137 Ga0068852_100465069 3300005616 Bacteria 1254
138 Ga0068852_101863612 3300005616 Bacteria 624
139 Ga0068859_100766262 3300005617 Bacteria 1053
140 Ga0068864_100080457 3300005618 Bacteria 2854
141 Ga0068864_100336155 3300005618 Bacteria 1422
142 Ga0068864_100713276 3300005618 Bacteria 980
143 Ga0068866_10060197 3300005718 Bacteria 1967
144 Ga0068866_10220698 3300005718 Bacteria 1143
145 Ga0068861_100033062 3300005719 Bacteria 3813
146 Ga0068861_100148087 3300005719 Bacteria 1923
147 Ga0068861_100153790 3300005719 Bacteria 1890
148 Ga0068861_100164450 3300005719 Bacteria 1833
149 Ga0068861_100263513 3300005719 Bacteria 1476
150 Ga0068861_100494476 3300005719 Bacteria 1104
151 Ga0068861_100676157 3300005719 Bacteria 956
152 Ga0068851_10175090 3300005834 Bacteria 1186
153 Ga0068851_10357824 3300005834 Bacteria 851
154 Ga0068870_10066579 3300005840 Bacteria 1952
155 Ga0068870_10519275 3300005840 Bacteria 797
156 Ga0068870_10892336 3300005840 Bacteria 627
157 Ga0068870_10959185 3300005840 Bacteria 608
158 Ga0068863_100314915 3300005841 Bacteria 1519
159 Ga0068863_100392291 3300005841 Bacteria 1357
160 Ga0068863_100404399 3300005841 Bacteria 1336
161 Ga0068863_100564274 3300005841 Bacteria 1125
162 Ga0068863_102493045 3300005841 Bacteria 526
163 Ga0068858_100048903 3300005842 Bacteria 3916
164 Ga0068858_100397065 3300005842 Bacteria 1325
165 Ga0068858_100461786 3300005842 Bacteria 1224
166 Ga0068858_100718171 3300005842 Bacteria 973
167 Ga0068858_100999822 3300005842 Bacteria 819
168 Ga0068858_101207399 3300005842 Bacteria 743
169 Ga0068858_101242402 3300005842 Bacteria 733
170 Ga0068860_100086071 3300005843 Bacteria 2990
171 Ga0068860_100150847 3300005843 Bacteria 2238
172 Ga0068860_100353972 3300005843 Bacteria 1445
173 Ga0068860_100492909 3300005843 Bacteria 1222
174 Ga0068860_100834988 3300005843 Bacteria 936
175 Ga0068860_100956299 3300005843 Bacteria 874
176 Ga0068862_100077665 3300005844 Bacteria 2875
177 Ga0068862_100766978 3300005844 Bacteria 939
178 Ga0068862_101014097 3300005844 Bacteria 821
179 Ga0081455_10109710 3300005937 Bacteria 2196
180 Ga0081455_10230722 3300005937 Bacteria 1366
181 Ga0081455_10690504 3300005937 Bacteria 652
182 Ga0081538_10043620 3300005981 Bacteria 2812
183 Ga0081540_1007986 3300005983 Bacteria 7452
184 Ga0081540_1008303 3300005983 Bacteria 7267
185 Ga0081540_1010128 3300005983 Bacteria 6417
186 Ga0081540_1139209 3300005983 Bacteria 977
187 Ga0081539_10037212 3300005985 Bacteria 2901
188 Ga0070717_10911795 3300006028 Bacteria 800
189 Ga0070717_11769401 3300006028 Bacteria 559
190 Ga0075365_10099467 3300006038 Bacteria 1990
191 Ga0075365_10182715 3300006038 Bacteria 1466
192 Ga0075368_10085864 3300006042 Bacteria 1284
193 Ga0075368_10093095 3300006042 Bacteria 1233
194 Ga0075368_10093219 3300006042 Bacteria 1233
195 Ga0075363_100061563 3300006048 Bacteria 2023
196 Ga0075363_100697926 3300006048 Bacteria 613
197 Ga0075364_10141851 3300006051 Bacteria 1616
198 Ga0075364_10222313 3300006051 Bacteria 1282
199 Ga0075364_11087969 3300006051 Bacteria 543
200 Ga0075432_10029052 3300006058 Bacteria 1908
201 Ga0070715_10642989 3300006163 Bacteria 627
202 Ga0070712_101772162 3300006175 Bacteria 541
203 Ga0075362_10162900 3300006177 Bacteria 1075
204 Ga0075362_10167615 3300006177 Bacteria 1060
205 Ga0075362_10459219 3300006177 Bacteria 648
206 Ga0075367_10126989 3300006178 Bacteria 1574
207 Ga0075367_10149598 3300006178 Bacteria 1448
208 Ga0075367_10222054 3300006178 Bacteria 1182
209 Ga0075367_10392288 3300006178 Bacteria 878
210 Ga0075369_10019837 3300006186 Bacteria 2748
211 Ga0075369_10046941 3300006186 Bacteria 1861
212 Ga0075369_10170822 3300006186 Bacteria 998
213 Ga0075369_10382273 3300006186 Bacteria 663
214 Ga0075366_10075614 3300006195 Bacteria 2009
215 Ga0075366_10484225 3300006195 Bacteria 764
216 Ga0075366_10505068 3300006195 Bacteria 748
217 Ga0097621_100526415 3300006237 Bacteria 1074
218 Ga0097621_100763233 3300006237 Bacteria 894
219 Ga0097621_102252735 3300006237 Bacteria 521
220 Ga0075370_10201049 3300006353 Bacteria 1175
221 Ga0075370_10371090 3300006353 Bacteria 856
222 Ga0068871_100199476 3300006358 Bacteria 1727
223 Ga0068871_100591327 3300006358 Bacteria 1008
224 Ga0068871_100995393 3300006358 Bacteria 780
225 Ga0068871_101916123 3300006358 Bacteria 563
226 Ga0075428_100818139 3300006844 Bacteria 990
227 Ga0075430_101069197 3300006846 Bacteria 665
228 Ga0075433_10013684 3300006852 Bacteria 6606
229 Ga0075433_10566706 3300006852 Bacteria 998
230 Ga0075434_100034640 3300006871 Bacteria 4987
231 Ga0075429_101656210 3300006880 Bacteria 556
232 Ga0068865_100131258 3300006881 Bacteria 1877
233 Ga0097620_100212218 3300006931 Bacteria 2022
234 Ga0097620_100766282 3300006931 Bacteria 1053
235 Ga0099825_1019614 3300006941 Bacteria 5000
236 Ga0075435_100413813 3300007076 Bacteria 1161
237 Ga0075435_101383387 3300007076 Bacteria 617
238 Ga0105251_10637227 3300009011 Bacteria 509
239 Ga0105250_10108560 3300009092 Bacteria 1135
240 Ga0105250_10290180 3300009092 Bacteria 705
241 Ga0105240_10004507 3300009093 Bacteria 21175
242 Ga0105240_10545640 3300009093 Bacteria 1283
243 Ga0111539_10180571 3300009094 Bacteria 2465
244 Ga0111539_10305309 3300009094 Bacteria 1852
245 Ga0111539_11715413 3300009094 Bacteria 728
246 Ga0105245_10081822 3300009098 Bacteria 2953
247 Ga0105245_10263703 3300009098 Bacteria 1677
248 Ga0105245_11638310 3300009098 Bacteria 695
249 Ga0105245_12061105 3300009098 Bacteria 624
250 Ga0105245_12155643 3300009098 Bacteria 611
251 Ga0105247_10251934 3300009101 Bacteria 1207
252 Ga0105247_10442116 3300009101 Bacteria 935
253 Ga0105247_10899207 3300009101 Unclassified 684
254 Ga0114129_10336223 3300009147 Bacteria 2004
255 Ga0105243_10023215 3300009148 Bacteria 4721
256 Ga0105243_10229227 3300009148 Bacteria 1647
257 Ga0105243_11888124 3300009148 Bacteria 630
258 Ga0105243_12654867 3300009148 Bacteria 541
259 Ga0105241_10025959 3300009174 Bacteria 4357
260 Ga0105241_10207196 3300009174 Bacteria 1641
261 Ga0105241_10218818 3300009174 Bacteria 1599
262 Ga0105241_10400965 3300009174 Bacteria 1203
263 Ga0105241_10624340 3300009174 Bacteria 976
264 Ga0105241_10935976 3300009174 Bacteria 807
265 Ga0105242_10282942 3300009176 Bacteria 1507
266 Ga0105242_12384550 3300009176 Bacteria 576
267 Ga0105248_10110058 3300009177 Bacteria 3106
268 Ga0105248_10124986 3300009177 Bacteria 2902
269 Ga0105248_12416744 3300009177 Bacteria 599
270 Ga0105248_12431553 3300009177 Bacteria 597
271 Ga0105237_10011480 3300009545 Bacteria 9372
272 Ga0105237_10073042 3300009545 Bacteria 3423
273 Ga0105237_10177502 3300009545 Bacteria 2130
274 Ga0105238_10145174 3300009551 Bacteria 2349
275 Ga0105238_10433183 3300009551 Bacteria 1311
276 Ga0105238_10454349 3300009551 Bacteria 1278
277 Ga0105238_10553048 3300009551 Bacteria 1155
278 Ga0105238_12102871 3300009551 Bacteria 599
279 Ga0105249_10194003 3300009553 Bacteria 1984
280 Ga0105249_10283008 3300009553 Bacteria 1657
281 Ga0105249_10811517 3300009553 Bacteria 1000
282 Ga0105249_10921351 3300009553 Bacteria 941
283 Ga0105249_12084693 3300009553 Bacteria 640
284 Ga0105239_10065781 3300010375 Bacteria 3982
285 Ga0105239_10131251 3300010375 Bacteria 2787
286 Ga0105239_10184048 3300010375 Bacteria 2337
287 Ga0105239_10550402 3300010375 Bacteria 1314
288 Ga0105239_10595403 3300010375 Bacteria 1261
289 Ga0105239_10653309 3300010375 Bacteria 1201
290 Ga0105239_11068166 3300010375 Bacteria 929
291 Ga0105239_11215918 3300010375 Bacteria 868
292 Ga0105246_10100197 3300011119 Bacteria 2107
293 Ga0105246_10836084 3300011119 Bacteria 820
294 Ga0105246_11356407 3300011119 Bacteria 661
295 Ga0105246_12245218 3300011119 Bacteria 532
296 Ga0157314_1019146 3300012500 Bacteria 682
297 Ga0157371_11530784 3300013102 Bacteria 521
298 Ga0157370_11611522 3300013104 Bacteria 583
299 Ga0157369_10084765 3300013105 Bacteria 3386
300 Ga0157369_10912182 3300013105 Bacteria 901
301 Ga0157374_11143790 3300013296 Bacteria 799
302 Ga0157374_11292578 3300013296 Bacteria 751
303 Ga0157374_11528414 3300013296 Bacteria 691
304 Ga0157374_11717939 3300013296 Bacteria 652
305 Ga0157378_10033626 3300013297 Bacteria 4534
306 Ga0157378_10412529 3300013297 Bacteria 1333
307 Ga0163162_10134241 3300013306 Bacteria 2585
308 Ga0163162_10308160 3300013306 Bacteria 1716
309 Ga0163162_10450553 3300013306 Bacteria 1419
310 Ga0163162_11906468 3300013306 Bacteria 680
311 Ga0157372_10267332 3300013307 Bacteria 1986
312 Ga0157372_10623061 3300013307 Bacteria 1257
313 Ga0157375_10354662 3300013308 Bacteria 1633
314 Ga0157375_10526432 3300013308 Bacteria 1345
315 Ga0157375_11794801 3300013308 Bacteria 727
316 Ga0163163_10087935 3300014325 Bacteria 3118
317 Ga0163163_10590413 3300014325 Bacteria 1174
318 Ga0163163_11097196 3300014325 Bacteria 859
319 Ga0157380_10141244 3300014326 Bacteria 2069
320 Ga0157380_10476978 3300014326 Bacteria 1205
321 Ga0157380_10628878 3300014326 Bacteria 1067
322 Ga0157380_10678003 3300014326 Bacteria 1032
323 Ga0157377_10081157 3300014745 Bacteria 1896
324 Ga0157377_10858488 3300014745 Bacteria 675
325 Ga0157379_10508380 3300014968 Bacteria 1117
326 Ga0157379_10605933 3300014968 Bacteria 1023
327 Ga0157379_10730083 3300014968 Bacteria 931
328 Ga0157379_11173454 3300014968 Bacteria 738
329 Ga0157376_10211162 3300014969 Bacteria 1792
330 Ga0157376_10292146 3300014969 Bacteria 1539
331 Ga0157376_10471476 3300014969 Bacteria 1228
332 Ga0157376_11116764 3300014969 Bacteria 814
333 Ga0182007_10035964 3300015262 Bacteria 1668
334 Ga0163161_10023451 3300017792 Bacteria 4353
335 Ga0163161_10735540 3300017792 Bacteria 824
336 Ga0163161_10929358 3300017792 Bacteria 739
337 Ga0163161_11614981 3300017792 Bacteria 572
338 Ga0206356_11821617 3300020070 Bacteria 885
339 Ga0206353_11062936 3300020082 Bacteria 1232
340 Ga0214544_1000013 3300021320 Bacteria 228947
341 Ga0214542_1000013 3300021321 Bacteria 234019
342 Ga0214545_1000012 3300021324 Bacteria 187898
343 Ga0214543_1000065 3300021327 Bacteria 126516
344 Ga0213876_10021294 3300021384 Bacteria 3429
345 Ga0209563_115804 3300025230 Bacteria 940
346 Ga0209026_1060825 3300025250 Bacteria 531
347 Ga0209677_110702 3300025253 Bacteria 1499
348 Ga0209148_1000319 3300025254 Bacteria 67129
349 Ga0209148_1024638 3300025254 Bacteria 948
350 Ga0209233_1004008 3300025261 Bacteria 5102
351 Ga0209233_1068717 3300025261 Bacteria 662
352 Ga0209455_1003084 3300025272 Bacteria 6083
353 Ga0209455_1020243 3300025272 Bacteria 1321
354 Ga0209673_1038344 3300025273 Bacteria 1396
355 Ga0209564_1004362 3300025295 Bacteria 8702
356 Ga0209758_1001334 3300025297 Bacteria 29905
357 Ga0209758_1001430 3300025297 Bacteria 28210
358 Ga0209758_1010151 3300025297 Bacteria 5694
359 Ga0209758_1060114 3300025297 Bacteria 1260
360 Ga0209256_1016536 3300025299 Bacteria 2506
361 Ga0207426_1019126 3300025302 Bacteria 2400
362 Ga0207426_1040571 3300025302 Bacteria 1449
363 Ga0207697_10042628 3300025315 Bacteria 1865
364 Ga0207697_10088841 3300025315 Bacteria 1308
365 Ga0207697_10344185 3300025315 Bacteria 662
366 Ga0207656_10032151 3300025321 Bacteria 2178
367 Ga0207696_1036713 3300025711 Bacteria 1454
368 Ga0207682_10283300 3300025893 Bacteria 775
369 Ga0207710_10091825 3300025900 Bacteria 1422
370 Ga0207710_10238009 3300025900 Bacteria 908
371 Ga0207710_10245697 3300025900 Bacteria 894
372 Ga0207688_10014273 3300025901 Bacteria 4322
373 Ga0207688_10020081 3300025901 Bacteria 3645
374 Ga0207680_10120789 3300025903 Bacteria 1713
375 Ga0207680_10206093 3300025903 Bacteria 1342
376 Ga0207680_10590501 3300025903 Bacteria 794
377 Ga0207647_10001937 3300025904 Bacteria 15820
378 Ga0207647_10070938 3300025904 Bacteria 2103
379 Ga0207685_10186238 3300025905 Bacteria 966
380 Ga0207645_10106103 3300025907 Bacteria 1816
381 Ga0207645_10227334 3300025907 Bacteria 1231
382 Ga0207643_10040804 3300025908 Bacteria 2614
383 Ga0207643_10336806 3300025908 Bacteria 945
384 Ga0207643_11035280 3300025908 Bacteria 530
385 Ga0207705_10088803 3300025909 Bacteria 2261
386 Ga0207705_10796273 3300025909 Bacteria 734
387 Ga0207654_10011983 3300025911 Bacteria 4435
388 Ga0207654_10036092 3300025911 Bacteria 2760
389 Ga0207654_10410139 3300025911 Bacteria 944
390 Ga0207654_10897793 3300025911 Bacteria 642
391 Ga0207707_10000478 3300025912 Bacteria 41482
392 Ga0207707_10057426 3300025912 Bacteria 3387
393 Ga0207695_10000240 3300025913 Bacteria 143196
394 Ga0207695_10322570 3300025913 Bacteria 1434
395 Ga0207671_10002558 3300025914 Bacteria 19311
396 Ga0207671_10052054 3300025914 Bacteria 3034
397 Ga0207671_10115950 3300025914 Bacteria 2043
398 Ga0207671_10155073 3300025914 Bacteria 1771
399 Ga0207671_10989369 3300025914 Bacteria 663
400 Ga0207663_10896480 3300025916 Bacteria 709
401 Ga0207660_10020143 3300025917 Bacteria 4473
402 Ga0207660_10027527 3300025917 Bacteria 3880
403 Ga0207662_10062100 3300025918 Bacteria 2244
404 Ga0207662_10743184 3300025918 Bacteria 689
405 Ga0207657_10110081 3300025919 Bacteria 2275
406 Ga0207657_10207786 3300025919 Bacteria 1572
407 Ga0207657_10638567 3300025919 Bacteria 829
408 Ga0207657_11254369 3300025919 Bacteria 561
409 Ga0207649_11226632 3300025920 Bacteria 593
410 Ga0207652_10308075 3300025921 Bacteria 1429
411 Ga0207681_10229584 3300025923 Bacteria 1440
412 Ga0207681_10573408 3300025923 Bacteria 930
413 Ga0207694_10710797 3300025924 Bacteria 847
414 Ga0207694_10715636 3300025924 Bacteria 844
415 Ga0207650_10028309 3300025925 Bacteria 4017
416 Ga0207650_10123908 3300025925 Bacteria 2015
417 Ga0207659_10514272 3300025926 Bacteria 1015
418 Ga0207659_10774291 3300025926 Bacteria 824
419 Ga0207687_10011179 3300025927 Bacteria 5863
420 Ga0207687_10028107 3300025927 Bacteria 3778
421 Ga0207687_10041102 3300025927 Bacteria 3173
422 Ga0207644_10020411 3300025931 Bacteria 4505
423 Ga0207644_10213911 3300025931 Bacteria 1525
424 Ga0207644_10259509 3300025931 Bacteria 1389
425 Ga0207644_10523805 3300025931 Bacteria 979
426 Ga0207690_10222175 3300025932 Bacteria 1446
427 Ga0207690_10691854 3300025932 Bacteria 838
428 Ga0207690_11249689 3300025932 Bacteria 620
429 Ga0207706_10104072 3300025933 Bacteria 2497
430 Ga0207686_10204210 3300025934 Bacteria 1417
431 Ga0207709_10013704 3300025935 Bacteria 4473
432 Ga0207709_10527947 3300025935 Bacteria 925
433 Ga0207709_10535462 3300025935 Bacteria 919
434 Ga0207670_10836763 3300025936 Bacteria 768
435 Ga0207670_11163308 3300025936 Bacteria 652
436 Ga0207670_11843814 3300025936 Bacteria 514
437 Ga0207704_11093415 3300025938 Bacteria 677
438 Ga0207691_10009643 3300025940 Bacteria 9262
439 Ga0207691_10655611 3300025940 Bacteria 887
440 Ga0207691_10784162 3300025940 Bacteria 801
441 Ga0207711_10064934 3300025941 Bacteria 3154
442 Ga0207711_11200408 3300025941 Bacteria 700
443 Ga0207689_10040232 3300025942 Bacteria 3869
444 Ga0207689_10063086 3300025942 Bacteria 3048
445 Ga0207689_10304415 3300025942 Bacteria 1321
446 Ga0207661_10009026 3300025944 Bacteria 7143
447 Ga0207679_11027688 3300025945 Bacteria 756
448 Ga0207667_10022463 3300025949 Bacteria 6968
449 Ga0207667_10382338 3300025949 Bacteria 1434
450 Ga0207667_11266069 3300025949 Bacteria 715
451 Ga0207651_10135535 3300025960 Bacteria 1893
452 Ga0207651_10669418 3300025960 Bacteria 912
453 Ga0207651_11585282 3300025960 Bacteria 590
454 Ga0207712_10147159 3300025961 Bacteria 1815
455 Ga0207712_10321395 3300025961 Bacteria 1277
456 Ga0207712_11119652 3300025961 Bacteria 701
457 Ga0207668_10034775 3300025972 Bacteria 3349
458 Ga0207668_10052349 3300025972 Bacteria 2824
459 Ga0207668_10340680 3300025972 Bacteria 1250
460 Ga0207668_10395125 3300025972 Bacteria 1167
461 Ga0207668_10904641 3300025972 Bacteria 785
462 Ga0207668_11153740 3300025972 Bacteria 695
463 Ga0207668_11838032 3300025972 Bacteria 546
464 Ga0207640_10563802 3300025981 Bacteria 959
465 Ga0207640_11506351 3300025981 Bacteria 604
466 Ga0207658_10201951 3300025986 Bacteria 1660
467 Ga0207658_10658323 3300025986 Bacteria 944
468 Ga0207658_11801995 3300025986 Bacteria 558
469 Ga0207677_10053550 3300026023 Bacteria 2747
470 Ga0207677_10229190 3300026023 Bacteria 1495
471 Ga0207677_11801406 3300026023 Bacteria 568
472 Ga0207677_12139832 3300026023 Bacteria 520
473 Ga0207703_10126988 3300026035 Bacteria 2197
474 Ga0207703_10511544 3300026035 Bacteria 1128
475 Ga0207703_11461328 3300026035 Bacteria 658
476 Ga0207703_12032092 3300026035 Bacteria 551
477 Ga0207639_10344819 3300026041 Bacteria 1329
478 Ga0207639_10468293 3300026041 Bacteria 1147
479 Ga0207639_10502570 3300026041 Bacteria 1108
480 Ga0207639_11203013 3300026041 Bacteria 711
481 Ga0207678_10012818 3300026067 Bacteria 7360
482 Ga0207678_10471447 3300026067 Bacteria 1093
483 Ga0207678_10580622 3300026067 Bacteria 982
484 Ga0207678_10645133 3300026067 Bacteria 930
485 Ga0207678_10681004 3300026067 Bacteria 904
486 Ga0207678_11066325 3300026067 Bacteria 715
487 Ga0207708_10022932 3300026075 Bacteria 4715
488 Ga0207708_10252280 3300026075 Bacteria 1422
489 Ga0207702_10456464 3300026078 Bacteria 1240
490 Ga0207702_10530225 3300026078 Bacteria 1150
491 Ga0207641_10310055 3300026088 Bacteria 1493
492 Ga0207641_10314699 3300026088 Bacteria 1483
493 Ga0207641_10795253 3300026088 Bacteria 935
494 Ga0207641_10917072 3300026088 Bacteria 870
495 Ga0207641_11245702 3300026088 Bacteria 744
496 Ga0207641_12111748 3300026088 Bacteria 564
497 Ga0207648_10072960 3300026089 Bacteria 2992
498 Ga0207648_10118811 3300026089 Bacteria 2324
499 Ga0207676_10025018 3300026095 Bacteria 4426
500 Ga0207676_10272374 3300026095 Bacteria 1534
501 Ga0207674_10083021 3300026116 Bacteria 3204
502 Ga0207674_10181900 3300026116 Bacteria 2054
503 Ga0207675_100154218 3300026118 Bacteria 2188
504 Ga0207675_100175572 3300026118 Bacteria 2050
505 Ga0207675_100193299 3300026118 Bacteria 1952
506 Ga0207675_100194966 3300026118 Bacteria 1944
507 Ga0207675_100261644 3300026118 Bacteria 1677
508 Ga0207675_101072413 3300026118 Bacteria 825
509 Ga0207683_10059172 3300026121 Bacteria 3366
510 Ga0207683_10125988 3300026121 Bacteria 2302
511 Ga0207683_10263047 3300026121 Bacteria 1575
512 Ga0207683_10648522 3300026121 Bacteria 978
513 Ga0207683_10740354 3300026121 Bacteria 912
514 Ga0207698_10180256 3300026142 Bacteria 1870
515 Ga0207698_10616640 3300026142 Bacteria 1071
516 Ga0207698_11542925 3300026142 Bacteria 679
517 Ga0207698_11597216 3300026142 Bacteria 668
518 Ga0209389_1000188 3300027296 Bacteria 46884
519 Ga0209489_110855 3300027361 Bacteria 9831
520 Ga0209700_100437 3300027363 Bacteria 76868
521 Ga0209813_10002512 3300027866 Bacteria 4201
522 Ga0209813_10097645 3300027866 Bacteria 995
523 Ga0209813_10460358 3300027866 Bacteria 522
524 Ga0207428_10024068 3300027907 Bacteria 5113
525 Ga0268266_10000466 3300028379 Bacteria 58721
526 Ga0268266_10012380 3300028379 Bacteria 7373
527 Ga0268266_10027532 3300028379 Bacteria 4832
528 Ga0268266_10586296 3300028379 Bacteria 1070
529 Ga0268266_11183041 3300028379 Bacteria 739
530 Ga0268265_10031314 3300028380 Bacteria 3840
531 Ga0268265_10044494 3300028380 Bacteria 3306
532 Ga0268265_10246585 3300028380 Bacteria 1579
533 Ga0268265_10659584 3300028380 Bacteria 1006
534 Ga0268265_12055668 3300028380 Bacteria 578
535 Ga0268264_10000073 3300028381 Bacteria 260615
536 Ga0268264_10175182 3300028381 Bacteria 1943
537 Ga0268264_10402731 3300028381 Bacteria 1315
538 Ga0268264_10532285 3300028381 Bacteria 1150
539 Ga0268264_10563134 3300028381 Bacteria 1119
540 Ga0268264_10731562 3300028381 Bacteria 985
541 Ga0307517_10494170 3300028786 Bacteria 624
542 Ga0307511_10171616 3300030521 Bacteria 1190
543 Ga0265316_10148218 3300031344 Bacteria 1759
544 Ga0307513_10430971 3300031456 Bacteria 1047
545 Ga0307509_10036522 3300031507 Bacteria 5378
546 Ga0307509_10089522 3300031507 Bacteria 3156
547 Ga0307509_10146091 3300031507 Bacteria 2290
548 Ga0307509_10189770 3300031507 Bacteria 1907
549 Ga0307509_10223145 3300031507 Bacteria 1695
550 Ga0307408_100185954 3300031548 Bacteria 1670
551 Ga0307508_10885365 3300031616 Bacteria 517
552 Ga0265314_10177011 3300031711 Bacteria 1282
553 Ga0307516_10556250 3300031730 Bacteria 801
554 Ga0307516_10698180 3300031730 Bacteria 671
555 Ga0307516_10774113 3300031730 Bacteria 620
556 Ga0307518_10346217 3300031838 Bacteria 869
557 Ga0307407_10336850 3300031903 Bacteria 1064
558 Ga0307412_12286827 3300031911 Bacteria 504
559 Ga0307416_100541436 3300032002 Bacteria 1236
560 Ga0307415_100187236 3300032126 Bacteria 1630
561 Ga0307507_10144079 3300033179 Bacteria 1816
562 Ga0307510_10036477 3300033180 Bacteria 5470
563 Ga0307510_10129996 3300033180 Bacteria 2195
564 Ga0373958_0001988 3300034819 Bacteria 2815
565 Ga0373928_0036118 3300035084 Bacteria 1116
566 Ga0373929_0029014 3300035085 Bacteria 1172
567 Ga0373949_0121630 3300035090 Bacteria 733
568 Ga0373951_0047234 3300035091 Bacteria 1052
569 Ga0373952_0090821 3300035092 Bacteria 793
570 Ga0373923_0129565 3300035111 Bacteria 1133
571 Ga0373932_0076071 3300035112 Bacteria 1051
572 Ga0373939_0234899 3300035114 Bacteria 707
573 Ga0373939_0418046 3300035114 Bacteria 559
574 Ga0373941_0144968 3300035115 Bacteria 866
575 Ga0373954_0360536 3300035118 Bacteria 718
576 Ga0373957_0299243 3300035120 Bacteria 682
577 Ga0373960_0019472 3300035121 Bacteria 1783
578 Ga0373960_0341758 3300035121 Bacteria 566
579 Ga0373962_0076424 3300035242 Bacteria 1009
580 Ga0373931_0217236 3300035691 Bacteria 1149
581 Ga0373935_0026726 3300035692 Bacteria 3565
582 Ga0373927_0241510 3300035695 Bacteria 1187
583 Ga0373927_0275021 3300035695 Bacteria 1107
584 Ga0373933_0089850 3300035724 Bacteria 1894
585 Ga0373937_0306843 3300036401 Bacteria 1501
586 Ga0373925_0013597 3300037068 Bacteria 5893
587 Ga0373925_0647629 3300037068 Bacteria 871
588 Ga0395900_0000394 3300037418 Bacteria 63170
589 Ga0395898_0011041 3300037466 Bacteria 9410
590 Ga0395905_0362238 3300037471 Bacteria 1343
591 Ga0395905_0623811 3300037471 Bacteria 980
592 Ga0395905_1264088 3300037471 Bacteria 642
593 Ga0436364_0163528 3300037853 Bacteria 1055
594 Ga0395901_0125444 3300038443 Bacteria 2698
595 Ga0436365_0394164 3300039437 Bacteria 13789
596 Ga0436365_1900573 3300039437 Bacteria 1113
597 Ga0436363_0822942 3300039450 Bacteria 703
598 Ga0436362_0044086 3300039453 Bacteria 1547
599 Ga0451789_0546568 3300041443 Bacteria 652
600 Ga0451793_1203669 3300041452 Bacteria 1038
601 Ga0451793_1654678 3300041452 Bacteria 609
602 Ga0451795_0738676 3300041456 Bacteria 1279
603 Ga0451835_0046854 3300041492 Bacteria 570
604 Ga0451839_0396340 3300041496 Bacteria 590
605 Ga0451839_0706751 3300041496 Bacteria 813
606 Ga0451843_1565422 3300041509 Bacteria 790
607 Ga0451853_0703402 3300041512 Bacteria 2049
608 Ga0466969_0158289 3300044656 Bacteria 1041
609 Ga0466972_0000576 3300044658 Bacteria 17815
610 Ga0466972_0000829 3300044658 Bacteria 14802
611 Ga0466972_0051840 3300044658 Bacteria 1979
612 Ga0466972_0465207 3300044658 Bacteria 594
613 Ga0466965_0047681 3300044683 Bacteria 2121
614 Ga0466965_0432140 3300044683 Bacteria 731
615 Ga0466966_0001892 3300044684 Bacteria 13590
616 Ga0466961_0000016 3300044693 Bacteria 111421
617 Ga0466963_0060568 3300044694 Bacteria 2528
618 Ga0466964_0116894 3300044706 Bacteria 1197
619 Ga0466964_0463375 3300044706 Bacteria 674
620 Ga0466968_0002646 3300044735 Bacteria 6592
621 Ga0466968_0055352 3300044735 Bacteria 1702
622 Ga0466957_0070058 3300044842 Bacteria 2167
623 Ga0466960_0002702 3300044901 Bacteria 6704
624 Ga0466960_0385823 3300044901 Bacteria 805
625 Ga0466960_0628537 3300044901 Bacteria 639
626 Ga0466959_0014272 3300045049 Bacteria 5766
627 Ga0466959_0984979 3300045049 Bacteria 562
628 Ga0466967_0111185 3300045976 Bacteria 2517
629 Ga0495617_005506 3300046452 Bacteria 4483
630 Ga0495617_050771 3300046452 Bacteria 1380
631 Ga0495617_112171 3300046452 Bacteria 882
632 Ga0495592_0017226 3300046454 Bacteria 5488
633 Ga0495592_0486425 3300046454 Bacteria 768
634 Ga0495603_0009571 3300046455 Bacteria 5857
635 Ga0495603_0247025 3300046455 Bacteria 1027
636 Ga0495590_0087600 3300046457 Bacteria 1100
637 Ga0495590_0161955 3300046457 Bacteria 814
638 Ga0495590_0234684 3300046457 Bacteria 680
639 Ga0495590_0342438 3300046457 Bacteria 567
640 Ga0495591_118921 3300046458 Bacteria 646
641 Ga0495629_0123577 3300046459 Bacteria 1803
642 Ga0495629_0160170 3300046459 Bacteria 1563
643 Ga0495629_0713273 3300046459 Bacteria 665
644 Ga0495638_0056812 3300046460 Bacteria 2428
645 Ga0495638_0057598 3300046460 Bacteria 2409
646 Ga0495641_0105202 3300046461 Bacteria 1259
647 Ga0495651_0003955 3300046462 Bacteria 11338
648 Ga0495651_0004024 3300046462 Bacteria 11236
649 Ga0495650_0100173 3300046471 Bacteria 1089
650 Ga0495605_0062663 3300046474 Bacteria 1776
651 Ga0495605_0249715 3300046474 Bacteria 759
652 Ga0495639_0021929 3300046475 Bacteria 2799
653 Ga0495664_0108404 3300046477 Bacteria 1675
654 Ga0495584_0133303 3300046491 Bacteria 1261
655 Ga0495584_0189537 3300046491 Bacteria 1045
656 Ga0495584_0534936 3300046491 Bacteria 597
657 Ga0495585_0276589 3300046492 Bacteria 831
658 Ga0495585_0376873 3300046492 Bacteria 686
659 Ga0495585_0485432 3300046492 Bacteria 588
660 Ga0495594_0019047 3300046499 Bacteria 3644
661 Ga0495596_0216225 3300046500 Bacteria 744
662 Ga0495596_0303239 3300046500 Bacteria 621
663 Ga0495607_0342425 3300046501 Bacteria 692
664 Ga0495606_0082372 3300046507 Bacteria 1997
665 Ga0495606_0411648 3300046507 Bacteria 701
666 Ga0495606_0444541 3300046507 Bacteria 665
667 Ga0495608_0088051 3300046511 Bacteria 2010
668 Ga0495608_0099737 3300046511 Bacteria 1873
669 Ga0495610_0032441 3300046512 Bacteria 2712
670 Ga0495616_0024995 3300046513 Bacteria 3196
671 Ga0495616_0185804 3300046513 Bacteria 921
672 Ga0495618_0491840 3300046514 Bacteria 740
673 Ga0495618_0866145 3300046514 Bacteria 523
674 Ga0495620_0045961 3300046515 Bacteria 1888
675 Ga0495620_0075873 3300046515 Bacteria 1367
676 Ga0495628_0030495 3300046516 Bacteria 4366
677 Ga0495630_0101141 3300046517 Bacteria 2181
678 Ga0495631_0150038 3300046518 Bacteria 1000
679 Ga0495631_0164998 3300046518 Bacteria 950
680 Ga0495631_0481188 3300046518 Bacteria 529
681 Ga0495632_0249599 3300046519 Bacteria 796
682 Ga0495643_0073363 3300046522 Bacteria 1793
683 Ga0495643_0256449 3300046522 Bacteria 814
684 Ga0495643_0343234 3300046522 Bacteria 670
685 Ga0495644_0265228 3300046523 Bacteria 668
686 Ga0495648_0112696 3300046524 Bacteria 1477
687 Ga0495648_0263521 3300046524 Bacteria 825
688 Ga0495648_0278276 3300046524 Bacteria 794
689 Ga0495663_0107021 3300046525 Bacteria 926
690 Ga0495666_0203094 3300046526 Bacteria 911
691 Ga0495652_0026602 3300046529 Bacteria 5108
692 Ga0495652_0386975 3300046529 Bacteria 993
693 Ga0495665_0371894 3300046531 Bacteria 727
694 Ga0495640_0006053 3300046533 Bacteria 9594
695 Ga0495587_0007178 3300046536 Bacteria 7232
696 Ga0495587_0637738 3300046536 Bacteria 586
697 Ga0495598_0043774 3300046537 Bacteria 1320
698 Ga0495609_0017043 3300046538 Bacteria 3379
699 Ga0495609_0105173 3300046538 Bacteria 1221
700 Ga0495609_0212452 3300046538 Bacteria 806
701 Ga0495621_0296646 3300046539 Bacteria 669
702 Ga0495645_0007485 3300046543 Bacteria 7601
703 Ga0495622_0016496 3300046557 Bacteria 3440
704 Ga0495622_0042578 3300046557 Bacteria 2111
705 Ga0495622_0070962 3300046557 Bacteria 1607
706 Ga0495667_0003371 3300046559 Bacteria 10691
707 Ga0495656_0016609 3300046615 Bacteria 2795
708 Ga0495656_0036339 3300046615 Bacteria 2028
709 Ga0495656_0143295 3300046615 Bacteria 1148
710 Ga0495656_0159526 3300046615 Bacteria 1095
711 Ga0495656_0296052 3300046615 Bacteria 828
712 Ga0495656_0764037 3300046615 Bacteria 521
713 Ga0495668_0027417 3300046616 Bacteria 3227
714 Ga0495668_0054002 3300046616 Bacteria 2221
715 Ga0495668_0283635 3300046616 Bacteria 907
716 Ga0495634_0020124 3300046642 Bacteria 4734
717 Ga0495634_0027702 3300046642 Bacteria 3941
718 Ga0495611_0245574 3300046648 Bacteria 830
719 Ga0495611_0332229 3300046648 Bacteria 699
720 Ga0495625_0068192 3300046660 Bacteria 2501
721 Ga0495625_0182994 3300046660 Bacteria 1392
722 Ga0495625_0298530 3300046660 Bacteria 1031
723 Ga0495625_0309833 3300046660 Bacteria 1008
724 Ga0495625_0358165 3300046660 Bacteria 920
725 Ga0495625_0695993 3300046660 Bacteria 601
726 Ga0495635_0000802 3300046663 Bacteria 20534
727 Ga0495659_0021517 3300046664 Bacteria 2174
728 Ga0495659_0059789 3300046664 Bacteria 1405
729 Ga0495659_0150488 3300046664 Bacteria 934
730 Ga0495659_0512110 3300046664 Bacteria 527
731 Ga0495661_0066273 3300046665 Bacteria 2126
732 Ga0495661_0069841 3300046665 Bacteria 2057
733 Ga0495588_0013908 3300046674 Bacteria 3842
734 Ga0495588_0035826 3300046674 Bacteria 2516
735 Ga0495588_0615626 3300046674 Bacteria 568
736 Ga0495657_0002404 3300046675 Bacteria 15754
737 Ga0495657_0029407 3300046675 Bacteria 3854
738 Ga0495599_0019977 3300046678 Bacteria 4171
739 Ga0495599_0495678 3300046678 Bacteria 719
740 Ga0495623_0002269 3300046679 Bacteria 12799
741 Ga0495647_0083452 3300046681 Bacteria 1299
742 Ga0495669_0021548 3300046684 Bacteria 2797
743 Ga0495669_0038661 3300046684 Bacteria 2113
744 Ga0495669_0067239 3300046684 Bacteria 1628
745 Ga0495613_0102632 3300046689 Bacteria 2065
746 Ga0495624_0110949 3300046690 Bacteria 1687
747 Ga0495624_0480375 3300046690 Bacteria 744
748 Ga0495670_0026042 3300046691 Bacteria 2895
749 Ga0495649_0019021 3300046694 Bacteria 3859
750 Ga0495649_0130513 3300046694 Bacteria 1326
751 Ga0495649_0197727 3300046694 Bacteria 1045
752 Ga0495589_0277902 3300046794 Bacteria 779
753 Ga0495589_0311943 3300046794 Bacteria 728
754 Ga0495589_0338087 3300046794 Bacteria 694
755 Ga0495589_0410466 3300046794 Bacteria 621
756 Ga0495600_0003267 3300046809 Bacteria 9496
757 Ga0495600_0016450 3300046809 Bacteria 4694
758 Ga0495581_0039503 3300047315 Bacteria 2732
759 Ga0495581_0098788 3300047315 Bacteria 1696
760 Ga0495604_0000420 3300047317 Bacteria 38211
761 Ga0495604_0016406 3300047317 Bacteria 5920
762 Ga0495604_0305546 3300047317 Bacteria 1067
763 Ga0495604_0528485 3300047317 Bacteria 763
764 Ga0495636_0364049 3300047318 Bacteria 684
765 Ga0495674_0050231 3300047319 Bacteria 3681
766 Ga0495674_0519370 3300047319 Bacteria 951
767 Ga0495672_0293264 3300047320 Bacteria 773
768 Ga0495676_0020250 3300047321 Bacteria 5842
769 Ga0495676_0125668 3300047321 Bacteria 1859
770 Ga0495680_0001714 3300047322 Bacteria 23262
771 Ga0495680_0787681 3300047322 Bacteria 622
772 Ga0495683_0207572 3300047323 Bacteria 880
773 Ga0495683_0382543 3300047323 Bacteria 588
774 Ga0495687_015494 3300047443 Bacteria 3874
775 Ga0495687_091254 3300047443 Bacteria 1166
776 Ga0495675_0078222 3300047444 Bacteria 2083
777 Ga0495677_0051520 3300047445 Bacteria 1516
778 Ga0495677_0096336 3300047445 Bacteria 1118
779 Ga0495685_026230 3300047447 Bacteria 2005
780 Ga0495673_0175865 3300047469 Bacteria 813
781 Ga0495673_0266012 3300047469 Bacteria 622
782 Ga0495684_0718322 3300047471 Bacteria 661
783 Ga0495686_0393349 3300047472 Bacteria 745
784 Ga0495602_0045327 3300048088 Bacteria 3980
785 Ga0495602_0361174 3300048088 Bacteria 1045
786 Ga0495615_0019659 3300048090 Bacteria 1503
787 Ga0495615_0329960 3300048090 Bacteria 500
788 Ga0496100_0110992 3300048903 Bacteria 1905
789 Ga0496100_0519332 3300048903 Bacteria 919
790 Ga0496100_0796568 3300048903 Bacteria 740
791 Ga0496101_0532717 3300048904 Bacteria 928
792 Ga0496101_0913439 3300048904 Bacteria 691
793 Ga0496101_0954275 3300048904 Bacteria 675
794 Ga0496102_0016889 3300048905 Bacteria 6386
795 Ga0496102_0058823 3300048905 Bacteria 3513
796 Ga0496102_0369010 3300048905 Bacteria 1351
797 Ga0496102_0406365 3300048905 Bacteria 1280
798 Ga0496103_0026103 3300048906 Bacteria 3535
799 Ga0496103_0211012 3300048906 Bacteria 1249
800 Ga0496103_0325780 3300048906 Bacteria 988
801 Ga0496104_0004495 3300048907 Bacteria 12150
802 Ga0496104_0213685 3300048907 Bacteria 1840
803 Ga0496104_0389271 3300048907 Bacteria 1306
804 Ga0496105_0000450 3300048908 Bacteria 27125
805 Ga0496105_0159112 3300048908 Bacteria 1854
806 Ga0496105_0552093 3300048908 Bacteria 899
807 Ga0496106_0001765 3300048909 Bacteria 16152
808 Ga0496106_0155935 3300048909 Bacteria 1803
809 Ga0496106_0178101 3300048909 Bacteria 1687
810 Ga0496106_0224327 3300048909 Bacteria 1499
811 Ga0496106_0615217 3300048909 Bacteria 869
812 Ga0496106_0756664 3300048909 Bacteria 772
813 Ga0496107_0146004 3300048910 Bacteria 1749
814 Ga0496107_0198028 3300048910 Bacteria 1493
815 Ga0496107_0249019 3300048910 Bacteria 1322
816 Ga0496107_0310916 3300048910 Bacteria 1173
817 Ga0496107_0363199 3300048910 Bacteria 1077
818 Ga0496108_0031474 3300048911 Bacteria 4403
819 Ga0496108_0083019 3300048911 Bacteria 2717
820 Ga0496108_0525779 3300048911 Bacteria 1033
821 Ga0496108_1244075 3300048911 Bacteria 628
822 Ga0496109_0372705 3300048912 Bacteria 1348
823 Ga0496109_0517248 3300048912 Bacteria 1126
824 Ga0496110_0218896 3300048913 Bacteria 1731
825 Ga0496110_0501973 3300048913 Bacteria 1104
826 Ga0496110_1106724 3300048913 Bacteria 700
827 Ga0496111_0304646 3300048914 Bacteria 1181
828 Ga0496112_0036617 3300048915 Bacteria 4787
829 Ga0496112_0235828 3300048915 Bacteria 1783
830 Ga0496113_0056733 3300048916 Bacteria 2942
831 Ga0496113_0057770 3300048916 Bacteria 2917
832 Ga0496113_1221636 3300048916 Bacteria 586
833 Ga0496114_0014151 3300048917 Bacteria 6398
834 Ga0496114_0309860 3300048917 Bacteria 1394
835 Ga0496115_0368681 3300048918 Bacteria 1169
836 Ga0496116_0021451 3300048919 Bacteria 4872
837 Ga0496116_0181305 3300048919 Bacteria 1127
838 Ga0496116_0227967 3300048919 Bacteria 948
839 Ga0496117_0009249 3300048920 Bacteria 9210
840 Ga0496117_0241781 3300048920 Bacteria 991
841 Ga0496118_0010771 3300048921 Bacteria 9013
842 Ga0496118_0019813 3300048921 Bacteria 5999
843 Ga0496118_0121508 3300048921 Bacteria 1701
844 Ga0496118_0285017 3300048921 Bacteria 917
845 Ga0496118_0631313 3300048921 Bacteria 507
846 Ga0496119_0002327 3300048922 Bacteria 20938
847 Ga0496119_0019511 3300048922 Bacteria 4990
848 Ga0496119_0155572 3300048922 Bacteria 1221
849 Ga0496119_0271356 3300048922 Bacteria 847
850 Ga0496119_0464475 3300048922 Bacteria 594
851 Ga0496120_0013616 3300048923 Bacteria 5465
852 Ga0496120_0094719 3300048923 Bacteria 1589
853 Ga0496121_0000218 3300048924 Bacteria 126175
854 Ga0496121_0036054 3300048924 Bacteria 4416
855 Ga0496121_0059772 3300048924 Bacteria 3140
856 Ga0496121_0084438 3300048924 Bacteria 2503
857 Ga0496121_0085839 3300048924 Bacteria 2476
858 Ga0496121_0093040 3300048924 Bacteria 2348
859 Ga0496121_0158219 3300048924 Bacteria 1660
860 Ga0496121_0185671 3300048924 Bacteria 1496
861 Ga0496121_0343395 3300048924 Bacteria 997
862 Ga0496121_0470250 3300048924 Bacteria 805
863 Ga0496124_0001579 3300048927 Bacteria 32910
864 Ga0496124_0197564 3300048927 Bacteria 1533
865 Ga0496124_0238592 3300048927 Bacteria 1354
866 Ga0496124_0287818 3300048927 Bacteria 1194
867 Ga0496124_0472283 3300048927 Bacteria 849
868 Ga0496125_0016330 3300048928 Bacteria 7134
869 Ga0496125_0040078 3300048928 Bacteria 4023
870 Ga0496125_0114617 3300048928 Bacteria 1941
871 Ga0496125_0258420 3300048928 Bacteria 1093
872 Ga0496126_0021157 3300048929 Bacteria 6360
873 Ga0496126_0050772 3300048929 Bacteria 3778
874 Ga0496126_0263474 3300048929 Bacteria 1432
875 Ga0496126_0452308 3300048929 Bacteria 1033
876 Ga0496126_0896951 3300048929 Bacteria 672
877 Ga0495682_0273227 3300049460 Bacteria 597
878 Ga0495682_0315231 3300049460 Bacteria 551
879 Ga0501067_0192603 3300049583 Bacteria 1136
880 Ga0501069_0095952 3300049585 Bacteria 1680
881 Ga0501071_0626498 3300049587 Bacteria 827
882 Ga0501081_0417058 3300049743 Bacteria 995
883 nmdc:mga03683_26959_c1 3300050489 Bacteria 2271
884 nmdc:mga03n38_111245_c1 3300050490 Bacteria 1334
885 nmdc:mga03n38_321600_c1 3300050490 Bacteria 835
886 nmdc:mga03n38_538479_c1 3300050490 Bacteria 659
887 nmdc:mga00v17_234290_c1 3300050491 Bacteria 1190
888 nmdc:mga00v17_471885_c1 3300050491 Bacteria 814
889 nmdc:mga00v17_8593_c1 3300050491 Bacteria 5498
890 nmdc:mga0yw44_241757_c1 3300050492 Bacteria 1200
891 nmdc:mga0yw44_507846_c1 3300050492 Bacteria 818
892 nmdc:mga0yw44_74854_c1 3300050492 Bacteria 2110
893 nmdc:mga0k408_333468_c1 3300050493 Bacteria 905
894 nmdc:mga0k408_48578_c1 3300050493 Bacteria 2455
895 nmdc:mga06z11_246755_c1 3300050494 Bacteria 1050
896 nmdc:mga06z11_47440_c1 3300050494 Bacteria 2182
897 nmdc:mga06z11_90175_c1 3300050494 Bacteria 1663
898 nmdc:mga04h51_129297_c1 3300050495 Bacteria 948
899 nmdc:mga04h51_55158_c1 3300050495 Bacteria 1346
900 nmdc:mga07m45_265884_c1 3300050496 Bacteria 998
901 nmdc:mga07m45_85220_c1 3300050496 Bacteria 1807
902 nmdc:mga05p37_1606391_c1 3300050507 Bacteria 640
903 nmdc:mga08y16_1152388_c1 3300050511 Bacteria 748
904 nmdc:mga08y16_168220_c1 3300050511 Bacteria 2278
905 nmdc:mga0n895_90315_c1 3300050512 Bacteria 3065
906 nmdc:mga0rr50_91695_c1 3300050513 Bacteria 2367
907 nmdc:mga0a205_11483_c1 3300050515 Bacteria 8156
908 nmdc:mga0a205_484773_c1 3300050515 Bacteria 1094
909 nmdc:mga0sz30_227651_c1 3300050516 Bacteria 829
910 nmdc:mga0sz30_448206_c1 3300050516 Bacteria 579
911 Ga0500610_0225658 3300053079 Bacteria 883
912 Ga0500635_0162024 3300053080 Bacteria 858
913 Ga0495595_0056594 3300053084 Bacteria 1828
914 Ga0500583_0151298 3300053092 Bacteria 1155
915 Ga0500566_0200001 3300053094 Bacteria 1010
916 Ga0500566_0488435 3300053094 Bacteria 532
917 Ga0500640_076091 3300053095 Bacteria 1432
918 Ga0500641_0060693 3300053096 Bacteria 1574
919 Ga0500650_0117657 3300053098 Bacteria 1240
920 Ga0500650_0279891 3300053098 Bacteria 742
921 Ga0500556_0098360 3300053104 Bacteria 1124
922 Ga0500569_006929 3300053109 Bacteria 2516
923 Ga0500572_025316 3300053111 Bacteria 1608
924 Ga0500594_0067539 3300053118 Bacteria 1045
925 Ga0500595_000781 3300053119 Bacteria 18598
926 Ga0500595_174302 3300053119 Bacteria 597
927 Ga0500607_056108 3300053121 Bacteria 2080
928 Ga0500621_201440 3300053126 Bacteria 705
929 Ga0500626_212931 3300053128 Bacteria 751
930 Ga0500658_0144677 3300053134 Bacteria 1068
931 Ga0500559_0042173 3300053136 Bacteria 1990
932 Ga0500559_0051602 3300053136 Bacteria 1816
933 Ga0500568_0071365 3300053139 Bacteria 1329
934 Ga0500577_0402999 3300053142 Bacteria 598
935 Ga0500588_0166520 3300053146 Bacteria 805
936 Ga0500590_049823 3300053148 Bacteria 2131
937 Ga0500590_203985 3300053148 Bacteria 833
938 Ga0500590_371381 3300053148 Bacteria 501
939 Ga0500616_0029003 3300053153 Bacteria 3047
940 Ga0500619_130219 3300053154 Bacteria 857
941 Ga0500624_007578 3300053157 Bacteria 1497
942 Ga0500627_0106212 3300053158 Bacteria 1262
943 Ga0500634_0215329 3300053161 Bacteria 830
944 Ga0500634_0224958 3300053161 Bacteria 802
945 Ga0500638_184129 3300053162 Bacteria 898
946 Ga0500638_332306 3300053162 Bacteria 572
947 Ga0500636_0000160 3300053177 Bacteria 35228
948 Ga0500637_0061113 3300053178 Bacteria 2158
949 Ga0500637_0388736 3300053178 Bacteria 729
950 Ga0500637_0396660 3300053178 Bacteria 718
951 Ga0500649_195563 3300053722 Bacteria 661
952 Ga0500657_208816 3300053728 Bacteria 637
953 Ga0500609_015225 3300053731 Bacteria 1041
954 Ga0500596_009479 3300053735 Bacteria 1519
955 Ga0500596_054490 3300053735 Bacteria 659
956 Ga0500599_000996 3300053736 Bacteria 3172
957 Ga0500601_000253 3300053737 Bacteria 10247
958 Ga0500661_016452 3300055283 Bacteria 1322
959 Ga0500661_031259 3300055283 Bacteria 939
960 Ga0587086_097612 3300059507 Bacteria 538
961 Ga0587079_046617 3300059647 Bacteria 895
962 2507510734 2507262055 Bacteria 8048963
963 2508544534 2508501009 Bacteria 7784016
964 2511398701 2511231028 Bacteria 8046582
965 2513643094 2513237094 Bacteria 8789602
966 2513721181 2513237104 Bacteria 10034502
967 2513877886 2513237139 Bacteria 8737671
968 2514016261 2513237161 Bacteria 8871253
969 2515627985 2515154112 Bacteria 8294334
970 2517105108 2517093001 Bacteria 9002274
971 2528854294 2528768022 Bacteria 10457665
972 2617353765 2617270735 Bacteria 9163226
973 2617378832 2617270741 Bacteria 8201522
974 2818242613 2816332527 Bacteria 8933356
975 2824601885 2824600985 Bacteria 8488197
976 2824612801 2824609381 Bacteria 8672835
977 2824653220 2824653114 Bacteria 8493680
978 2824662562 2824661429 Bacteria 9877870
979 2824673415 2824671348 Bacteria 8369588
980 2824680994 2824679649 Bacteria 8248951
981 2824689543 2824687955 Bacteria 8360029
982 2824697324 2824696289 Bacteria 8335049
983 2824707893 2824704595 Bacteria 9667483
984 2824734676 2824732956 Bacteria 7810675
985 2824747806 2824746037 Bacteria 7911610
986 2824759015 2824753945 Bacteria 9787441
987 2824763921 2824763712 Bacteria 9792355
988 2838125258 2838122688 Bacteria 8803140
989 2841948605 2841941048 Bacteria 8688029
990 2841951501 2841949485 Bacteria 8680857
991 2841960503 2841957949 Bacteria 8652217
992 2841968483 2841966195 Bacteria 8673214
993 2841976317 2841974524 Bacteria 8931498
994 2841987679 2841983080 Bacteria 8395090
995 2844317181 2844315083 Bacteria 8138177
996 2847933875 2847930680 Bacteria 9342022
997 2847944551 2847939898 Bacteria 8606328
998 2874592313 2874590934 Bacteria 8299676
999 2874634591 2874628541 Bacteria 8630250
1000 2874650080 2874645413 Bacteria 8214782
1001 2876775391 2876771140 Bacteria 8287509
1002 2876826256 2876818435 Bacteria 8274608
1003 2879079521 2879074833 Bacteria 8279565
1004 2879087405 2879083081 Bacteria 8587928
1005 2879109628 2879099564 Bacteria 10442239
1006 2879132232 2879127579 Bacteria 8294491
1007 2879146881 2879142872 Bacteria 8267021
1008 2885367288 2885366525 Bacteria 8326213
1009 2885418434 2885409591 Bacteria 9235467
1010 2888381869 2888378607 Bacteria 9652610
1011 2888388769 2888388044 Bacteria 7304136
1012 2888422490 2888419890 Bacteria 7857137
1013 2903735165 2903727486 Bacteria 8281579
1014 2904720495 2904711408 Bacteria 9771557
1015 2906607220 2906602504 Bacteria 8295279
1016 2906643819 2906643746 Bacteria 8722424
1017 2908778122 2908775508 Bacteria 8092255
1018 2922371820
1019 2922389281 2922386360 Bacteria 7017218
1020 2922399472 2922393267 Bacteria 8285685
1021 2929616830 2929615660 Bacteria 9193770
1022 2929625573 2929624759 Bacteria 9339455
1023 2932791146 2932784394 Bacteria 9704911
1024 2932799197 2932794094 Bacteria 7915132
1025 2932803808 2932801729 Bacteria 7987968
1026 2932811671 2932809354 Bacteria 9135765
1027 2932826613 2932818245 Bacteria 9955613
1028 2932834241 2932828146 Bacteria 9745859
1029 2933577888 2933577622 Bacteria 9116884
1030 2935616088 2935608549 Bacteria 8203142
1031 2935623937 2935616580 Bacteria 9032984
1032 2935646935 2935638405 Bacteria 10015038
1033 2935654894 2935648319 Bacteria 8801166
1034 2935663836 2935656913 Bacteria 8965014
1035 2935674085 2935665750 Bacteria 9571747
1036 2935684724 2935675223 Bacteria 9928132
1037 2935691578 2935684952 Bacteria 9590419
1038 2935699453 2935694250 Bacteria 9291695
1039 2935707680 2935703347 Bacteria 10242284
1040 2935719412 2935713505 Bacteria 9608509
1041 2935728988 2935722832 Bacteria 9608746
1042 2935737771 2935732158 Bacteria 9706831
1043 2935747147 2935741537 Bacteria 9707219
1044 2935758053 2935750917 Bacteria 9590372
1045 2935766689 2935760218 Bacteria 9817913
1046 2935770680 2935769743 Bacteria 7878163
1047 2935782913 2935777560 Bacteria 8077691
1048 2935787034 2935785616 Bacteria 7962367
1049 2935795082 2935793552 Bacteria 8012592
1050 2935809298 2935801545 Bacteria 9301974
1051 2935817811 2935810662 Bacteria 9401221
1052 2935819984 2935819856 Bacteria 8261050
1053 2935836250 2935827899 Bacteria 10038562
1054 2935845159 2935837841 Bacteria 9454360
1055 2935850006 2935847175 Bacteria 8228321
1056 2935862213 2935855204 Bacteria 9035059
1057 2935870860 2935864058 Bacteria 9784707
1058 2935881253 2935873716 Bacteria 9632195
1059 2935884314 2935883170 Bacteria 7964738
1060 2935915159 2935908558 Bacteria 8568796
1061 2935923836 2935916978 Bacteria 9113783
1062 2935932656 2935926038 Bacteria 8601059
1063 2935941260 2935934488 Bacteria 8602579
1064 2935949326 2935942939 Bacteria 8599779
1065 2935958021 2935951376 Bacteria 8602333
1066 2935963771 2935959822 Bacteria 7869783
1067 2935974337 2935967501 Bacteria 8603075
1068 2935979527 2935975950 Bacteria 8347125
1069 2935991612 2935984226 Bacteria 8302647
1070 2935999155 2935992306 Bacteria 9802711
1071 2936005576 2936002035 Bacteria 9362176
1072 2936017992 2936011229 Bacteria 8801034
1073 2936026495 2936019824 Bacteria 8804134
1074 2936035098 2936028420 Bacteria 8965941
1075 2936042104 2936037263 Bacteria 9446081
1076 2936053248 2936046547 Bacteria 8903709
1077 2936059231 2936055302 Bacteria 8785755
1078 2940564036 2940556831 Bacteria 9590747
1079 2941535026 2941531003 Bacteria 7653939
1080 2941545488 2941538514 Bacteria 9402094
1081 3005508201 3005506211 Bacteria 6943378
1082 3005596883 3005594810 Bacteria 8716512
1083 3005720288 3005718088 Bacteria 8283608
1084 8006966418 8006964411 Bacteria 8966052
1085 8016515869 8016511872 Bacteria 9921665
1086 8016523412 8016522445 Bacteria 8156687
1087 8016541182 8016539877 Bacteria 8155419
1088 8016552070 8016548790 Bacteria 8155074
1089 8016560448 8016557553 Bacteria 8154380
1090 8016566573 8016566248 Bacteria 8158151
1091 8016589882 8016583857 Bacteria 10421953
1092 8016598350 8016595262 Bacteria 8149947
1093 8016604451 8016603502 Bacteria 8731218
1094 8016621030 8016613128 Bacteria 8794220
1095 8016628974 8016622563 Bacteria 7999408
1096 8016633549 8016630954 Bacteria 9217207
1097 8017060642 8017057580 Bacteria 10023680
1098 8019536613 8019530166 Bacteria 8155624
1099 8019542848 8019538911 Bacteria 7872763
1100 8019547898 8019547302 Bacteria 7996444
1101 8019580154 8019576017 Bacteria 10049540
1102 8019587873 8019586578 Bacteria 10212056
1103 8019603454 8019597564 Bacteria 10041141
1104 8019615073 8019608314 Bacteria 10042931
1105 8019625627 8019619141 Bacteria 9218857
1106 8019636663 8019629233 Bacteria 8687553
1107 8019642962 8019638758 Bacteria 9062356
1108 8019664464 8019659431 Bacteria 8577854
1109 8019674056 8019668869 Bacteria 8791617
1110 8019682068 8019678201 Bacteria 8863603
1111 8019693527 8019687851 Bacteria 8712826
1112 8055748476 8055742211 Bacteria 9226248
1113 8056678277 8056673599 Bacteria 7871253
1114 8056976278 8056967851 Bacteria 9038162
1115 Ga0068860_100000750
1116 JGI24739J22299_10174530
1117 JGI24750J21931_1073513
1118 JGI25153J46596_10000843
1119 JGI25153J46596_10021234
1120 rootL2_10055505
1121 rootH1_10060569
1122 JGI25160J50197_1026031
1123 JGI25404J52841_10001353
1124 JGI25404J52841_10004360
1125 Ga0055528_1082334
1126 Ga0055543_1020090
1127 Ga0065165_1038053
1128 Ga0065165_1038358
1129 Ga0070658_10107170
1130 Ga0070658_10553576
1131 Ga0070676_10025880
1132 Ga0070676_10338105
1133 Ga0070683_100023716
1134 Ga0070683_100876709
1135 Ga0070690_100884968
1136 Ga0070690_101055014
1137 Ga0070670_100250549
1138 Ga0068869_100121583
1139 Ga0068869_100267459
1140 Ga0068869_100426135
1141 Ga0070666_10291684
1142 Ga0070666_10827191
1143 Ga0070680_100004777
1144 Ga0070680_100543344
1145 Ga0070682_100031944
1146 Ga0070682_100437133
1147 Ga0070682_100695615
1148 Ga0068868_100141581
1149 Ga0068868_100621024
1150 Ga0070660_100498857
1151 Ga0070660_101522759
1152 Ga0070689_100700055
1153 Ga0070687_100402922
1154 Ga0070661_100156504
1155 Ga0070661_100799065
1156 Ga0070692_10376038
1157 Ga0070692_10676437
1158 Ga0070668_100055099
1159 Ga0070668_100084489
1160 Ga0070668_100252158
1161 Ga0070668_100257843
1162 Ga0070668_100754749
1163 Ga0070668_100986344
1164 Ga0070668_101716920
1165 Ga0070669_100304580
1166 Ga0070669_100335148
1167 Ga0070675_101822876
1168 Ga0070671_100015685
1169 Ga0070671_100535186
1170 Ga0070671_100610857
1171 Ga0070671_100669016
1172 Ga0070674_100132979
1173 Ga0070674_100162288
1174 Ga0070674_100502260
1175 Ga0070673_100207106
1176 Ga0070688_100670027
1177 Ga0070659_100332715
1178 Ga0070667_100189101
1179 Ga0070667_100379012
1180 Ga0070667_100381448
1181 Ga0070703_10028631
1182 Ga0070701_10124376
1183 Ga0070711_100600866
1184 Ga0070711_101418067
1185 Ga0070705_100880836
1186 Ga0070700_100040996
1187 Ga0070700_100246793
1188 Ga0070700_100559845
1189 Ga0070700_100830728
1190 Ga0070700_100913979
1191 Ga0070694_100413650
1192 Ga0070663_100009162
1193 Ga0070663_100246854
1194 Ga0070663_100465253
1195 Ga0070663_100508816
1196 Ga0070663_100667781
1197 Ga0070663_101087753
1198 Ga0070678_100021931
1199 Ga0070678_100221283
1200 Ga0070678_100779224
1201 Ga0070678_101145000
1202 Ga0070662_100142055
1203 Ga0070662_100294048
1204 Ga0070662_100430657
1205 Ga0070681_10469658
1206 Ga0068867_100048504
1207 Ga0068867_100138539
1208 Ga0068867_100525795
1209 Ga0070685_10160444
1210 Ga0070685_10274246
1211 Ga0070685_10693705
1212 Ga0070698_100126600
1213 Ga0070699_101350453
1214 Ga0070684_100016830
1215 Ga0070684_101467372
1216 Ga0068853_100214742
1217 Ga0068853_101783340
1218 Ga0070672_100174547
1219 Ga0070672_100380821
1220 Ga0070672_101009408
1221 Ga0070686_100050955
1222 Ga0070695_101105884
1223 Ga0070696_100941657
1224 Ga0070693_100149081
1225 Ga0070693_100496949
1226 Ga0070665_100029422
1227 Ga0070665_100030432
1228 Ga0070665_100195114
1229 Ga0070665_100217409
1230 Ga0070665_100226356
1231 Ga0070665_100748299
1232 Ga0070665_100839117
1233 Ga0070704_101907666
1234 Ga0068855_100088885
1235 Ga0068855_100102387
1236 Ga0068857_100238698
1237 Ga0068857_100498259
1238 Ga0068857_101152947
1239 Ga0068854_100104129
1240 Ga0068854_100171858
1241 Ga0068854_100817197
1242 Ga0068856_100007648
1243 Ga0068856_100139603
1244 Ga0068856_101282933
1245 Ga0068856_101346862
1246 Ga0070702_100076314
1247 Ga0070702_100137210
1248 Ga0070702_100521353
1249 Ga0070702_100556064
1250 Ga0068852_100231763
1251 Ga0068852_100465069
1252 Ga0068852_101863612
1253 Ga0068859_100766262
1254 Ga0068864_100080457
1255 Ga0068864_100336155
1256 Ga0068864_100713276
1257 Ga0068866_10060197
1258 Ga0068866_10220698
1259 Ga0068861_100033062
1260 Ga0068861_100148087
1261 Ga0068861_100153790
1262 Ga0068861_100164450
1263 Ga0068861_100263513
1264 Ga0068861_100494476
1265 Ga0068861_100676157
1266 Ga0068851_10175090
1267 Ga0068851_10357824
1268 Ga0068870_10066579
1269 Ga0068870_10519275
1270 Ga0068870_10892336
1271 Ga0068870_10959185
1272 Ga0068863_100314915
1273 Ga0068863_100392291
1274 Ga0068863_100404399
1275 Ga0068863_100564274
1276 Ga0068863_102493045
1277 Ga0068858_100048903
1278 Ga0068858_100397065
1279 Ga0068858_100461786
1280 Ga0068858_100718171
1281 Ga0068858_100999822
1282 Ga0068858_101207399
1283 Ga0068858_101242402
1284 Ga0068860_100086071
1285 Ga0068860_100150847
1286 Ga0068860_100353972
1287 Ga0068860_100492909
1288 Ga0068860_100834988
1289 Ga0068860_100956299
1290 Ga0068862_100077665
1291 Ga0068862_100766978
1292 Ga0068862_101014097
1293 Ga0081455_10109710
1294 Ga0081455_10230722
1295 Ga0081455_10690504
1296 Ga0081538_10043620
1297 Ga0081540_1007986
1298 Ga0081540_1008303
1299 Ga0081540_1010128
1300 Ga0081540_1139209
1301 Ga0081539_10037212
1302 Ga0070717_10911795
1303 Ga0070717_11769401
1304 Ga0075365_10099467
1305 Ga0075365_10182715
1306 Ga0075368_10085864
1307 Ga0075368_10093095
1308 Ga0075368_10093219
1309 Ga0075363_100061563
1310 Ga0075363_100697926
1311 Ga0075364_10141851
1312 Ga0075364_10222313
1313 Ga0075364_11087969
1314 Ga0075432_10029052
1315 Ga0070715_10642989
1316 Ga0070712_101772162
1317 Ga0075362_10162900
1318 Ga0075362_10167615
1319 Ga0075362_10459219
1320 Ga0075367_10126989
1321 Ga0075367_10149598
1322 Ga0075367_10222054
1323 Ga0075367_10392288
1324 Ga0075369_10019837
1325 Ga0075369_10046941
1326 Ga0075369_10170822
1327 Ga0075369_10382273
1328 Ga0075366_10075614
1329 Ga0075366_10484225
1330 Ga0075366_10505068
1331 Ga0097621_100526415
1332 Ga0097621_100763233
1333 Ga0097621_102252735
1334 Ga0075370_10201049
1335 Ga0075370_10371090
1336 Ga0068871_100199476
1337 Ga0068871_100591327
1338 Ga0068871_100995393
1339 Ga0068871_101916123
1340 Ga0075428_100818139
1341 Ga0075430_101069197
1342 Ga0075433_10013684
1343 Ga0075433_10566706
1344 Ga0075434_100034640
1345 Ga0075429_101656210
1346 Ga0068865_100131258
1347 Ga0097620_100212218
1348 Ga0097620_100766282
1349 Ga0099825_1019614
1350 Ga0075435_100413813
1351 Ga0075435_101383387
1352 Ga0105251_10637227
1353 Ga0105250_10108560
1354 Ga0105250_10290180
1355 Ga0105240_10004507
1356 Ga0105240_10545640
1357 Ga0111539_10180571
1358 Ga0111539_10305309
1359 Ga0111539_11715413
1360 Ga0105245_10081822
1361 Ga0105245_10263703
1362 Ga0105245_11638310
1363 Ga0105245_12061105
1364 Ga0105245_12155643
1365 Ga0105247_10251934
1366 Ga0105247_10442116
1367 Ga0105247_10899207
1368 Ga0114129_10336223
1369 Ga0105243_10023215
1370 Ga0105243_10229227
1371 Ga0105243_11888124
1372 Ga0105243_12654867
1373 Ga0105241_10025959
1374 Ga0105241_10207196
1375 Ga0105241_10218818
1376 Ga0105241_10400965
1377 Ga0105241_10624340
1378 Ga0105241_10935976
1379 Ga0105242_10282942
1380 Ga0105242_12384550
1381 Ga0105248_10110058
1382 Ga0105248_10124986
1383 Ga0105248_12416744
1384 Ga0105248_12431553
1385 Ga0105237_10011480
1386 Ga0105237_10073042
1387 Ga0105237_10177502
1388 Ga0105238_10145174
1389 Ga0105238_10433183
1390 Ga0105238_10454349
1391 Ga0105238_10553048
1392 Ga0105238_12102871
1393 Ga0105249_10194003
1394 Ga0105249_10283008
1395 Ga0105249_10811517
1396 Ga0105249_10921351
1397 Ga0105249_12084693
1398 Ga0105239_10065781
1399 Ga0105239_10131251
1400 Ga0105239_10184048
1401 Ga0105239_10550402
1402 Ga0105239_10595403
1403 Ga0105239_10653309
1404 Ga0105239_11068166
1405 Ga0105239_11215918
1406 Ga0105246_10100197
1407 Ga0105246_10836084
1408 Ga0105246_11356407
1409 Ga0105246_12245218
1410 Ga0157314_1019146
1411 Ga0157371_11530784
1412 Ga0157370_11611522
1413 Ga0157369_10084765
1414 Ga0157369_10912182
1415 Ga0157374_11143790
1416 Ga0157374_11292578
1417 Ga0157374_11528414
1418 Ga0157374_11717939
1419 Ga0157378_10033626
1420 Ga0157378_10412529
1421 Ga0163162_10134241
1422 Ga0163162_10308160
1423 Ga0163162_10450553
1424 Ga0163162_11906468
1425 Ga0157372_10267332
1426 Ga0157372_10623061
1427 Ga0157375_10354662
1428 Ga0157375_10526432
1429 Ga0157375_11794801
1430 Ga0163163_10087935
1431 Ga0163163_10590413
1432 Ga0163163_11097196
1433 Ga0157380_10141244
1434 Ga0157380_10476978
1435 Ga0157380_10628878
1436 Ga0157380_10678003
1437 Ga0157377_10081157
1438 Ga0157377_10858488
1439 Ga0157379_10508380
1440 Ga0157379_10605933
1441 Ga0157379_10730083
1442 Ga0157379_11173454
1443 Ga0157376_10211162
1444 Ga0157376_10292146
1445 Ga0157376_10471476
1446 Ga0157376_11116764
1447 Ga0182007_10035964
1448 Ga0163161_10023451
1449 Ga0163161_10735540
1450 Ga0163161_10929358
1451 Ga0163161_11614981
1452 Ga0206356_11821617
1453 Ga0206353_11062936
1454 Ga0214544_1000013
1455 Ga0214542_1000013
1456 Ga0214545_1000012
1457 Ga0214543_1000065
1458 Ga0213876_10021294
1459 Ga0209563_115804
1460 Ga0209026_1060825
1461 Ga0209677_110702
1462 Ga0209148_1000319
1463 Ga0209148_1024638
1464 Ga0209233_1004008
1465 Ga0209233_1068717
1466 Ga0209455_1003084
1467 Ga0209455_1020243
1468 Ga0209673_1038344
1469 Ga0209564_1004362
1470 Ga0209758_1001334
1471 Ga0209758_1001430
1472 Ga0209758_1010151
1473 Ga0209758_1060114
1474 Ga0209256_1016536
1475 Ga0207426_1019126
1476 Ga0207426_1040571
1477 Ga0207697_10042628
1478 Ga0207697_10088841
1479 Ga0207697_10344185
1480 Ga0207656_10032151
1481 Ga0207696_1036713
1482 Ga0207682_10283300
1483 Ga0207710_10091825
1484 Ga0207710_10238009
1485 Ga0207710_10245697
1486 Ga0207688_10014273
1487 Ga0207688_10020081
1488 Ga0207680_10120789
1489 Ga0207680_10206093
1490 Ga0207680_10590501
1491 Ga0207647_10001937
1492 Ga0207647_10070938
1493 Ga0207685_10186238
1494 Ga0207645_10106103
1495 Ga0207645_10227334
1496 Ga0207643_10040804
1497 Ga0207643_10336806
1498 Ga0207643_11035280
1499 Ga0207705_10088803
1500 Ga0207705_10796273
1501 Ga0207654_10011983
1502 Ga0207654_10036092
1503 Ga0207654_10410139
1504 Ga0207654_10897793
1505 Ga0207707_10000478
1506 Ga0207707_10057426
1507 Ga0207695_10000240
1508 Ga0207695_10322570
1509 Ga0207671_10002558
1510 Ga0207671_10052054
1511 Ga0207671_10115950
1512 Ga0207671_10155073
1513 Ga0207671_10989369
1514 Ga0207663_10896480
1515 Ga0207660_10020143
1516 Ga0207660_10027527
1517 Ga0207662_10062100
1518 Ga0207662_10743184
1519 Ga0207657_10110081
1520 Ga0207657_10207786
1521 Ga0207657_10638567
1522 Ga0207657_11254369
1523 Ga0207649_11226632
1524 Ga0207652_10308075
1525 Ga0207681_10229584
1526 Ga0207681_10573408
1527 Ga0207694_10710797
1528 Ga0207694_10715636
1529 Ga0207650_10028309
1530 Ga0207650_10123908
1531 Ga0207659_10514272
1532 Ga0207659_10774291
1533 Ga0207687_10011179
1534 Ga0207687_10028107
1535 Ga0207687_10041102
1536 Ga0207644_10020411
1537 Ga0207644_10213911
1538 Ga0207644_10259509
1539 Ga0207644_10523805
1540 Ga0207690_10222175
1541 Ga0207690_10691854
1542 Ga0207690_11249689
1543 Ga0207706_10104072
1544 Ga0207686_10204210
1545 Ga0207709_10013704
1546 Ga0207709_10527947
1547 Ga0207709_10535462
1548 Ga0207670_10836763
1549 Ga0207670_11163308
1550 Ga0207670_11843814
1551 Ga0207704_11093415
1552 Ga0207691_10009643
1553 Ga0207691_10655611
1554 Ga0207691_10784162
1555 Ga0207711_10064934
1556 Ga0207711_11200408
1557 Ga0207689_10040232
1558 Ga0207689_10063086
1559 Ga0207689_10304415
1560 Ga0207661_10009026
1561 Ga0207679_11027688
1562 Ga0207667_10022463
1563 Ga0207667_10382338
1564 Ga0207667_11266069
1565 Ga0207651_10135535
1566 Ga0207651_10669418
1567 Ga0207651_11585282
1568 Ga0207712_10147159
1569 Ga0207712_10321395
1570 Ga0207712_11119652
1571 Ga0207668_10034775
1572 Ga0207668_10052349
1573 Ga0207668_10340680
1574 Ga0207668_10395125
1575 Ga0207668_10904641
1576 Ga0207668_11153740
1577 Ga0207668_11838032
1578 Ga0207640_10563802
1579 Ga0207640_11506351
1580 Ga0207658_10201951
1581 Ga0207658_10658323
1582 Ga0207658_11801995
1583 Ga0207677_10053550
1584 Ga0207677_10229190
1585 Ga0207677_11801406
1586 Ga0207677_12139832
1587 Ga0207703_10126988
1588 Ga0207703_10511544
1589 Ga0207703_11461328
1590 Ga0207703_12032092
1591 Ga0207639_10344819
1592 Ga0207639_10468293
1593 Ga0207639_10502570
1594 Ga0207639_11203013
1595 Ga0207678_10012818
1596 Ga0207678_10471447
1597 Ga0207678_10580622
1598 Ga0207678_10645133
1599 Ga0207678_10681004
1600 Ga0207678_11066325
1601 Ga0207708_10022932
1602 Ga0207708_10252280
1603 Ga0207702_10456464
1604 Ga0207702_10530225
1605 Ga0207641_10310055
1606 Ga0207641_10314699
1607 Ga0207641_10795253
1608 Ga0207641_10917072
1609 Ga0207641_11245702
1610 Ga0207641_12111748
1611 Ga0207648_10072960
1612 Ga0207648_10118811
1613 Ga0207676_10025018
1614 Ga0207676_10272374
1615 Ga0207674_10083021
1616 Ga0207674_10181900
1617 Ga0207675_100154218
1618 Ga0207675_100175572
1619 Ga0207675_100193299
1620 Ga0207675_100194966
1621 Ga0207675_100261644
1622 Ga0207675_101072413
1623 Ga0207683_10059172
1624 Ga0207683_10125988
1625 Ga0207683_10263047
1626 Ga0207683_10648522
1627 Ga0207683_10740354
1628 Ga0207698_10180256
1629 Ga0207698_10616640
1630 Ga0207698_11542925
1631 Ga0207698_11597216
1632 Ga0209389_1000188
1633 Ga0209489_110855
1634 Ga0209700_100437
1635 Ga0209813_10002512
1636 Ga0209813_10097645
1637 Ga0209813_10460358
1638 Ga0207428_10024068
1639 Ga0268266_10000466
1640 Ga0268266_10012380
1641 Ga0268266_10027532
1642 Ga0268266_10586296
1643 Ga0268266_11183041
1644 Ga0268265_10031314
1645 Ga0268265_10044494
1646 Ga0268265_10246585
1647 Ga0268265_10659584
1648 Ga0268265_12055668
1649 Ga0268264_10000073
1650 Ga0268264_10175182
1651 Ga0268264_10402731
1652 Ga0268264_10532285
1653 Ga0268264_10563134
1654 Ga0268264_10731562
1655 Ga0307517_10494170
1656 Ga0307511_10171616
1657 Ga0265316_10148218
1658 Ga0307513_10430971
1659 Ga0307509_10036522
1660 Ga0307509_10089522
1661 Ga0307509_10146091
1662 Ga0307509_10189770
1663 Ga0307509_10223145
1664 Ga0307408_100185954
1665 Ga0307508_10885365
1666 Ga0265314_10177011
1667 Ga0307516_10556250
1668 Ga0307516_10698180
1669 Ga0307516_10774113
1670 Ga0307518_10346217
1671 Ga0307407_10336850
1672 Ga0307412_12286827
1673 Ga0307416_100541436
1674 Ga0307415_100187236
1675 Ga0307507_10144079
1676 Ga0307510_10036477
1677 Ga0307510_10129996
1678 Ga0373958_0001988
1679 Ga0373928_0036118
1680 Ga0373929_0029014
1681 Ga0373949_0121630
1682 Ga0373951_0047234
1683 Ga0373952_0090821
1684 Ga0373923_0129565
1685 Ga0373932_0076071
1686 Ga0373939_0234899
1687 Ga0373939_0418046
1688 Ga0373941_0144968
1689 Ga0373954_0360536
1690 Ga0373957_0299243
1691 Ga0373960_0019472
1692 Ga0373960_0341758
1693 Ga0373962_0076424
1694 Ga0373931_0217236
1695 Ga0373935_0026726
1696 Ga0373927_0241510
1697 Ga0373927_0275021
1698 Ga0373933_0089850
1699 Ga0373937_0306843
1700 Ga0373925_0013597
1701 Ga0373925_0647629
1702 Ga0395900_0000394
1703 Ga0395898_0011041
1704 Ga0395905_0362238
1705 Ga0395905_0623811
1706 Ga0395905_1264088
1707 Ga0436364_0163528
1708 Ga0395901_0125444
1709 Ga0436365_0394164
1710 Ga0436365_1900573
1711 Ga0436363_0822942
1712 Ga0436362_0044086
1713 Ga0451789_0546568
1714 Ga0451793_1203669
1715 Ga0451793_1654678
1716 Ga0451795_0738676
1717 Ga0451835_0046854
1718 Ga0451839_0396340
1719 Ga0451839_0706751
1720 Ga0451843_1565422
1721 Ga0451853_0703402
1722 Ga0466969_0158289
1723 Ga0466972_0000576
1724 Ga0466972_0000829
1725 Ga0466972_0051840
1726 Ga0466972_0465207
1727 Ga0466965_0047681
1728 Ga0466965_0432140
1729 Ga0466966_0001892
1730 Ga0466961_0000016
1731 Ga0466963_0060568
1732 Ga0466964_0116894
1733 Ga0466964_0463375
1734 Ga0466968_0002646
1735 Ga0466968_0055352
1736 Ga0466957_0070058
1737 Ga0466960_0002702
1738 Ga0466960_0385823
1739 Ga0466960_0628537
1740 Ga0466959_0014272
1741 Ga0466959_0984979
1742 Ga0466967_0111185
1743 Ga0495617_005506
1744 Ga0495617_050771
1745 Ga0495617_112171
1746 Ga0495592_0017226
1747 Ga0495592_0486425
1748 Ga0495603_0009571
1749 Ga0495603_0247025
1750 Ga0495590_0087600
1751 Ga0495590_0161955
1752 Ga0495590_0234684
1753 Ga0495590_0342438
1754 Ga0495591_118921
1755 Ga0495629_0123577
1756 Ga0495629_0160170
1757 Ga0495629_0713273
1758 Ga0495638_0056812
1759 Ga0495638_0057598
1760 Ga0495641_0105202
1761 Ga0495651_0003955
1762 Ga0495651_0004024
1763 Ga0495650_0100173
1764 Ga0495605_0062663
1765 Ga0495605_0249715
1766 Ga0495639_0021929
1767 Ga0495664_0108404
1768 Ga0495584_0133303
1769 Ga0495584_0189537
1770 Ga0495584_0534936
1771 Ga0495585_0276589
1772 Ga0495585_0376873
1773 Ga0495585_0485432
1774 Ga0495594_0019047
1775 Ga0495596_0216225
1776 Ga0495596_0303239
1777 Ga0495607_0342425
1778 Ga0495606_0082372
1779 Ga0495606_0411648
1780 Ga0495606_0444541
1781 Ga0495608_0088051
1782 Ga0495608_0099737
1783 Ga0495610_0032441
1784 Ga0495616_0024995
1785 Ga0495616_0185804
1786 Ga0495618_0491840
1787 Ga0495618_0866145
1788 Ga0495620_0045961
1789 Ga0495620_0075873
1790 Ga0495628_0030495
1791 Ga0495630_0101141
1792 Ga0495631_0150038
1793 Ga0495631_0164998
1794 Ga0495631_0481188
1795 Ga0495632_0249599
1796 Ga0495643_0073363
1797 Ga0495643_0256449
1798 Ga0495643_0343234
1799 Ga0495644_0265228
1800 Ga0495648_0112696
1801 Ga0495648_0263521
1802 Ga0495648_0278276
1803 Ga0495663_0107021
1804 Ga0495666_0203094
1805 Ga0495652_0026602
1806 Ga0495652_0386975
1807 Ga0495665_0371894
1808 Ga0495640_0006053
1809 Ga0495587_0007178
1810 Ga0495587_0637738
1811 Ga0495598_0043774
1812 Ga0495609_0017043
1813 Ga0495609_0105173
1814 Ga0495609_0212452
1815 Ga0495621_0296646
1816 Ga0495645_0007485
1817 Ga0495622_0016496
1818 Ga0495622_0042578
1819 Ga0495622_0070962
1820 Ga0495667_0003371
1821 Ga0495656_0016609
1822 Ga0495656_0036339
1823 Ga0495656_0143295
1824 Ga0495656_0159526
1825 Ga0495656_0296052
1826 Ga0495656_0764037
1827 Ga0495668_0027417
1828 Ga0495668_0054002
1829 Ga0495668_0283635
1830 Ga0495634_0020124
1831 Ga0495634_0027702
1832 Ga0495611_0245574
1833 Ga0495611_0332229
1834 Ga0495625_0068192
1835 Ga0495625_0182994
1836 Ga0495625_0298530
1837 Ga0495625_0309833
1838 Ga0495625_0358165
1839 Ga0495625_0695993
1840 Ga0495635_0000802
1841 Ga0495659_0021517
1842 Ga0495659_0059789
1843 Ga0495659_0150488
1844 Ga0495659_0512110
1845 Ga0495661_0066273
1846 Ga0495661_0069841
1847 Ga0495588_0013908
1848 Ga0495588_0035826
1849 Ga0495588_0615626
1850 Ga0495657_0002404
1851 Ga0495657_0029407
1852 Ga0495599_0019977
1853 Ga0495599_0495678
1854 Ga0495623_0002269
1855 Ga0495647_0083452
1856 Ga0495669_0021548
1857 Ga0495669_0038661
1858 Ga0495669_0067239
1859 Ga0495613_0102632
1860 Ga0495624_0110949
1861 Ga0495624_0480375
1862 Ga0495670_0026042
1863 Ga0495649_0019021
1864 Ga0495649_0130513
1865 Ga0495649_0197727
1866 Ga0495589_0277902
1867 Ga0495589_0311943
1868 Ga0495589_0338087
1869 Ga0495589_0410466
1870 Ga0495600_0003267
1871 Ga0495600_0016450
1872 Ga0495581_0039503
1873 Ga0495581_0098788
1874 Ga0495604_0000420
1875 Ga0495604_0016406
1876 Ga0495604_0305546
1877 Ga0495604_0528485
1878 Ga0495636_0364049
1879 Ga0495674_0050231
1880 Ga0495674_0519370
1881 Ga0495672_0293264
1882 Ga0495676_0020250
1883 Ga0495676_0125668
1884 Ga0495680_0001714
1885 Ga0495680_0787681
1886 Ga0495683_0207572
1887 Ga0495683_0382543
1888 Ga0495687_015494
1889 Ga0495687_091254
1890 Ga0495675_0078222
1891 Ga0495677_0051520
1892 Ga0495677_0096336
1893 Ga0495685_026230
1894 Ga0495673_0175865
1895 Ga0495673_0266012
1896 Ga0495684_0718322
1897 Ga0495686_0393349
1898 Ga0495602_0045327
1899 Ga0495602_0361174
1900 Ga0495615_0019659
1901 Ga0495615_0329960
1902 Ga0496100_0110992
1903 Ga0496100_0519332
1904 Ga0496100_0796568
1905 Ga0496101_0532717
1906 Ga0496101_0913439
1907 Ga0496101_0954275
1908 Ga0496102_0016889
1909 Ga0496102_0058823
1910 Ga0496102_0369010
1911 Ga0496102_0406365
1912 Ga0496103_0026103
1913 Ga0496103_0211012
1914 Ga0496103_0325780
1915 Ga0496104_0004495
1916 Ga0496104_0213685
1917 Ga0496104_0389271
1918 Ga0496105_0000450
1919 Ga0496105_0159112
1920 Ga0496105_0552093
1921 Ga0496106_0001765
1922 Ga0496106_0155935
1923 Ga0496106_0178101
1924 Ga0496106_0224327
1925 Ga0496106_0615217
1926 Ga0496106_0756664
1927 Ga0496107_0146004
1928 Ga0496107_0198028
1929 Ga0496107_0249019
1930 Ga0496107_0310916
1931 Ga0496107_0363199
1932 Ga0496108_0031474
1933 Ga0496108_0083019
1934 Ga0496108_0525779
1935 Ga0496108_1244075
1936 Ga0496109_0372705
1937 Ga0496109_0517248
1938 Ga0496110_0218896
1939 Ga0496110_0501973
1940 Ga0496110_1106724
1941 Ga0496111_0304646
1942 Ga0496112_0036617
1943 Ga0496112_0235828
1944 Ga0496113_0056733
1945 Ga0496113_0057770
1946 Ga0496113_1221636
1947 Ga0496114_0014151
1948 Ga0496114_0309860
1949 Ga0496115_0368681
1950 Ga0496116_0021451
1951 Ga0496116_0181305
1952 Ga0496116_0227967
1953 Ga0496117_0009249
1954 Ga0496117_0241781
1955 Ga0496118_0010771
1956 Ga0496118_0019813
1957 Ga0496118_0121508
1958 Ga0496118_0285017
1959 Ga0496118_0631313
1960 Ga0496119_0002327
1961 Ga0496119_0019511
1962 Ga0496119_0155572
1963 Ga0496119_0271356
1964 Ga0496119_0464475
1965 Ga0496120_0013616
1966 Ga0496120_0094719
1967 Ga0496121_0000218
1968 Ga0496121_0036054
1969 Ga0496121_0059772
1970 Ga0496121_0084438
1971 Ga0496121_0085839
1972 Ga0496121_0093040
1973 Ga0496121_0158219
1974 Ga0496121_0185671
1975 Ga0496121_0343395
1976 Ga0496121_0470250
1977 Ga0496124_0001579
1978 Ga0496124_0197564
1979 Ga0496124_0238592
1980 Ga0496124_0287818
1981 Ga0496124_0472283
1982 Ga0496125_0016330
1983 Ga0496125_0040078
1984 Ga0496125_0114617
1985 Ga0496125_0258420
1986 Ga0496126_0021157
1987 Ga0496126_0050772
1988 Ga0496126_0263474
1989 Ga0496126_0452308
1990 Ga0496126_0896951
1991 Ga0495682_0273227
1992 Ga0495682_0315231
1993 Ga0501067_0192603
1994 Ga0501069_0095952
1995 Ga0501071_0626498
1996 Ga0501081_0417058
1997 nmdc:mga03683_26959_c1
1998 nmdc:mga03n38_111245_c1
1999 nmdc:mga03n38_321600_c1
2000 nmdc:mga03n38_538479_c1
2001 nmdc:mga00v17_234290_c1
2002 nmdc:mga00v17_471885_c1
2003 nmdc:mga00v17_8593_c1
2004 nmdc:mga0yw44_241757_c1
2005 nmdc:mga0yw44_507846_c1
2006 nmdc:mga0yw44_74854_c1
2007 nmdc:mga0k408_333468_c1
2008 nmdc:mga0k408_48578_c1
2009 nmdc:mga06z11_246755_c1
2010 nmdc:mga06z11_47440_c1
2011 nmdc:mga06z11_90175_c1
2012 nmdc:mga04h51_129297_c1
2013 nmdc:mga04h51_55158_c1
2014 nmdc:mga07m45_265884_c1
2015 nmdc:mga07m45_85220_c1
2016 nmdc:mga05p37_1606391_c1
2017 nmdc:mga08y16_1152388_c1
2018 nmdc:mga08y16_168220_c1
2019 nmdc:mga0n895_90315_c1
2020 nmdc:mga0rr50_91695_c1
2021 nmdc:mga0a205_11483_c1
2022 nmdc:mga0a205_484773_c1
2023 nmdc:mga0sz30_227651_c1
2024 nmdc:mga0sz30_448206_c1
2025 Ga0500610_0225658
2026 Ga0500635_0162024
2027 Ga0495595_0056594
2028 Ga0500583_0151298
2029 Ga0500566_0200001
2030 Ga0500566_0488435
2031 Ga0500640_076091
2032 Ga0500641_0060693
2033 Ga0500650_0117657
2034 Ga0500650_0279891
2035 Ga0500556_0098360
2036 Ga0500569_006929
2037 Ga0500572_025316
2038 Ga0500594_0067539
2039 Ga0500595_000781
2040 Ga0500595_174302
2041 Ga0500607_056108
2042 Ga0500621_201440
2043 Ga0500626_212931
2044 Ga0500658_0144677
2045 Ga0500559_0042173
2046 Ga0500559_0051602
2047 Ga0500568_0071365
2048 Ga0500577_0402999
2049 Ga0500588_0166520
2050 Ga0500590_049823
2051 Ga0500590_203985
2052 Ga0500590_371381
2053 Ga0500616_0029003
2054 Ga0500619_130219
2055 Ga0500624_007578
2056 Ga0500627_0106212
2057 Ga0500634_0215329
2058 Ga0500634_0224958
2059 Ga0500638_184129
2060 Ga0500638_332306
2061 Ga0500636_0000160
2062 Ga0500637_0061113
2063 Ga0500637_0388736
2064 Ga0500637_0396660
2065 Ga0500649_195563
2066 Ga0500657_208816
2067 Ga0500609_015225
2068 Ga0500596_009479
2069 Ga0500596_054490
2070 Ga0500599_000996
2071 Ga0500601_000253
2072 Ga0500661_016452
2073 Ga0500661_031259
2074 Ga0587086_097612
2075 Ga0587079_046617
2076 2507510734
2077 2508544534
2078 2511398701
2079 2513643094
2080 2513721181
2081 2513877886
2082 2514016261
2083 2515627985
2084 2517105108
2085 2528854294
2086 2617353765
2087 2617378832
2088 2818242613
2089 2824601885
2090 2824612801
2091 2824653220
2092 2824662562
2093 2824673415
2094 2824680994
2095 2824689543
2096 2824697324
2097 2824707893
2098 2824734676
2099 2824747806
2100 2824759015
2101 2824763921
2102 2838125258
2103 2841948605
2104 2841951501
2105 2841960503
2106 2841968483
2107 2841976317
2108 2841987679
2109 2844317181
2110 2847933875
2111 2847944551
2112 2874592313
2113 2874634591
2114 2874650080
2115 2876775391
2116 2876826256
2117 2879079521
2118 2879087405
2119 2879109628
2120 2879132232
2121 2879146881
2122 2885367288
2123 2885418434
2124 2888381869
2125 2888388769
2126 2888422490
2127 2903735165
2128 2904720495
2129 2906607220
2130 2906643819
2131 2908778122
2132 2922371820
2133 2922389281
2134 2922399472
2135 2929616830
2136 2929625573
2137 2932791146
2138 2932799197
2139 2932803808
2140 2932811671
2141 2932826613
2142 2932834241
2143 2933577888
2144 2935616088
2145 2935623937
2146 2935646935
2147 2935654894
2148 2935663836
2149 2935674085
2150 2935684724
2151 2935691578
2152 2935699453
2153 2935707680
2154 2935719412
2155 2935728988
2156 2935737771
2157 2935747147
2158 2935758053
2159 2935766689
2160 2935770680
2161 2935782913
2162 2935787034
2163 2935795082
2164 2935809298
2165 2935817811
2166 2935819984
2167 2935836250
2168 2935845159
2169 2935850006
2170 2935862213
2171 2935870860
2172 2935881253
2173 2935884314
2174 2935915159
2175 2935923836
2176 2935932656
2177 2935941260
2178 2935949326
2179 2935958021
2180 2935963771
2181 2935974337
2182 2935979527
2183 2935991612
2184 2935999155
2185 2936005576
2186 2936017992
2187 2936026495
2188 2936035098
2189 2936042104
2190 2936053248
2191 2936059231
2192 2940564036
2193 2941535026
2194 2941545488
2195 3005508201
2196 3005596883
2197 3005720288
2198 8006966418
2199 8016515869
2200 8016523412
2201 8016541182
2202 8016552070
2203 8016560448
2204 8016566573
2205 8016589882
2206 8016598350
2207 8016604451
2208 8016621030
2209 8016628974
2210 8016633549
2211 8017060642
2212 8019536613
2213 8019542848
2214 8019547898
2215 8019580154
2216 8019587873
2217 8019603454
2218 8019615073
2219 8019625627
2220 8019636663
2221 8019642962
2222 8019664464
2223 8019674056
2224 8019682068
2225 8019693527
2226 8055748476
2227 8056678277
2228 8056976278

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

42

114

0.89

PF00034

Cytochrom_C

Cytochrome c

44

118

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d0w-assembly2.cif.gz_B crystal structure of cytochrome cl from hyphomicrobium denitrificans 0.7852 38 112
7c90-assembly1.cif.gz_C crystal structure of cytochrome cl from the marine methylotrophic bacterium methylophaga aminisulfidivorans mpt (ma-cytcl) 0.7654 39 114
7c90-assembly1.cif.gz_D crystal structure of cytochrome cl from the marine methylotrophic bacterium methylophaga aminisulfidivorans mpt (ma-cytcl) 0.7639 41 114
1yiq-assembly1.cif.gz_A molecular cloning and structural analysis of quinohemoprotein alcohol dehydrogenase adhiig from pseudomonas putida hk5. compariison to the other quinohemoprotein alcohol dehydrogenase adhiib found in the same microorganism. 0.7616 39 115
5mxy-assembly1.cif.gz_A kustc0563 c-type cytochrome 0.7451 45 117
ID Description Score Start End Superfamily
2d0wB00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7852 38 112 1.10.760.10
1yiqA02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.764 39 115 1.10.760.10
1kv9A02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.724 41 115 1.10.760.10
1n15B01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7145 40 113 1.10.760.10
4eifA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7126 44 115 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A7Y8UIS6-F1-model_v4 deleted 0.8533 30 118
AF-A0A537N7Y1-F1-model_v4 Cytochrome c 0.8311 33 114 GO:0009055
GO:0020037
GO:0046872
AF-A0A1Q3WW55-F1-model_v4 Cytochrome c domain-containing protein 0.827 32 118 GO:0009055
GO:0020037
GO:0046872
AF-E8X6B0-F1-model_v4 Cytochrome c class I 0.8252 33 117 GO:0009055
GO:0020037
GO:0046872
AF-A0A537V2L3-F1-model_v4 Cytochrome c 0.824 27 114 GO:0009055
GO:0020037
GO:0046872

Map