F490160

General Info

Members Datasets Scaffolds Average Seq Length
1106 855 447 283

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0383784|Ga0501076_0383784_136_1026
Length 296
Sequence MNSGGSQTRAPGQVKEVTSLSNPLVKDIRALALKKFRDREGAFIAEGLKLVIDALDQGWSIRTLVFAKAGLGNPAVEKAAARTVAAGGTVLEVSEKVLGAITRRDNPQMVVGVFAQKFAPLASIKPSGDDVWVALDRVRDPGNLGTIIRTVDAAGAKGIILVGDCTDPFSLETVRATMGSIFSVPIAKASVETFLAWRRDFFGLVAGTYLKGAVDYRSVDFGGRPVLLLMGNEQQGLPDDLAAGCDRLLRIPQAGRADSLNLAVATGVMLFEVRRKALKIDAGPATWECALFFLMC

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
10 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
11 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
12 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
13 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
14 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
15 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
16 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
17 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
18 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
19 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
20 2512875024 Mesorhizobium loti R88b Isolate Nodule
21 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
22 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
23 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
24 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
25 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
26 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
27 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
28 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
31 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
32 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
33 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
34 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
35 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
36 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
37 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
38 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
39 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
40 2516143018 Ensifer sp. BR816 Isolate Nodule
41 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
42 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
43 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
44 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
45 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
46 2519899620 Rhizobium sp. Pop5 Isolate Nodule
47 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
48 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
49 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
50 2534681786 Brucella suis 92/29 Isolate Unclassified
51 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
52 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
53 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
54 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
55 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
56 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
57 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
58 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
59 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
60 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
61 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
62 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
63 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
64 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
65 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
66 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
67 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
68 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
69 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
70 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
71 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
72 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
73 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
74 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
75 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
76 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
77 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
78 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
79 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
80 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
81 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
82 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
83 2643221582 Rhizobium sp. Root651 Isolate Unclassified
84 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
85 2643221618 Ensifer sp. Root231 Isolate Unclassified
86 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
87 2643221626 Ensifer sp. Root31 Isolate Unclassified
88 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
89 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
90 2643221655 Ensifer sp. Root1252 Isolate Unclassified
91 2643221659 Ensifer sp. Root127 Isolate Unclassified
92 2643221688 Rhizobium sp. Root482 Isolate Unclassified
93 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
94 2643221693 Rhizobium sp. Root491 Isolate Unclassified
95 2643221698 Ensifer sp. Root142 Isolate Unclassified
96 2643221712 Ensifer sp. Root258 Isolate Unclassified
97 2643221718 Rhizobium sp. Root268 Isolate Unclassified
98 2643221719 Rhizobium sp. Root274 Isolate Unclassified
99 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
100 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
101 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
102 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
103 2718218365 Rhizobium sp. N731 Isolate Nodule
104 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
105 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
106 2728369397 Rhizobium sp. N1314 Isolate Nodule
107 2738541293 Rhizobium sp. GV031 Isolate Unclassified
108 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
109 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
110 2738543024 Aminobacter sp. AP02 Isolate Unclassified
111 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
112 2751185800 Brucella pituitosa AA2 Isolate Unclassified
113 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
114 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
115 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
116 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
117 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
118 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
119 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
120 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
121 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
122 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
123 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
124 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
125 2791355261 Rhizobium sp. J15 Isolate Nodule
126 2791355262 Rhizobium sp. M1 Isolate Nodule
127 2791355263 Rhizobium chutanense C5 Isolate Nodule
128 2791355266 Rhizobium sp. L43 Isolate Nodule
129 2791355267 Rhizobium sp. L18 Isolate Nodule
130 2802429633 Rhizobium anhuiense J3 Isolate Nodule
131 2802429634 Rhizobium anhuiense S10 Isolate Nodule
132 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
133 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
134 2802429637 Rhizobium anhuiense C15 Isolate Nodule
135 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
136 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
137 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
138 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
139 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
140 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
141 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
142 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
143 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
144 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
145 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
146 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
147 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
148 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
149 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
150 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
151 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
152 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
153 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
154 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
155 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
156 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
157 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
158 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
159 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
160 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
161 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
162 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
163 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
164 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
165 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
166 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
167 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
168 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
169 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
170 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
171 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
172 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
173 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
174 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
175 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
176 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
177 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
178 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
179 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
180 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
181 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
182 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
183 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
184 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
185 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
186 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
187 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
188 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
189 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
190 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
191 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
192 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
193 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
194 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
195 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
196 2844163670 Ensifer sp. 1H6 Isolate Unclassified
197 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
198 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
199 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
200 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
201 2854911287 Brucella lupini LUP21 Isolate Unclassified
202 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
203 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
204 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
205 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
206 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
207 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
208 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
209 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
210 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
211 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
212 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
213 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
214 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
215 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
216 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
217 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
218 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
219 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
220 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
221 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
222 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
223 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
224 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
225 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
226 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
227 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
228 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
229 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
230 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
231 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
232 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
233 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
234 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
235 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
236 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
237 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
238 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
239 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
240 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
241 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
242 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
243 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
244 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
245 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
246 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
247 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
248 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
249 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
250 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
251 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
252 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
253 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
254 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
255 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
256 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
257 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
258 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
259 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
260 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
261 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
262 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
263 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
264 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
265 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
266 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
267 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
268 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
269 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
270 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
271 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
272 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
273 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
274 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
275 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
276 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
277 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
278 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
279 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
280 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
281 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
282 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
283 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
284 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
285 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
286 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
287 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
288 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
289 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
290 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
291 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
292 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
293 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
294 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
295 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
296 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
297 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
298 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
299 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
300 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
301 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
302 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
303 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
304 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
305 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
306 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
307 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
308 2909042592 Labrys sp. LIt4 Isolate Nodule
309 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
310 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
311 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
312 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
313 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
314 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
315 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
316 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
317 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
318 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
319 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
320 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
321 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
322 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
323 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
324 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
325 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
326 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
327 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
328 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
329 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
330 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
331 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
332 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
333 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
334 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
335 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
336 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
337 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
338 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
339 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
340 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
341 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
342 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
343 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
344 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
345 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
346 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
347 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
348 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
349 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
350 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
351 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
352 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
353 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
354 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
355 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
356 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
357 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
358 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
359 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
360 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
361 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
362 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
363 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
364 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
365 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
366 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
367 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
368 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
369 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
370 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
371 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
372 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
373 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
374 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
375 2936381700 Rhizobium chutanense C16 Isolate Unclassified
376 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
377 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
378 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
379 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
380 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
381 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
382 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
383 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
384 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
385 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
386 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
387 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
388 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
389 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
390 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
391 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
392 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
393 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
394 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
395 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
396 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
397 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
398 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
399 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
400 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
401 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
402 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
403 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
404 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
405 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
406 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
407 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
408 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
409 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
410 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
411 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
412 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
413 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
414 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
415 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
416 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
417 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
418 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
419 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
420 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
421 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
422 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
423 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
424 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
425 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
426 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
427 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
428 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
429 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
430 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
431 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
432 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
433 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
434 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
435 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
436 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
437 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
438 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
439 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
440 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
441 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
442 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
443 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
444 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
445 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
446 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
447 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
448 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
449 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
450 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
451 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
452 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
453 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
454 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
455 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
456 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
457 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
458 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
459 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
460 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
461 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
462 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
463 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
464 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
465 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
466 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
467 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
468 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
469 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
470 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
471 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
472 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
473 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
474 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
475 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
476 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
477 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
478 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
479 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
480 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
481 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
482 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
483 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
484 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
485 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
486 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
487 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
488 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
489 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
490 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
491 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
492 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
493 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
494 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
495 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
496 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
497 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
498 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
499 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
500 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
501 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
502 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
503 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
504 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
505 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
506 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
507 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
508 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
509 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
510 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
511 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
512 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
513 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
514 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
515 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
516 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
517 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
518 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
519 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
520 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
521 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
522 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
523 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
524 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
525 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
526 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
527 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
528 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
529 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
530 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
531 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
532 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
533 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
534 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
535 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
536 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
537 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
538 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
539 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
540 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
541 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
542 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
543 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
544 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
545 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
546 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
547 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
548 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
549 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
550 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
551 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
552 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
553 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
554 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
555 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
556 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
557 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
558 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
559 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
560 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
561 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
562 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
563 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
564 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
565 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
566 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
567 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
568 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
569 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
570 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
571 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
572 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
573 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
574 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
575 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
576 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
577 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
578 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
579 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
580 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
581 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
582 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
583 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
584 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
585 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
586 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
587 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
588 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
589 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
590 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
591 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
592 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
593 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
594 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
595 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
596 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
597 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
598 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
599 2996893221 Rhizobium sp. R635 Isolate Nodule
600 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
601 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
602 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
603 3004167301 Mesorhizobium loti 582 Isolate Unclassified
604 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
605 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
606 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
607 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
608 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
609 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
610 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
611 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
612 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
613 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
614 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
615 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
616 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
617 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
618 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
619 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
620 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
621 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
622 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
623 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
624 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
625 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
626 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
627 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
628 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
629 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
630 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
631 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
632 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
633 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
634 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
635 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
636 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
637 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
638 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
639 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
640 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
641 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
642 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
643 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
644 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
645 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
646 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
647 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
648 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
649 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
650 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
651 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
652 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
653 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
654 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
655 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
656 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
657 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
658 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
659 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
660 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
661 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
662 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
663 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
664 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
665 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
666 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
667 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
668 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
669 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
670 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
671 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
672 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
673 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
674 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
675 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
676 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
677 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
678 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
679 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
680 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
681 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
682 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
683 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
684 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
685 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
686 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
687 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
688 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
689 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
690 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
691 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
692 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
693 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
694 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
695 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
696 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
697 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
698 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
699 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
700 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
701 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
702 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
703 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
704 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
705 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
706 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
707 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
708 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
709 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
710 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
711 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
712 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
713 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
714 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
715 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
716 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
717 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
718 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
719 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
720 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
721 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
722 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
723 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
724 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
725 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
726 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
727 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
728 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
729 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
730 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
731 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
732 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
733 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
734 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
735 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
736 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
737 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
738 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
739 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
740 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
741 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
742 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
743 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
744 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
745 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
746 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
747 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
748 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
749 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
750 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
751 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
752 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
753 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
754 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
755 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
756 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
757 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
758 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
759 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
760 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
761 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
762 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
763 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
764 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
765 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
766 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
767 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
768 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
769 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
770 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
771 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
772 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
773 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
774 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
775 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
776 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
777 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
778 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
779 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
780 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
781 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
782 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
783 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
784 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
785 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
786 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
787 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
788 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
789 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
790 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
791 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
792 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
793 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
794 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
795 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
796 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
797 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
798 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
799 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
800 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
801 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
802 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
803 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
804 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
805 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
806 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
807 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
808 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
809 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
810 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
811 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
812 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
813 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
814 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
815 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
816 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
817 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
818 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
819 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
820 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
821 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
822 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
823 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
824 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
825 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
826 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
827 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
828 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
829 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
830 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
831 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
832 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
833 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
834 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
835 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
836 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
837 8005382845 Rhizobium sp. R634 Isolate Nodule
838 8005395548 Rhizobium sp. R339 Isolate Nodule
839 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
840 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
841 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
842 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
843 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
844 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
845 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
846 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
847 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
848 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
849 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
850 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
851 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
852 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
853 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
854 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
855 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 40.33
Metatranscriptomes 0.09
Isolates 59.58

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 11.21
Nodule 47.56
Rhizoplane 1.08
Rhizosphere 25.14
Stem 0
Stem Tuber 0
Unclassified 14.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10016044 3300001979 Bacteria 2717
2 JGI25157J39369_1000713 3300002741 Bacteria 17898
3 JGI25150J39212_1000735 3300002774 Bacteria 11633
4 JGI25151J46595_10000555 3300003187 Bacteria 34026
5 JGI25151J46595_10001025 3300003187 Bacteria 20943
6 JGI25406J46586_10016349 3300003203 Bacteria 3095
7 JGI25165J46597_1000034 3300003214 Bacteria 292458
8 JGI25153J46596_10000745 3300003215 Bacteria 19895
9 JGI25153J46596_10005618 3300003215 Bacteria 6555
10 JGI25160J50197_1000414 3300003354 Bacteria 27125
11 JGI25161J50226_1003778 3300003374 Bacteria 3360
12 Ga0006562J51391_1008046 3300003578 Bacteria 6060
13 Ga0055542_1001311 3300003762 Bacteria 13175
14 Ga0055526_1009020 3300003771 Bacteria 4874
15 Ga0055526_1009332 3300003771 Bacteria 4740
16 Ga0055524_1002757 3300003775 Bacteria 8835
17 Ga0055524_1004509 3300003775 Bacteria 6415
18 Ga0055524_1007060 3300003775 Bacteria 4818
19 Ga0055528_1005430 3300003790 Bacteria 5942
20 Ga0055528_1007428 3300003790 Bacteria 4847
21 Ga0055528_1013953 3300003790 Bacteria 3009
22 Ga0055540_1000356 3300003792 Bacteria 38898
23 Ga0058692_1002415 3300003856 Bacteria 6260
24 Ga0058692_1003540 3300003856 Bacteria 4798
25 Ga0055543_1000647 3300004625 Bacteria 18553
26 Ga0065165_1025564 3300005262 Bacteria 1960
27 Ga0070658_10241626 3300005327 Bacteria 1531
28 Ga0070670_100000416 3300005331 Bacteria 35091
29 Ga0070663_100108880 3300005455 Bacteria 2079
30 Ga0070663_100175953 3300005455 Bacteria 1657
31 Ga0068867_100106622 3300005459 Bacteria 2147
32 Ga0068853_100397238 3300005539 Bacteria 1290
33 Ga0070665_100014592 3300005548 Bacteria 7884
34 Ga0070665_100028975 3300005548 Bacteria 5573
35 Ga0068855_100324509 3300005563 Bacteria 1701
36 Ga0068856_100121315 3300005614 Bacteria 2616
37 Ga0081455_10138185 3300005937 Bacteria 1896
38 Ga0081539_10000429 3300005985 Bacteria 89452
39 Ga0075365_10006214 3300006038 Bacteria 6548
40 Ga0075365_10025349 3300006038 Bacteria 3752
41 Ga0075365_10043888 3300006038 Bacteria 2928
42 Ga0075365_10072980 3300006038 Bacteria 2312
43 Ga0075365_10073314 3300006038 Bacteria 2307
44 Ga0075365_10102518 3300006038 Bacteria 1961
45 Ga0075365_10227253 3300006038 Bacteria 1310
46 Ga0075368_10000085 3300006042 Bacteria 23151
47 Ga0075368_10047527 3300006042 Bacteria 1699
48 Ga0075364_10004845 3300006051 Bacteria 7795
49 Ga0075364_10058169 3300006051 Bacteria 2533
50 Ga0075364_10270073 3300006051 Bacteria 1157
51 Ga0075362_10001424 3300006177 Bacteria 7630
52 Ga0075367_10015887 3300006178 Bacteria 4102
53 Ga0075367_10030454 3300006178 Bacteria 3094
54 Ga0075367_10073354 3300006178 Bacteria 2062
55 Ga0075367_10076937 3300006178 Bacteria 2014
56 Ga0075367_10105946 3300006178 Bacteria 1722
57 Ga0075369_10085498 3300006186 Bacteria 1403
58 Ga0075366_10128226 3300006195 Bacteria 1530
59 Ga0075366_10176906 3300006195 Bacteria 1295
60 Ga0075370_10004010 3300006353 Bacteria 7078
61 Ga0099826_10001769 3300006948 Bacteria 13372
62 Ga0105244_10061736 3300009036 Bacteria 1885
63 Ga0105240_10190883 3300009093 Bacteria 2409
64 Ga0105240_10379176 3300009093 Bacteria 1597
65 Ga0105241_10082579 3300009174 Bacteria 2519
66 Ga0105237_10027130 3300009545 Bacteria 5849
67 Ga0105237_10391846 3300009545 Bacteria 1394
68 Ga0105238_10001783 3300009551 Bacteria 21532
69 Ga0105238_10625112 3300009551 Bacteria 1086
70 Ga0105249_10418680 3300009553 Bacteria 1373
71 Ga0123341_1000225 3300009765 Bacteria 29755
72 Ga0123342_1021815 3300009766 Bacteria 4438
73 Ga0105239_10064361 3300010375 Bacteria 4026
74 Ga0105239_10090733 3300010375 Bacteria 3371
75 Ga0105239_10141682 3300010375 Bacteria 2679
76 Ga0105239_10156496 3300010375 Bacteria 2545
77 Ga0105239_10348638 3300010375 Bacteria 1671
78 Ga0105239_10519283 3300010375 Bacteria 1355
79 Ga0157373_10019888 3300013100 Bacteria 4884
80 Ga0157371_10000004 3300013102 Bacteria 512593
81 Ga0157370_10000165 3300013104 Bacteria 81259
82 Ga0157369_10176879 3300013105 Bacteria 2246
83 Ga0157374_10470004 3300013296 Bacteria 1260
84 Ga0157378_10183955 3300013297 Bacteria 1967
85 Ga0157372_10367743 3300013307 Bacteria 1676
86 Ga0157372_10399204 3300013307 Bacteria 1602
87 Ga0182008_10003585 3300014497 Bacteria 9297
88 Ga0214544_1000105 3300021320 Bacteria 114109
89 Ga0214542_1000029 3300021321 Bacteria 174097
90 Ga0214542_1029334 3300021321 Bacteria 2264
91 Ga0214543_1000027 3300021327 Bacteria 215065
92 Ga0214543_1000040 3300021327 Bacteria 174142
93 Ga0207425_1000012 3300025245 Bacteria 528324
94 Ga0207425_1001222 3300025245 Bacteria 11284
95 Ga0207425_1009744 3300025245 Bacteria 2375
96 Ga0209026_1000100 3300025250 Bacteria 156131
97 Ga0209677_113343 3300025253 Bacteria 1173
98 Ga0209148_1000069 3300025254 Bacteria 334444
99 Ga0209759_1000438 3300025256 Bacteria 49192
100 Ga0209129_1000110 3300025258 Bacteria 150918
101 Ga0209129_1001057 3300025258 Bacteria 16254
102 Ga0209129_1006102 3300025258 Bacteria 4021
103 Ga0209233_1000028 3300025261 Bacteria 642062
104 Ga0209233_1013679 3300025261 Bacteria 2312
105 Ga0209455_1000135 3300025272 Bacteria 148007
106 Ga0209673_1000063 3300025273 Bacteria 256709
107 Ga0209673_1000677 3300025273 Bacteria 49184
108 Ga0209673_1003382 3300025273 Bacteria 9488
109 Ga0209673_1003971 3300025273 Bacteria 8246
110 Ga0209673_1008183 3300025273 Bacteria 4696
111 Ga0209676_1041953 3300025292 Bacteria 1274
112 Ga0209025_1000024 3300025294 Bacteria 528324
113 Ga0209025_1000037 3300025294 Bacteria 383429
114 Ga0209025_1000235 3300025294 Bacteria 129981
115 Ga0209025_1027930 3300025294 Bacteria 2780
116 Ga0209025_1046820 3300025294 Bacteria 1774
117 Ga0209564_1000138 3300025295 Bacteria 181512
118 Ga0209564_1001016 3300025295 Bacteria 34616
119 Ga0209758_1000150 3300025297 Bacteria 163494
120 Ga0209758_1000911 3300025297 Bacteria 40057
121 Ga0209758_1003440 3300025297 Bacteria 14403
122 Ga0209758_1008601 3300025297 Bacteria 6563
123 Ga0209758_1022005 3300025297 Bacteria 2944
124 Ga0209050_1004886 3300025298 Bacteria 8780
125 Ga0209256_1000781 3300025299 Bacteria 41041
126 Ga0209256_1000911 3300025299 Bacteria 36227
127 Ga0207426_1000070 3300025302 Bacteria 331559
128 Ga0209051_1000197 3300025303 Bacteria 106822
129 Ga0209051_1002357 3300025303 Bacteria 13666
130 Ga0209051_1019603 3300025303 Bacteria 2944
131 Ga0209257_1014934 3300025304 Bacteria 3283
132 Ga0207647_10040277 3300025904 Bacteria 2944
133 Ga0207645_10069558 3300025907 Bacteria 2252
134 Ga0207705_10069918 3300025909 Bacteria 2543
135 Ga0207671_10026100 3300025914 Bacteria 4382
136 Ga0207671_10288998 3300025914 Bacteria 1294
137 Ga0207657_10041291 3300025919 Bacteria 4080
138 Ga0207694_10008697 3300025924 Bacteria 7664
139 Ga0207694_10149690 3300025924 Bacteria 1880
140 Ga0207650_10001599 3300025925 Bacteria 16169
141 Ga0207639_10060837 3300026041 Bacteria 2914
142 Ga0207639_10350182 3300026041 Bacteria 1319
143 Ga0207639_10399663 3300026041 Bacteria 1238
144 Ga0207678_10007884 3300026067 Bacteria 9393
145 Ga0207678_10140650 3300026067 Bacteria 2060
146 Ga0207678_10353287 3300026067 Bacteria 1268
147 Ga0207674_10062282 3300026116 Bacteria 3768
148 Ga0207683_10165747 3300026121 Bacteria 1999
149 Ga0209281_1000319 3300027111 Bacteria 84764
150 Ga0209371_1000009 3300027312 Bacteria 963030
151 Ga0209371_1000350 3300027312 Bacteria 50342
152 Ga0209282_1000390 3300027666 Bacteria 21370
153 Ga0209813_10060545 3300027866 Bacteria 1207
154 Ga0268266_10002934 3300028379 Bacteria 17634
155 Ga0307515_10000029 3300028794 Bacteria 365410
156 Ga0307515_10019713 3300028794 Bacteria 12108
157 Ga0268256_1000010 3300030500 Bacteria 963034
158 Ga0268256_1009935 3300030500 Bacteria 3116
159 Ga0268256_1011570 3300030500 Bacteria 2782
160 Ga0316181_1117224 3300030744 Bacteria 6270
161 Ga0307513_10000338 3300031456 Bacteria 67781
162 Ga0307513_10031617 3300031456 Bacteria 5991
163 Ga0307513_10370815 3300031456 Bacteria 1174
164 Ga0307408_100021050 3300031548 Bacteria 4409
165 Ga0307408_100299738 3300031548 Bacteria 1346
166 Ga0307405_10000625 3300031731 Bacteria 13601
167 Ga0307412_10179237 3300031911 Bacteria 1592
168 Ga0307416_100972437 3300032002 Bacteria 951
169 Ga0307414_10450560 3300032004 Bacteria 1128
170 Ga0316582_0146136 3300036647 Bacteria 1596
171 Ga0395899_0000044 3300037312 Bacteria 248735
172 Ga0395899_0188414 3300037312 Bacteria 1445
173 Ga0395899_0235307 3300037312 Bacteria 1263
174 Ga0395900_0000042 3300037418 Bacteria 242667
175 Ga0395900_0051710 3300037418 Bacteria 4231
176 Ga0395900_0063825 3300037418 Bacteria 3786
177 Ga0395900_0089857 3300037418 Bacteria 3157
178 Ga0395898_0000080 3300037466 Bacteria 242667
179 Ga0395898_0207204 3300037466 Bacteria 1871
180 Ga0395905_0000044 3300037471 Bacteria 242916
181 Ga0395905_0002892 3300037471 Bacteria 18760
182 Ga0395905_0010055 3300037471 Bacteria 9221
183 Ga0395905_0049704 3300037471 Bacteria 3930
184 Ga0395905_0071548 3300037471 Bacteria 3251
185 Ga0395905_0071620 3300037471 Bacteria 3249
186 Ga0395905_0231332 3300037471 Bacteria 1728
187 Ga0395901_0000027 3300038443 Bacteria 244204
188 Ga0395901_0019916 3300038443 Bacteria 6864
189 Ga0395901_0274420 3300038443 Bacteria 1753
190 Ga0395901_0927489 3300038443 Bacteria 851
191 Ga0439466_0034939 3300041411 Bacteria 1702
192 Ga0451798_0293113 3300041458 Bacteria 1992
193 Ga0451847_0064822 3300041503 Bacteria 2038
194 Ga0451847_0391665 3300041503 Bacteria 1483
195 Ga0451851_0964114 3300041507 Bacteria 1249
196 Ga0451843_0791251 3300041509 Bacteria 1475
197 Ga0439449_0083682 3300042007 Bacteria 1177
198 Ga0439449_0103989 3300042007 Bacteria 1050
199 Ga0439462_0028235 3300042015 Bacteria 1483
200 Ga0450909_007959 3300042185 Bacteria 1539
201 Ga0466965_0147495 3300044683 Bacteria 1228
202 Ga0466960_0080164 3300044901 Bacteria 1643
203 Ga0495638_0010639 3300046460 Bacteria 6373
204 Ga0495638_0063313 3300046460 Bacteria 2280
205 Ga0495638_0083946 3300046460 Bacteria 1928
206 Ga0495582_0236257 3300046473 Bacteria 1047
207 Ga0495605_0009076 3300046474 Bacteria 5598
208 Ga0495596_0067410 3300046500 Bacteria 1391
209 Ga0495606_0043403 3300046507 Bacteria 2999
210 Ga0495606_0111411 3300046507 Bacteria 1650
211 Ga0495610_0002588 3300046512 Bacteria 15003
212 Ga0495610_0092146 3300046512 Bacteria 1372
213 Ga0495620_0123357 3300046515 Bacteria 1020
214 Ga0495631_0005728 3300046518 Bacteria 6479
215 Ga0495643_0058364 3300046522 Bacteria 2054
216 Ga0495648_0086268 3300046524 Bacteria 1771
217 Ga0495654_0000070 3300046530 Bacteria 117357
218 Ga0495597_0039857 3300046542 Bacteria 2101
219 Ga0495633_0011884 3300046558 Bacteria 4662
220 Ga0495668_0030556 3300046616 Bacteria 3041
221 Ga0495668_0091137 3300046616 Bacteria 1670
222 Ga0495625_0001943 3300046660 Bacteria 23383
223 Ga0495625_0037698 3300046660 Bacteria 3543
224 Ga0495625_0103387 3300046660 Bacteria 1954
225 Ga0495625_0119729 3300046660 Bacteria 1793
226 Ga0495625_0133800 3300046660 Bacteria 1677
227 Ga0495660_0009127 3300046810 Bacteria 5789
228 Ga0495672_0014128 3300047320 Bacteria 5478
229 Ga0495686_0017458 3300047472 Bacteria 4835
230 Ga0495686_0040841 3300047472 Bacteria 2956
231 Ga0495686_0089052 3300047472 Bacteria 1875
232 Ga0496101_0174857 3300048904 Bacteria 1651
233 Ga0496113_0283958 3300048916 Bacteria 1324
234 Ga0496113_0307749 3300048916 Bacteria 1269
235 Ga0496116_0000240 3300048919 Bacteria 100232
236 Ga0496116_0018317 3300048919 Bacteria 5403
237 Ga0496116_0020742 3300048919 Bacteria 4979
238 Ga0496116_0052957 3300048919 Bacteria 2684
239 Ga0496116_0068279 3300048919 Bacteria 2265
240 Ga0496117_0000002 3300048920 Bacteria 2483758
241 Ga0496117_0042458 3300048920 Bacteria 3318
242 Ga0496118_0000651 3300048921 Bacteria 56681
243 Ga0496118_0095635 3300048921 Bacteria 2027
244 Ga0496118_0136322 3300048921 Bacteria 1566
245 Ga0496118_0161586 3300048921 Bacteria 1384
246 Ga0496119_0010271 3300048922 Bacteria 7892
247 Ga0496119_0087711 3300048922 Bacteria 1775
248 Ga0496119_0094974 3300048922 Bacteria 1685
249 Ga0496119_0197716 3300048922 Bacteria 1043
250 Ga0496120_0000034 3300048923 Bacteria 215228
251 Ga0496120_0001725 3300048923 Bacteria 24868
252 Ga0496120_0013587 3300048923 Bacteria 5471
253 Ga0496121_0000220 3300048924 Bacteria 123930
254 Ga0496121_0038875 3300048924 Bacteria 4203
255 Ga0496121_0131071 3300048924 Bacteria 1876
256 Ga0496122_0000001 3300048925 Bacteria 1827766
257 Ga0496122_0000018 3300048925 Bacteria 426350
258 Ga0496122_0000309 3300048925 Bacteria 107844
259 Ga0496122_0010754 3300048925 Bacteria 9387
260 Ga0496122_0036198 3300048925 Bacteria 3997
261 Ga0496122_0082641 3300048925 Bacteria 2229
262 Ga0496123_0000001 3300048926 Bacteria 1831497
263 Ga0496123_0000015 3300048926 Bacteria 426088
264 Ga0496123_0000396 3300048926 Bacteria 81106
265 Ga0496123_0009540 3300048926 Bacteria 8727
266 Ga0496123_0055175 3300048926 Bacteria 2609
267 Ga0496123_0133904 3300048926 Bacteria 1367
268 Ga0496124_0000083 3300048927 Bacteria 207798
269 Ga0496124_0000532 3300048927 Bacteria 64777
270 Ga0496124_0004069 3300048927 Bacteria 17326
271 Ga0496124_0009307 3300048927 Bacteria 10124
272 Ga0496124_0010687 3300048927 Bacteria 9259
273 Ga0496124_0030901 3300048927 Bacteria 4745
274 Ga0496124_0070190 3300048927 Bacteria 2906
275 Ga0496125_0000001 3300048928 Bacteria 1766138
276 Ga0496125_0002207 3300048928 Bacteria 25974
277 Ga0496125_0018596 3300048928 Bacteria 6596
278 Ga0496125_0024406 3300048928 Bacteria 5561
279 Ga0496125_0094809 3300048928 Bacteria 2222
280 Ga0496125_0104487 3300048928 Bacteria 2074
281 Ga0496126_0000923 3300048929 Bacteria 50791
282 Ga0496126_0018802 3300048929 Bacteria 6831
283 Ga0496126_0067549 3300048929 Bacteria 3194
284 Ga0496126_0084226 3300048929 Bacteria 2804
285 Ga0496126_0116210 3300048929 Bacteria 2326
286 Ga0501031_0000008 3300049568 Bacteria 156304
287 Ga0501031_0016852 3300049568 Bacteria 4745
288 Ga0501031_0018554 3300049568 Bacteria 4529
289 Ga0501031_0057026 3300049568 Bacteria 2545
290 Ga0501031_0092356 3300049568 Bacteria 1975
291 Ga0501032_0000018 3300049569 Bacteria 156275
292 Ga0501032_0000019 3300049569 Bacteria 155168
293 Ga0501032_0037294 3300049569 Bacteria 3315
294 Ga0501032_0043587 3300049569 Bacteria 3038
295 Ga0501032_0052697 3300049569 Bacteria 2741
296 Ga0501032_0104220 3300049569 Bacteria 1879
297 Ga0501032_0121169 3300049569 Bacteria 1729
298 Ga0501033_0000032 3300049570 Bacteria 156304
299 Ga0501033_0000120 3300049570 Bacteria 75504
300 Ga0501033_0000536 3300049570 Bacteria 35334
301 Ga0501033_0000582 3300049570 Bacteria 33881
302 Ga0501033_0006155 3300049570 Bacteria 9412
303 Ga0501033_0012030 3300049570 Bacteria 6606
304 Ga0501033_0081695 3300049570 Bacteria 2370
305 Ga0501033_0119224 3300049570 Bacteria 1916
306 Ga0501033_0229142 3300049570 Bacteria 1320
307 Ga0501033_0245738 3300049570 Bacteria 1269
308 Ga0501033_0282050 3300049570 Bacteria 1172
309 Ga0501034_0000103 3300049571 Bacteria 156304
310 Ga0501034_0000130 3300049571 Bacteria 139568
311 Ga0501034_0002418 3300049571 Bacteria 22602
312 Ga0501034_0010831 3300049571 Bacteria 9473
313 Ga0501034_0052227 3300049571 Bacteria 4118
314 Ga0501034_0055615 3300049571 Bacteria 3982
315 Ga0501034_0069313 3300049571 Bacteria 3537
316 Ga0501036_0000012 3300049572 Bacteria 156304
317 Ga0501036_0000218 3300049572 Bacteria 38481
318 Ga0501036_0011354 3300049572 Bacteria 7372
319 Ga0501037_0000018 3300049573 Bacteria 156304
320 Ga0501037_0000124 3300049573 Bacteria 71522
321 Ga0501037_0000218 3300049573 Bacteria 50780
322 Ga0501037_0020309 3300049573 Bacteria 4903
323 Ga0501037_0042585 3300049573 Bacteria 3336
324 Ga0501037_0387788 3300049573 Bacteria 959
325 Ga0501038_0000017 3300049574 Bacteria 156304
326 Ga0501038_0002051 3300049574 Bacteria 18639
327 Ga0501038_0083578 3300049574 Bacteria 2687
328 Ga0501038_0401518 3300049574 Bacteria 1060
329 Ga0501039_0000024 3300049575 Bacteria 156304
330 Ga0501039_0000028 3300049575 Bacteria 139568
331 Ga0501039_0076539 3300049575 Bacteria 2601
332 Ga0501042_0058678 3300049578 Bacteria 2747
333 Ga0501043_0000003 3300049579 Bacteria 318844
334 Ga0501043_0000113 3300049579 Bacteria 76112
335 Ga0501043_0000414 3300049579 Bacteria 38416
336 Ga0501043_0021339 3300049579 Bacteria 5076
337 Ga0501043_0065090 3300049579 Bacteria 2862
338 Ga0501046_0014956 3300049580 Bacteria 6529
339 Ga0501046_0020037 3300049580 Bacteria 5538
340 Ga0501046_0362822 3300049580 Bacteria 1050
341 Ga0501047_0000117 3300049581 Bacteria 96579
342 Ga0501047_0020728 3300049581 Bacteria 6314
343 Ga0501047_0505959 3300049581 Bacteria 1034
344 Ga0501047_0593832 3300049581 Bacteria 929
345 Ga0501048_0005763 3300049582 Bacteria 9415
346 Ga0501048_0455247 3300049582 Bacteria 917
347 Ga0501067_0020826 3300049583 Bacteria 3629
348 Ga0501067_0030357 3300049583 Bacteria 2998
349 Ga0501067_0092122 3300049583 Bacteria 1683
350 Ga0501068_0002502 3300049584 Bacteria 9762
351 Ga0501068_0116690 3300049584 Bacteria 1663
352 Ga0501068_0142535 3300049584 Bacteria 1502
353 Ga0501069_0000003 3300049585 Bacteria 210301
354 Ga0501069_0010373 3300049585 Bacteria 4930
355 Ga0501070_0000321 3300049586 Bacteria 43662
356 Ga0501070_0000665 3300049586 Bacteria 31670
357 Ga0501070_0001482 3300049586 Bacteria 21004
358 Ga0501070_0035887 3300049586 Bacteria 4140
359 Ga0501070_0038483 3300049586 Bacteria 3990
360 Ga0501070_0070375 3300049586 Bacteria 2897
361 Ga0501071_0010029 3300049587 Bacteria 6332
362 Ga0501072_0125074 3300049588 Bacteria 2048
363 Ga0501073_0004613 3300049589 Bacteria 10355
364 Ga0501073_0010103 3300049589 Bacteria 6940
365 Ga0501073_0035099 3300049589 Bacteria 3565
366 Ga0501073_0035117 3300049589 Bacteria 3564
367 Ga0501074_0000027 3300049590 Bacteria 67860
368 Ga0501074_0007601 3300049590 Bacteria 7844
369 Ga0501074_0035351 3300049590 Bacteria 3620
370 Ga0501074_0049435 3300049590 Bacteria 3036
371 Ga0501076_0383784 3300049592 Bacteria 1155
372 Ga0501080_0000139 3300049742 Bacteria 50565
373 Ga0501080_0001625 3300049742 Bacteria 19124
374 Ga0501080_0011077 3300049742 Bacteria 8251
375 Ga0501080_0092101 3300049742 Bacteria 2815
376 Ga0501080_0120613 3300049742 Bacteria 2430
377 Ga0501083_0000024 3300049744 Bacteria 123029
378 Ga0501035_0000040 3300049822 Bacteria 156262
379 Ga0501035_0000083 3300049822 Bacteria 117302
380 Ga0501035_0000201 3300049822 Bacteria 72627
381 Ga0501035_0001357 3300049822 Bacteria 25189
382 Ga0501035_0001444 3300049822 Bacteria 24353
383 Ga0501035_0003722 3300049822 Bacteria 14538
384 Ga0501035_0005117 3300049822 Bacteria 12416
385 Ga0501035_0005789 3300049822 Bacteria 11649
386 Ga0501035_0006120 3300049822 Bacteria 11327
387 Ga0501035_0017381 3300049822 Bacteria 6632
388 Ga0501035_0278145 3300049822 Bacteria 1415
389 Ga0501044_0000016 3300049823 Bacteria 231626
390 Ga0501044_0000040 3300049823 Bacteria 156304
391 Ga0501044_0003099 3300049823 Bacteria 18829
392 Ga0501044_0018152 3300049823 Bacteria 7544
393 Ga0501044_0037694 3300049823 Bacteria 5052
394 Ga0501044_0126723 3300049823 Bacteria 2550
395 Ga0501044_0159056 3300049823 Bacteria 2237
396 Ga0501044_0294201 3300049823 Bacteria 1554
397 Ga0501044_0353566 3300049823 Bacteria 1388
398 Ga0501044_0460944 3300049823 Bacteria 1176
399 Ga0501044_0575221 3300049823 Bacteria 1021
400 Ga0501044_0595124 3300049823 Bacteria 999
401 Ga0501045_0009290 3300049824 Bacteria 6877
402 nmdc:mga03683_18865_c1 3300050489 Bacteria 2627
403 nmdc:mga03n38_240941_c1 3300050490 Bacteria 952
404 nmdc:mga03n38_35569_c1 3300050490 Bacteria 2135
405 nmdc:mga00v17_2996_c1 3300050491 Bacteria 8679
406 nmdc:mga00v17_41256_c1 3300050491 Bacteria 2771
407 nmdc:mga00v17_7106_c1 3300050491 Bacteria 5963
408 nmdc:mga00v17_8212_c1 3300050491 Bacteria 5612
409 nmdc:mga0yw44_12630_c1 3300050492 Bacteria 4412
410 nmdc:mga0yw44_1843_c1 3300050492 Bacteria 8705
411 nmdc:mga0yw44_186248_c1 3300050492 Bacteria 1368
412 nmdc:mga0yw44_23409_c1 3300050492 Bacteria 3479
413 nmdc:mga0yw44_3578_c1 3300050492 Bacteria 6928
414 nmdc:mga0yw44_42223_c1 3300050492 Bacteria 2718
415 nmdc:mga0yw44_69588_c1 3300050492 Bacteria 2180
416 nmdc:mga0yw44_7601_c1 3300050492 Bacteria 5344
417 nmdc:mga0k408_77511_c1 3300050493 Bacteria 1944
418 nmdc:mga06z11_197491_c1 3300050494 Bacteria 1167
419 nmdc:mga06z11_5987_c1 3300050494 Bacteria 4915
420 nmdc:mga06z11_6107_c1 3300050494 Bacteria 4875
421 nmdc:mga04h51_39039_c1 3300050495 Bacteria 1541
422 nmdc:mga04h51_72368_c1 3300050495 Bacteria 1206
423 nmdc:mga07m45_104620_c1 3300050496 Bacteria 1628
424 nmdc:mga07m45_1262_c1 3300050496 Bacteria 11509
425 nmdc:mga07m45_15785_c1 3300050496 Bacteria 4036
426 nmdc:mga07m45_73203_c1 3300050496 Bacteria 1951
427 nmdc:mga0sz30_70_c1 3300050516 Bacteria 39892
428 nmdc:mga0sz30_80138_c1 3300050516 Bacteria 1412
429 Ga0500610_0174851 3300053079 Bacteria 1057
430 Ga0495655_0002792 3300053083 Bacteria 2809
431 Ga0500618_000565 3300053125 Bacteria 22969
432 Ga0500658_0001181 3300053134 Bacteria 10641
433 Ga0500559_0002567 3300053136 Bacteria 9306
434 Ga0500561_0000112 3300053137 Bacteria 15641
435 Ga0500568_0001323 3300053139 Bacteria 16244
436 Ga0500573_0015270 3300053140 Bacteria 4350
437 Ga0500590_110537 3300053148 Bacteria 1304
438 Ga0500616_0000652 3300053153 Bacteria 41596
439 Ga0500616_0001070 3300053153 Bacteria 28660
440 Ga0500616_0028539 3300053153 Bacteria 3074
441 Ga0500622_0000946 3300053156 Bacteria 24704
442 Ga0500624_000650 3300053157 Bacteria 9162
443 Ga0500627_0049487 3300053158 Bacteria 1828
444 Ga0500627_0080941 3300053158 Bacteria 1448
445 Ga0500627_0096079 3300053158 Bacteria 1328
446 Ga0500636_0000022 3300053177 Bacteria 93090
447 Ga0501082_0031083 3300060353 Bacteria 4602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0002418 Ga0501034_0002418_4683_5405 240
2 3300046515 Ga0495620_0123357 Ga0495620_0123357_12_746 243
3 3300049582 Ga0501048_0455247 Ga0501048_0455247_121_852 243
4 3300053079 Ga0500610_0174851 Ga0500610_0174851_313_1047 243
5 3300049571 Ga0501034_0055615 Ga0501034_0055615_1714_2529 256
6 3300047320 Ga0495672_0014128 Ga0495672_0014128_4661_5443 260
7 iso_pu_bacteria 2856349417 2856352520 262
8 iso_pu_bacteria 2888350351 2888354777 262
9 iso_pu_bacteria 639633055 639646281 267
10 iso_pu_bacteria 2965047637 2965054591 268
11 iso_pu_bacteria 2523231067 2523468700 269
12 iso_pu_bacteria 2958041894 2958049102 269
13 3300006186 Ga0075369_10085498 Ga0075369_100854982 270
14 3300038443 Ga0395901_0927489 Ga0395901_0927489_26_838 270
15 3300046500 Ga0495596_0067410 Ga0495596_0067410_554_1366 270
16 3300050516 nmdc:mga0sz30_80138_c1 nmdc:mga0sz30_80138_c1_525_1379 270
17 iso_pu_bacteria 2738543031 2739349805 270
18 iso_pu_bacteria 637000159 637075817 270
19 3300046507 Ga0495606_0111411 Ga0495606_0111411_818_1633 271
20 3300048919 Ga0496116_0068279 Ga0496116_0068279_1434_2249 271
21 3300048921 Ga0496118_0161586 Ga0496118_0161586_534_1349 271
22 3300049583 Ga0501067_0092122 Ga0501067_0092122_823_1644 271
23 3300049584 Ga0501068_0116690 Ga0501068_0116690_804_1625 271
24 3300049823 Ga0501044_0126723 Ga0501044_0126723_16_837 271
25 3300049823 Ga0501044_0575221 Ga0501044_0575221_177_992 271
26 iso_pu_bacteria 2671180139 2671693747 271
27 3300048922 Ga0496119_0197716 Ga0496119_0197716_61_906 274
28 3300050492 nmdc:mga0yw44_69588_c1 nmdc:mga0yw44_69588_c1_1152_1976 274
29 iso_pu_bacteria 2643221623 2644133809 274
30 iso_pu_bacteria 2894817345 2894821199 274
31 iso_pu_bacteria 2909042592 2909047768 274
32 iso_pu_bacteria 8002285264 8002290958 274
33 3300006038 Ga0075365_10025349 Ga0075365_100253494 275
34 3300010375 Ga0105239_10519283 Ga0105239_105192832 275
35 3300050492 nmdc:mga0yw44_23409_c1 nmdc:mga0yw44_23409_c1_1689_2546 275
36 3300053177 Ga0500636_0000022 Ga0500636_0000022_60277_61137 275
37 iso_pu_bacteria 2847670302 2847674801 275
38 iso_pu_bacteria 2856314179 2856317314 275
39 iso_pu_bacteria 2878035449 2878038352 275
40 iso_pu_bacteria 2906414383 2906417377 275
41 3300049580 Ga0501046_0362822 Ga0501046_0362822_201_1031 276
42 iso_pu_bacteria 2588253730 2588518827 276
43 iso_pu_bacteria 2738543024 2739307748 276
44 iso_pu_bacteria 2891373044 2891375290 276
45 3300013297 Ga0157378_10183955 Ga0157378_101839552 277
46 3300048921 Ga0496118_0095635 Ga0496118_0095635_912_1778 277
47 iso_pu_bacteria 2551306089 2551709721 277
48 iso_pu_bacteria 2643221689 2644498927 277
49 iso_pu_bacteria 2837678835 2837681139 277
50 iso_pu_bacteria 2882632389 2882639489 277
51 iso_pu_bacteria 2889790730 2889794961 277
52 iso_pu_bacteria 2889914905 2889917208 277
53 iso_pu_bacteria 8054558443 8054563274 277
54 3300006042 Ga0075368_10047527 Ga0075368_100475272 278
55 3300027866 Ga0209813_10060545 Ga0209813_100605452 278
56 3300046460 Ga0495638_0063313 Ga0495638_0063313_927_1775 278
57 3300049570 Ga0501033_0000120 Ga0501033_0000120_6210_7064 278
58 3300049571 Ga0501034_0052227 Ga0501034_0052227_2360_3199 278
59 3300049581 Ga0501047_0505959 Ga0501047_0505959_145_984 278
60 3300049822 Ga0501035_0001444 Ga0501035_0001444_14825_15679 278
61 3300050495 nmdc:mga04h51_72368_c1 nmdc:mga04h51_72368_c1_296_1141 278
62 iso_pu_bacteria 2508501122 2509108957 278
63 iso_pu_bacteria 2509276019 2509375321 278
64 iso_pu_bacteria 2516143018 2516204629 278
65 iso_pu_bacteria 2558860100 2558866410 278
66 iso_pu_bacteria 2600254933 2600376609 278
67 iso_pu_bacteria 2791355094 2792637774 278
68 iso_pu_bacteria 2791355253 2793282896 278
69 iso_pu_bacteria 2818991439 2819556709 278
70 iso_pu_bacteria 2842211629 2842213753 278
71 iso_pu_bacteria 2850079185 2850079614 278
72 iso_pu_bacteria 2871488783 2871493415 278
73 iso_pu_bacteria 2878753008 2878757459 278
74 iso_pu_bacteria 2881155292 2881160873 278
75 iso_pu_bacteria 2881845957 2881847147 278
76 iso_pu_bacteria 2881853255 2881858066 278
77 iso_pu_bacteria 2881861095 2881864988 278
78 iso_pu_bacteria 2882912400 2882917640 278
79 iso_pu_bacteria 2885318864 2885319296 278
80 iso_pu_bacteria 2885342637 2885345542 278
81 iso_pu_bacteria 2885350715 2885354927 278
82 iso_pu_bacteria 2903492973 2903501187 278
83 iso_pu_bacteria 2913295892 2913298260 278
84 iso_pu_bacteria 2924784321 2924786755 278
85 iso_pu_bacteria 2926754445 2926754558 278
86 iso_pu_bacteria 2961127735 2961130197 278
87 iso_pu_bacteria 2961170736 2961175212 278
88 iso_pu_bacteria 2967996073 2967999786 278
89 iso_pu_bacteria 2968003550 2968008144 278
90 iso_pu_bacteria 2970503327 2970507800 278
91 iso_pu_bacteria 2977821940 2977826618 278
92 iso_pu_bacteria 2977828996 2977833468 278
93 iso_pu_bacteria 2979100975 2979104976 278
94 iso_pu_bacteria 2979808191 2979812984 278
95 iso_pu_bacteria 2984509177 2984513221 278
96 iso_pu_bacteria 2984518228 2984520409 278
97 iso_pu_bacteria 2984537506 2984539706 278
98 iso_pu_bacteria 2984601300 2984601931 278
99 iso_pu_bacteria 3005445848 3005445888 278
100 iso_pu_bacteria 8004374579 8004379034 278
101 iso_pu_bacteria 8045864390 8045868748 278
102 iso_pu_bacteria 2508501127 2509142381 279
103 iso_pu_bacteria 2509276021 2509388791 279
104 iso_pu_bacteria 2509276033 2509444378 279
105 iso_pu_bacteria 2510065019 2510131058 279
106 iso_pu_bacteria 2510065057 2510307256 279
107 iso_pu_bacteria 2510461069 2510839022 279
108 iso_pu_bacteria 2510461076 2510897364 279
109 iso_pu_bacteria 2510917026 2511171498 279
110 iso_pu_bacteria 2511231052 2511499002 279
111 iso_pu_bacteria 2512047086 2512531600 279
112 iso_pu_bacteria 2513237084 2513570270 279
113 iso_pu_bacteria 2513237085 2513574748 279
114 iso_pu_bacteria 2513237086 2513586139 279
115 iso_pu_bacteria 2513237091 2513616141 279
116 iso_pu_bacteria 2513237103 2513707368 279
117 iso_pu_bacteria 2513237140 2513882706 279
118 iso_pu_bacteria 2513237143 2513906506 279
119 iso_pu_bacteria 2513237159 2513996441 279
120 iso_pu_bacteria 2513237162 2514022129 279
121 iso_pu_bacteria 2515075009 2515109990 279
122 iso_pu_bacteria 2515154107 2515607421 279
123 iso_pu_bacteria 2515154113 2515633983 279
124 iso_pu_bacteria 2515154114 2515641197 279
125 iso_pu_bacteria 2515154116 2515659796 279
126 iso_pu_bacteria 2515154134 2515740935 279
127 iso_pu_bacteria 2516653046 2516895277 279
128 iso_pu_bacteria 2516653077 2517038685 279
129 iso_pu_bacteria 2516653085 2517078933 279
130 iso_pu_bacteria 2517093000 2517097736 279
131 iso_pu_bacteria 2517287029 2517409155 279
132 iso_pu_bacteria 2519899620 2520375773 279
133 iso_pu_bacteria 2524023207 2524450840 279
134 iso_pu_bacteria 2529292951 2530648149 279
135 iso_pu_bacteria 2537561587 2537873372 279
136 iso_pu_bacteria 2551306084 2551679951 279
137 iso_pu_bacteria 2551306085 2551683694 279
138 iso_pu_bacteria 2551306086 2551694869 279
139 iso_pu_bacteria 2551306087 2551698942 279
140 iso_pu_bacteria 2551306090 2551716233 279
141 iso_pu_bacteria 2551306091 2551724648 279
142 iso_pu_bacteria 2551306092 2551735448 279
143 iso_pu_bacteria 2551306093 2551741204 279
144 iso_pu_bacteria 2554235003 2554246370 279
145 iso_pu_bacteria 2558860242 2559293592 279
146 iso_pu_bacteria 2558860983 2561466654 279
147 iso_pu_bacteria 2582581866 2585394620 279
148 iso_pu_bacteria 2585427526 2585523734 279
149 iso_pu_bacteria 2585427528 2585541869 279
150 iso_pu_bacteria 2585427593 2585840483 279
151 iso_pu_bacteria 2585427594 2585843924 279
152 iso_pu_bacteria 2585427633 2585994119 279
153 iso_pu_bacteria 2585427634 2585998643 279
154 iso_pu_bacteria 2599185210 2599605835 279
155 iso_pu_bacteria 2600255279 2601609386 279
156 iso_pu_bacteria 2600255308 2601746161 279
157 iso_pu_bacteria 2643221582 2643920754 279
158 iso_pu_bacteria 2643221618 2644103598 279
159 iso_pu_bacteria 2643221626 2644144477 279
160 iso_pu_bacteria 2643221653 2644297923 279
161 iso_pu_bacteria 2643221655 2644306528 279
162 iso_pu_bacteria 2643221659 2644330718 279
163 iso_pu_bacteria 2643221688 2644495547 279
164 iso_pu_bacteria 2643221693 2644519441 279
165 iso_pu_bacteria 2643221698 2644542477 279
166 iso_pu_bacteria 2643221712 2644612139 279
167 iso_pu_bacteria 2643221718 2644650779 279
168 iso_pu_bacteria 2643221719 2644656176 279
169 iso_pu_bacteria 2687453392 2688597053 279
170 iso_pu_bacteria 2718218365 2721156832 279
171 iso_pu_bacteria 2724679232 2725950615 279
172 iso_pu_bacteria 2728369397 2730296464 279
173 iso_pu_bacteria 2738541293 2738804566 279
174 iso_pu_bacteria 2738541317 2738948697 279
175 iso_pu_bacteria 2738541333 2739036906 279
176 iso_pu_bacteria 2765235942 2766063382 279
177 iso_pu_bacteria 2775507049 2776911701 279
178 iso_pu_bacteria 2791355259 2793314014 279
179 iso_pu_bacteria 2791355261 2793328995 279
180 iso_pu_bacteria 2791355262 2793336259 279
181 iso_pu_bacteria 2791355263 2793343907 279
182 iso_pu_bacteria 2791355266 2793358307 279
183 iso_pu_bacteria 2791355267 2793365540 279
184 iso_pu_bacteria 2802429633 2806046682 279
185 iso_pu_bacteria 2802429634 2806051443 279
186 iso_pu_bacteria 2802429635 2806059432 279
187 iso_pu_bacteria 2802429636 2806066603 279
188 iso_pu_bacteria 2802429637 2806073661 279
189 iso_pu_bacteria 2808606387 2808986637 279
190 iso_pu_bacteria 2818991272 2819245168 279
191 iso_pu_bacteria 2821123053 2821123383 279
192 iso_pu_bacteria 2837651117 2837651679 279
193 iso_pu_bacteria 2838042994 2838048473 279
194 iso_pu_bacteria 2838675328 2838677444 279
195 iso_pu_bacteria 2838680041 2838680233 279
196 iso_pu_bacteria 2838686498 2838689635 279
197 iso_pu_bacteria 2838694306 2838695736 279
198 iso_pu_bacteria 2838707686 2838709111 279
199 iso_pu_bacteria 2838714209 2838716332 279
200 iso_pu_bacteria 2838719591 2838719868 279
201 iso_pu_bacteria 2838724970 2838727084 279
202 iso_pu_bacteria 2838729681 2838731670 279
203 iso_pu_bacteria 2838736955 2838739594 279
204 iso_pu_bacteria 2838742623 2838744611 279
205 iso_pu_bacteria 2839993093 2839993750 279
206 iso_pu_bacteria 2841840854 2841844282 279
207 iso_pu_bacteria 2841846520 2841846799 279
208 iso_pu_bacteria 2841851746 2841853152 279
209 iso_pu_bacteria 2841859092 2841860672 279
210 iso_pu_bacteria 2841864319 2841868907 279
211 iso_pu_bacteria 2842077413 2842079653 279
212 iso_pu_bacteria 2842110456 2842112530 279
213 iso_pu_bacteria 2842118031 2842120271 279
214 iso_pu_bacteria 2842124991 2842127172 279
215 iso_pu_bacteria 2842130223 2842132337 279
216 iso_pu_bacteria 2842140634 2842144003 279
217 iso_pu_bacteria 2842152218 2842152494 279
218 iso_pu_bacteria 2842156927 2842160478 279
219 iso_pu_bacteria 2842163707 2842165542 279
220 iso_pu_bacteria 2842170452 2842172577 279
221 iso_pu_bacteria 2842175837 2842176113 279
222 iso_pu_bacteria 2842180545 2842183856 279
223 iso_pu_bacteria 2842187318 2842189439 279
224 iso_pu_bacteria 2842217011 2842219207 279
225 iso_pu_bacteria 2842224351 2842224629 279
226 iso_pu_bacteria 2842229732 2842231437 279
227 iso_pu_bacteria 2842237096 2842238522 279
228 iso_pu_bacteria 2842243621 2842246093 279
229 iso_pu_bacteria 2842257432 2842260471 279
230 iso_pu_bacteria 2842271015 2842273881 279
231 iso_pu_bacteria 2842291075 2842293314 279
232 iso_pu_bacteria 2842304105 2842308890 279
233 iso_pu_bacteria 2842341865 2842344437 279
234 iso_pu_bacteria 2842363717 2842367479 279
235 iso_pu_bacteria 2842370503 2842370695 279
236 iso_pu_bacteria 2842377471 2842379711 279
237 iso_pu_bacteria 2842384541 2842386782 279
238 iso_pu_bacteria 2842395702 2842401641 279
239 iso_pu_bacteria 2842515876 2842517457 279
240 iso_pu_bacteria 2842521101 2842521362 279
241 iso_pu_bacteria 2842922631 2842923018 279
242 iso_pu_bacteria 2844163670 2844170128 279
243 iso_pu_bacteria 2844454524 2844456382 279
244 iso_pu_bacteria 2855825444 2855827914 279
245 iso_pu_bacteria 2855839649 2855839671 279
246 iso_pu_bacteria 2857516855 2857521974 279
247 iso_pu_bacteria 2857531043 2857533667 279
248 iso_pu_bacteria 2858800743 2858803010 279
249 iso_pu_bacteria 2869242130 2869249081 279
250 iso_pu_bacteria 2899792073 2899794536 279
251 iso_pu_bacteria 2899803654 2899805630 279
252 iso_pu_bacteria 2899845264 2899845881 279
253 iso_pu_bacteria 2913308742 2913311488 279
254 iso_pu_bacteria 2915986958 2915990394 279
255 iso_pu_bacteria 2915993759 2915997305 279
256 iso_pu_bacteria 2916000859 2916004843 279
257 iso_pu_bacteria 2916007675 2916008246 279
258 iso_pu_bacteria 2916014648 2916021347 279
259 iso_pu_bacteria 2916021584 2916028305 279
260 iso_pu_bacteria 2916028427 2916032767 279
261 iso_pu_bacteria 2916035215 2916038278 279
262 iso_pu_bacteria 2916041962 2916044608 279
263 iso_pu_bacteria 2916048683 2916053565 279
264 iso_pu_bacteria 2916055098 2916057105 279
265 iso_pu_bacteria 2916068649 2916075208 279
266 iso_pu_bacteria 2916076590 2916077988 279
267 iso_pu_bacteria 2919114240 2919116536 279
268 iso_pu_bacteria 2921201388 2921204080 279
269 iso_pu_bacteria 2921208531 2921214917 279
270 iso_pu_bacteria 2921237296 2921242200 279
271 iso_pu_bacteria 2921244191 2921248509 279
272 iso_pu_bacteria 2921257292 2921259915 279
273 iso_pu_bacteria 2921263974 2921267380 279
274 iso_pu_bacteria 2921282425 2921284424 279
275 iso_pu_bacteria 2921289301 2921292197 279
276 iso_pu_bacteria 2921296804 2921296965 279
277 iso_pu_bacteria 2924144063 2924146205 279
278 iso_pu_bacteria 2924150972 2924156358 279
279 iso_pu_bacteria 2924158325 2924164608 279
280 iso_pu_bacteria 2924165586 2924171952 279
281 iso_pu_bacteria 2924172951 2924177158 279
282 iso_pu_bacteria 2924179722 2924184439 279
283 iso_pu_bacteria 2924186466 2924190936 279
284 iso_pu_bacteria 2924193448 2924200225 279
285 iso_pu_bacteria 2924200457 2924202544 279
286 iso_pu_bacteria 2924207177 2924209527 279
287 iso_pu_bacteria 2924214083 2924215887 279
288 iso_pu_bacteria 2924221636 2924227360 279
289 iso_pu_bacteria 2924228884 2924230076 279
290 iso_pu_bacteria 2926760298 2926761729 279
291 iso_pu_bacteria 2929138655 2929142147 279
292 iso_pu_bacteria 2933006813 2933007141 279
293 iso_pu_bacteria 2933011516 2933015268 279
294 iso_pu_bacteria 2933570622 2933575334 279
295 iso_pu_bacteria 2933586486 2933588581 279
296 iso_pu_bacteria 2933594066 2933594344 279
297 iso_pu_bacteria 2935894831 2935896256 279
298 iso_pu_bacteria 2935901341 2935902539 279
299 iso_pu_bacteria 2936367885 2936369299 279
300 iso_pu_bacteria 2936375103 2936377353 279
301 iso_pu_bacteria 2936381700 2936385758 279
302 iso_pu_bacteria 2936996657 2936998592 279
303 iso_pu_bacteria 2937002841 2937006387 279
304 iso_pu_bacteria 2937009748 2937011745 279
305 iso_pu_bacteria 2937016420 2937018451 279
306 iso_pu_bacteria 2937023124 2937023509 279
307 iso_pu_bacteria 2937042894 2937045093 279
308 iso_pu_bacteria 2937049772 2937054304 279
309 iso_pu_bacteria 2937056579 2937062389 279
310 iso_pu_bacteria 2937063883 2937066740 279
311 iso_pu_bacteria 2937071275 2937072936 279
312 iso_pu_bacteria 2937091812 2937097166 279
313 iso_pu_bacteria 2937098957 2937104584 279
314 iso_pu_bacteria 2937106411 2937108348 279
315 iso_pu_bacteria 2937113482 2937116397 279
316 iso_pu_bacteria 2937119839 2937121936 279
317 iso_pu_bacteria 2937126314 2937129606 279
318 iso_pu_bacteria 2937843397 2937843459 279
319 iso_pu_bacteria 2941499720 2941501022 279
320 iso_pu_bacteria 2957382221 2957384396 279
321 iso_pu_bacteria 2957388812 2957393244 279
322 iso_pu_bacteria 2957395598 2957400749 279
323 iso_pu_bacteria 2957402308 2957403437 279
324 iso_pu_bacteria 2957408893 2957413458 279
325 iso_pu_bacteria 2957415311 2957417367 279
326 iso_pu_bacteria 2957422303 2957429894 279
327 iso_pu_bacteria 2957430029 2957434687 279
328 iso_pu_bacteria 2957443900 2957446810 279
329 iso_pu_bacteria 2957450854 2957452889 279
330 iso_pu_bacteria 2957457609 2957463838 279
331 iso_pu_bacteria 2957464669 2957467229 279
332 iso_pu_bacteria 2957471148 2957476122 279
333 iso_pu_bacteria 2957478035 2957481210 279
334 iso_pu_bacteria 2957484790 2957486662 279
335 iso_pu_bacteria 2957491536 2957492990 279
336 iso_pu_bacteria 2957498199 2957503092 279
337 iso_pu_bacteria 2957505466 2957510192 279
338 iso_pu_bacteria 2960584000 2960587659 279
339 iso_pu_bacteria 2960597568 2960600841 279
340 iso_pu_bacteria 2960603979 2960604387 279
341 iso_pu_bacteria 2960610863 2960613766 279
342 iso_pu_bacteria 2960617483 2960620414 279
343 iso_pu_bacteria 2960624210 2960627064 279
344 iso_pu_bacteria 2960637947 2960642564 279
345 iso_pu_bacteria 2960645483 2960652403 279
346 iso_pu_bacteria 2960652885 2960657619 279
347 iso_pu_bacteria 2960660292 2960660717 279
348 iso_pu_bacteria 2960667422 2960670238 279
349 iso_pu_bacteria 2960674078 2960676816 279
350 iso_pu_bacteria 2960687367 2960693459 279
351 iso_pu_bacteria 2964607997 2964613409 279
352 iso_pu_bacteria 2964615318 2964618292 279
353 iso_pu_bacteria 2964621998 2964626551 279
354 iso_pu_bacteria 2964628898 2964634154 279
355 iso_pu_bacteria 2964636051 2964639969 279
356 iso_pu_bacteria 2964643177 2964645025 279
357 iso_pu_bacteria 2964649959 2964650010 279
358 iso_pu_bacteria 2964656573 2964659544 279
359 iso_pu_bacteria 2964663802 2964670284 279
360 iso_pu_bacteria 2964670856 2964676779 279
361 iso_pu_bacteria 2964678106 2964678857 279
362 iso_pu_bacteria 2964685014 2964685283 279
363 iso_pu_bacteria 2964691889 2964696238 279
364 iso_pu_bacteria 2964698721 2964699270 279
365 iso_pu_bacteria 2964705432 2964708230 279
366 iso_pu_bacteria 2964712639 2964712951 279
367 iso_pu_bacteria 2964719344 2964723255 279
368 iso_pu_bacteria 2967664464 2967668481 279
369 iso_pu_bacteria 2967671571 2967676348 279
370 iso_pu_bacteria 2967678726 2967682122 279
371 iso_pu_bacteria 2967693043 2967695346 279
372 iso_pu_bacteria 2967699805 2967701099 279
373 iso_pu_bacteria 2967706974 2967709891 279
374 iso_pu_bacteria 2967714385 2967717908 279
375 iso_pu_bacteria 2967721400 2967723683 279
376 iso_pu_bacteria 2967735183 2967738165 279
377 iso_pu_bacteria 2967742019 2967748874 279
378 iso_pu_bacteria 2967748971 2967749532 279
379 iso_pu_bacteria 2967755722 2967757282 279
380 iso_pu_bacteria 2967762386 2967768739 279
381 iso_pu_bacteria 2967769361 2967771345 279
382 iso_pu_bacteria 2967775926 2967781574 279
383 iso_pu_bacteria 2970019648 2970023029 279
384 iso_pu_bacteria 2970033650 2970040423 279
385 iso_pu_bacteria 2970040964 2970046215 279
386 iso_pu_bacteria 2970047711 2970050900 279
387 iso_pu_bacteria 2970054988 2970058297 279
388 iso_pu_bacteria 2970061556 2970066350 279
389 iso_pu_bacteria 2970068827 2970072488 279
390 iso_pu_bacteria 2970076120 2970079347 279
391 iso_pu_bacteria 2970082768 2970088050 279
392 iso_pu_bacteria 2970088815 2970091713 279
393 iso_pu_bacteria 2970095765 2970099365 279
394 iso_pu_bacteria 2970102677 2970106121 279
395 iso_pu_bacteria 2970109326 2970111579 279
396 iso_pu_bacteria 2970116247 2970122389 279
397 iso_pu_bacteria 2970129317 2970131263 279
398 iso_pu_bacteria 2970136068 2970139708 279
399 iso_pu_bacteria 2970149975 2970151916 279
400 iso_pu_bacteria 2970156795 2970162563 279
401 iso_pu_bacteria 2970164137 2970169611 279
402 iso_pu_bacteria 2970170962 2970173697 279
403 iso_pu_bacteria 2970177841 2970179424 279
404 iso_pu_bacteria 2970184632 2970187782 279
405 iso_pu_bacteria 2970191845 2970194910 279
406 iso_pu_bacteria 2977516862 2977521945 279
407 iso_pu_bacteria 2977523885 2977528332 279
408 iso_pu_bacteria 2977537788 2977538551 279
409 iso_pu_bacteria 2977551784 2977554149 279
410 iso_pu_bacteria 2977558990 2977564087 279
411 iso_pu_bacteria 2977565890 2977570034 279
412 iso_pu_bacteria 2977572785 2977577571 279
413 iso_pu_bacteria 2977579622 2977584088 279
414 iso_pu_bacteria 2979089926 2979093007 279
415 iso_pu_bacteria 2979095461 2979099605 279
416 iso_pu_bacteria 2989776772 2989777127 279
417 iso_pu_bacteria 2996893221 2996897804 279
418 iso_pu_bacteria 3003930520 3003931629 279
419 iso_pu_bacteria 648276728 648736738 279
420 iso_pu_bacteria 650716007 650738831 279
421 iso_pu_bacteria 8003570095 8003572379 279
422 iso_pu_bacteria 8003992118 8003992140 279
423 iso_pu_bacteria 8005246636 8005247723 279
424 iso_pu_bacteria 8005301065 8005305676 279
425 iso_pu_bacteria 8005307578 8005310464 279
426 iso_pu_bacteria 8005376324 8005377806 279
427 iso_pu_bacteria 8005382845 8005385106 279
428 iso_pu_bacteria 8005395548 8005399814 279
429 iso_pu_bacteria 8005460587 8005460627 279
430 iso_pu_bacteria 8005556819 8005560244 279
431 iso_pu_bacteria 8005563573 8005564301 279
432 iso_pu_bacteria 8005570704 8005573864 279
433 iso_pu_bacteria 8005658619 8005662659 279
434 iso_pu_bacteria 8005695170 8005699644 279
435 iso_pu_bacteria 8018163183 8018167377 279
436 iso_pu_bacteria 8023680758 8023684629 279
437 iso_pu_bacteria 8024479707 8024479917 279
438 iso_pu_bacteria 8024486573 8024491666 279
439 iso_pu_bacteria 8054460903 8054460925 279
440 iso_pu_bacteria 8056375014 8056376131 279
441 iso_pu_bacteria 8057874678 8057877532 279
442 3300005455 Ga0070663_100175953 Ga0070663_1001759531 280
443 3300005563 Ga0068855_100324509 Ga0068855_1003245092 280
444 3300006195 Ga0075366_10176906 Ga0075366_101769062 280
445 3300009093 Ga0105240_10379176 Ga0105240_103791762 280
446 3300010375 Ga0105239_10090733 Ga0105239_100907332 280
447 3300025294 Ga0209025_1000037 Ga0209025_100003743 280
448 3300026067 Ga0207678_10007884 Ga0207678_100078849 280
449 3300036647 Ga0316582_0146136 Ga0316582_0146136_610_1458 280
450 3300037471 Ga0395905_0002892 Ga0395905_0002892_8911_9765 280
451 3300048925 Ga0496122_0000309 Ga0496122_0000309_52549_53415 280
452 3300048926 Ga0496123_0000396 Ga0496123_0000396_37877_38743 280
453 3300048927 Ga0496124_0000532 Ga0496124_0000532_35643_36509 280
454 3300048928 Ga0496125_0002207 Ga0496125_0002207_24918_25784 280
455 3300048929 Ga0496126_0000923 Ga0496126_0000923_28703_29569 280
456 3300048929 Ga0496126_0018802 Ga0496126_0018802_314_1180 280
457 3300049568 Ga0501031_0000008 Ga0501031_0000008_109948_110793 280
458 3300049568 Ga0501031_0016852 Ga0501031_0016852_2052_2897 280
459 3300049568 Ga0501031_0018554 Ga0501031_0018554_849_1712 280
460 3300049569 Ga0501032_0000018 Ga0501032_0000018_45501_46346 280
461 3300049569 Ga0501032_0000019 Ga0501032_0000019_51852_52697 280
462 3300049569 Ga0501032_0104220 Ga0501032_0104220_274_1116 280
463 3300049569 Ga0501032_0121169 Ga0501032_0121169_820_1686 280
464 3300049570 Ga0501033_0000032 Ga0501033_0000032_45512_46357 280
465 3300049570 Ga0501033_0000582 Ga0501033_0000582_15656_16501 280
466 3300049570 Ga0501033_0229142 Ga0501033_0229142_273_1139 280
467 3300049571 Ga0501034_0000103 Ga0501034_0000103_109948_110793 280
468 3300049571 Ga0501034_0000130 Ga0501034_0000130_36252_37097 280
469 3300049571 Ga0501034_0069313 Ga0501034_0069313_713_1576 280
470 3300049572 Ga0501036_0000012 Ga0501036_0000012_45512_46357 280
471 3300049572 Ga0501036_0000218 Ga0501036_0000218_15690_16535 280
472 3300049572 Ga0501036_0011354 Ga0501036_0011354_590_1453 280
473 3300049573 Ga0501037_0000018 Ga0501037_0000018_109948_110793 280
474 3300049573 Ga0501037_0000218 Ga0501037_0000218_34223_35068 280
475 3300049573 Ga0501037_0020309 Ga0501037_0020309_1247_2110 280
476 3300049573 Ga0501037_0042585 Ga0501037_0042585_2198_3064 280
477 3300049574 Ga0501038_0000017 Ga0501038_0000017_109948_110793 280
478 3300049574 Ga0501038_0002051 Ga0501038_0002051_286_1131 280
479 3300049574 Ga0501038_0083578 Ga0501038_0083578_1182_2024 280
480 3300049575 Ga0501039_0000024 Ga0501039_0000024_109948_110793 280
481 3300049575 Ga0501039_0000028 Ga0501039_0000028_102472_103317 280
482 3300049575 Ga0501039_0076539 Ga0501039_0076539_1247_2110 280
483 3300049578 Ga0501042_0058678 Ga0501042_0058678_608_1471 280
484 3300049579 Ga0501043_0000113 Ga0501043_0000113_56114_56959 280
485 3300049579 Ga0501043_0000414 Ga0501043_0000414_13686_14531 280
486 3300049579 Ga0501043_0021339 Ga0501043_0021339_631_1497 280
487 3300049579 Ga0501043_0065090 Ga0501043_0065090_849_1712 280
488 3300049580 Ga0501046_0014956 Ga0501046_0014956_2722_3585 280
489 3300049580 Ga0501046_0020037 Ga0501046_0020037_4341_5186 280
490 3300049581 Ga0501047_0000117 Ga0501047_0000117_35754_36599 280
491 3300049581 Ga0501047_0020728 Ga0501047_0020728_101_943 280
492 3300049581 Ga0501047_0593832 Ga0501047_0593832_46_891 280
493 3300049582 Ga0501048_0005763 Ga0501048_0005763_1302_2165 280
494 3300049584 Ga0501068_0002502 Ga0501068_0002502_1678_2541 280
495 3300049584 Ga0501068_0142535 Ga0501068_0142535_54_896 280
496 3300049585 Ga0501069_0010373 Ga0501069_0010373_2523_3365 280
497 3300049586 Ga0501070_0001482 Ga0501070_0001482_17863_18705 280
498 3300049586 Ga0501070_0035887 Ga0501070_0035887_2852_3697 280
499 3300049586 Ga0501070_0038483 Ga0501070_0038483_462_1325 280
500 3300049588 Ga0501072_0125074 Ga0501072_0125074_978_1829 280
501 3300049589 Ga0501073_0010103 Ga0501073_0010103_4249_5112 280
502 3300049589 Ga0501073_0035117 Ga0501073_0035117_1936_2778 280
503 3300049590 Ga0501074_0035351 Ga0501074_0035351_1084_1947 280
504 3300049590 Ga0501074_0049435 Ga0501074_0049435_926_1768 280
505 3300049742 Ga0501080_0011077 Ga0501080_0011077_1139_2002 280
506 3300049742 Ga0501080_0092101 Ga0501080_0092101_1525_2367 280
507 3300049742 Ga0501080_0120613 Ga0501080_0120613_154_996 280
508 3300049822 Ga0501035_0000040 Ga0501035_0000040_109906_110751 280
509 3300049822 Ga0501035_0000201 Ga0501035_0000201_56112_56957 280
510 3300049822 Ga0501035_0001357 Ga0501035_0001357_185_1027 280
511 3300049822 Ga0501035_0005117 Ga0501035_0005117_124_966 280
512 3300049822 Ga0501035_0006120 Ga0501035_0006120_2011_2874 280
513 3300049822 Ga0501035_0278145 Ga0501035_0278145_276_1142 280
514 3300049823 Ga0501044_0000040 Ga0501044_0000040_109948_110793 280
515 3300049823 Ga0501044_0003099 Ga0501044_0003099_15671_16516 280
516 3300049823 Ga0501044_0159056 Ga0501044_0159056_1106_1948 280
517 3300049823 Ga0501044_0460944 Ga0501044_0460944_262_1104 280
518 3300049824 Ga0501045_0009290 Ga0501045_0009290_4944_5807 280
519 3300053136 Ga0500559_0002567 Ga0500559_0002567_1472_2326 280
520 3300053139 Ga0500568_0001323 Ga0500568_0001323_880_1722 280
521 3300053140 Ga0500573_0015270 Ga0500573_0015270_119_976 280
522 iso_pu_bacteria 2513237090 2513608897 280
523 iso_pu_bacteria 2513237305 2514417374 280
524 iso_pu_bacteria 2513237351 2514585866 280
525 iso_pu_bacteria 2597489875 2597810983 280
526 iso_pu_bacteria 2643221551 2643776744 280
527 iso_pu_bacteria 2643221555 2643795192 280
528 iso_pu_bacteria 2721755686 2723574214 280
529 iso_pu_bacteria 2841734538 2841737552 280
530 iso_pu_bacteria 2869162929 2869165715 280
531 iso_pu_bacteria 2871474448 2871475515 280
532 iso_pu_bacteria 2878788777 2878790099 280
533 iso_pu_bacteria 2885312484 2885313042 280
534 iso_pu_bacteria 2888343758 2888345472 280
535 iso_pu_bacteria 2891048133 2891049128 280
536 iso_pu_bacteria 2924754689 2924761878 280
537 iso_pu_bacteria 2924762789 2924765236 280
538 iso_pu_bacteria 2937822353 2937822453 280
539 iso_pu_bacteria 2937836603 2937840211 280
540 iso_pu_bacteria 2958071322 2958071418 280
541 iso_pu_bacteria 2970524798 2970527188 280
542 iso_pu_bacteria 2970540015 2970544648 280
543 iso_pu_bacteria 2987666974 2987669649 280
544 iso_pu_bacteria 2996310559 2996316595 280
545 iso_pu_bacteria 2996336353 2996336582 280
546 iso_pu_bacteria 8004395343 8004400556 280
547 iso_pu_bacteria 8004633249 8004634513 280
548 iso_pu_bacteria 8055617313 8055619270 280
549 3300003856 Ga0058692_1003540 Ga0058692_10035404 281
550 3300009553 Ga0105249_10418680 Ga0105249_104186802 281
551 3300021320 Ga0214544_1000105 Ga0214544_100010577 281
552 3300021321 Ga0214542_1000029 Ga0214542_100002992 281
553 3300021321 Ga0214542_1029334 Ga0214542_10293342 281
554 3300021327 Ga0214543_1000027 Ga0214543_100002715 281
555 3300021327 Ga0214543_1000040 Ga0214543_100004092 281
556 3300027312 Ga0209371_1000009 Ga0209371_1000009725 281
557 3300030500 Ga0268256_1000010 Ga0268256_1000010724 281
558 3300030744 Ga0316181_1117224 Ga0316181_11172243 281
559 3300037418 Ga0395900_0063825 Ga0395900_0063825_2146_3006 281
560 3300037471 Ga0395905_0010055 Ga0395905_0010055_2123_2980 281
561 3300037471 Ga0395905_0071620 Ga0395905_0071620_514_1374 281
562 3300042007 Ga0439449_0103989 Ga0439449_0103989_44_901 281
563 3300046522 Ga0495643_0058364 Ga0495643_0058364_1172_2029 281
564 3300048919 Ga0496116_0000240 Ga0496116_0000240_66095_66952 281
565 3300053125 Ga0500618_000565 Ga0500618_000565_5632_6489 281
566 iso_pu_bacteria 2503198000 2503199814 281
567 iso_pu_bacteria 2508501123 2509114712 281
568 iso_pu_bacteria 2509276018 2509369729 281
569 iso_pu_bacteria 2509276022 2509394724 281
570 iso_pu_bacteria 2510065059 2510318683 281
571 iso_pu_bacteria 2511231027 2511391695 281
572 iso_pu_bacteria 2512875016 2512932732 281
573 iso_pu_bacteria 2512875024 2512960795 281
574 iso_pu_bacteria 2513237164 2514036561 281
575 iso_pu_bacteria 2534681786 2535483939 281
576 iso_pu_bacteria 2643221595 2643987514 281
577 iso_pu_bacteria 2643221627 2644157967 281
578 iso_pu_bacteria 2756170246 2756671131 281
579 iso_pu_bacteria 2765235802 2765467776 281
580 iso_pu_bacteria 2775506902 2776269072 281
581 iso_pu_bacteria 2775506904 2776283789 281
582 iso_pu_bacteria 2791355123 2792748185 281
583 iso_pu_bacteria 2840764183 2840766777 281
584 iso_pu_bacteria 2842871566 2842875281 281
585 iso_pu_bacteria 2844002411 2844008875 281
586 iso_pu_bacteria 2844009547 2844012405 281
587 iso_pu_bacteria 2856320880 2856322902 281
588 iso_pu_bacteria 2856328259 2856334673 281
589 iso_pu_bacteria 2856334872 2856339641 281
590 iso_pu_bacteria 2857349434 2857352173 281
591 iso_pu_bacteria 2857367948 2857373627 281
592 iso_pu_bacteria 2869169390 2869173948 281
593 iso_pu_bacteria 2869234852 2869238437 281
594 iso_pu_bacteria 2869249662 2869256150 281
595 iso_pu_bacteria 2869256925 2869257775 281
596 iso_pu_bacteria 2869264136 2869268543 281
597 iso_pu_bacteria 2869271264 2869278373 281
598 iso_pu_bacteria 2869278585 2869282452 281
599 iso_pu_bacteria 2871435913 2871438378 281
600 iso_pu_bacteria 2871451962 2871455565 281
601 iso_pu_bacteria 2871459585 2871466518 281
602 iso_pu_bacteria 2871481445 2871486228 281
603 iso_pu_bacteria 2874116593 2874118711 281
604 iso_pu_bacteria 2874123672 2874126797 281
605 iso_pu_bacteria 2874131515 2874135788 281
606 iso_pu_bacteria 2874139085 2874142108 281
607 iso_pu_bacteria 2874162495 2874163124 281
608 iso_pu_bacteria 2874168670 2874174981 281
609 iso_pu_bacteria 2876363079 2876365017 281
610 iso_pu_bacteria 2876386047 2876391611 281
611 iso_pu_bacteria 2876399893 2876402667 281
612 iso_pu_bacteria 2876406927 2876412235 281
613 iso_pu_bacteria 2878730984 2878731840 281
614 iso_pu_bacteria 2878738818 2878744709 281
615 iso_pu_bacteria 2888337043 2888338133 281
616 iso_pu_bacteria 2889010040 2889016394 281
617 iso_pu_bacteria 2889016732 2889018580 281
618 iso_pu_bacteria 2894652903 2894653300 281
619 iso_pu_bacteria 2903448605 2903450024 281
620 iso_pu_bacteria 2903513507 2903521176 281
621 iso_pu_bacteria 2903521522 2903522248 281
622 iso_pu_bacteria 2903528002 2903528626 281
623 iso_pu_bacteria 2904578770 2904579543 281
624 iso_pu_bacteria 2906354277 2906358179 281
625 iso_pu_bacteria 2906363423 2906364874 281
626 iso_pu_bacteria 2906370794 2906375910 281
627 iso_pu_bacteria 2906378014 2906378180 281
628 iso_pu_bacteria 2906386501 2906390605 281
629 iso_pu_bacteria 2906393657 2906399963 281
630 iso_pu_bacteria 2906401398 2906403436 281
631 iso_pu_bacteria 2906408224 2906409071 281
632 iso_pu_bacteria 2906427513 2906428953 281
633 iso_pu_bacteria 2919119836 2919120792 281
634 iso_pu_bacteria 2922130491 2922135508 281
635 iso_pu_bacteria 2922151315 2922156392 281
636 iso_pu_bacteria 2922172374 2922173710 281
637 iso_pu_bacteria 2922178524 2922183856 281
638 iso_pu_bacteria 2924718760 2924721935 281
639 iso_pu_bacteria 2924733363 2924737362 281
640 iso_pu_bacteria 2924748358 2924749599 281
641 iso_pu_bacteria 2924776078 2924782740 281
642 iso_pu_bacteria 2928521798 2928522335 281
643 iso_pu_bacteria 2937848649 2937852217 281
644 iso_pu_bacteria 2937861824 2937868115 281
645 iso_pu_bacteria 2937868953 2937874257 281
646 iso_pu_bacteria 2937877337 2937881381 281
647 iso_pu_bacteria 2937972304 2937977472 281
648 iso_pu_bacteria 2954011201 2954014243 281
649 iso_pu_bacteria 2958034702 2958039234 281
650 iso_pu_bacteria 2958041894 2958053136 281
651 iso_pu_bacteria 2958064165 2958070439 281
652 iso_pu_bacteria 2958084443 2958088062 281
653 iso_pu_bacteria 2958092219 2958096998 281
654 iso_pu_bacteria 2958100919 2958107144 281
655 iso_pu_bacteria 2958108152 2958110716 281
656 iso_pu_bacteria 2958122699 2958129509 281
657 iso_pu_bacteria 2958137437 2958142684 281
658 iso_pu_bacteria 2958144490 2958148294 281
659 iso_pu_bacteria 2958158011 2958163363 281
660 iso_pu_bacteria 2958172287 2958178181 281
661 iso_pu_bacteria 2961136820 2961143851 281
662 iso_pu_bacteria 2961183825 2961189429 281
663 iso_pu_bacteria 2963644680 2963646472 281
664 iso_pu_bacteria 2965025482 2965027124 281
665 iso_pu_bacteria 2965032056 2965040038 281
666 iso_pu_bacteria 2965040258 2965043218 281
667 iso_pu_bacteria 2965089291 2965092260 281
668 iso_pu_bacteria 2965102966 2965109807 281
669 iso_pu_bacteria 2965110997 2965119000 281
670 iso_pu_bacteria 2965119406 2965123420 281
671 iso_pu_bacteria 2968016561 2968020560 281
672 iso_pu_bacteria 2968083720 2968090729 281
673 iso_pu_bacteria 2968138860 2968144830 281
674 iso_pu_bacteria 2970469710 2970473857 281
675 iso_pu_bacteria 2970489779 2970492803 281
676 iso_pu_bacteria 2970510686 2970514422 281
677 iso_pu_bacteria 2970532167 2970536544 281
678 iso_pu_bacteria 2970547951 2970551218 281
679 iso_pu_bacteria 2970593180 2970597061 281
680 iso_pu_bacteria 2970619444 2970626398 281
681 iso_pu_bacteria 2970627176 2970627697 281
682 iso_pu_bacteria 2977851361 2977857013 281
683 iso_pu_bacteria 2977872689 2977875205 281
684 iso_pu_bacteria 2977898635 2977900233 281
685 iso_pu_bacteria 2977907340 2977908640 281
686 iso_pu_bacteria 2977915119 2977917989 281
687 iso_pu_bacteria 2977922695 2977926088 281
688 iso_pu_bacteria 2977935797 2977937842 281
689 iso_pu_bacteria 2977942078 2977945130 281
690 iso_pu_bacteria 2977950692 2977956040 281
691 iso_pu_bacteria 2977957713 2977958543 281
692 iso_pu_bacteria 2977971508 2977972194 281
693 iso_pu_bacteria 2977986579 2977988676 281
694 iso_pu_bacteria 2979710463 2979710932 281
695 iso_pu_bacteria 2979742915 2979745527 281
696 iso_pu_bacteria 2979764755 2979771030 281
697 iso_pu_bacteria 2979772303 2979774324 281
698 iso_pu_bacteria 2979793036 2979799569 281
699 iso_pu_bacteria 2987636660 2987639357 281
700 iso_pu_bacteria 2987652177 2987652275 281
701 iso_pu_bacteria 2996348954 2996352822 281
702 iso_pu_bacteria 2996386984 2996387268 281
703 iso_pu_bacteria 3000135777 3000139439 281
704 iso_pu_bacteria 3004167301 3004167452 281
705 iso_pu_bacteria 3004195979 3004202018 281
706 iso_pu_bacteria 3004203850 3004204399 281
707 iso_pu_bacteria 3004211236 3004217870 281
708 iso_pu_bacteria 3004218560 3004221082 281
709 iso_pu_bacteria 3004232784 3004239317 281
710 iso_pu_bacteria 3004248173 3004252655 281
711 iso_pu_bacteria 3004268573 3004274110 281
712 iso_pu_bacteria 3004275668 3004279504 281
713 iso_pu_bacteria 3004334049 3004335956 281
714 iso_pu_bacteria 649633066 649871609 281
715 iso_pu_bacteria 8004300914 8004306403 281
716 iso_pu_bacteria 8004312739 8004317242 281
717 iso_pu_bacteria 8004361976 8004365226 281
718 iso_pu_bacteria 8004727605 8004733139 281
719 iso_pu_bacteria 8055431914 8055433645 281
720 3300002774 JGI25150J39212_1000735 JGI25150J39212_100073512 282
721 3300003187 JGI25151J46595_10000555 JGI25151J46595_100005554 282
722 3300003187 JGI25151J46595_10001025 JGI25151J46595_1000102515 282
723 3300003215 JGI25153J46596_10000745 JGI25153J46596_100007453 282
724 3300003215 JGI25153J46596_10005618 JGI25153J46596_100056189 282
725 3300003354 JGI25160J50197_1000414 JGI25160J50197_10004147 282
726 3300003374 JGI25161J50226_1003778 JGI25161J50226_10037783 282
727 3300003771 Ga0055526_1009020 Ga0055526_10090207 282
728 3300003771 Ga0055526_1009332 Ga0055526_10093327 282
729 3300003775 Ga0055524_1002757 Ga0055524_10027572 282
730 3300003775 Ga0055524_1004509 Ga0055524_10045099 282
731 3300003775 Ga0055524_1007060 Ga0055524_10070607 282
732 3300003790 Ga0055528_1005430 Ga0055528_10054302 282
733 3300003790 Ga0055528_1007428 Ga0055528_10074282 282
734 3300003790 Ga0055528_1013953 Ga0055528_10139532 282
735 3300003792 Ga0055540_1000356 Ga0055540_100035625 282
736 3300003856 Ga0058692_1002415 Ga0058692_10024152 282
737 3300004625 Ga0055543_1000647 Ga0055543_10006477 282
738 3300005262 Ga0065165_1025564 Ga0065165_10255641 282
739 3300005331 Ga0070670_100000416 Ga0070670_10000041630 282
740 3300005455 Ga0070663_100108880 Ga0070663_1001088802 282
741 3300005459 Ga0068867_100106622 Ga0068867_1001066222 282
742 3300005548 Ga0070665_100014592 Ga0070665_1000145925 282
743 3300006038 Ga0075365_10006214 Ga0075365_100062143 282
744 3300006038 Ga0075365_10102518 Ga0075365_101025182 282
745 3300006042 Ga0075368_10000085 Ga0075368_100000856 282
746 3300006051 Ga0075364_10058169 Ga0075364_100581692 282
747 3300006051 Ga0075364_10270073 Ga0075364_102700732 282
748 3300006177 Ga0075362_10001424 Ga0075362_100014246 282
749 3300006178 Ga0075367_10076937 Ga0075367_100769372 282
750 3300006178 Ga0075367_10105946 Ga0075367_101059462 282
751 3300006195 Ga0075366_10128226 Ga0075366_101282261 282
752 3300006353 Ga0075370_10004010 Ga0075370_100040108 282
753 3300006948 Ga0099826_10001769 Ga0099826_100017692 282
754 3300009036 Ga0105244_10061736 Ga0105244_100617362 282
755 3300009765 Ga0123341_1000225 Ga0123341_10002256 282
756 3300009766 Ga0123342_1021815 Ga0123342_10218154 282
757 3300013100 Ga0157373_10019888 Ga0157373_100198882 282
758 3300013102 Ga0157371_10000004 Ga0157371_10000004271 282
759 3300013104 Ga0157370_10000165 Ga0157370_1000016514 282
760 3300025245 Ga0207425_1000012 Ga0207425_10000124 282
761 3300025245 Ga0207425_1001222 Ga0207425_10012226 282
762 3300025245 Ga0207425_1009744 Ga0207425_10097442 282
763 3300025258 Ga0209129_1000110 Ga0209129_10001104 282
764 3300025258 Ga0209129_1001057 Ga0209129_10010572 282
765 3300025258 Ga0209129_1006102 Ga0209129_10061023 282
766 3300025273 Ga0209673_1000063 Ga0209673_10000636 282
767 3300025273 Ga0209673_1000677 Ga0209673_100067727 282
768 3300025273 Ga0209673_1003382 Ga0209673_10033827 282
769 3300025273 Ga0209673_1003971 Ga0209673_10039716 282
770 3300025273 Ga0209673_1008183 Ga0209673_10081833 282
771 3300025292 Ga0209676_1041953 Ga0209676_10419532 282
772 3300025294 Ga0209025_1000024 Ga0209025_10000244 282
773 3300025294 Ga0209025_1000235 Ga0209025_100023514 282
774 3300025294 Ga0209025_1027930 Ga0209025_10279303 282
775 3300025295 Ga0209564_1000138 Ga0209564_1000138166 282
776 3300025295 Ga0209564_1001016 Ga0209564_100101627 282
777 3300025297 Ga0209758_1000150 Ga0209758_1000150162 282
778 3300025297 Ga0209758_1000911 Ga0209758_10009116 282
779 3300025297 Ga0209758_1003440 Ga0209758_10034407 282
780 3300025297 Ga0209758_1022005 Ga0209758_10220053 282
781 3300025298 Ga0209050_1004886 Ga0209050_10048862 282
782 3300025299 Ga0209256_1000781 Ga0209256_100078144 282
783 3300025299 Ga0209256_1000911 Ga0209256_100091113 282
784 3300025302 Ga0207426_1000070 Ga0207426_100007029 282
785 3300025303 Ga0209051_1000197 Ga0209051_100019731 282
786 3300025303 Ga0209051_1002357 Ga0209051_10023576 282
787 3300025303 Ga0209051_1019603 Ga0209051_10196032 282
788 3300025304 Ga0209257_1014934 Ga0209257_10149342 282
789 3300025925 Ga0207650_10001599 Ga0207650_100015999 282
790 3300026067 Ga0207678_10140650 Ga0207678_101406502 282
791 3300026121 Ga0207683_10165747 Ga0207683_101657472 282
792 3300027111 Ga0209281_1000319 Ga0209281_100031952 282
793 3300027312 Ga0209371_1000350 Ga0209371_100035043 282
794 3300027666 Ga0209282_1000390 Ga0209282_100039018 282
795 3300028794 Ga0307515_10000029 Ga0307515_10000029257 282
796 3300028794 Ga0307515_10019713 Ga0307515_100197138 282
797 3300030500 Ga0268256_1009935 Ga0268256_10099353 282
798 3300030500 Ga0268256_1011570 Ga0268256_10115703 282
799 3300031456 Ga0307513_10000338 Ga0307513_1000033832 282
800 3300031456 Ga0307513_10031617 Ga0307513_100316172 282
801 3300031548 Ga0307408_100021050 Ga0307408_1000210503 282
802 3300031731 Ga0307405_10000625 Ga0307405_100006256 282
803 3300032004 Ga0307414_10450560 Ga0307414_104505602 282
804 3300041411 Ga0439466_0034939 Ga0439466_0034939_777_1637 282
805 3300041458 Ga0451798_0293113 Ga0451798_0293113_1017_1877 282
806 3300041503 Ga0451847_0064822 Ga0451847_0064822_1128_1988 282
807 3300041503 Ga0451847_0391665 Ga0451847_0391665_141_1001 282
808 3300041507 Ga0451851_0964114 Ga0451851_0964114_200_1060 282
809 3300041509 Ga0451843_0791251 Ga0451843_0791251_200_1060 282
810 3300042007 Ga0439449_0083682 Ga0439449_0083682_96_968 282
811 3300042015 Ga0439462_0028235 Ga0439462_0028235_515_1375 282
812 3300042185 Ga0450909_007959 Ga0450909_007959_544_1416 282
813 3300044683 Ga0466965_0147495 Ga0466965_0147495_190_1071 282
814 3300044901 Ga0466960_0080164 Ga0466960_0080164_113_994 282
815 3300046460 Ga0495638_0010639 Ga0495638_0010639_4156_5016 282
816 3300046473 Ga0495582_0236257 Ga0495582_0236257_91_951 282
817 3300046474 Ga0495605_0009076 Ga0495605_0009076_338_1198 282
818 3300046507 Ga0495606_0043403 Ga0495606_0043403_266_1123 282
819 3300046512 Ga0495610_0002588 Ga0495610_0002588_5671_6531 282
820 3300046518 Ga0495631_0005728 Ga0495631_0005728_3970_4830 282
821 3300046524 Ga0495648_0086268 Ga0495648_0086268_97_954 282
822 3300046530 Ga0495654_0000070 Ga0495654_0000070_5668_6528 282
823 3300046542 Ga0495597_0039857 Ga0495597_0039857_29_889 282
824 3300046558 Ga0495633_0011884 Ga0495633_0011884_1128_1988 282
825 3300046616 Ga0495668_0091137 Ga0495668_0091137_668_1528 282
826 3300046660 Ga0495625_0001943 Ga0495625_0001943_17239_18099 282
827 3300046660 Ga0495625_0119729 Ga0495625_0119729_148_1017 282
828 3300046660 Ga0495625_0133800 Ga0495625_0133800_439_1299 282
829 3300046810 Ga0495660_0009127 Ga0495660_0009127_146_1006 282
830 3300047472 Ga0495686_0017458 Ga0495686_0017458_3769_4629 282
831 3300047472 Ga0495686_0089052 Ga0495686_0089052_767_1627 282
832 3300048904 Ga0496101_0174857 Ga0496101_0174857_602_1462 282
833 3300048916 Ga0496113_0307749 Ga0496113_0307749_179_1039 282
834 3300048919 Ga0496116_0018317 Ga0496116_0018317_440_1300 282
835 3300048919 Ga0496116_0020742 Ga0496116_0020742_440_1300 282
836 3300048919 Ga0496116_0052957 Ga0496116_0052957_232_1092 282
837 3300048920 Ga0496117_0000002 Ga0496117_0000002_2191576_2192436 282
838 3300048920 Ga0496117_0042458 Ga0496117_0042458_707_1567 282
839 3300048921 Ga0496118_0000651 Ga0496118_0000651_49169_50029 282
840 3300048922 Ga0496119_0087711 Ga0496119_0087711_531_1391 282
841 3300048923 Ga0496120_0000034 Ga0496120_0000034_124883_125743 282
842 3300048923 Ga0496120_0013587 Ga0496120_0013587_2756_3616 282
843 3300048924 Ga0496121_0000220 Ga0496121_0000220_64641_65501 282
844 3300048924 Ga0496121_0038875 Ga0496121_0038875_459_1319 282
845 3300048924 Ga0496121_0131071 Ga0496121_0131071_472_1332 282
846 3300048925 Ga0496122_0000001 Ga0496122_0000001_1562372_1563232 282
847 3300048925 Ga0496122_0000018 Ga0496122_0000018_145433_146293 282
848 3300048925 Ga0496122_0010754 Ga0496122_0010754_8032_8892 282
849 3300048925 Ga0496122_0082641 Ga0496122_0082641_1212_2072 282
850 3300048926 Ga0496123_0000001 Ga0496123_0000001_1566103_1566963 282
851 3300048926 Ga0496123_0000015 Ga0496123_0000015_145433_146293 282
852 3300048926 Ga0496123_0009540 Ga0496123_0009540_3123_3983 282
853 3300048926 Ga0496123_0055175 Ga0496123_0055175_575_1435 282
854 3300048927 Ga0496124_0000083 Ga0496124_0000083_99798_100658 282
855 3300048927 Ga0496124_0004069 Ga0496124_0004069_16438_17298 282
856 3300048927 Ga0496124_0009307 Ga0496124_0009307_5744_6604 282
857 3300048927 Ga0496124_0010687 Ga0496124_0010687_3999_4859 282
858 3300048927 Ga0496124_0030901 Ga0496124_0030901_93_953 282
859 3300048927 Ga0496124_0070190 Ga0496124_0070190_1493_2353 282
860 3300048928 Ga0496125_0000001 Ga0496125_0000001_64791_65651 282
861 3300048928 Ga0496125_0018596 Ga0496125_0018596_5518_6378 282
862 3300048928 Ga0496125_0024406 Ga0496125_0024406_3515_4375 282
863 3300048928 Ga0496125_0104487 Ga0496125_0104487_1047_1907 282
864 3300048929 Ga0496126_0084226 Ga0496126_0084226_397_1257 282
865 3300049570 Ga0501033_0119224 Ga0501033_0119224_504_1355 282
866 3300049570 Ga0501033_0282050 Ga0501033_0282050_44_895 282
867 3300049822 Ga0501035_0017381 Ga0501035_0017381_757_1608 282
868 3300049823 Ga0501044_0037694 Ga0501044_0037694_1393_2244 282
869 3300049823 Ga0501044_0294201 Ga0501044_0294201_97_948 282
870 3300050490 nmdc:mga03n38_240941_c1 nmdc:mga03n38_240941_c1_27_887 282
871 3300050491 nmdc:mga00v17_2996_c1 nmdc:mga00v17_2996_c1_4785_5645 282
872 3300050491 nmdc:mga00v17_7106_c1 nmdc:mga00v17_7106_c1_370_1230 282
873 3300050492 nmdc:mga0yw44_42223_c1 nmdc:mga0yw44_42223_c1_1234_2094 282
874 3300050492 nmdc:mga0yw44_7601_c1 nmdc:mga0yw44_7601_c1_4455_5315 282
875 3300050493 nmdc:mga0k408_77511_c1 nmdc:mga0k408_77511_c1_1061_1921 282
876 3300050494 nmdc:mga06z11_6107_c1 nmdc:mga06z11_6107_c1_1724_2584 282
877 3300050495 nmdc:mga04h51_39039_c1 nmdc:mga04h51_39039_c1_54_914 282
878 3300050496 nmdc:mga07m45_1262_c1 nmdc:mga07m45_1262_c1_6713_7573 282
879 3300050496 nmdc:mga07m45_73203_c1 nmdc:mga07m45_73203_c1_999_1859 282
880 3300050516 nmdc:mga0sz30_70_c1 nmdc:mga0sz30_70_c1_37957_38817 282
881 3300053134 Ga0500658_0001181 Ga0500658_0001181_4390_5250 282
882 3300053137 Ga0500561_0000112 Ga0500561_0000112_6575_7435 282
883 3300053148 Ga0500590_110537 Ga0500590_110537_325_1185 282
884 3300053153 Ga0500616_0000652 Ga0500616_0000652_5118_5978 282
885 3300053153 Ga0500616_0001070 Ga0500616_0001070_1292_2152 282
886 3300053156 Ga0500622_0000946 Ga0500622_0000946_1721_2581 282
887 3300053157 Ga0500624_000650 Ga0500624_000650_3731_4591 282
888 3300053158 Ga0500627_0096079 Ga0500627_0096079_163_1023 282
889 iso_pu_bacteria 2599185301 2599939777 282
890 iso_pu_bacteria 2693429783 2694628923 282
891 iso_pu_bacteria 2693429784 2694637164 282
892 iso_pu_bacteria 2751185800 2753358494 282
893 iso_pu_bacteria 2767802442 2770197852 282
894 iso_pu_bacteria 2847686936 2847690883 282
895 iso_pu_bacteria 2854911287 2854914022 282
896 iso_pu_bacteria 2856364286 2856366939 282
897 iso_pu_bacteria 2869285874 2869287649 282
898 iso_pu_bacteria 2871429161 2871435597 282
899 iso_pu_bacteria 2871444079 2871447479 282
900 iso_pu_bacteria 2871495908 2871496457 282
901 iso_pu_bacteria 2874102143 2874104687 282
902 iso_pu_bacteria 2874146452 2874151280 282
903 iso_pu_bacteria 2874155637 2874158914 282
904 iso_pu_bacteria 2876369609 2876373317 282
905 iso_pu_bacteria 2876377896 2876381816 282
906 iso_pu_bacteria 2876392853 2876397801 282
907 iso_pu_bacteria 2876413966 2876417333 282
908 iso_pu_bacteria 2878745973 2878749160 282
909 iso_pu_bacteria 2878760144 2878760685 282
910 iso_pu_bacteria 2878767105 2878767690 282
911 iso_pu_bacteria 2881147464 2881149682 282
912 iso_pu_bacteria 2881161766 2881166563 282
913 iso_pu_bacteria 2885305155 2885308042 282
914 iso_pu_bacteria 2885326080 2885333679 282
915 iso_pu_bacteria 2903492973 2903498624 282
916 iso_pu_bacteria 2903540706 2903541251 282
917 iso_pu_bacteria 2904659560 2904664452 282
918 iso_pu_bacteria 2906308376 2906310198 282
919 iso_pu_bacteria 2906321335 2906324263 282
920 iso_pu_bacteria 2906328253 2906333091 282
921 iso_pu_bacteria 2915650412 2915650873 282
922 iso_pu_bacteria 2922158528 2922159086 282
923 iso_pu_bacteria 2924726620 2924727634 282
924 iso_pu_bacteria 2937813078 2937817022 282
925 iso_pu_bacteria 2937891427 2937892001 282
926 iso_pu_bacteria 2937994558 2937995107 282
927 iso_pu_bacteria 2938014810 2938022200 282
928 iso_pu_bacteria 2958115193 2958120979 282
929 iso_pu_bacteria 2958130278 2958132051 282
930 iso_pu_bacteria 2958165035 2958165628 282
931 iso_pu_bacteria 2958179912 2958181865 282
932 iso_pu_bacteria 2961077736 2961079709 282
933 iso_pu_bacteria 2961114664 2961119451 282
934 iso_pu_bacteria 2961163497 2961164087 282
935 iso_pu_bacteria 2965018300 2965018847 282
936 iso_pu_bacteria 2965062239 2965063048 282
937 iso_pu_bacteria 2968091066 2968091244 282
938 iso_pu_bacteria 2968097103 2968099193 282
939 iso_pu_bacteria 2968110612 2968115706 282
940 iso_pu_bacteria 2968117919 2968119064 282
941 iso_pu_bacteria 2968128360 2968134543 282
942 iso_pu_bacteria 2968171901 2968172490 282
943 iso_pu_bacteria 2970554993 2970555538 282
944 iso_pu_bacteria 2977843712 2977847313 282
945 iso_pu_bacteria 2977858184 2977859047 282
946 iso_pu_bacteria 2977864932 2977864957 282
947 iso_pu_bacteria 2979779861 2979782865 282
948 iso_pu_bacteria 2987659509 2987660095 282
949 iso_pu_bacteria 2996341866 2996348812 282
950 iso_pu_bacteria 3004188549 3004189143 282
951 iso_pu_bacteria 8004387939 8004389434 282
952 iso_pu_bacteria 8004445564 8004451188 282
953 iso_pu_bacteria 8004640170 8004643366 282
954 iso_pu_bacteria 8004703790 8004712269 282
955 iso_pu_bacteria 8004714634 8004717832 282
956 3300003578 Ga0006562J51391_1008046 Ga0006562J51391_10080465 283
957 3300005548 Ga0070665_100028975 Ga0070665_1000289753 283
958 3300006038 Ga0075365_10072980 Ga0075365_100729803 283
959 3300028379 Ga0268266_10002934 Ga0268266_100029342 283
960 3300037312 Ga0395899_0000044 Ga0395899_0000044_63624_64490 283
961 3300037418 Ga0395900_0000042 Ga0395900_0000042_57784_58650 283
962 3300037466 Ga0395898_0000080 Ga0395898_0000080_57784_58650 283
963 3300037471 Ga0395905_0000044 Ga0395905_0000044_184267_185133 283
964 3300038443 Ga0395901_0000027 Ga0395901_0000027_184233_185099 283
965 3300047472 Ga0495686_0040841 Ga0495686_0040841_1439_2293 283
966 3300048922 Ga0496119_0010271 Ga0496119_0010271_4276_5160 283
967 3300048925 Ga0496122_0036198 Ga0496122_0036198_1782_2666 283
968 3300048926 Ga0496123_0133904 Ga0496123_0133904_144_1028 283
969 3300048929 Ga0496126_0116210 Ga0496126_0116210_1086_1970 283
970 3300049570 Ga0501033_0006155 Ga0501033_0006155_2429_3283 283
971 3300049574 Ga0501038_0401518 Ga0501038_0401518_123_977 283
972 3300049583 Ga0501067_0030357 Ga0501067_0030357_1811_2680 283
973 3300049823 Ga0501044_0353566 Ga0501044_0353566_408_1262 283
974 3300050492 nmdc:mga0yw44_12630_c1 nmdc:mga0yw44_12630_c1_462_1316 283
975 3300053153 Ga0500616_0028539 Ga0500616_0028539_1945_2799 283
976 3300053158 Ga0500627_0049487 Ga0500627_0049487_894_1748 283
977 iso_pu_bacteria 2643221550 2643769943 283
978 iso_pu_bacteria 2643221564 2643837748 283
979 iso_pu_bacteria 2758568016 2758640725 283
980 3300002741 JGI25157J39369_1000713 JGI25157J39369_100071313 284
981 3300003203 JGI25406J46586_10016349 JGI25406J46586_100163494 284
982 3300005985 Ga0081539_10000429 Ga0081539_1000042980 284
983 3300006038 Ga0075365_10073314 Ga0075365_100733142 284
984 3300006038 Ga0075365_10227253 Ga0075365_102272532 284
985 3300006178 Ga0075367_10030454 Ga0075367_100304542 284
986 3300009093 Ga0105240_10190883 Ga0105240_101908832 284
987 3300013307 Ga0157372_10367743 Ga0157372_103677432 284
988 3300025250 Ga0209026_1000100 Ga0209026_1000100105 284
989 3300025256 Ga0209759_1000438 Ga0209759_100043841 284
990 3300025907 Ga0207645_10069558 Ga0207645_100695582 284
991 3300031456 Ga0307513_10370815 Ga0307513_103708152 284
992 3300031548 Ga0307408_100299738 Ga0307408_1002997382 284
993 3300031911 Ga0307412_10179237 Ga0307412_101792372 284
994 3300032002 Ga0307416_100972437 Ga0307416_1009724371 284
995 3300046460 Ga0495638_0083946 Ga0495638_0083946_929_1795 284
996 3300046512 Ga0495610_0092146 Ga0495610_0092146_385_1242 284
997 3300046660 Ga0495625_0037698 Ga0495625_0037698_743_1600 284
998 3300046660 Ga0495625_0103387 Ga0495625_0103387_556_1413 284
999 3300049568 Ga0501031_0057026 Ga0501031_0057026_1403_2263 284
1000 3300049568 Ga0501031_0092356 Ga0501031_0092356_851_1711 284
1001 3300049569 Ga0501032_0037294 Ga0501032_0037294_82_939 284
1002 3300049569 Ga0501032_0043587 Ga0501032_0043587_1996_2853 284
1003 3300049569 Ga0501032_0052697 Ga0501032_0052697_1367_2227 284
1004 3300049570 Ga0501033_0000536 Ga0501033_0000536_33145_34005 284
1005 3300049570 Ga0501033_0012030 Ga0501033_0012030_2682_3542 284
1006 3300049570 Ga0501033_0081695 Ga0501033_0081695_1266_2123 284
1007 3300049570 Ga0501033_0245738 Ga0501033_0245738_203_1060 284
1008 3300049571 Ga0501034_0010831 Ga0501034_0010831_4915_5775 284
1009 3300049573 Ga0501037_0000124 Ga0501037_0000124_67356_68216 284
1010 3300049573 Ga0501037_0387788 Ga0501037_0387788_13_873 284
1011 3300049579 Ga0501043_0000003 Ga0501043_0000003_119679_120539 284
1012 3300049583 Ga0501067_0020826 Ga0501067_0020826_1854_2714 284
1013 3300049585 Ga0501069_0000003 Ga0501069_0000003_135254_136114 284
1014 3300049586 Ga0501070_0000321 Ga0501070_0000321_29705_30565 284
1015 3300049586 Ga0501070_0000665 Ga0501070_0000665_10640_11500 284
1016 3300049587 Ga0501071_0010029 Ga0501071_0010029_2433_3293 284
1017 3300049589 Ga0501073_0004613 Ga0501073_0004613_6252_7112 284
1018 3300049589 Ga0501073_0035099 Ga0501073_0035099_551_1411 284
1019 3300049590 Ga0501074_0000027 Ga0501074_0000027_11374_12234 284
1020 3300049590 Ga0501074_0007601 Ga0501074_0007601_5341_6201 284
1021 3300049742 Ga0501080_0000139 Ga0501080_0000139_38879_39739 284
1022 3300049742 Ga0501080_0001625 Ga0501080_0001625_905_1765 284
1023 3300049744 Ga0501083_0000024 Ga0501083_0000024_83210_84070 284
1024 3300049822 Ga0501035_0000083 Ga0501035_0000083_113842_114702 284
1025 3300049822 Ga0501035_0003722 Ga0501035_0003722_2002_2859 284
1026 3300049822 Ga0501035_0005789 Ga0501035_0005789_6714_7574 284
1027 3300049823 Ga0501044_0000016 Ga0501044_0000016_135246_136106 284
1028 3300049823 Ga0501044_0018152 Ga0501044_0018152_6517_7377 284
1029 3300049823 Ga0501044_0595124 Ga0501044_0595124_26_883 284
1030 3300050489 nmdc:mga03683_18865_c1 nmdc:mga03683_18865_c1_809_1666 284
1031 3300050490 nmdc:mga03n38_35569_c1 nmdc:mga03n38_35569_c1_693_1550 284
1032 3300050491 nmdc:mga00v17_41256_c1 nmdc:mga00v17_41256_c1_1238_2095 284
1033 3300050492 nmdc:mga0yw44_186248_c1 nmdc:mga0yw44_186248_c1_455_1312 284
1034 3300050492 nmdc:mga0yw44_3578_c1 nmdc:mga0yw44_3578_c1_1484_2341 284
1035 3300050496 nmdc:mga07m45_104620_c1 nmdc:mga07m45_104620_c1_557_1414 284
1036 3300053083 Ga0495655_0002792 Ga0495655_0002792_727_1584 284
1037 3300053158 Ga0500627_0080941 Ga0500627_0080941_474_1331 284
1038 3300060353 Ga0501082_0031083 Ga0501082_0031083_585_1445 284
1039 iso_pu_bacteria 3002141150 3002142175 284
1040 3300001979 JGI24740J21852_10016044 JGI24740J21852_100160443 285
1041 3300003214 JGI25165J46597_1000034 JGI25165J46597_1000034164 285
1042 3300003762 Ga0055542_1001311 Ga0055542_10013113 285
1043 3300005327 Ga0070658_10241626 Ga0070658_102416262 285
1044 3300005539 Ga0068853_100397238 Ga0068853_1003972382 285
1045 3300005614 Ga0068856_100121315 Ga0068856_1001213153 285
1046 3300005937 Ga0081455_10138185 Ga0081455_101381852 285
1047 3300006038 Ga0075365_10043888 Ga0075365_100438883 285
1048 3300006051 Ga0075364_10004845 Ga0075364_100048456 285
1049 3300006178 Ga0075367_10015887 Ga0075367_100158874 285
1050 3300006178 Ga0075367_10073354 Ga0075367_100733543 285
1051 3300009174 Ga0105241_10082579 Ga0105241_100825792 285
1052 3300009545 Ga0105237_10027130 Ga0105237_100271302 285
1053 3300009545 Ga0105237_10391846 Ga0105237_103918462 285
1054 3300009551 Ga0105238_10001783 Ga0105238_1000178322 285
1055 3300009551 Ga0105238_10625112 Ga0105238_106251122 285
1056 3300010375 Ga0105239_10064361 Ga0105239_100643614 285
1057 3300010375 Ga0105239_10141682 Ga0105239_101416823 285
1058 3300010375 Ga0105239_10156496 Ga0105239_101564962 285
1059 3300010375 Ga0105239_10348638 Ga0105239_103486382 285
1060 3300013105 Ga0157369_10176879 Ga0157369_101768792 285
1061 3300013296 Ga0157374_10470004 Ga0157374_104700042 285
1062 3300013307 Ga0157372_10399204 Ga0157372_103992041 285
1063 3300014497 Ga0182008_10003585 Ga0182008_100035853 285
1064 3300025253 Ga0209677_113343 Ga0209677_1133432 285
1065 3300025254 Ga0209148_1000069 Ga0209148_100006965 285
1066 3300025261 Ga0209233_1000028 Ga0209233_1000028169 285
1067 3300025261 Ga0209233_1013679 Ga0209233_10136792 285
1068 3300025272 Ga0209455_1000135 Ga0209455_1000135122 285
1069 3300025294 Ga0209025_1046820 Ga0209025_10468202 285
1070 3300025297 Ga0209758_1008601 Ga0209758_10086012 285
1071 3300025904 Ga0207647_10040277 Ga0207647_100402772 285
1072 3300025909 Ga0207705_10069918 Ga0207705_100699182 285
1073 3300025914 Ga0207671_10026100 Ga0207671_100261002 285
1074 3300025914 Ga0207671_10288998 Ga0207671_102889981 285
1075 3300025919 Ga0207657_10041291 Ga0207657_100412912 285
1076 3300025924 Ga0207694_10008697 Ga0207694_100086979 285
1077 3300025924 Ga0207694_10149690 Ga0207694_101496902 285
1078 3300026041 Ga0207639_10060837 Ga0207639_100608372 285
1079 3300026041 Ga0207639_10350182 Ga0207639_103501822 285
1080 3300026041 Ga0207639_10399663 Ga0207639_103996632 285
1081 3300026067 Ga0207678_10353287 Ga0207678_103532873 285
1082 3300026116 Ga0207674_10062282 Ga0207674_100622824 285
1083 3300037312 Ga0395899_0188414 Ga0395899_0188414_374_1231 285
1084 3300037312 Ga0395899_0235307 Ga0395899_0235307_293_1153 285
1085 3300037418 Ga0395900_0051710 Ga0395900_0051710_2207_3067 285
1086 3300037418 Ga0395900_0089857 Ga0395900_0089857_1879_2736 285
1087 3300037466 Ga0395898_0207204 Ga0395898_0207204_754_1614 285
1088 3300037471 Ga0395905_0049704 Ga0395905_0049704_732_1592 285
1089 3300037471 Ga0395905_0071548 Ga0395905_0071548_359_1219 285
1090 3300037471 Ga0395905_0231332 Ga0395905_0231332_500_1360 285
1091 3300038443 Ga0395901_0019916 Ga0395901_0019916_4849_5709 285
1092 3300038443 Ga0395901_0274420 Ga0395901_0274420_234_1094 285
1093 3300046616 Ga0495668_0030556 Ga0495668_0030556_1099_1956 285
1094 3300048916 Ga0496113_0283958 Ga0496113_0283958_31_891 285
1095 3300048921 Ga0496118_0136322 Ga0496118_0136322_208_1065 285
1096 3300048922 Ga0496119_0094974 Ga0496119_0094974_77_934 285
1097 3300048923 Ga0496120_0001725 Ga0496120_0001725_2461_3321 285
1098 3300048928 Ga0496125_0094809 Ga0496125_0094809_798_1658 285
1099 3300048929 Ga0496126_0067549 Ga0496126_0067549_751_1611 285
1100 3300049586 Ga0501070_0070375 Ga0501070_0070375_1330_2190 285
1101 3300049592 Ga0501076_0383784 Ga0501076_0383784_136_1026 285
1102 3300050491 nmdc:mga00v17_8212_c1 nmdc:mga00v17_8212_c1_1717_2574 285
1103 3300050492 nmdc:mga0yw44_1843_c1 nmdc:mga0yw44_1843_c1_97_954 285
1104 3300050494 nmdc:mga06z11_197491_c1 nmdc:mga06z11_197491_c1_296_1156 285
1105 3300050494 nmdc:mga06z11_5987_c1 nmdc:mga06z11_5987_c1_1180_2037 285
1106 3300050496 nmdc:mga07m45_15785_c1 nmdc:mga07m45_15785_c1_300_1157 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08032

SpoU_sub_bind

RNA 2'-O ribose methyltransferase substrate binding

44

119

0.95

PF00588

SpoU_methylase

SpoU rRNA Methylase family

130

271

0.91

PF22435

MRM3-like_sub_bind

MRM3-like substrate binding domain

22

112

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kzk-assembly1.cif.gz_B crystal structure of rrna methyltransferase from sinorhizobium meliloti 0.9701 10 277
5l0z-assembly1.cif.gz_B crystal structure of adomet bound rrna methyltransferase from sinorhizobium meliloti 0.9667 10 277
5kzk-assembly1.cif.gz_B crystal structure of rrna methyltransferase from sinorhizobium meliloti 0.9664 10 277
5l0z-assembly1.cif.gz_B crystal structure of adomet bound rrna methyltransferase from sinorhizobium meliloti 0.9631 10 277
4x3m-assembly1.cif.gz_B crystal structure of ttha0275 from thermus thermophilus (hb8) in complex with adenosine in space group p212121 0.8868 13 281
ID Description Score Start End Superfamily
5l0zB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9347 126 277 3.40.1280.10
5l0zB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9111 126 277 3.40.1280.10
af_Q2FZE0_99_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8906 123 272 3.40.1280.10
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.888 128 273 3.40.1280.10
4x3mB01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8834 13 115 3.30.1330.30
ID Description Score Start End GO Terms
AF-A0A5R2N226-F1-model_v4 RNA methyltransferase 0.9924 47 140 GO:0008168
GO:0032259
AF-A0A4S0IFU7-F1-model_v4 RNA methyltransferase 0.9823 103 215 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-A0A4S0IFU7-F1-model_v4 RNA methyltransferase 0.9654 103 215 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-A0A2W4CGN2-F1-model_v4 RNA methyltransferase 0.9548 1 279 GO:0003723
GO:0005737
GO:0006396
GO:0008173
GO:0032259
AF-A0A529FPR9-F1-model_v4 RNA methyltransferase 0.9531 114 280 GO:0003723
GO:0006396
GO:0008173
GO:0032259

Feature Viewer

pLDDT pTM Quality
91.48 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map