F490135

General Info

Members Datasets Scaffolds Average Seq Length
1105 339 2210 187

Family's Representative Sequence

Representative Sequence 3300025893|Ga0207682_10042443|Ga0207682_100424432
Length 215
Sequence MGTTLSEAPPRKRASRLRLAKAVFNCPPVRAGVSVMPLVVLMGTTALAQGPTFGVGRAPTPEEIRAVDISISPTGDELPPGRGTAKEGAQLYVQKACVGCHGVGGSGGLAPLLASKKEADVPVWKKERILPLRAPYATIVWDFINRGMPLGLEGTLKPDEVYSLTAYLLFLNKVIPEDQVLDKQSLPKVKMPIGDQFGKPHEFKVNAPRLEGYPY

Samples

Sample ID Description Type Environment
1 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
207 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
208 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
209 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
210 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
211 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
215 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
216 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
217 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
218 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
219 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
225 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
226 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
227 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
232 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
236 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
237 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
238 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
250 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
251 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
252 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
274 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
275 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
287 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
288 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
289 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
290 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
291 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
292 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
293 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
314 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
315 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
316 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
336 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 1.63
Rhizosphere 96.92
Stem 0
Stem Tuber 0
Unclassified 26.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207682_10042443 3300025893 Bacteria 1858
2 SwRhRL2b_contig_3032446 2162886007 Unclassified 911
3 ARcpr5oldR_c010840 3300000041 Unclassified 778
4 JGI24746J21847_1001423 3300001977 Unclassified 3808
5 JGI24751J29686_10005177 3300002459 Bacteria 2653
6 JGI24751J29686_10033568 3300002459 Unclassified 1064
7 Ga0006778J45830_1027403 3300003162 Bacteria 702
8 JGI25165J46597_1000003 3300003214 Bacteria 694080
9 Ga0007410J51695_1020453 3300003574 Bacteria 798
10 Ga0058859_11478325 3300004798 Bacteria 613
11 Ga0058863_11154503 3300004799 Unclassified 599
12 Ga0058861_11345411 3300004800 Unclassified 721
13 Ga0058861_11619973 3300004800 Bacteria 1928
14 Ga0058861_11964324 3300004800 Bacteria 862
15 Ga0058860_12099259 3300004801 Unclassified 698
16 Ga0058860_12204101 3300004801 Unclassified 951
17 Ga0058862_11744529 3300004803 Bacteria 1911
18 Ga0058862_12769194 3300004803 Bacteria 2049
19 Ga0065714_10120588 3300005288 Unclassified 1353
20 Ga0065704_10004042 3300005289 Bacteria 3991
21 Ga0065704_10005168 3300005289 Unclassified 3872
22 Ga0065712_10074022 3300005290 Bacteria 4208
23 Ga0065712_10128508 3300005290 Bacteria 1578
24 Ga0065712_10136592 3300005290 Unclassified 1475
25 Ga0065712_10149591 3300005290 Bacteria 1380
26 Ga0065715_10010752 3300005293 Unclassified 2448
27 Ga0065715_10023454 3300005293 Bacteria 1541
28 Ga0065715_10024118 3300005293 Unclassified 1856
29 Ga0065715_10163698 3300005293 Bacteria 1605
30 Ga0065715_10203398 3300005293 Bacteria 1308
31 Ga0065707_10001405 3300005295 Bacteria 10473
32 Ga0065707_10008883 3300005295 Unclassified 3583
33 Ga0065707_10120166 3300005295 Unclassified 2141
34 Ga0065707_10563363 3300005295 Bacteria 713
35 Ga0070658_10080659 3300005327 Bacteria 2672
36 Ga0070658_10137220 3300005327 Bacteria 2042
37 Ga0070676_10028387 3300005328 Bacteria 3178
38 Ga0070676_10111141 3300005328 Bacteria 1706
39 Ga0070676_10138907 3300005328 Bacteria 1545
40 Ga0070676_10246314 3300005328 Bacteria 1191
41 Ga0070683_100016713 3300005329 Bacteria 6474
42 Ga0070683_100251636 3300005329 Unclassified 1680
43 Ga0070683_100773368 3300005329 Bacteria 920
44 Ga0070683_100880943 3300005329 Bacteria 859
45 Ga0070690_100008406 3300005330 Bacteria 5943
46 Ga0070690_100011868 3300005330 Bacteria 5112
47 Ga0070690_100026704 3300005330 Bacteria 3564
48 Ga0070690_100415323 3300005330 Bacteria 991
49 Ga0070670_100101198 3300005331 Bacteria 2481
50 Ga0070670_100147006 3300005331 Unclassified 2039
51 Ga0070670_100262808 3300005331 Bacteria 1505
52 Ga0070677_10016768 3300005333 Bacteria 2612
53 Ga0070677_10081654 3300005333 Bacteria 1384
54 Ga0070677_10167176 3300005333 Unclassified 1037
55 Ga0070677_10186852 3300005333 Unclassified 991
56 Ga0070677_10229593 3300005333 Bacteria 911
57 Ga0070677_10333397 3300005333 Bacteria 781
58 Ga0070677_10426231 3300005333 Unclassified 704
59 Ga0068869_100001817 3300005334 Bacteria 12818
60 Ga0068869_100069007 3300005334 Bacteria 2612
61 Ga0068869_100079712 3300005334 Bacteria 2441
62 Ga0068869_100086889 3300005334 Unclassified 2345
63 Ga0068869_100246937 3300005334 Bacteria 1424
64 Ga0068869_100256085 3300005334 Bacteria 1399
65 Ga0068869_100291877 3300005334 Bacteria 1314
66 Ga0068869_100305928 3300005334 Bacteria 1285
67 Ga0068869_100437615 3300005334 Unclassified 1082
68 Ga0070666_10003881 3300005335 Bacteria 9079
69 Ga0070666_10095913 3300005335 Bacteria 2041
70 Ga0070666_10464080 3300005335 Unclassified 915
71 Ga0070680_100150655 3300005336 Bacteria 1952
72 Ga0070680_100192119 3300005336 Bacteria 1720
73 Ga0070680_100457047 3300005336 Bacteria 1091
74 Ga0070682_100751685 3300005337 Unclassified 787
75 Ga0068868_100146382 3300005338 Bacteria 1943
76 Ga0068868_100181846 3300005338 Bacteria 1745
77 Ga0068868_100205591 3300005338 Bacteria 1643
78 Ga0070660_100060000 3300005339 Bacteria 2951
79 Ga0070660_100104038 3300005339 Bacteria 2252
80 Ga0070660_100106393 3300005339 Bacteria 2228
81 Ga0070689_100009051 3300005340 Bacteria 7050
82 Ga0070689_100031685 3300005340 Bacteria 4019
83 Ga0070689_100082585 3300005340 Unclassified 2524
84 Ga0070689_100116610 3300005340 Bacteria 2129
85 Ga0070689_100293399 3300005340 Bacteria 1352
86 Ga0070689_100691174 3300005340 Bacteria 890
87 Ga0070691_10002877 3300005341 Bacteria 7711
88 Ga0070691_10023689 3300005341 Bacteria 2852
89 Ga0070687_100004448 3300005343 Bacteria 5591
90 Ga0070687_100131437 3300005343 Bacteria 1446
91 Ga0070661_100047551 3300005344 Unclassified 3140
92 Ga0070661_100058230 3300005344 Bacteria 2831
93 Ga0070661_100156916 3300005344 Bacteria 1722
94 Ga0070661_100463929 3300005344 Bacteria 1009
95 Ga0070692_10434984 3300005345 Bacteria 836
96 Ga0070692_10687571 3300005345 Unclassified 687
97 Ga0070668_100010486 3300005347 Bacteria 6889
98 Ga0070668_100428177 3300005347 Bacteria 1134
99 Ga0070668_100449992 3300005347 Unclassified 1107
100 Ga0070668_100729695 3300005347 Bacteria 876
101 Ga0070669_100010337 3300005353 Bacteria 6627
102 Ga0070669_100058864 3300005353 Bacteria 2820
103 Ga0070669_100084280 3300005353 Unclassified 2371
104 Ga0070669_100642073 3300005353 Unclassified 892
105 Ga0070675_100000464 3300005354 Bacteria 27701
106 Ga0070675_100089079 3300005354 Bacteria 2583
107 Ga0070675_100105755 3300005354 Bacteria 2375
108 Ga0070675_100137027 3300005354 Bacteria 2089
109 Ga0070675_100324662 3300005354 Bacteria 1360
110 Ga0070675_100384097 3300005354 Bacteria 1250
111 Ga0070675_100466046 3300005354 Bacteria 1135
112 Ga0070675_100817831 3300005354 Unclassified 852
113 Ga0070675_100919647 3300005354 Unclassified 802
114 Ga0070671_100055695 3300005355 Bacteria 3289
115 Ga0070671_100155579 3300005355 Bacteria 1931
116 Ga0070671_100169671 3300005355 Bacteria 1845
117 Ga0070674_100032443 3300005356 Bacteria 3468
118 Ga0070674_100747977 3300005356 Unclassified 840
119 Ga0070674_100753385 3300005356 Bacteria 837
120 Ga0070674_100915458 3300005356 Unclassified 765
121 Ga0070674_100990526 3300005356 Unclassified 737
122 Ga0070673_100008655 3300005364 Bacteria 6781
123 Ga0070673_100034453 3300005364 Bacteria 3832
124 Ga0070673_100051812 3300005364 Bacteria 3217
125 Ga0070673_100056656 3300005364 Bacteria 3093
126 Ga0070673_100074490 3300005364 Bacteria 2736
127 Ga0070673_100188600 3300005364 Bacteria 1770
128 Ga0070673_101111224 3300005364 Unclassified 739
129 Ga0070688_100027363 3300005365 Bacteria 3396
130 Ga0070688_100028663 3300005365 Bacteria 3326
131 Ga0070688_100170237 3300005365 Bacteria 1502
132 Ga0070688_100464008 3300005365 Unclassified 949
133 Ga0070688_100824686 3300005365 Unclassified 727
134 Ga0070659_100037772 3300005366 Bacteria 3765
135 Ga0070667_100008486 3300005367 Bacteria 8518
136 Ga0070667_100013176 3300005367 Bacteria 6834
137 Ga0070667_100146499 3300005367 Bacteria 2071
138 Ga0070667_100273403 3300005367 Bacteria 1515
139 Ga0070667_100396141 3300005367 Bacteria 1256
140 Ga0070667_100437278 3300005367 Bacteria 1194
141 Ga0070667_100472470 3300005367 Unclassified 1147
142 Ga0070667_100483975 3300005367 Bacteria 1133
143 Ga0070667_100635606 3300005367 Unclassified 985
144 Ga0070709_10101345 3300005434 Unclassified 1919
145 Ga0070709_10370843 3300005434 Bacteria 1062
146 Ga0070713_100267422 3300005436 Bacteria 1565
147 Ga0070710_10469579 3300005437 Bacteria 856
148 Ga0070710_10731332 3300005437 Bacteria 701
149 Ga0070701_10003530 3300005438 Bacteria 6203
150 Ga0070701_10038044 3300005438 Bacteria 2433
151 Ga0070701_10096782 3300005438 Bacteria 1628
152 Ga0070701_10248525 3300005438 Bacteria 1073
153 Ga0070711_100367241 3300005439 Bacteria 1160
154 Ga0070705_100043086 3300005440 Unclassified 2585
155 Ga0070705_100556711 3300005440 Unclassified 880
156 Ga0070705_101076244 3300005440 Unclassified 656
157 Ga0070700_100010513 3300005441 Bacteria 5113
158 Ga0070700_100038354 3300005441 Bacteria 2919
159 Ga0070694_100009867 3300005444 Bacteria 5870
160 Ga0070694_100168322 3300005444 Bacteria 1613
161 Ga0070694_100291348 3300005444 Bacteria 1248
162 Ga0070694_100341445 3300005444 Bacteria 1158
163 Ga0070694_100575269 3300005444 Unclassified 904
164 Ga0070708_100378911 3300005445 Unclassified 1334
165 Ga0070708_100576698 3300005445 Unclassified 1061
166 Ga0070708_101094123 3300005445 Unclassified 746
167 Ga0070708_101209960 3300005445 Unclassified 707
168 Ga0070663_100215951 3300005455 Bacteria 1504
169 Ga0070678_100004034 3300005456 Bacteria 8266
170 Ga0070678_100056470 3300005456 Bacteria 2872
171 Ga0070678_100094618 3300005456 Bacteria 2300
172 Ga0070678_100885522 3300005456 Bacteria 815
173 Ga0070662_100245993 3300005457 Bacteria 1436
174 Ga0070662_101197998 3300005457 Unclassified 653
175 Ga0070681_10010262 3300005458 Bacteria 9242
176 Ga0070681_10013494 3300005458 Bacteria 8120
177 Ga0070681_10064420 3300005458 Bacteria 3635
178 Ga0070681_10290219 3300005458 Bacteria 1546
179 Ga0068867_100000898 3300005459 Bacteria 20171
180 Ga0068867_100007475 3300005459 Bacteria 7727
181 Ga0068867_100014622 3300005459 Bacteria 5561
182 Ga0068867_100054992 3300005459 Bacteria 2941
183 Ga0068867_100130713 3300005459 Bacteria 1951
184 Ga0068867_100258612 3300005459 Bacteria 1418
185 Ga0068867_100347645 3300005459 Bacteria 1236
186 Ga0068867_100612472 3300005459 Bacteria 951
187 Ga0070685_10079184 3300005466 Unclassified 1966
188 Ga0070685_10171365 3300005466 Bacteria 1391
189 Ga0070685_10317003 3300005466 Bacteria 1055
190 Ga0070707_100229824 3300005468 Bacteria 1806
191 Ga0070707_101071705 3300005468 Bacteria 772
192 Ga0070698_101054681 3300005471 Unclassified 761
193 Ga0070699_100410760 3300005518 Bacteria 1225
194 Ga0070699_100563940 3300005518 Unclassified 1037
195 Ga0070679_100012895 3300005530 Bacteria 8002
196 Ga0070679_100050628 3300005530 Bacteria 4137
197 Ga0070679_100073633 3300005530 Bacteria 3407
198 Ga0070679_100076852 3300005530 Unclassified 3327
199 Ga0070684_100000686 3300005535 Bacteria 23355
200 Ga0070684_100227943 3300005535 Bacteria 1701
201 Ga0070684_100272808 3300005535 Bacteria 1549
202 Ga0070684_100306170 3300005535 Bacteria 1459
203 Ga0070684_100583377 3300005535 Bacteria 1039
204 Ga0068853_100013515 3300005539 Bacteria 6669
205 Ga0068853_100071915 3300005539 Unclassified 3013
206 Ga0068853_100136091 3300005539 Bacteria 2203
207 Ga0068853_100326225 3300005539 Bacteria 1424
208 Ga0068853_100341633 3300005539 Bacteria 1391
209 Ga0068853_100415734 3300005539 Unclassified 1260
210 Ga0070672_100033588 3300005543 Bacteria 3886
211 Ga0070672_100046100 3300005543 Bacteria 3376
212 Ga0070672_100052061 3300005543 Bacteria 3195
213 Ga0070672_100061480 3300005543 Unclassified 2961
214 Ga0070672_100085283 3300005543 Bacteria 2538
215 Ga0070672_100093177 3300005543 Bacteria 2433
216 Ga0070672_100133153 3300005543 Bacteria 2045
217 Ga0070672_100498076 3300005543 Unclassified 1054
218 Ga0070672_100502039 3300005543 Bacteria 1049
219 Ga0070672_100670395 3300005543 Unclassified 907
220 Ga0070686_100016391 3300005544 Unclassified 4311
221 Ga0070686_100166673 3300005544 Unclassified 1555
222 Ga0070686_100302434 3300005544 Bacteria 1187
223 Ga0070686_100329493 3300005544 Bacteria 1141
224 Ga0070686_100501945 3300005544 Bacteria 941
225 Ga0070686_100818335 3300005544 Unclassified 752
226 Ga0070686_100825890 3300005544 Unclassified 749
227 Ga0070686_101091704 3300005544 Unclassified 659
228 Ga0070695_100109052 3300005545 Bacteria 1876
229 Ga0070695_100161546 3300005545 Bacteria 1573
230 Ga0070695_100278729 3300005545 Bacteria 1227
231 Ga0070695_100591478 3300005545 Unclassified 870
232 Ga0070695_101087944 3300005545 Bacteria 654
233 Ga0070696_100077321 3300005546 Bacteria 2352
234 Ga0070696_100176990 3300005546 Bacteria 1581
235 Ga0070696_100181098 3300005546 Unclassified 1563
236 Ga0070696_100488859 3300005546 Unclassified 977
237 Ga0070696_100929214 3300005546 Unclassified 723
238 Ga0070665_100066267 3300005548 Bacteria 3623
239 Ga0070665_100069879 3300005548 Unclassified 3519
240 Ga0070665_100237681 3300005548 Bacteria 1822
241 Ga0070665_100253431 3300005548 Bacteria 1761
242 Ga0070704_100006391 3300005549 Bacteria 6947
243 Ga0070704_100095090 3300005549 Bacteria 2231
244 Ga0070704_100120553 3300005549 Bacteria 2014
245 Ga0070704_100669043 3300005549 Unclassified 918
246 Ga0068855_100048876 3300005563 Unclassified 4991
247 Ga0068855_100079772 3300005563 Bacteria 3796
248 Ga0068855_100232806 3300005563 Bacteria 2062
249 Ga0068855_100711845 3300005563 Bacteria 1074
250 Ga0070664_100168905 3300005564 Bacteria 1939
251 Ga0070664_100371284 3300005564 Bacteria 1304
252 Ga0070664_100399255 3300005564 Bacteria 1257
253 Ga0070664_100888807 3300005564 Unclassified 835
254 Ga0068857_100001723 3300005577 Bacteria 17599
255 Ga0068857_100013627 3300005577 Bacteria 7084
256 Ga0068857_100077163 3300005577 Unclassified 2972
257 Ga0068857_100081572 3300005577 Bacteria 2888
258 Ga0068857_100151507 3300005577 Bacteria 2101
259 Ga0068854_100005751 3300005578 Bacteria 7843
260 Ga0068854_100108817 3300005578 Bacteria 2088
261 Ga0068856_100003074 3300005614 Bacteria 17036
262 Ga0068856_100024019 3300005614 Bacteria 5930
263 Ga0068856_100143017 3300005614 Bacteria 2399
264 Ga0068856_100202771 3300005614 Unclassified 1998
265 Ga0068856_100583066 3300005614 Unclassified 1139
266 Ga0070702_100025563 3300005615 Bacteria 3165
267 Ga0070702_100107701 3300005615 Bacteria 1721
268 Ga0070702_100144463 3300005615 Unclassified 1519
269 Ga0070702_100293266 3300005615 Bacteria 1122
270 Ga0070702_100341074 3300005615 Bacteria 1052
271 Ga0068852_100004765 3300005616 Bacteria 9634
272 Ga0068852_100162470 3300005616 Bacteria 2086
273 Ga0068852_100176436 3300005616 Bacteria 2006
274 Ga0068852_101255527 3300005616 Unclassified 762
275 Ga0068859_100000942 3300005617 Bacteria 29786
276 Ga0068859_100007715 3300005617 Bacteria 10928
277 Ga0068859_100015193 3300005617 Bacteria 7728
278 Ga0068859_100041903 3300005617 Bacteria 4599
279 Ga0068859_100064018 3300005617 Bacteria 3709
280 Ga0068859_100106707 3300005617 Bacteria 2860
281 Ga0068859_100136850 3300005617 Bacteria 2522
282 Ga0068859_100162902 3300005617 Bacteria 2309
283 Ga0068859_100239373 3300005617 Bacteria 1904
284 Ga0068859_100376769 3300005617 Unclassified 1515
285 Ga0068859_100570123 3300005617 Bacteria 1226
286 Ga0068859_100738089 3300005617 Bacteria 1074
287 Ga0068859_100894406 3300005617 Unclassified 973
288 Ga0068859_101445197 3300005617 Bacteria 759
289 Ga0068864_100016200 3300005618 Bacteria 6205
290 Ga0068864_100046995 3300005618 Unclassified 3705
291 Ga0068864_100059994 3300005618 Bacteria 3293
292 Ga0068864_100083878 3300005618 Bacteria 2799
293 Ga0068864_100547607 3300005618 Bacteria 1118
294 Ga0068864_100879421 3300005618 Unclassified 884
295 Ga0068864_100921191 3300005618 Bacteria 864
296 Ga0068866_10021155 3300005718 Bacteria 2993
297 Ga0068866_10026122 3300005718 Unclassified 2753
298 Ga0068866_10300711 3300005718 Bacteria 1002
299 Ga0068866_10325162 3300005718 Unclassified 969
300 Ga0068861_100166951 3300005719 Unclassified 1821
301 Ga0068861_100189992 3300005719 Bacteria 1716
302 Ga0068861_100217553 3300005719 Bacteria 1612
303 Ga0068861_100344695 3300005719 Bacteria 1305
304 Ga0068861_100464815 3300005719 Bacteria 1136
305 Ga0068851_10040510 3300005834 Unclassified 2341
306 Ga0068851_10056395 3300005834 Bacteria 2004
307 Ga0068851_10060858 3300005834 Bacteria 1934
308 Ga0068870_10000192 3300005840 Bacteria 21774
309 Ga0068870_10026859 3300005840 Bacteria 2874
310 Ga0068870_10031021 3300005840 Bacteria 2705
311 Ga0068870_10056652 3300005840 Bacteria 2093
312 Ga0068870_10062330 3300005840 Unclassified 2008
313 Ga0068870_10212369 3300005840 Unclassified 1180
314 Ga0068870_10549857 3300005840 Unclassified 777
315 Ga0068863_100056915 3300005841 Bacteria 3701
316 Ga0068863_100064599 3300005841 Bacteria 3461
317 Ga0068863_100096215 3300005841 Bacteria 2811
318 Ga0068863_100359118 3300005841 Bacteria 1420
319 Ga0068863_100471370 3300005841 Unclassified 1234
320 Ga0068863_100524905 3300005841 Bacteria 1168
321 Ga0068863_100763841 3300005841 Bacteria 963
322 Ga0068863_100902909 3300005841 Bacteria 884
323 Ga0068858_100003479 3300005842 Bacteria 15610
324 Ga0068858_100007617 3300005842 Bacteria 10456
325 Ga0068858_100034638 3300005842 Bacteria 4684
326 Ga0068858_100110507 3300005842 Bacteria 2567
327 Ga0068858_100146416 3300005842 Unclassified 2218
328 Ga0068858_100180141 3300005842 Bacteria 1995
329 Ga0068858_100283255 3300005842 Bacteria 1578
330 Ga0068858_100747344 3300005842 Unclassified 953
331 Ga0068858_101676034 3300005842 Unclassified 628
332 Ga0068860_100002423 3300005843 Bacteria 19584
333 Ga0068860_100010508 3300005843 Bacteria 9152
334 Ga0068860_100085132 3300005843 Bacteria 3007
335 Ga0068860_100105001 3300005843 Bacteria 2697
336 Ga0068860_100179620 3300005843 Bacteria 2046
337 Ga0068860_100550700 3300005843 Bacteria 1156
338 Ga0068860_100630863 3300005843 Bacteria 1079
339 Ga0068860_100733267 3300005843 Unclassified 999
340 Ga0068860_100831517 3300005843 Unclassified 938
341 Ga0068862_100004844 3300005844 Bacteria 11336
342 Ga0068862_100022719 3300005844 Bacteria 5248
343 Ga0068862_100352551 3300005844 Unclassified 1366
344 Ga0068862_100395750 3300005844 Bacteria 1291
345 Ga0068862_100532586 3300005844 Unclassified 1119
346 Ga0068862_100767944 3300005844 Unclassified 939
347 Ga0068862_100858566 3300005844 Unclassified 890
348 Ga0081455_10063215 3300005937 Bacteria 3107
349 Ga0075368_10082332 3300006042 Bacteria 1311
350 Ga0075432_10050045 3300006058 Bacteria 1473
351 Ga0075432_10232679 3300006058 Bacteria 741
352 Ga0070715_10072635 3300006163 Unclassified 1541
353 Ga0070716_100443727 3300006173 Bacteria 944
354 Ga0070712_100816347 3300006175 Unclassified 801
355 Ga0097621_100000897 3300006237 Bacteria 20878
356 Ga0097621_100026878 3300006237 Bacteria 4520
357 Ga0097621_100043866 3300006237 Bacteria 3606
358 Ga0097621_100047407 3300006237 Bacteria 3482
359 Ga0097621_100137181 3300006237 Bacteria 2087
360 Ga0097621_100267770 3300006237 Unclassified 1500
361 Ga0097621_100329099 3300006237 Unclassified 1355
362 Ga0097621_100433608 3300006237 Unclassified 1181
363 Ga0097621_100543354 3300006237 Unclassified 1057
364 Ga0068871_100007271 3300006358 Bacteria 7898
365 Ga0068871_100051962 3300006358 Bacteria 3318
366 Ga0068871_100062489 3300006358 Bacteria 3044
367 Ga0068871_100124894 3300006358 Bacteria 2177
368 Ga0068871_100192444 3300006358 Unclassified 1758
369 Ga0068871_100253739 3300006358 Bacteria 1533
370 Ga0068871_100303275 3300006358 Bacteria 1402
371 Ga0068871_100502713 3300006358 Unclassified 1093
372 Ga0075428_100090306 3300006844 Bacteria 3341
373 Ga0075428_100924432 3300006844 Bacteria 925
374 Ga0075430_100001748 3300006846 Bacteria 17731
375 Ga0075433_10000163 3300006852 Bacteria 36379
376 Ga0075433_10026369 3300006852 Bacteria 4919
377 Ga0075433_10057273 3300006852 Bacteria 3407
378 Ga0075433_10089438 3300006852 Bacteria 2722
379 Ga0075434_100013654 3300006871 Bacteria 7742
380 Ga0075434_100024659 3300006871 Bacteria 5881
381 Ga0075434_100041785 3300006871 Unclassified 4543
382 Ga0075434_100095884 3300006871 Bacteria 2971
383 Ga0075434_100422031 3300006871 Bacteria 1355
384 Ga0075434_100511025 3300006871 Bacteria 1222
385 Ga0075434_101032732 3300006871 Unclassified 836
386 Ga0075434_101186243 3300006871 Bacteria 776
387 Ga0075434_101250751 3300006871 Bacteria 754
388 Ga0075429_100056763 3300006880 Bacteria 3409
389 Ga0075429_100101578 3300006880 Bacteria 2511
390 Ga0075429_100113089 3300006880 Bacteria 2373
391 Ga0075429_101156006 3300006880 Unclassified 676
392 Ga0068865_100005059 3300006881 Bacteria 7980
393 Ga0068865_100163513 3300006881 Unclassified 1700
394 Ga0068865_100216258 3300006881 Bacteria 1496
395 Ga0097620_100000942 3300006931 Bacteria 29786
396 Ga0097620_100007715 3300006931 Bacteria 10928
397 Ga0097620_100015192 3300006931 Bacteria 7728
398 Ga0097620_100041902 3300006931 Bacteria 4599
399 Ga0097620_100064020 3300006931 Bacteria 3709
400 Ga0097620_100106707 3300006931 Bacteria 2860
401 Ga0097620_100136852 3300006931 Bacteria 2522
402 Ga0097620_100162894 3300006931 Bacteria 2309
403 Ga0097620_100239372 3300006931 Bacteria 1904
404 Ga0097620_100376769 3300006931 Unclassified 1515
405 Ga0097620_100570061 3300006931 Bacteria 1226
406 Ga0097620_100738261 3300006931 Bacteria 1074
407 Ga0097620_100806427 3300006931 Bacteria 1026
408 Ga0097620_101445340 3300006931 Bacteria 759
409 Ga0075435_100213936 3300007076 Bacteria 1636
410 Ga0075435_100256247 3300007076 Bacteria 1490
411 Ga0099795_10010530 3300007788 Bacteria 2727
412 Ga0099795_10105546 3300007788 Unclassified 1110
413 Ga0105251_10284940 3300009011 Unclassified 747
414 Ga0105240_10016319 3300009093 Bacteria 10059
415 Ga0105240_10054577 3300009093 Bacteria 5007
416 Ga0105240_10217939 3300009093 Unclassified 2225
417 Ga0105240_10326187 3300009093 Bacteria 1748
418 Ga0105240_10651498 3300009093 Unclassified 1154
419 Ga0105240_11724918 3300009093 Unclassified 653
420 Ga0111539_10001989 3300009094 Bacteria 27254
421 Ga0111539_10007265 3300009094 Bacteria 14185
422 Ga0111539_10084724 3300009094 Bacteria 3726
423 Ga0111539_10262686 3300009094 Bacteria 2009
424 Ga0111539_10326513 3300009094 Bacteria 1786
425 Ga0111539_10369883 3300009094 Bacteria 1669
426 Ga0111539_10390502 3300009094 Bacteria 1621
427 Ga0111539_10392062 3300009094 Bacteria 1617
428 Ga0105245_10004042 3300009098 Bacteria 13042
429 Ga0105245_10006936 3300009098 Bacteria 9931
430 Ga0105245_10030011 3300009098 Bacteria 4807
431 Ga0105245_10359887 3300009098 Bacteria 1444
432 Ga0105245_10610102 3300009098 Bacteria 1118
433 Ga0105245_11123326 3300009098 Bacteria 832
434 Ga0105247_10047368 3300009101 Bacteria 2639
435 Ga0105247_10081480 3300009101 Bacteria 2040
436 Ga0105247_10157607 3300009101 Bacteria 1500
437 Ga0114129_10007250 3300009147 Bacteria 15785
438 Ga0114129_10098075 3300009147 Bacteria 4056
439 Ga0114129_10104941 3300009147 Bacteria 3905
440 Ga0114129_10159295 3300009147 Bacteria 3085
441 Ga0114129_10633701 3300009147 Bacteria 1381
442 Ga0114129_11065212 3300009147 Bacteria 1014
443 Ga0114129_11507640 3300009147 Unclassified 826
444 Ga0105243_10001279 3300009148 Bacteria 22573
445 Ga0105243_10185066 3300009148 Bacteria 1814
446 Ga0105243_10342088 3300009148 Bacteria 1371
447 Ga0105243_11072984 3300009148 Unclassified 812
448 Ga0105241_10037368 3300009174 Bacteria 3658
449 Ga0105241_10069753 3300009174 Unclassified 2726
450 Ga0105241_10706879 3300009174 Unclassified 921
451 Ga0105241_10875950 3300009174 Unclassified 832
452 Ga0105241_11075613 3300009174 Bacteria 756
453 Ga0105242_10004043 3300009176 Bacteria 11395
454 Ga0105242_10005299 3300009176 Bacteria 9957
455 Ga0105242_10008066 3300009176 Bacteria 8107
456 Ga0105242_10093821 3300009176 Bacteria 2531
457 Ga0105242_10422650 3300009176 Bacteria 1249
458 Ga0105242_11082708 3300009176 Bacteria 814
459 Ga0105242_11301810 3300009176 Unclassified 750
460 Ga0105242_11827432 3300009176 Unclassified 646
461 Ga0105248_10009933 3300009177 Bacteria 10475
462 Ga0105248_10039929 3300009177 Bacteria 5260
463 Ga0105248_10048288 3300009177 Bacteria 4774
464 Ga0105248_10125576 3300009177 Unclassified 2895
465 Ga0105248_10135672 3300009177 Bacteria 2776
466 Ga0105248_10192213 3300009177 Bacteria 2300
467 Ga0105248_10192602 3300009177 Bacteria 2297
468 Ga0105248_10209773 3300009177 Bacteria 2195
469 Ga0105248_10499622 3300009177 Unclassified 1371
470 Ga0105248_10707859 3300009177 Bacteria 1136
471 Ga0105248_11147088 3300009177 Unclassified 879
472 Ga0105248_11308643 3300009177 Unclassified 820
473 Ga0105237_10011728 3300009545 Bacteria 9270
474 Ga0105237_10018144 3300009545 Bacteria 7286
475 Ga0105237_10145955 3300009545 Bacteria 2361
476 Ga0105237_10180962 3300009545 Bacteria 2108
477 Ga0105238_10000849 3300009551 Bacteria 31444
478 Ga0105238_10001232 3300009551 Bacteria 25744
479 Ga0105238_10024027 3300009551 Bacteria 6215
480 Ga0105238_10033651 3300009551 Bacteria 5215
481 Ga0105238_10036598 3300009551 Unclassified 4991
482 Ga0105238_10251783 3300009551 Bacteria 1745
483 Ga0105238_10253922 3300009551 Bacteria 1737
484 Ga0105238_10422998 3300009551 Bacteria 1327
485 Ga0105238_11775139 3300009551 Bacteria 649
486 Ga0105249_10001729 3300009553 Bacteria 19110
487 Ga0105249_10043358 3300009553 Bacteria 4092
488 Ga0105249_10143927 3300009553 Bacteria 2288
489 Ga0105249_10892685 3300009553 Bacteria 956
490 Ga0105249_11019436 3300009553 Unclassified 897
491 Ga0105249_11054609 3300009553 Unclassified 882
492 Ga0105239_10010043 3300010375 Bacteria 10614
493 Ga0105239_10012533 3300010375 Bacteria 9444
494 Ga0105239_10064265 3300010375 Bacteria 4029
495 Ga0105239_10130067 3300010375 Bacteria 2799
496 Ga0105239_10499996 3300010375 Bacteria 1382
497 Ga0105239_12162935 3300010375 Unclassified 647
498 Ga0105246_10015063 3300011119 Bacteria 4873
499 Ga0105246_10052626 3300011119 Bacteria 2799
500 Ga0105246_10064861 3300011119 Bacteria 2553
501 Ga0105246_10434080 3300011119 Unclassified 1100
502 Ga0105246_10437056 3300011119 Bacteria 1096
503 Ga0105246_10461185 3300011119 Unclassified 1070
504 Ga0105246_11149702 3300011119 Bacteria 712
505 Ga0157373_10891108 3300013100 Unclassified 660
506 Ga0157371_10166629 3300013102 Bacteria 1573
507 Ga0157370_10022349 3300013104 Bacteria 6294
508 Ga0157370_10159105 3300013104 Bacteria 2102
509 Ga0157369_10004883 3300013105 Bacteria 15725
510 Ga0157369_10081249 3300013105 Bacteria 3469
511 Ga0157369_10319511 3300013105 Unclassified 1614
512 Ga0157369_10529497 3300013105 Unclassified 1219
513 Ga0157374_10086910 3300013296 Bacteria 2976
514 Ga0157374_10101635 3300013296 Bacteria 2756
515 Ga0157374_10147748 3300013296 Bacteria 2284
516 Ga0157374_10259160 3300013296 Bacteria 1712
517 Ga0157374_10329109 3300013296 Unclassified 1515
518 Ga0157374_10471764 3300013296 Bacteria 1257
519 Ga0157374_10712086 3300013296 Unclassified 1017
520 Ga0157378_10007429 3300013297 Bacteria 9574
521 Ga0157378_10024970 3300013297 Bacteria 5263
522 Ga0157378_10047677 3300013297 Bacteria 3809
523 Ga0157378_10661096 3300013297 Bacteria 1061
524 Ga0157378_10668687 3300013297 Unclassified 1056
525 Ga0157378_10691071 3300013297 Bacteria 1039
526 Ga0157378_10875635 3300013297 Unclassified 928
527 Ga0157378_11539705 3300013297 Unclassified 710
528 Ga0163162_10009293 3300013306 Bacteria 9561
529 Ga0163162_10096289 3300013306 Bacteria 3048
530 Ga0163162_10239598 3300013306 Bacteria 1945
531 Ga0163162_10269670 3300013306 Bacteria 1834
532 Ga0163162_10306040 3300013306 Bacteria 1722
533 Ga0163162_10329540 3300013306 Bacteria 1659
534 Ga0163162_10360816 3300013306 Bacteria 1586
535 Ga0163162_10375808 3300013306 Bacteria 1554
536 Ga0163162_10519671 3300013306 Unclassified 1320
537 Ga0163162_10841212 3300013306 Unclassified 1033
538 Ga0163162_10896393 3300013306 Unclassified 1000
539 Ga0163162_11029831 3300013306 Bacteria 931
540 Ga0163162_12314489 3300013306 Unclassified 617
541 Ga0157372_10063730 3300013307 Bacteria 4134
542 Ga0157372_10199556 3300013307 Bacteria 2317
543 Ga0157372_10323416 3300013307 Unclassified 1796
544 Ga0157375_10040638 3300013308 Bacteria 4485
545 Ga0157375_10070513 3300013308 Unclassified 3505
546 Ga0157375_10106202 3300013308 Bacteria 2899
547 Ga0157375_10110475 3300013308 Unclassified 2847
548 Ga0157375_10144322 3300013308 Bacteria 2510
549 Ga0157375_10303357 3300013308 Bacteria 1761
550 Ga0157375_10636665 3300013308 Unclassified 1223
551 Ga0163163_10000361 3300014325 Bacteria 43656
552 Ga0163163_10001459 3300014325 Bacteria 19984
553 Ga0163163_10005428 3300014325 Bacteria 11024
554 Ga0163163_10015032 3300014325 Bacteria 7137
555 Ga0163163_10021529 3300014325 Bacteria 6086
556 Ga0163163_10032762 3300014325 Bacteria 5021
557 Ga0163163_10037686 3300014325 Bacteria 4705
558 Ga0163163_10065912 3300014325 Bacteria 3596
559 Ga0163163_10120865 3300014325 Unclassified 2653
560 Ga0163163_10164998 3300014325 Bacteria 2261
561 Ga0163163_10598923 3300014325 Bacteria 1165
562 Ga0157380_10029086 3300014326 Unclassified 4222
563 Ga0157380_10044230 3300014326 Bacteria 3489
564 Ga0157380_10128698 3300014326 Bacteria 2157
565 Ga0157380_10129518 3300014326 Unclassified 2150
566 Ga0157380_10510759 3300014326 Bacteria 1170
567 Ga0157377_10037240 3300014745 Bacteria 2680
568 Ga0157377_10190939 3300014745 Bacteria 1294
569 Ga0157377_10442009 3300014745 Bacteria 896
570 Ga0157379_10032746 3300014968 Bacteria 4635
571 Ga0157379_10108621 3300014968 Bacteria 2491
572 Ga0157379_10513130 3300014968 Bacteria 1112
573 Ga0157379_10599316 3300014968 Bacteria 1028
574 Ga0157379_10853834 3300014968 Bacteria 862
575 Ga0157379_11236078 3300014968 Bacteria 719
576 Ga0157379_11392486 3300014968 Unclassified 679
577 Ga0157376_10016956 3300014969 Bacteria 5545
578 Ga0157376_10047574 3300014969 Bacteria 3542
579 Ga0157376_10079794 3300014969 Bacteria 2806
580 Ga0157376_10123948 3300014969 Bacteria 2294
581 Ga0157376_10290350 3300014969 Bacteria 1544
582 Ga0157376_10474909 3300014969 Unclassified 1224
583 Ga0157376_11848168 3300014969 Unclassified 641
584 Ga0163161_10034563 3300017792 Bacteria 3617
585 Ga0163161_10064361 3300017792 Bacteria 2675
586 Ga0163161_10436867 3300017792 Unclassified 1056
587 Ga0163161_10457790 3300017792 Unclassified 1032
588 Ga0163161_10689515 3300017792 Unclassified 850
589 Ga0197907_10421835 3300020069 Bacteria 1944
590 Ga0207427_105203 3300025231 Bacteria 1900
591 Ga0209233_1000015 3300025261 Bacteria 980563
592 Ga0207673_1001094 3300025290 Bacteria 2924
593 Ga0207697_10113503 3300025315 Unclassified 1161
594 Ga0207697_10153462 3300025315 Unclassified 1003
595 Ga0207656_10033635 3300025321 Unclassified 2137
596 Ga0207656_10035796 3300025321 Bacteria 2081
597 Ga0207653_10125981 3300025885 Unclassified 926
598 Ga0207682_10001552 3300025893 Bacteria 10537
599 Ga0207682_10002307 3300025893 Bacteria 8596
600 Ga0207682_10131487 3300025893 Bacteria 1117
601 Ga0207642_10019271 3300025899 Bacteria 2639
602 Ga0207642_10181108 3300025899 Bacteria 1148
603 Ga0207710_10080581 3300025900 Unclassified 1510
604 Ga0207688_10018673 3300025901 Bacteria 3770
605 Ga0207688_10038963 3300025901 Bacteria 2640
606 Ga0207680_10012330 3300025903 Bacteria 4350
607 Ga0207680_10033879 3300025903 Bacteria 2917
608 Ga0207680_10198679 3300025903 Unclassified 1365
609 Ga0207680_10699508 3300025903 Unclassified 726
610 Ga0207699_10049909 3300025906 Bacteria 2465
611 Ga0207699_10126601 3300025906 Unclassified 1660
612 Ga0207699_10434357 3300025906 Bacteria 940
613 Ga0207645_10014193 3300025907 Bacteria 5336
614 Ga0207645_10043728 3300025907 Bacteria 2867
615 Ga0207645_10102888 3300025907 Bacteria 1844
616 Ga0207645_10160763 3300025907 Unclassified 1469
617 Ga0207645_10237411 3300025907 Bacteria 1204
618 Ga0207643_10000798 3300025908 Bacteria 19183
619 Ga0207643_10013855 3300025908 Bacteria 4373
620 Ga0207643_10019999 3300025908 Bacteria 3672
621 Ga0207643_10020115 3300025908 Bacteria 3663
622 Ga0207643_10021415 3300025908 Bacteria 3552
623 Ga0207643_10034947 3300025908 Unclassified 2817
624 Ga0207643_10084745 3300025908 Unclassified 1840
625 Ga0207643_10085865 3300025908 Unclassified 1828
626 Ga0207643_10256420 3300025908 Unclassified 1079
627 Ga0207705_10114537 3300025909 Bacteria 1995
628 Ga0207654_10004648 3300025911 Bacteria 6938
629 Ga0207654_10088212 3300025911 Bacteria 1884
630 Ga0207654_10169691 3300025911 Bacteria 1416
631 Ga0207654_10320770 3300025911 Bacteria 1059
632 Ga0207654_10366289 3300025911 Unclassified 995
633 Ga0207654_10556955 3300025911 Unclassified 815
634 Ga0207707_10001529 3300025912 Bacteria 21351
635 Ga0207707_10096014 3300025912 Bacteria 2590
636 Ga0207707_10168131 3300025912 Bacteria 1916
637 Ga0207707_10339748 3300025912 Bacteria 1295
638 Ga0207695_10003423 3300025913 Bacteria 22383
639 Ga0207695_10071698 3300025913 Bacteria 3538
640 Ga0207695_10378269 3300025913 Bacteria 1302
641 Ga0207695_10448896 3300025913 Unclassified 1173
642 Ga0207695_10689554 3300025913 Bacteria 902
643 Ga0207671_10009867 3300025914 Bacteria 7939
644 Ga0207671_10039236 3300025914 Bacteria 3507
645 Ga0207671_10277042 3300025914 Bacteria 1322
646 Ga0207671_10714911 3300025914 Unclassified 796
647 Ga0207663_10187128 3300025916 Bacteria 1484
648 Ga0207663_10212571 3300025916 Unclassified 1403
649 Ga0207663_10560404 3300025916 Bacteria 894
650 Ga0207660_10019478 3300025917 Bacteria 4537
651 Ga0207660_10116398 3300025917 Unclassified 2019
652 Ga0207662_10008158 3300025918 Bacteria 5726
653 Ga0207662_10016059 3300025918 Bacteria 4220
654 Ga0207662_10040381 3300025918 Bacteria 2743
655 Ga0207662_10054175 3300025918 Bacteria 2391
656 Ga0207662_10537783 3300025918 Unclassified 808
657 Ga0207657_10019241 3300025919 Bacteria 6488
658 Ga0207657_10030748 3300025919 Bacteria 4870
659 Ga0207657_10645223 3300025919 Unclassified 824
660 Ga0207649_10153743 3300025920 Bacteria 1587
661 Ga0207649_10486372 3300025920 Unclassified 937
662 Ga0207652_10072593 3300025921 Bacteria 2993
663 Ga0207652_10085387 3300025921 Bacteria 2766
664 Ga0207646_10342059 3300025922 Bacteria 1352
665 Ga0207681_10002323 3300025923 Bacteria 12097
666 Ga0207694_10000624 3300025924 Bacteria 32177
667 Ga0207694_10001139 3300025924 Bacteria 23040
668 Ga0207694_10032845 3300025924 Unclassified 3974
669 Ga0207694_10063865 3300025924 Bacteria 2868
670 Ga0207694_10114304 3300025924 Bacteria 2150
671 Ga0207694_10155778 3300025924 Bacteria 1842
672 Ga0207694_10451603 3300025924 Unclassified 1073
673 Ga0207650_10019082 3300025925 Bacteria 4819
674 Ga0207650_10067002 3300025925 Unclassified 2693
675 Ga0207650_10204184 3300025925 Bacteria 1584
676 Ga0207650_10537474 3300025925 Bacteria 979
677 Ga0207650_10736012 3300025925 Bacteria 834
678 Ga0207659_10000105 3300025926 Bacteria 50176
679 Ga0207659_10024654 3300025926 Bacteria 4034
680 Ga0207659_10273626 3300025926 Unclassified 1378
681 Ga0207659_10336558 3300025926 Unclassified 1249
682 Ga0207659_10407395 3300025926 Bacteria 1138
683 Ga0207659_10629882 3300025926 Unclassified 916
684 Ga0207659_10792633 3300025926 Bacteria 814
685 Ga0207687_10003518 3300025927 Bacteria 10536
686 Ga0207687_10003843 3300025927 Bacteria 10085
687 Ga0207687_10079795 3300025927 Bacteria 2360
688 Ga0207687_10129887 3300025927 Bacteria 1897
689 Ga0207644_10034620 3300025931 Bacteria 3535
690 Ga0207644_10050756 3300025931 Bacteria 2974
691 Ga0207644_10412280 3300025931 Unclassified 1106
692 Ga0207644_10454512 3300025931 Unclassified 1052
693 Ga0207690_10168330 3300025932 Bacteria 1639
694 Ga0207706_10004735 3300025933 Bacteria 12740
695 Ga0207706_10031615 3300025933 Bacteria 4715
696 Ga0207706_10940725 3300025933 Bacteria 728
697 Ga0207686_10008754 3300025934 Bacteria 5467
698 Ga0207686_10027723 3300025934 Bacteria 3320
699 Ga0207686_10036186 3300025934 Unclassified 2970
700 Ga0207686_10133254 3300025934 Bacteria 1707
701 Ga0207686_10194765 3300025934 Bacteria 1447
702 Ga0207686_10480517 3300025934 Bacteria 961
703 Ga0207686_10973272 3300025934 Unclassified 688
704 Ga0207686_11162172 3300025934 Unclassified 631
705 Ga0207709_10001549 3300025935 Bacteria 15798
706 Ga0207709_10032156 3300025935 Unclassified 3070
707 Ga0207709_10055347 3300025935 Bacteria 2450
708 Ga0207709_10351390 3300025935 Unclassified 1113
709 Ga0207670_10005628 3300025936 Bacteria 6891
710 Ga0207670_10008307 3300025936 Bacteria 5851
711 Ga0207670_10131820 3300025936 Bacteria 1832
712 Ga0207670_10197782 3300025936 Bacteria 1525
713 Ga0207670_10443913 3300025936 Bacteria 1045
714 Ga0207670_11018791 3300025936 Unclassified 697
715 Ga0207669_10069686 3300025937 Bacteria 2201
716 Ga0207669_10417463 3300025937 Unclassified 1055
717 Ga0207669_10420585 3300025937 Unclassified 1052
718 Ga0207669_10439617 3300025937 Bacteria 1031
719 Ga0207704_10096844 3300025938 Bacteria 1955
720 Ga0207704_10200572 3300025938 Bacteria 1460
721 Ga0207704_10263593 3300025938 Unclassified 1300
722 Ga0207704_10320770 3300025938 Bacteria 1195
723 Ga0207704_10351884 3300025938 Unclassified 1147
724 Ga0207691_10018369 3300025940 Bacteria 6625
725 Ga0207691_10092753 3300025940 Bacteria 2704
726 Ga0207691_10093984 3300025940 Bacteria 2683
727 Ga0207691_10114985 3300025940 Bacteria 2390
728 Ga0207691_10178784 3300025940 Bacteria 1854
729 Ga0207691_10180676 3300025940 Bacteria 1844
730 Ga0207691_10213787 3300025940 Bacteria 1674
731 Ga0207711_10008109 3300025941 Bacteria 8792
732 Ga0207711_10045439 3300025941 Bacteria 3753
733 Ga0207711_10100108 3300025941 Bacteria 2563
734 Ga0207711_10118360 3300025941 Bacteria 2363
735 Ga0207711_10124681 3300025941 Bacteria 2303
736 Ga0207711_10149472 3300025941 Bacteria 2107
737 Ga0207711_10155115 3300025941 Bacteria 2069
738 Ga0207711_10165616 3300025941 Unclassified 2003
739 Ga0207711_10249144 3300025941 Bacteria 1631
740 Ga0207711_10275598 3300025941 Bacteria 1548
741 Ga0207711_10316394 3300025941 Bacteria 1442
742 Ga0207711_10520701 3300025941 Unclassified 1109
743 Ga0207689_10006162 3300025942 Bacteria 10610
744 Ga0207689_10028459 3300025942 Bacteria 4676
745 Ga0207689_10052460 3300025942 Bacteria 3360
746 Ga0207689_10102687 3300025942 Unclassified 2349
747 Ga0207689_10113792 3300025942 Unclassified 2224
748 Ga0207689_10123447 3300025942 Bacteria 2130
749 Ga0207689_10130486 3300025942 Bacteria 2068
750 Ga0207689_10161911 3300025942 Bacteria 1844
751 Ga0207689_10227314 3300025942 Bacteria 1542
752 Ga0207689_10284758 3300025942 Bacteria 1369
753 Ga0207689_10350789 3300025942 Bacteria 1227
754 Ga0207661_10000440 3300025944 Bacteria 26788
755 Ga0207661_10256458 3300025944 Unclassified 1556
756 Ga0207661_10291435 3300025944 Bacteria 1461
757 Ga0207679_10003442 3300025945 Bacteria 9766
758 Ga0207679_10276353 3300025945 Bacteria 1439
759 Ga0207679_10620460 3300025945 Unclassified 976
760 Ga0207667_10003148 3300025949 Bacteria 20418
761 Ga0207667_10163885 3300025949 Bacteria 2286
762 Ga0207651_10002639 3300025960 Bacteria 8570
763 Ga0207651_10041856 3300025960 Bacteria 3044
764 Ga0207651_10082790 3300025960 Bacteria 2318
765 Ga0207651_10111037 3300025960 Bacteria 2058
766 Ga0207651_10174935 3300025960 Bacteria 1697
767 Ga0207651_10747914 3300025960 Bacteria 864
768 Ga0207651_10875513 3300025960 Unclassified 799
769 Ga0207651_11067159 3300025960 Bacteria 723
770 Ga0207712_10017205 3300025961 Bacteria 4692
771 Ga0207712_10061861 3300025961 Bacteria 2659
772 Ga0207712_10194884 3300025961 Bacteria 1602
773 Ga0207712_10196972 3300025961 Bacteria 1594
774 Ga0207712_10699297 3300025961 Bacteria 885
775 Ga0207668_10503927 3300025972 Bacteria 1042
776 Ga0207668_10906152 3300025972 Unclassified 785
777 Ga0207640_10070375 3300025981 Archaea 2353
778 Ga0207640_10271757 3300025981 Unclassified 1326
779 Ga0207640_11320049 3300025981 Unclassified 644
780 Ga0207658_10046204 3300025986 Bacteria 3178
781 Ga0207658_10074635 3300025986 Unclassified 2577
782 Ga0207658_10089572 3300025986 Bacteria 2382
783 Ga0207658_10382217 3300025986 Bacteria 1233
784 Ga0207658_10517252 3300025986 Unclassified 1065
785 Ga0207658_10545971 3300025986 Bacteria 1037
786 Ga0207658_11165745 3300025986 Bacteria 704
787 Ga0207677_10032256 3300026023 Bacteria 3365
788 Ga0207677_10101523 3300026023 Bacteria 2118
789 Ga0207677_10107740 3300026023 Bacteria 2067
790 Ga0207677_10186482 3300026023 Unclassified 1637
791 Ga0207677_10201096 3300026023 Bacteria 1584
792 Ga0207703_10008840 3300026035 Bacteria 7942
793 Ga0207703_10009347 3300026035 Bacteria 7704
794 Ga0207703_10028701 3300026035 Bacteria 4389
795 Ga0207703_10045830 3300026035 Bacteria 3518
796 Ga0207703_10076337 3300026035 Bacteria 2779
797 Ga0207703_10171073 3300026035 Bacteria 1911
798 Ga0207703_10212594 3300026035 Unclassified 1725
799 Ga0207639_10036023 3300026041 Unclassified 3664
800 Ga0207639_10058508 3300026041 Bacteria 2965
801 Ga0207639_10093330 3300026041 Unclassified 2413
802 Ga0207639_10153410 3300026041 Bacteria 1932
803 Ga0207639_10372324 3300026041 Unclassified 1281
804 Ga0207639_10608920 3300026041 Bacteria 1008
805 Ga0207678_10684803 3300026067 Unclassified 902
806 Ga0207678_10950159 3300026067 Unclassified 760
807 Ga0207708_10013738 3300026075 Bacteria 6051
808 Ga0207708_10031656 3300026075 Bacteria 4016
809 Ga0207708_10074218 3300026075 Bacteria 2607
810 Ga0207708_10078656 3300026075 Bacteria 2533
811 Ga0207708_10129157 3300026075 Bacteria 1975
812 Ga0207708_10633618 3300026075 Bacteria 909
813 Ga0207702_10007504 3300026078 Bacteria 9297
814 Ga0207702_10182119 3300026078 Bacteria 1935
815 Ga0207702_10190438 3300026078 Unclassified 1895
816 Ga0207702_10214051 3300026078 Bacteria 1793
817 Ga0207702_10811037 3300026078 Unclassified 925
818 Ga0207641_10017321 3300026088 Bacteria 5897
819 Ga0207641_10162254 3300026088 Bacteria 2033
820 Ga0207641_10342890 3300026088 Bacteria 1422
821 Ga0207641_10345991 3300026088 Bacteria 1416
822 Ga0207641_10500081 3300026088 Unclassified 1180
823 Ga0207641_10523834 3300026088 Unclassified 1153
824 Ga0207641_10593807 3300026088 Bacteria 1083
825 Ga0207648_10002414 3300026089 Bacteria 20118
826 Ga0207648_10052045 3300026089 Bacteria 3580
827 Ga0207648_10069740 3300026089 Bacteria 3063
828 Ga0207648_10112445 3300026089 Bacteria 2391
829 Ga0207648_10124833 3300026089 Bacteria 2264
830 Ga0207648_10231822 3300026089 Bacteria 1642
831 Ga0207648_10595273 3300026089 Unclassified 1019
832 Ga0207648_11092935 3300026089 Bacteria 748
833 Ga0207676_10014803 3300026095 Bacteria 5618
834 Ga0207676_10063294 3300026095 Bacteria 2938
835 Ga0207676_10073867 3300026095 Bacteria 2745
836 Ga0207676_10106727 3300026095 Bacteria 2334
837 Ga0207676_10127202 3300026095 Bacteria 2160
838 Ga0207676_10136823 3300026095 Bacteria 2091
839 Ga0207676_10279074 3300026095 Bacteria 1516
840 Ga0207676_10288616 3300026095 Bacteria 1493
841 Ga0207676_10293377 3300026095 Unclassified 1482
842 Ga0207676_10507336 3300026095 Bacteria 1146
843 Ga0207676_10956103 3300026095 Unclassified 842
844 Ga0207674_10001214 3300026116 Bacteria 33550
845 Ga0207674_10002954 3300026116 Bacteria 21110
846 Ga0207674_10037435 3300026116 Bacteria 5046
847 Ga0207674_10041715 3300026116 Bacteria 4744
848 Ga0207674_10045562 3300026116 Bacteria 4510
849 Ga0207674_10130834 3300026116 Unclassified 2473
850 Ga0207674_10302372 3300026116 Bacteria 1549
851 Ga0207674_10343952 3300026116 Bacteria 1442
852 Ga0207674_10392169 3300026116 Unclassified 1342
853 Ga0207675_100008002 3300026118 Bacteria 9961
854 Ga0207675_100011835 3300026118 Bacteria 8156
855 Ga0207675_100041840 3300026118 Bacteria 4278
856 Ga0207675_100100074 3300026118 Bacteria 2731
857 Ga0207675_100130326 3300026118 Bacteria 2384
858 Ga0207675_100168452 3300026118 Unclassified 2093
859 Ga0207675_100237964 3300026118 Bacteria 1758
860 Ga0207675_100355090 3300026118 Unclassified 1437
861 Ga0207675_100419591 3300026118 Bacteria 1321
862 Ga0207675_100510765 3300026118 Unclassified 1197
863 Ga0207675_100741039 3300026118 Bacteria 993
864 Ga0207683_10007588 3300026121 Bacteria 9293
865 Ga0207683_10015647 3300026121 Bacteria 6457
866 Ga0207683_10019890 3300026121 Bacteria 5736
867 Ga0207683_10029512 3300026121 Bacteria 4749
868 Ga0207683_10042168 3300026121 Bacteria 3985
869 Ga0207683_10110848 3300026121 Bacteria 2457
870 Ga0207683_10436090 3300026121 Bacteria 1207
871 Ga0207683_11012894 3300026121 Bacteria 771
872 Ga0207698_10078502 3300026142 Bacteria 2651
873 Ga0207698_10195044 3300026142 Bacteria 1808
874 Ga0209996_1009649 3300027395 Unclassified 1274
875 Ga0209179_1003916 3300027512 Bacteria 2199
876 Ga0209974_10041910 3300027876 Bacteria 1524
877 Ga0207428_10002147 3300027907 Bacteria 19816
878 Ga0207428_10006528 3300027907 Bacteria 10759
879 Ga0207428_10018399 3300027907 Bacteria 5970
880 Ga0207428_10178002 3300027907 Bacteria 1608
881 Ga0207428_10226658 3300027907 Bacteria 1399
882 Ga0207428_10621396 3300027907 Unclassified 777
883 Ga0268266_10018050 3300028379 Bacteria 6013
884 Ga0268266_10049466 3300028379 Unclassified 3605
885 Ga0268266_10118119 3300028379 Bacteria 2357
886 Ga0268266_10121578 3300028379 Bacteria 2324
887 Ga0268265_10002294 3300028380 Bacteria 14564
888 Ga0268265_10013612 3300028380 Bacteria 5531
889 Ga0268265_10362758 3300028380 Bacteria 1327
890 Ga0268265_10373655 3300028380 Bacteria 1309
891 Ga0268265_10506205 3300028380 Unclassified 1139
892 Ga0268265_10894232 3300028380 Bacteria 872
893 Ga0268264_10004132 3300028381 Bacteria 12418
894 Ga0268264_10004498 3300028381 Bacteria 11891
895 Ga0268264_10042979 3300028381 Bacteria 3743
896 Ga0268264_10095187 3300028381 Bacteria 2576
897 Ga0268264_10119876 3300028381 Bacteria 2317
898 Ga0268264_10294959 3300028381 Bacteria 1524
899 Ga0268264_10300397 3300028381 Unclassified 1511
900 Ga0268264_10450644 3300028381 Bacteria 1246
901 Ga0268264_11278363 3300028381 Unclassified 744
902 Ga0265337_1001333 3300028556 Bacteria 12242
903 Ga0265319_1053056 3300028563 Unclassified 1333
904 Ga0265334_10003224 3300028573 Bacteria 7447
905 Ga0265318_10008720 3300028577 Unclassified 4493
906 Ga0265338_10344360 3300028800 Unclassified 1073
907 Ga0265766_1013085 3300030863 Bacteria 619
908 Ga0265770_1073202 3300030878 Unclassified 658
909 Ga0265779_101300 3300031043 Bacteria 1090
910 Ga0265330_10039117 3300031235 Bacteria 2108
911 Ga0265328_10023384 3300031239 Bacteria 2346
912 Ga0265320_10045118 3300031240 Bacteria 2167
913 Ga0265325_10011366 3300031241 Bacteria 5116
914 Ga0265329_10025089 3300031242 Bacteria 1975
915 Ga0265331_10000991 3300031250 Bacteria 22304
916 Ga0265331_10106578 3300031250 Bacteria 1287
917 Ga0265316_10010483 3300031344 Bacteria 8440
918 Ga0265313_10006487 3300031595 Bacteria 8268
919 Ga0265313_10040068 3300031595 Bacteria 2319
920 Ga0265314_10000277 3300031711 Bacteria 74718
921 Ga0265314_10002727 3300031711 Bacteria 17658
922 Ga0265314_10051768 3300031711 Bacteria 2859
923 Ga0265314_10123611 3300031711 Bacteria 1625
924 Ga0307416_100645561 3300032002 Bacteria 1143
925 Ga0373938_0026288 3300034957 Unclassified 1217
926 Ga0373934_0282294 3300035086 Bacteria 688
927 Ga0373949_0114447 3300035090 Unclassified 752
928 Ga0373949_0195878 3300035090 Bacteria 605
929 Ga0373951_0044619 3300035091 Unclassified 1077
930 Ga0373936_0339512 3300035113 Unclassified 683
931 Ga0373939_0023471 3300035114 Bacteria 1709
932 Ga0373945_0037397 3300035116 Bacteria 1742
933 Ga0373953_0229957 3300035117 Unclassified 804
934 Ga0373954_0205448 3300035118 Bacteria 968
935 Ga0373943_0001872 3300035170 Bacteria 9516
936 Ga0373946_0144012 3300035171 Bacteria 1107
937 Ga0373946_0182868 3300035171 Bacteria 996
938 Ga0373946_0266263 3300035171 Unclassified 840
939 Ga0373942_0007237 3300035207 Bacteria 2572
940 Ga0373942_0027018 3300035207 Bacteria 1490
941 Ga0373961_0014069 3300035241 Bacteria 2028
942 Ga0373962_0009519 3300035242 Bacteria 2410
943 Ga0373962_0087497 3300035242 Bacteria 955
944 Ga0373924_0096458 3300035410 Bacteria 1269
945 Ga0373931_0014369 3300035691 Bacteria 3867
946 Ga0373931_0051309 3300035691 Bacteria 2197
947 Ga0373931_0165144 3300035691 Bacteria 1300
948 Ga0373931_0253117 3300035691 Bacteria 1072
949 Ga0373935_0043797 3300035692 Bacteria 2818
950 Ga0373927_0166580 3300035695 Bacteria 1444
951 Ga0373927_0366441 3300035695 Bacteria 950
952 Ga0373933_0123202 3300035724 Bacteria 1625
953 Ga0373933_0605088 3300035724 Unclassified 720
954 Ga0373947_0002238 3300035725 Bacteria 11697
955 Ga0373947_0080496 3300035725 Bacteria 2015
956 Ga0373937_0070565 3300036401 Unclassified 3223
957 Ga0373937_0094591 3300036401 Bacteria 2771
958 Ga0373937_0100932 3300036401 Bacteria 2678
959 Ga0373937_0112639 3300036401 Bacteria 2531
960 Ga0373925_0046983 3300037068 Bacteria 3212
961 Ga0373925_0721254 3300037068 Bacteria 822
962 Ga0436364_0421318 3300037853 Unclassified 681
963 Ga0436364_1037684 3300037853 Bacteria 1015
964 Ga0436365_1618975 3300039437 Bacteria 2493
965 Ga0436363_0177020 3300039450 Bacteria 1537
966 Ga0436363_1275821 3300039450 Unclassified 1248
967 Ga0451853_2100878 3300041512 Bacteria 1128
968 Ga0439434_0144096 3300042435 Unclassified 786
969 Ga0439444_0014056 3300042437 Bacteria 1333
970 Ga0453683_0223505 3300044673 Bacteria 1198
971 Ga0466963_0182391 3300044694 Bacteria 1466
972 Ga0451576_0040309 3300045051 Bacteria 4944
973 Ga0466967_0329392 3300045976 Unclassified 1474
974 Ga0495603_0152915 3300046455 Unclassified 1340
975 Ga0495629_0514811 3300046459 Viruses 806
976 Ga0495650_0167094 3300046471 Bacteria 781
977 Ga0495582_0215025 3300046473 Unclassified 1099
978 Ga0495582_0280401 3300046473 Bacteria 957
979 Ga0495582_0295699 3300046473 Unclassified 931
980 Ga0495639_0081638 3300046475 Unclassified 1507
981 Ga0495584_0120907 3300046491 Bacteria 1326
982 Ga0495585_0133167 3300046492 Bacteria 1307
983 Ga0495594_0075565 3300046499 Bacteria 1878
984 Ga0495594_0318204 3300046499 Unclassified 886
985 Ga0495596_0241848 3300046500 Bacteria 701
986 Ga0495628_0555715 3300046516 Bacteria 824
987 Ga0495630_0496490 3300046517 Bacteria 936
988 Ga0495630_0918046 3300046517 Unclassified 667
989 Ga0495631_0274007 3300046518 Unclassified 719
990 Ga0495644_0110161 3300046523 Bacteria 1044
991 Ga0495642_0085588 3300046528 Unclassified 1331
992 Ga0495642_0241067 3300046528 Unclassified 790
993 Ga0495665_0055515 3300046531 Bacteria 2091
994 Ga0495665_0220081 3300046531 Bacteria 981
995 Ga0495640_0519088 3300046533 Unclassified 724
996 Ga0495586_0039826 3300046535 Bacteria 2527
997 Ga0495586_0171064 3300046535 Bacteria 1228
998 Ga0495586_0291118 3300046535 Bacteria 935
999 Ga0495587_0483187 3300046536 Bacteria 685
1000 Ga0495587_0592830 3300046536 Unclassified 610
1001 Ga0495609_0061694 3300046538 Unclassified 1656
1002 Ga0495621_0047402 3300046539 Bacteria 1528
1003 Ga0495621_0078573 3300046539 Bacteria 1227
1004 Ga0495667_0401021 3300046559 Bacteria 864
1005 Ga0495634_0543770 3300046642 Unclassified 678
1006 Ga0495611_0052573 3300046648 Unclassified 1838
1007 Ga0495659_0026141 3300046664 Bacteria 2003
1008 Ga0495659_0082970 3300046664 Unclassified 1220
1009 Ga0495659_0270302 3300046664 Unclassified 712
1010 Ga0495657_0208135 3300046675 Bacteria 1190
1011 Ga0495623_0207302 3300046679 Unclassified 1124
1012 Ga0495658_0045681 3300046683 Bacteria 2459
1013 Ga0495658_0282263 3300046683 Unclassified 1048
1014 Ga0495624_0506264 3300046690 Bacteria 722
1015 Ga0495670_0152473 3300046691 Unclassified 1212
1016 Ga0495671_0278895 3300046692 Bacteria 805
1017 Ga0495660_0409995 3300046810 Bacteria 592
1018 Ga0495604_0108998 3300047317 Bacteria 2022
1019 Ga0495636_0017175 3300047318 Bacteria 2895
1020 Ga0495676_0481556 3300047321 Bacteria 816
1021 Ga0495675_0237439 3300047444 Unclassified 1098
1022 Ga0495677_0110752 3300047445 Unclassified 1044
1023 Ga0495614_0385747 3300048089 Unclassified 657
1024 Ga0495614_0435779 3300048089 Unclassified 619
1025 Ga0495615_0151397 3300048090 Unclassified 691
1026 Ga0496100_0302110 3300048903 Bacteria 1198
1027 Ga0496101_0093742 3300048904 Bacteria 2237
1028 Ga0496102_0144900 3300048905 Unclassified 2229
1029 Ga0496104_0134125 3300048907 Bacteria 2379
1030 Ga0496105_0354963 3300048908 Bacteria 1170
1031 Ga0496108_0386900 3300048911 Bacteria 1221
1032 Ga0496108_0476558 3300048911 Bacteria 1090
1033 Ga0496108_0860903 3300048911 Unclassified 780
1034 Ga0496109_0133336 3300048912 Bacteria 2320
1035 Ga0496109_0468415 3300048912 Bacteria 1190
1036 Ga0496110_0109838 3300048913 Bacteria 2477
1037 Ga0496110_0525656 3300048913 Unclassified 1076
1038 Ga0496112_0008426 3300048915 Bacteria 9233
1039 Ga0496112_0329134 3300048915 Bacteria 1472
1040 Ga0496113_0135923 3300048916 Bacteria 1932
1041 Ga0496113_0993691 3300048916 Unclassified 661
1042 Ga0496115_0085330 3300048918 Bacteria 2575
1043 Ga0496115_0768556 3300048918 Bacteria 752
1044 Ga0501031_0122088 3300049568 Unclassified 1702
1045 Ga0501031_0183972 3300049568 Bacteria 1365
1046 Ga0501036_0030543 3300049572 Bacteria 4550
1047 Ga0501036_0586479 3300049572 Unclassified 925
1048 Ga0501039_0211147 3300049575 Unclassified 1526
1049 Ga0501039_0400824 3300049575 Bacteria 1077
1050 Ga0501041_0028086 3300049577 Unclassified 3393
1051 Ga0501042_0173619 3300049578 Bacteria 1555
1052 Ga0501043_0103194 3300049579 Bacteria 2241
1053 Ga0501046_0370554 3300049580 Bacteria 1038
1054 Ga0501048_0041623 3300049582 Bacteria 3290
1055 Ga0501068_0194132 3300049584 Unclassified 1287
1056 Ga0501069_0153810 3300049585 Unclassified 1323
1057 Ga0501070_0825314 3300049586 Unclassified 727
1058 Ga0501072_0060653 3300049588 Bacteria 2982
1059 Ga0501074_0383248 3300049590 Unclassified 997
1060 Ga0501075_0038936 3300049591 Bacteria 3556
1061 Ga0501075_0289405 3300049591 Unclassified 1248
1062 Ga0501076_0014997 3300049592 Bacteria 5851
1063 Ga0501259_116618 3300049688 Unclassified 630
1064 Ga0501079_0056877 3300049741 Bacteria 3018
1065 Ga0501079_0097824 3300049741 Bacteria 2275
1066 Ga0501080_0457271 3300049742 Bacteria 1144
1067 Ga0501081_0711439 3300049743 Bacteria 754
1068 Ga0501045_0369061 3300049824 Bacteria 1068
1069 nmdc:mga0yw44_567387_c1 3300050492 Bacteria 771
1070 nmdc:mga05p37_165436_c1 3300050507 Bacteria 2700
1071 nmdc:mga05p37_29994_c1 3300050507 Bacteria 6636
1072 nmdc:mga05p37_39948_c1 3300050507 Bacteria 5761
1073 nmdc:mga05p37_507054_c1 3300050507 Bacteria 1383
1074 nmdc:mga09592_129105_c1 3300050508 Bacteria 2174
1075 nmdc:mga09592_53072_c1 3300050508 Bacteria 3422
1076 nmdc:mga09592_81991_c1 3300050508 Bacteria 2749
1077 nmdc:mga0qj67_542322_c1 3300050509 Bacteria 933
1078 nmdc:mga0qj67_71952_c1 3300050509 Bacteria 2760
1079 nmdc:mga08y16_1035244_c1 3300050511 Unclassified 799
1080 nmdc:mga08y16_10962_c1 3300050511 Bacteria 9521
1081 nmdc:mga08y16_239971_c1 3300050511 Bacteria 1874
1082 nmdc:mga08y16_28255_c1 3300050511 Bacteria 5912
1083 nmdc:mga08y16_383054_c1 3300050511 Bacteria 1441
1084 nmdc:mga08y16_52878_c1 3300050511 Bacteria 4248
1085 nmdc:mga08y16_533285_c1 3300050511 Bacteria 1189
1086 nmdc:mga0n895_1568_c1 3300050512 Bacteria 17188
1087 nmdc:mga0n895_164140_c1 3300050512 Bacteria 2253
1088 nmdc:mga0n895_18550_c1 3300050512 Bacteria 6441
1089 nmdc:mga0n895_336428_c1 3300050512 Bacteria 1529
1090 nmdc:mga0n895_408317_c1 3300050512 Bacteria 1373
1091 nmdc:mga0n895_494403_c1 3300050512 Bacteria 1233
1092 nmdc:mga0rr50_186517_c1 3300050513 Unclassified 1698
1093 nmdc:mga0rr50_581520_c1 3300050513 Unclassified 954
1094 nmdc:mga0rr50_599744_c1 3300050513 Bacteria 939
1095 nmdc:mga08x19_74519_c1 3300050514 Bacteria 2218
1096 nmdc:mga0a205_16064_c1 3300050515 Bacteria 7007
1097 nmdc:mga0a205_31076_c1 3300050515 Bacteria 5115
1098 nmdc:mga0a205_33077_c1 3300050515 Bacteria 4959
1099 nmdc:mga0a205_901929_c1 3300050515 Bacteria 731
1100 Ga0495595_0082051 3300053084 Bacteria 1537
1101 Ga0500642_0321498 3300053130 Bacteria 694
1102 Ga0500559_0180776 3300053136 Unclassified 994
1103 Ga0501084_0116330 3300054114 Bacteria 2248
1104 Ga0501082_0015291 3300060353 Bacteria 6607
1105 Ga0530510_0010125 3300061734 Bacteria 6610
1106 Ga0207682_10042443
1107 SwRhRL2b_contig_3032446
1108 ARcpr5oldR_c010840
1109 JGI24746J21847_1001423
1110 JGI24751J29686_10005177
1111 JGI24751J29686_10033568
1112 Ga0006778J45830_1027403
1113 JGI25165J46597_1000003
1114 Ga0007410J51695_1020453
1115 Ga0058859_11478325
1116 Ga0058863_11154503
1117 Ga0058861_11345411
1118 Ga0058861_11619973
1119 Ga0058861_11964324
1120 Ga0058860_12099259
1121 Ga0058860_12204101
1122 Ga0058862_11744529
1123 Ga0058862_12769194
1124 Ga0065714_10120588
1125 Ga0065704_10004042
1126 Ga0065704_10005168
1127 Ga0065712_10074022
1128 Ga0065712_10128508
1129 Ga0065712_10136592
1130 Ga0065712_10149591
1131 Ga0065715_10010752
1132 Ga0065715_10023454
1133 Ga0065715_10024118
1134 Ga0065715_10163698
1135 Ga0065715_10203398
1136 Ga0065707_10001405
1137 Ga0065707_10008883
1138 Ga0065707_10120166
1139 Ga0065707_10563363
1140 Ga0070658_10080659
1141 Ga0070658_10137220
1142 Ga0070676_10028387
1143 Ga0070676_10111141
1144 Ga0070676_10138907
1145 Ga0070676_10246314
1146 Ga0070683_100016713
1147 Ga0070683_100251636
1148 Ga0070683_100773368
1149 Ga0070683_100880943
1150 Ga0070690_100008406
1151 Ga0070690_100011868
1152 Ga0070690_100026704
1153 Ga0070690_100415323
1154 Ga0070670_100101198
1155 Ga0070670_100147006
1156 Ga0070670_100262808
1157 Ga0070677_10016768
1158 Ga0070677_10081654
1159 Ga0070677_10167176
1160 Ga0070677_10186852
1161 Ga0070677_10229593
1162 Ga0070677_10333397
1163 Ga0070677_10426231
1164 Ga0068869_100001817
1165 Ga0068869_100069007
1166 Ga0068869_100079712
1167 Ga0068869_100086889
1168 Ga0068869_100246937
1169 Ga0068869_100256085
1170 Ga0068869_100291877
1171 Ga0068869_100305928
1172 Ga0068869_100437615
1173 Ga0070666_10003881
1174 Ga0070666_10095913
1175 Ga0070666_10464080
1176 Ga0070680_100150655
1177 Ga0070680_100192119
1178 Ga0070680_100457047
1179 Ga0070682_100751685
1180 Ga0068868_100146382
1181 Ga0068868_100181846
1182 Ga0068868_100205591
1183 Ga0070660_100060000
1184 Ga0070660_100104038
1185 Ga0070660_100106393
1186 Ga0070689_100009051
1187 Ga0070689_100031685
1188 Ga0070689_100082585
1189 Ga0070689_100116610
1190 Ga0070689_100293399
1191 Ga0070689_100691174
1192 Ga0070691_10002877
1193 Ga0070691_10023689
1194 Ga0070687_100004448
1195 Ga0070687_100131437
1196 Ga0070661_100047551
1197 Ga0070661_100058230
1198 Ga0070661_100156916
1199 Ga0070661_100463929
1200 Ga0070692_10434984
1201 Ga0070692_10687571
1202 Ga0070668_100010486
1203 Ga0070668_100428177
1204 Ga0070668_100449992
1205 Ga0070668_100729695
1206 Ga0070669_100010337
1207 Ga0070669_100058864
1208 Ga0070669_100084280
1209 Ga0070669_100642073
1210 Ga0070675_100000464
1211 Ga0070675_100089079
1212 Ga0070675_100105755
1213 Ga0070675_100137027
1214 Ga0070675_100324662
1215 Ga0070675_100384097
1216 Ga0070675_100466046
1217 Ga0070675_100817831
1218 Ga0070675_100919647
1219 Ga0070671_100055695
1220 Ga0070671_100155579
1221 Ga0070671_100169671
1222 Ga0070674_100032443
1223 Ga0070674_100747977
1224 Ga0070674_100753385
1225 Ga0070674_100915458
1226 Ga0070674_100990526
1227 Ga0070673_100008655
1228 Ga0070673_100034453
1229 Ga0070673_100051812
1230 Ga0070673_100056656
1231 Ga0070673_100074490
1232 Ga0070673_100188600
1233 Ga0070673_101111224
1234 Ga0070688_100027363
1235 Ga0070688_100028663
1236 Ga0070688_100170237
1237 Ga0070688_100464008
1238 Ga0070688_100824686
1239 Ga0070659_100037772
1240 Ga0070667_100008486
1241 Ga0070667_100013176
1242 Ga0070667_100146499
1243 Ga0070667_100273403
1244 Ga0070667_100396141
1245 Ga0070667_100437278
1246 Ga0070667_100472470
1247 Ga0070667_100483975
1248 Ga0070667_100635606
1249 Ga0070709_10101345
1250 Ga0070709_10370843
1251 Ga0070713_100267422
1252 Ga0070710_10469579
1253 Ga0070710_10731332
1254 Ga0070701_10003530
1255 Ga0070701_10038044
1256 Ga0070701_10096782
1257 Ga0070701_10248525
1258 Ga0070711_100367241
1259 Ga0070705_100043086
1260 Ga0070705_100556711
1261 Ga0070705_101076244
1262 Ga0070700_100010513
1263 Ga0070700_100038354
1264 Ga0070694_100009867
1265 Ga0070694_100168322
1266 Ga0070694_100291348
1267 Ga0070694_100341445
1268 Ga0070694_100575269
1269 Ga0070708_100378911
1270 Ga0070708_100576698
1271 Ga0070708_101094123
1272 Ga0070708_101209960
1273 Ga0070663_100215951
1274 Ga0070678_100004034
1275 Ga0070678_100056470
1276 Ga0070678_100094618
1277 Ga0070678_100885522
1278 Ga0070662_100245993
1279 Ga0070662_101197998
1280 Ga0070681_10010262
1281 Ga0070681_10013494
1282 Ga0070681_10064420
1283 Ga0070681_10290219
1284 Ga0068867_100000898
1285 Ga0068867_100007475
1286 Ga0068867_100014622
1287 Ga0068867_100054992
1288 Ga0068867_100130713
1289 Ga0068867_100258612
1290 Ga0068867_100347645
1291 Ga0068867_100612472
1292 Ga0070685_10079184
1293 Ga0070685_10171365
1294 Ga0070685_10317003
1295 Ga0070707_100229824
1296 Ga0070707_101071705
1297 Ga0070698_101054681
1298 Ga0070699_100410760
1299 Ga0070699_100563940
1300 Ga0070679_100012895
1301 Ga0070679_100050628
1302 Ga0070679_100073633
1303 Ga0070679_100076852
1304 Ga0070684_100000686
1305 Ga0070684_100227943
1306 Ga0070684_100272808
1307 Ga0070684_100306170
1308 Ga0070684_100583377
1309 Ga0068853_100013515
1310 Ga0068853_100071915
1311 Ga0068853_100136091
1312 Ga0068853_100326225
1313 Ga0068853_100341633
1314 Ga0068853_100415734
1315 Ga0070672_100033588
1316 Ga0070672_100046100
1317 Ga0070672_100052061
1318 Ga0070672_100061480
1319 Ga0070672_100085283
1320 Ga0070672_100093177
1321 Ga0070672_100133153
1322 Ga0070672_100498076
1323 Ga0070672_100502039
1324 Ga0070672_100670395
1325 Ga0070686_100016391
1326 Ga0070686_100166673
1327 Ga0070686_100302434
1328 Ga0070686_100329493
1329 Ga0070686_100501945
1330 Ga0070686_100818335
1331 Ga0070686_100825890
1332 Ga0070686_101091704
1333 Ga0070695_100109052
1334 Ga0070695_100161546
1335 Ga0070695_100278729
1336 Ga0070695_100591478
1337 Ga0070695_101087944
1338 Ga0070696_100077321
1339 Ga0070696_100176990
1340 Ga0070696_100181098
1341 Ga0070696_100488859
1342 Ga0070696_100929214
1343 Ga0070665_100066267
1344 Ga0070665_100069879
1345 Ga0070665_100237681
1346 Ga0070665_100253431
1347 Ga0070704_100006391
1348 Ga0070704_100095090
1349 Ga0070704_100120553
1350 Ga0070704_100669043
1351 Ga0068855_100048876
1352 Ga0068855_100079772
1353 Ga0068855_100232806
1354 Ga0068855_100711845
1355 Ga0070664_100168905
1356 Ga0070664_100371284
1357 Ga0070664_100399255
1358 Ga0070664_100888807
1359 Ga0068857_100001723
1360 Ga0068857_100013627
1361 Ga0068857_100077163
1362 Ga0068857_100081572
1363 Ga0068857_100151507
1364 Ga0068854_100005751
1365 Ga0068854_100108817
1366 Ga0068856_100003074
1367 Ga0068856_100024019
1368 Ga0068856_100143017
1369 Ga0068856_100202771
1370 Ga0068856_100583066
1371 Ga0070702_100025563
1372 Ga0070702_100107701
1373 Ga0070702_100144463
1374 Ga0070702_100293266
1375 Ga0070702_100341074
1376 Ga0068852_100004765
1377 Ga0068852_100162470
1378 Ga0068852_100176436
1379 Ga0068852_101255527
1380 Ga0068859_100000942
1381 Ga0068859_100007715
1382 Ga0068859_100015193
1383 Ga0068859_100041903
1384 Ga0068859_100064018
1385 Ga0068859_100106707
1386 Ga0068859_100136850
1387 Ga0068859_100162902
1388 Ga0068859_100239373
1389 Ga0068859_100376769
1390 Ga0068859_100570123
1391 Ga0068859_100738089
1392 Ga0068859_100894406
1393 Ga0068859_101445197
1394 Ga0068864_100016200
1395 Ga0068864_100046995
1396 Ga0068864_100059994
1397 Ga0068864_100083878
1398 Ga0068864_100547607
1399 Ga0068864_100879421
1400 Ga0068864_100921191
1401 Ga0068866_10021155
1402 Ga0068866_10026122
1403 Ga0068866_10300711
1404 Ga0068866_10325162
1405 Ga0068861_100166951
1406 Ga0068861_100189992
1407 Ga0068861_100217553
1408 Ga0068861_100344695
1409 Ga0068861_100464815
1410 Ga0068851_10040510
1411 Ga0068851_10056395
1412 Ga0068851_10060858
1413 Ga0068870_10000192
1414 Ga0068870_10026859
1415 Ga0068870_10031021
1416 Ga0068870_10056652
1417 Ga0068870_10062330
1418 Ga0068870_10212369
1419 Ga0068870_10549857
1420 Ga0068863_100056915
1421 Ga0068863_100064599
1422 Ga0068863_100096215
1423 Ga0068863_100359118
1424 Ga0068863_100471370
1425 Ga0068863_100524905
1426 Ga0068863_100763841
1427 Ga0068863_100902909
1428 Ga0068858_100003479
1429 Ga0068858_100007617
1430 Ga0068858_100034638
1431 Ga0068858_100110507
1432 Ga0068858_100146416
1433 Ga0068858_100180141
1434 Ga0068858_100283255
1435 Ga0068858_100747344
1436 Ga0068858_101676034
1437 Ga0068860_100002423
1438 Ga0068860_100010508
1439 Ga0068860_100085132
1440 Ga0068860_100105001
1441 Ga0068860_100179620
1442 Ga0068860_100550700
1443 Ga0068860_100630863
1444 Ga0068860_100733267
1445 Ga0068860_100831517
1446 Ga0068862_100004844
1447 Ga0068862_100022719
1448 Ga0068862_100352551
1449 Ga0068862_100395750
1450 Ga0068862_100532586
1451 Ga0068862_100767944
1452 Ga0068862_100858566
1453 Ga0081455_10063215
1454 Ga0075368_10082332
1455 Ga0075432_10050045
1456 Ga0075432_10232679
1457 Ga0070715_10072635
1458 Ga0070716_100443727
1459 Ga0070712_100816347
1460 Ga0097621_100000897
1461 Ga0097621_100026878
1462 Ga0097621_100043866
1463 Ga0097621_100047407
1464 Ga0097621_100137181
1465 Ga0097621_100267770
1466 Ga0097621_100329099
1467 Ga0097621_100433608
1468 Ga0097621_100543354
1469 Ga0068871_100007271
1470 Ga0068871_100051962
1471 Ga0068871_100062489
1472 Ga0068871_100124894
1473 Ga0068871_100192444
1474 Ga0068871_100253739
1475 Ga0068871_100303275
1476 Ga0068871_100502713
1477 Ga0075428_100090306
1478 Ga0075428_100924432
1479 Ga0075430_100001748
1480 Ga0075433_10000163
1481 Ga0075433_10026369
1482 Ga0075433_10057273
1483 Ga0075433_10089438
1484 Ga0075434_100013654
1485 Ga0075434_100024659
1486 Ga0075434_100041785
1487 Ga0075434_100095884
1488 Ga0075434_100422031
1489 Ga0075434_100511025
1490 Ga0075434_101032732
1491 Ga0075434_101186243
1492 Ga0075434_101250751
1493 Ga0075429_100056763
1494 Ga0075429_100101578
1495 Ga0075429_100113089
1496 Ga0075429_101156006
1497 Ga0068865_100005059
1498 Ga0068865_100163513
1499 Ga0068865_100216258
1500 Ga0097620_100000942
1501 Ga0097620_100007715
1502 Ga0097620_100015192
1503 Ga0097620_100041902
1504 Ga0097620_100064020
1505 Ga0097620_100106707
1506 Ga0097620_100136852
1507 Ga0097620_100162894
1508 Ga0097620_100239372
1509 Ga0097620_100376769
1510 Ga0097620_100570061
1511 Ga0097620_100738261
1512 Ga0097620_100806427
1513 Ga0097620_101445340
1514 Ga0075435_100213936
1515 Ga0075435_100256247
1516 Ga0099795_10010530
1517 Ga0099795_10105546
1518 Ga0105251_10284940
1519 Ga0105240_10016319
1520 Ga0105240_10054577
1521 Ga0105240_10217939
1522 Ga0105240_10326187
1523 Ga0105240_10651498
1524 Ga0105240_11724918
1525 Ga0111539_10001989
1526 Ga0111539_10007265
1527 Ga0111539_10084724
1528 Ga0111539_10262686
1529 Ga0111539_10326513
1530 Ga0111539_10369883
1531 Ga0111539_10390502
1532 Ga0111539_10392062
1533 Ga0105245_10004042
1534 Ga0105245_10006936
1535 Ga0105245_10030011
1536 Ga0105245_10359887
1537 Ga0105245_10610102
1538 Ga0105245_11123326
1539 Ga0105247_10047368
1540 Ga0105247_10081480
1541 Ga0105247_10157607
1542 Ga0114129_10007250
1543 Ga0114129_10098075
1544 Ga0114129_10104941
1545 Ga0114129_10159295
1546 Ga0114129_10633701
1547 Ga0114129_11065212
1548 Ga0114129_11507640
1549 Ga0105243_10001279
1550 Ga0105243_10185066
1551 Ga0105243_10342088
1552 Ga0105243_11072984
1553 Ga0105241_10037368
1554 Ga0105241_10069753
1555 Ga0105241_10706879
1556 Ga0105241_10875950
1557 Ga0105241_11075613
1558 Ga0105242_10004043
1559 Ga0105242_10005299
1560 Ga0105242_10008066
1561 Ga0105242_10093821
1562 Ga0105242_10422650
1563 Ga0105242_11082708
1564 Ga0105242_11301810
1565 Ga0105242_11827432
1566 Ga0105248_10009933
1567 Ga0105248_10039929
1568 Ga0105248_10048288
1569 Ga0105248_10125576
1570 Ga0105248_10135672
1571 Ga0105248_10192213
1572 Ga0105248_10192602
1573 Ga0105248_10209773
1574 Ga0105248_10499622
1575 Ga0105248_10707859
1576 Ga0105248_11147088
1577 Ga0105248_11308643
1578 Ga0105237_10011728
1579 Ga0105237_10018144
1580 Ga0105237_10145955
1581 Ga0105237_10180962
1582 Ga0105238_10000849
1583 Ga0105238_10001232
1584 Ga0105238_10024027
1585 Ga0105238_10033651
1586 Ga0105238_10036598
1587 Ga0105238_10251783
1588 Ga0105238_10253922
1589 Ga0105238_10422998
1590 Ga0105238_11775139
1591 Ga0105249_10001729
1592 Ga0105249_10043358
1593 Ga0105249_10143927
1594 Ga0105249_10892685
1595 Ga0105249_11019436
1596 Ga0105249_11054609
1597 Ga0105239_10010043
1598 Ga0105239_10012533
1599 Ga0105239_10064265
1600 Ga0105239_10130067
1601 Ga0105239_10499996
1602 Ga0105239_12162935
1603 Ga0105246_10015063
1604 Ga0105246_10052626
1605 Ga0105246_10064861
1606 Ga0105246_10434080
1607 Ga0105246_10437056
1608 Ga0105246_10461185
1609 Ga0105246_11149702
1610 Ga0157373_10891108
1611 Ga0157371_10166629
1612 Ga0157370_10022349
1613 Ga0157370_10159105
1614 Ga0157369_10004883
1615 Ga0157369_10081249
1616 Ga0157369_10319511
1617 Ga0157369_10529497
1618 Ga0157374_10086910
1619 Ga0157374_10101635
1620 Ga0157374_10147748
1621 Ga0157374_10259160
1622 Ga0157374_10329109
1623 Ga0157374_10471764
1624 Ga0157374_10712086
1625 Ga0157378_10007429
1626 Ga0157378_10024970
1627 Ga0157378_10047677
1628 Ga0157378_10661096
1629 Ga0157378_10668687
1630 Ga0157378_10691071
1631 Ga0157378_10875635
1632 Ga0157378_11539705
1633 Ga0163162_10009293
1634 Ga0163162_10096289
1635 Ga0163162_10239598
1636 Ga0163162_10269670
1637 Ga0163162_10306040
1638 Ga0163162_10329540
1639 Ga0163162_10360816
1640 Ga0163162_10375808
1641 Ga0163162_10519671
1642 Ga0163162_10841212
1643 Ga0163162_10896393
1644 Ga0163162_11029831
1645 Ga0163162_12314489
1646 Ga0157372_10063730
1647 Ga0157372_10199556
1648 Ga0157372_10323416
1649 Ga0157375_10040638
1650 Ga0157375_10070513
1651 Ga0157375_10106202
1652 Ga0157375_10110475
1653 Ga0157375_10144322
1654 Ga0157375_10303357
1655 Ga0157375_10636665
1656 Ga0163163_10000361
1657 Ga0163163_10001459
1658 Ga0163163_10005428
1659 Ga0163163_10015032
1660 Ga0163163_10021529
1661 Ga0163163_10032762
1662 Ga0163163_10037686
1663 Ga0163163_10065912
1664 Ga0163163_10120865
1665 Ga0163163_10164998
1666 Ga0163163_10598923
1667 Ga0157380_10029086
1668 Ga0157380_10044230
1669 Ga0157380_10128698
1670 Ga0157380_10129518
1671 Ga0157380_10510759
1672 Ga0157377_10037240
1673 Ga0157377_10190939
1674 Ga0157377_10442009
1675 Ga0157379_10032746
1676 Ga0157379_10108621
1677 Ga0157379_10513130
1678 Ga0157379_10599316
1679 Ga0157379_10853834
1680 Ga0157379_11236078
1681 Ga0157379_11392486
1682 Ga0157376_10016956
1683 Ga0157376_10047574
1684 Ga0157376_10079794
1685 Ga0157376_10123948
1686 Ga0157376_10290350
1687 Ga0157376_10474909
1688 Ga0157376_11848168
1689 Ga0163161_10034563
1690 Ga0163161_10064361
1691 Ga0163161_10436867
1692 Ga0163161_10457790
1693 Ga0163161_10689515
1694 Ga0197907_10421835
1695 Ga0207427_105203
1696 Ga0209233_1000015
1697 Ga0207673_1001094
1698 Ga0207697_10113503
1699 Ga0207697_10153462
1700 Ga0207656_10033635
1701 Ga0207656_10035796
1702 Ga0207653_10125981
1703 Ga0207682_10001552
1704 Ga0207682_10002307
1705 Ga0207682_10131487
1706 Ga0207642_10019271
1707 Ga0207642_10181108
1708 Ga0207710_10080581
1709 Ga0207688_10018673
1710 Ga0207688_10038963
1711 Ga0207680_10012330
1712 Ga0207680_10033879
1713 Ga0207680_10198679
1714 Ga0207680_10699508
1715 Ga0207699_10049909
1716 Ga0207699_10126601
1717 Ga0207699_10434357
1718 Ga0207645_10014193
1719 Ga0207645_10043728
1720 Ga0207645_10102888
1721 Ga0207645_10160763
1722 Ga0207645_10237411
1723 Ga0207643_10000798
1724 Ga0207643_10013855
1725 Ga0207643_10019999
1726 Ga0207643_10020115
1727 Ga0207643_10021415
1728 Ga0207643_10034947
1729 Ga0207643_10084745
1730 Ga0207643_10085865
1731 Ga0207643_10256420
1732 Ga0207705_10114537
1733 Ga0207654_10004648
1734 Ga0207654_10088212
1735 Ga0207654_10169691
1736 Ga0207654_10320770
1737 Ga0207654_10366289
1738 Ga0207654_10556955
1739 Ga0207707_10001529
1740 Ga0207707_10096014
1741 Ga0207707_10168131
1742 Ga0207707_10339748
1743 Ga0207695_10003423
1744 Ga0207695_10071698
1745 Ga0207695_10378269
1746 Ga0207695_10448896
1747 Ga0207695_10689554
1748 Ga0207671_10009867
1749 Ga0207671_10039236
1750 Ga0207671_10277042
1751 Ga0207671_10714911
1752 Ga0207663_10187128
1753 Ga0207663_10212571
1754 Ga0207663_10560404
1755 Ga0207660_10019478
1756 Ga0207660_10116398
1757 Ga0207662_10008158
1758 Ga0207662_10016059
1759 Ga0207662_10040381
1760 Ga0207662_10054175
1761 Ga0207662_10537783
1762 Ga0207657_10019241
1763 Ga0207657_10030748
1764 Ga0207657_10645223
1765 Ga0207649_10153743
1766 Ga0207649_10486372
1767 Ga0207652_10072593
1768 Ga0207652_10085387
1769 Ga0207646_10342059
1770 Ga0207681_10002323
1771 Ga0207694_10000624
1772 Ga0207694_10001139
1773 Ga0207694_10032845
1774 Ga0207694_10063865
1775 Ga0207694_10114304
1776 Ga0207694_10155778
1777 Ga0207694_10451603
1778 Ga0207650_10019082
1779 Ga0207650_10067002
1780 Ga0207650_10204184
1781 Ga0207650_10537474
1782 Ga0207650_10736012
1783 Ga0207659_10000105
1784 Ga0207659_10024654
1785 Ga0207659_10273626
1786 Ga0207659_10336558
1787 Ga0207659_10407395
1788 Ga0207659_10629882
1789 Ga0207659_10792633
1790 Ga0207687_10003518
1791 Ga0207687_10003843
1792 Ga0207687_10079795
1793 Ga0207687_10129887
1794 Ga0207644_10034620
1795 Ga0207644_10050756
1796 Ga0207644_10412280
1797 Ga0207644_10454512
1798 Ga0207690_10168330
1799 Ga0207706_10004735
1800 Ga0207706_10031615
1801 Ga0207706_10940725
1802 Ga0207686_10008754
1803 Ga0207686_10027723
1804 Ga0207686_10036186
1805 Ga0207686_10133254
1806 Ga0207686_10194765
1807 Ga0207686_10480517
1808 Ga0207686_10973272
1809 Ga0207686_11162172
1810 Ga0207709_10001549
1811 Ga0207709_10032156
1812 Ga0207709_10055347
1813 Ga0207709_10351390
1814 Ga0207670_10005628
1815 Ga0207670_10008307
1816 Ga0207670_10131820
1817 Ga0207670_10197782
1818 Ga0207670_10443913
1819 Ga0207670_11018791
1820 Ga0207669_10069686
1821 Ga0207669_10417463
1822 Ga0207669_10420585
1823 Ga0207669_10439617
1824 Ga0207704_10096844
1825 Ga0207704_10200572
1826 Ga0207704_10263593
1827 Ga0207704_10320770
1828 Ga0207704_10351884
1829 Ga0207691_10018369
1830 Ga0207691_10092753
1831 Ga0207691_10093984
1832 Ga0207691_10114985
1833 Ga0207691_10178784
1834 Ga0207691_10180676
1835 Ga0207691_10213787
1836 Ga0207711_10008109
1837 Ga0207711_10045439
1838 Ga0207711_10100108
1839 Ga0207711_10118360
1840 Ga0207711_10124681
1841 Ga0207711_10149472
1842 Ga0207711_10155115
1843 Ga0207711_10165616
1844 Ga0207711_10249144
1845 Ga0207711_10275598
1846 Ga0207711_10316394
1847 Ga0207711_10520701
1848 Ga0207689_10006162
1849 Ga0207689_10028459
1850 Ga0207689_10052460
1851 Ga0207689_10102687
1852 Ga0207689_10113792
1853 Ga0207689_10123447
1854 Ga0207689_10130486
1855 Ga0207689_10161911
1856 Ga0207689_10227314
1857 Ga0207689_10284758
1858 Ga0207689_10350789
1859 Ga0207661_10000440
1860 Ga0207661_10256458
1861 Ga0207661_10291435
1862 Ga0207679_10003442
1863 Ga0207679_10276353
1864 Ga0207679_10620460
1865 Ga0207667_10003148
1866 Ga0207667_10163885
1867 Ga0207651_10002639
1868 Ga0207651_10041856
1869 Ga0207651_10082790
1870 Ga0207651_10111037
1871 Ga0207651_10174935
1872 Ga0207651_10747914
1873 Ga0207651_10875513
1874 Ga0207651_11067159
1875 Ga0207712_10017205
1876 Ga0207712_10061861
1877 Ga0207712_10194884
1878 Ga0207712_10196972
1879 Ga0207712_10699297
1880 Ga0207668_10503927
1881 Ga0207668_10906152
1882 Ga0207640_10070375
1883 Ga0207640_10271757
1884 Ga0207640_11320049
1885 Ga0207658_10046204
1886 Ga0207658_10074635
1887 Ga0207658_10089572
1888 Ga0207658_10382217
1889 Ga0207658_10517252
1890 Ga0207658_10545971
1891 Ga0207658_11165745
1892 Ga0207677_10032256
1893 Ga0207677_10101523
1894 Ga0207677_10107740
1895 Ga0207677_10186482
1896 Ga0207677_10201096
1897 Ga0207703_10008840
1898 Ga0207703_10009347
1899 Ga0207703_10028701
1900 Ga0207703_10045830
1901 Ga0207703_10076337
1902 Ga0207703_10171073
1903 Ga0207703_10212594
1904 Ga0207639_10036023
1905 Ga0207639_10058508
1906 Ga0207639_10093330
1907 Ga0207639_10153410
1908 Ga0207639_10372324
1909 Ga0207639_10608920
1910 Ga0207678_10684803
1911 Ga0207678_10950159
1912 Ga0207708_10013738
1913 Ga0207708_10031656
1914 Ga0207708_10074218
1915 Ga0207708_10078656
1916 Ga0207708_10129157
1917 Ga0207708_10633618
1918 Ga0207702_10007504
1919 Ga0207702_10182119
1920 Ga0207702_10190438
1921 Ga0207702_10214051
1922 Ga0207702_10811037
1923 Ga0207641_10017321
1924 Ga0207641_10162254
1925 Ga0207641_10342890
1926 Ga0207641_10345991
1927 Ga0207641_10500081
1928 Ga0207641_10523834
1929 Ga0207641_10593807
1930 Ga0207648_10002414
1931 Ga0207648_10052045
1932 Ga0207648_10069740
1933 Ga0207648_10112445
1934 Ga0207648_10124833
1935 Ga0207648_10231822
1936 Ga0207648_10595273
1937 Ga0207648_11092935
1938 Ga0207676_10014803
1939 Ga0207676_10063294
1940 Ga0207676_10073867
1941 Ga0207676_10106727
1942 Ga0207676_10127202
1943 Ga0207676_10136823
1944 Ga0207676_10279074
1945 Ga0207676_10288616
1946 Ga0207676_10293377
1947 Ga0207676_10507336
1948 Ga0207676_10956103
1949 Ga0207674_10001214
1950 Ga0207674_10002954
1951 Ga0207674_10037435
1952 Ga0207674_10041715
1953 Ga0207674_10045562
1954 Ga0207674_10130834
1955 Ga0207674_10302372
1956 Ga0207674_10343952
1957 Ga0207674_10392169
1958 Ga0207675_100008002
1959 Ga0207675_100011835
1960 Ga0207675_100041840
1961 Ga0207675_100100074
1962 Ga0207675_100130326
1963 Ga0207675_100168452
1964 Ga0207675_100237964
1965 Ga0207675_100355090
1966 Ga0207675_100419591
1967 Ga0207675_100510765
1968 Ga0207675_100741039
1969 Ga0207683_10007588
1970 Ga0207683_10015647
1971 Ga0207683_10019890
1972 Ga0207683_10029512
1973 Ga0207683_10042168
1974 Ga0207683_10110848
1975 Ga0207683_10436090
1976 Ga0207683_11012894
1977 Ga0207698_10078502
1978 Ga0207698_10195044
1979 Ga0209996_1009649
1980 Ga0209179_1003916
1981 Ga0209974_10041910
1982 Ga0207428_10002147
1983 Ga0207428_10006528
1984 Ga0207428_10018399
1985 Ga0207428_10178002
1986 Ga0207428_10226658
1987 Ga0207428_10621396
1988 Ga0268266_10018050
1989 Ga0268266_10049466
1990 Ga0268266_10118119
1991 Ga0268266_10121578
1992 Ga0268265_10002294
1993 Ga0268265_10013612
1994 Ga0268265_10362758
1995 Ga0268265_10373655
1996 Ga0268265_10506205
1997 Ga0268265_10894232
1998 Ga0268264_10004132
1999 Ga0268264_10004498
2000 Ga0268264_10042979
2001 Ga0268264_10095187
2002 Ga0268264_10119876
2003 Ga0268264_10294959
2004 Ga0268264_10300397
2005 Ga0268264_10450644
2006 Ga0268264_11278363
2007 Ga0265337_1001333
2008 Ga0265319_1053056
2009 Ga0265334_10003224
2010 Ga0265318_10008720
2011 Ga0265338_10344360
2012 Ga0265766_1013085
2013 Ga0265770_1073202
2014 Ga0265779_101300
2015 Ga0265330_10039117
2016 Ga0265328_10023384
2017 Ga0265320_10045118
2018 Ga0265325_10011366
2019 Ga0265329_10025089
2020 Ga0265331_10000991
2021 Ga0265331_10106578
2022 Ga0265316_10010483
2023 Ga0265313_10006487
2024 Ga0265313_10040068
2025 Ga0265314_10000277
2026 Ga0265314_10002727
2027 Ga0265314_10051768
2028 Ga0265314_10123611
2029 Ga0307416_100645561
2030 Ga0373938_0026288
2031 Ga0373934_0282294
2032 Ga0373949_0114447
2033 Ga0373949_0195878
2034 Ga0373951_0044619
2035 Ga0373936_0339512
2036 Ga0373939_0023471
2037 Ga0373945_0037397
2038 Ga0373953_0229957
2039 Ga0373954_0205448
2040 Ga0373943_0001872
2041 Ga0373946_0144012
2042 Ga0373946_0182868
2043 Ga0373946_0266263
2044 Ga0373942_0007237
2045 Ga0373942_0027018
2046 Ga0373961_0014069
2047 Ga0373962_0009519
2048 Ga0373962_0087497
2049 Ga0373924_0096458
2050 Ga0373931_0014369
2051 Ga0373931_0051309
2052 Ga0373931_0165144
2053 Ga0373931_0253117
2054 Ga0373935_0043797
2055 Ga0373927_0166580
2056 Ga0373927_0366441
2057 Ga0373933_0123202
2058 Ga0373933_0605088
2059 Ga0373947_0002238
2060 Ga0373947_0080496
2061 Ga0373937_0070565
2062 Ga0373937_0094591
2063 Ga0373937_0100932
2064 Ga0373937_0112639
2065 Ga0373925_0046983
2066 Ga0373925_0721254
2067 Ga0436364_0421318
2068 Ga0436364_1037684
2069 Ga0436365_1618975
2070 Ga0436363_0177020
2071 Ga0436363_1275821
2072 Ga0451853_2100878
2073 Ga0439434_0144096
2074 Ga0439444_0014056
2075 Ga0453683_0223505
2076 Ga0466963_0182391
2077 Ga0451576_0040309
2078 Ga0466967_0329392
2079 Ga0495603_0152915
2080 Ga0495629_0514811
2081 Ga0495650_0167094
2082 Ga0495582_0215025
2083 Ga0495582_0280401
2084 Ga0495582_0295699
2085 Ga0495639_0081638
2086 Ga0495584_0120907
2087 Ga0495585_0133167
2088 Ga0495594_0075565
2089 Ga0495594_0318204
2090 Ga0495596_0241848
2091 Ga0495628_0555715
2092 Ga0495630_0496490
2093 Ga0495630_0918046
2094 Ga0495631_0274007
2095 Ga0495644_0110161
2096 Ga0495642_0085588
2097 Ga0495642_0241067
2098 Ga0495665_0055515
2099 Ga0495665_0220081
2100 Ga0495640_0519088
2101 Ga0495586_0039826
2102 Ga0495586_0171064
2103 Ga0495586_0291118
2104 Ga0495587_0483187
2105 Ga0495587_0592830
2106 Ga0495609_0061694
2107 Ga0495621_0047402
2108 Ga0495621_0078573
2109 Ga0495667_0401021
2110 Ga0495634_0543770
2111 Ga0495611_0052573
2112 Ga0495659_0026141
2113 Ga0495659_0082970
2114 Ga0495659_0270302
2115 Ga0495657_0208135
2116 Ga0495623_0207302
2117 Ga0495658_0045681
2118 Ga0495658_0282263
2119 Ga0495624_0506264
2120 Ga0495670_0152473
2121 Ga0495671_0278895
2122 Ga0495660_0409995
2123 Ga0495604_0108998
2124 Ga0495636_0017175
2125 Ga0495676_0481556
2126 Ga0495675_0237439
2127 Ga0495677_0110752
2128 Ga0495614_0385747
2129 Ga0495614_0435779
2130 Ga0495615_0151397
2131 Ga0496100_0302110
2132 Ga0496101_0093742
2133 Ga0496102_0144900
2134 Ga0496104_0134125
2135 Ga0496105_0354963
2136 Ga0496108_0386900
2137 Ga0496108_0476558
2138 Ga0496108_0860903
2139 Ga0496109_0133336
2140 Ga0496109_0468415
2141 Ga0496110_0109838
2142 Ga0496110_0525656
2143 Ga0496112_0008426
2144 Ga0496112_0329134
2145 Ga0496113_0135923
2146 Ga0496113_0993691
2147 Ga0496115_0085330
2148 Ga0496115_0768556
2149 Ga0501031_0122088
2150 Ga0501031_0183972
2151 Ga0501036_0030543
2152 Ga0501036_0586479
2153 Ga0501039_0211147
2154 Ga0501039_0400824
2155 Ga0501041_0028086
2156 Ga0501042_0173619
2157 Ga0501043_0103194
2158 Ga0501046_0370554
2159 Ga0501048_0041623
2160 Ga0501068_0194132
2161 Ga0501069_0153810
2162 Ga0501070_0825314
2163 Ga0501072_0060653
2164 Ga0501074_0383248
2165 Ga0501075_0038936
2166 Ga0501075_0289405
2167 Ga0501076_0014997
2168 Ga0501259_116618
2169 Ga0501079_0056877
2170 Ga0501079_0097824
2171 Ga0501080_0457271
2172 Ga0501081_0711439
2173 Ga0501045_0369061
2174 nmdc:mga0yw44_567387_c1
2175 nmdc:mga05p37_165436_c1
2176 nmdc:mga05p37_29994_c1
2177 nmdc:mga05p37_39948_c1
2178 nmdc:mga05p37_507054_c1
2179 nmdc:mga09592_129105_c1
2180 nmdc:mga09592_53072_c1
2181 nmdc:mga09592_81991_c1
2182 nmdc:mga0qj67_542322_c1
2183 nmdc:mga0qj67_71952_c1
2184 nmdc:mga08y16_1035244_c1
2185 nmdc:mga08y16_10962_c1
2186 nmdc:mga08y16_239971_c1
2187 nmdc:mga08y16_28255_c1
2188 nmdc:mga08y16_383054_c1
2189 nmdc:mga08y16_52878_c1
2190 nmdc:mga08y16_533285_c1
2191 nmdc:mga0n895_1568_c1
2192 nmdc:mga0n895_164140_c1
2193 nmdc:mga0n895_18550_c1
2194 nmdc:mga0n895_336428_c1
2195 nmdc:mga0n895_408317_c1
2196 nmdc:mga0n895_494403_c1
2197 nmdc:mga0rr50_186517_c1
2198 nmdc:mga0rr50_581520_c1
2199 nmdc:mga0rr50_599744_c1
2200 nmdc:mga08x19_74519_c1
2201 nmdc:mga0a205_16064_c1
2202 nmdc:mga0a205_31076_c1
2203 nmdc:mga0a205_33077_c1
2204 nmdc:mga0a205_901929_c1
2205 Ga0495595_0082051
2206 Ga0500642_0321498
2207 Ga0500559_0180776
2208 Ga0501084_0116330
2209 Ga0501082_0015291
2210 Ga0530510_0010125

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

85

172

0.88

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

83

168

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xts-assembly1.cif.gz_B crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.8167 31 162
7b21-assembly1.cif.gz_AAA the x183 domain from cellvibrio japonicus cbp2d 0.6455 58 137
1c6r-assembly1.cif.gz_A crystal structure of reduced cytochrome c6 from the green algae scenedesmus obliquus 0.6279 60 137
2xts-assembly1.cif.gz_B crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.6174 31 162
6tr1-assembly3.cif.gz_E native cytochrome c6 from thermosynechococcus elongatus in space group h3 0.6157 60 137
ID Description Score Start End Superfamily
2xtsD01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.817 35 161 1.10.760.10
2xtsD01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7567 35 161 1.10.760.10
4pwaC00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6099 90 136 1.10.760.10
1ls9A00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.5797 60 133 1.10.760.10
2v08B00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.5548 60 137 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A2V8DP02-F1-model_v4 Cytochrome c domain-containing protein 0.9681 62 159 GO:0009055
GO:0020037
GO:0046872
AF-A0A2V8F9J0-F1-model_v4 Cytochrome c domain-containing protein 0.9511 46 179 GO:0009055
GO:0020037
GO:0046872
AF-H7GH64-F1-model_v4 Cytochrome c 0.9413 92 156 GO:0009055
GO:0020037
AF-A0A3B9U2K0-F1-model_v4 deleted 0.9279 98 163
AF-A0A3M1BCA1-F1-model_v4 Uncharacterized protein 0.9179 97 153 GO:0009055
GO:0016020
GO:0020037

Map