F490135
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1105 | 339 | 2210 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300025893|Ga0207682_10042443|Ga0207682_100424432 |
| Length | 215 |
| Sequence | MGTTLSEAPPRKRASRLRLAKAVFNCPPVRAGVSVMPLVVLMGTTALAQGPTFGVGRAPTPEEIRAVDISISPTGDELPPGRGTAKEGAQLYVQKACVGCHGVGGSGGLAPLLASKKEADVPVWKKERILPLRAPYATIVWDFINRGMPLGLEGTLKPDEVYSLTAYLLFLNKVIPEDQVLDKQSLPKVKMPIGDQFGKPHEFKVNAPRLEGYPY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 216 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 218 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 221 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 225 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 230 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 238 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 242 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 250 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 251 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 252 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 304 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 305 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 321 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 336 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.64 |
| Metatranscriptomes | 1.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.63 |
| Nodule | 0 |
| Rhizoplane | 1.63 |
| Rhizosphere | 96.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207682_10042443 | 3300025893 | Bacteria | 1858 |
| 2 | SwRhRL2b_contig_3032446 | 2162886007 | Unclassified | 911 |
| 3 | ARcpr5oldR_c010840 | 3300000041 | Unclassified | 778 |
| 4 | JGI24746J21847_1001423 | 3300001977 | Unclassified | 3808 |
| 5 | JGI24751J29686_10005177 | 3300002459 | Bacteria | 2653 |
| 6 | JGI24751J29686_10033568 | 3300002459 | Unclassified | 1064 |
| 7 | Ga0006778J45830_1027403 | 3300003162 | Bacteria | 702 |
| 8 | JGI25165J46597_1000003 | 3300003214 | Bacteria | 694080 |
| 9 | Ga0007410J51695_1020453 | 3300003574 | Bacteria | 798 |
| 10 | Ga0058859_11478325 | 3300004798 | Bacteria | 613 |
| 11 | Ga0058863_11154503 | 3300004799 | Unclassified | 599 |
| 12 | Ga0058861_11345411 | 3300004800 | Unclassified | 721 |
| 13 | Ga0058861_11619973 | 3300004800 | Bacteria | 1928 |
| 14 | Ga0058861_11964324 | 3300004800 | Bacteria | 862 |
| 15 | Ga0058860_12099259 | 3300004801 | Unclassified | 698 |
| 16 | Ga0058860_12204101 | 3300004801 | Unclassified | 951 |
| 17 | Ga0058862_11744529 | 3300004803 | Bacteria | 1911 |
| 18 | Ga0058862_12769194 | 3300004803 | Bacteria | 2049 |
| 19 | Ga0065714_10120588 | 3300005288 | Unclassified | 1353 |
| 20 | Ga0065704_10004042 | 3300005289 | Bacteria | 3991 |
| 21 | Ga0065704_10005168 | 3300005289 | Unclassified | 3872 |
| 22 | Ga0065712_10074022 | 3300005290 | Bacteria | 4208 |
| 23 | Ga0065712_10128508 | 3300005290 | Bacteria | 1578 |
| 24 | Ga0065712_10136592 | 3300005290 | Unclassified | 1475 |
| 25 | Ga0065712_10149591 | 3300005290 | Bacteria | 1380 |
| 26 | Ga0065715_10010752 | 3300005293 | Unclassified | 2448 |
| 27 | Ga0065715_10023454 | 3300005293 | Bacteria | 1541 |
| 28 | Ga0065715_10024118 | 3300005293 | Unclassified | 1856 |
| 29 | Ga0065715_10163698 | 3300005293 | Bacteria | 1605 |
| 30 | Ga0065715_10203398 | 3300005293 | Bacteria | 1308 |
| 31 | Ga0065707_10001405 | 3300005295 | Bacteria | 10473 |
| 32 | Ga0065707_10008883 | 3300005295 | Unclassified | 3583 |
| 33 | Ga0065707_10120166 | 3300005295 | Unclassified | 2141 |
| 34 | Ga0065707_10563363 | 3300005295 | Bacteria | 713 |
| 35 | Ga0070658_10080659 | 3300005327 | Bacteria | 2672 |
| 36 | Ga0070658_10137220 | 3300005327 | Bacteria | 2042 |
| 37 | Ga0070676_10028387 | 3300005328 | Bacteria | 3178 |
| 38 | Ga0070676_10111141 | 3300005328 | Bacteria | 1706 |
| 39 | Ga0070676_10138907 | 3300005328 | Bacteria | 1545 |
| 40 | Ga0070676_10246314 | 3300005328 | Bacteria | 1191 |
| 41 | Ga0070683_100016713 | 3300005329 | Bacteria | 6474 |
| 42 | Ga0070683_100251636 | 3300005329 | Unclassified | 1680 |
| 43 | Ga0070683_100773368 | 3300005329 | Bacteria | 920 |
| 44 | Ga0070683_100880943 | 3300005329 | Bacteria | 859 |
| 45 | Ga0070690_100008406 | 3300005330 | Bacteria | 5943 |
| 46 | Ga0070690_100011868 | 3300005330 | Bacteria | 5112 |
| 47 | Ga0070690_100026704 | 3300005330 | Bacteria | 3564 |
| 48 | Ga0070690_100415323 | 3300005330 | Bacteria | 991 |
| 49 | Ga0070670_100101198 | 3300005331 | Bacteria | 2481 |
| 50 | Ga0070670_100147006 | 3300005331 | Unclassified | 2039 |
| 51 | Ga0070670_100262808 | 3300005331 | Bacteria | 1505 |
| 52 | Ga0070677_10016768 | 3300005333 | Bacteria | 2612 |
| 53 | Ga0070677_10081654 | 3300005333 | Bacteria | 1384 |
| 54 | Ga0070677_10167176 | 3300005333 | Unclassified | 1037 |
| 55 | Ga0070677_10186852 | 3300005333 | Unclassified | 991 |
| 56 | Ga0070677_10229593 | 3300005333 | Bacteria | 911 |
| 57 | Ga0070677_10333397 | 3300005333 | Bacteria | 781 |
| 58 | Ga0070677_10426231 | 3300005333 | Unclassified | 704 |
| 59 | Ga0068869_100001817 | 3300005334 | Bacteria | 12818 |
| 60 | Ga0068869_100069007 | 3300005334 | Bacteria | 2612 |
| 61 | Ga0068869_100079712 | 3300005334 | Bacteria | 2441 |
| 62 | Ga0068869_100086889 | 3300005334 | Unclassified | 2345 |
| 63 | Ga0068869_100246937 | 3300005334 | Bacteria | 1424 |
| 64 | Ga0068869_100256085 | 3300005334 | Bacteria | 1399 |
| 65 | Ga0068869_100291877 | 3300005334 | Bacteria | 1314 |
| 66 | Ga0068869_100305928 | 3300005334 | Bacteria | 1285 |
| 67 | Ga0068869_100437615 | 3300005334 | Unclassified | 1082 |
| 68 | Ga0070666_10003881 | 3300005335 | Bacteria | 9079 |
| 69 | Ga0070666_10095913 | 3300005335 | Bacteria | 2041 |
| 70 | Ga0070666_10464080 | 3300005335 | Unclassified | 915 |
| 71 | Ga0070680_100150655 | 3300005336 | Bacteria | 1952 |
| 72 | Ga0070680_100192119 | 3300005336 | Bacteria | 1720 |
| 73 | Ga0070680_100457047 | 3300005336 | Bacteria | 1091 |
| 74 | Ga0070682_100751685 | 3300005337 | Unclassified | 787 |
| 75 | Ga0068868_100146382 | 3300005338 | Bacteria | 1943 |
| 76 | Ga0068868_100181846 | 3300005338 | Bacteria | 1745 |
| 77 | Ga0068868_100205591 | 3300005338 | Bacteria | 1643 |
| 78 | Ga0070660_100060000 | 3300005339 | Bacteria | 2951 |
| 79 | Ga0070660_100104038 | 3300005339 | Bacteria | 2252 |
| 80 | Ga0070660_100106393 | 3300005339 | Bacteria | 2228 |
| 81 | Ga0070689_100009051 | 3300005340 | Bacteria | 7050 |
| 82 | Ga0070689_100031685 | 3300005340 | Bacteria | 4019 |
| 83 | Ga0070689_100082585 | 3300005340 | Unclassified | 2524 |
| 84 | Ga0070689_100116610 | 3300005340 | Bacteria | 2129 |
| 85 | Ga0070689_100293399 | 3300005340 | Bacteria | 1352 |
| 86 | Ga0070689_100691174 | 3300005340 | Bacteria | 890 |
| 87 | Ga0070691_10002877 | 3300005341 | Bacteria | 7711 |
| 88 | Ga0070691_10023689 | 3300005341 | Bacteria | 2852 |
| 89 | Ga0070687_100004448 | 3300005343 | Bacteria | 5591 |
| 90 | Ga0070687_100131437 | 3300005343 | Bacteria | 1446 |
| 91 | Ga0070661_100047551 | 3300005344 | Unclassified | 3140 |
| 92 | Ga0070661_100058230 | 3300005344 | Bacteria | 2831 |
| 93 | Ga0070661_100156916 | 3300005344 | Bacteria | 1722 |
| 94 | Ga0070661_100463929 | 3300005344 | Bacteria | 1009 |
| 95 | Ga0070692_10434984 | 3300005345 | Bacteria | 836 |
| 96 | Ga0070692_10687571 | 3300005345 | Unclassified | 687 |
| 97 | Ga0070668_100010486 | 3300005347 | Bacteria | 6889 |
| 98 | Ga0070668_100428177 | 3300005347 | Bacteria | 1134 |
| 99 | Ga0070668_100449992 | 3300005347 | Unclassified | 1107 |
| 100 | Ga0070668_100729695 | 3300005347 | Bacteria | 876 |
| 101 | Ga0070669_100010337 | 3300005353 | Bacteria | 6627 |
| 102 | Ga0070669_100058864 | 3300005353 | Bacteria | 2820 |
| 103 | Ga0070669_100084280 | 3300005353 | Unclassified | 2371 |
| 104 | Ga0070669_100642073 | 3300005353 | Unclassified | 892 |
| 105 | Ga0070675_100000464 | 3300005354 | Bacteria | 27701 |
| 106 | Ga0070675_100089079 | 3300005354 | Bacteria | 2583 |
| 107 | Ga0070675_100105755 | 3300005354 | Bacteria | 2375 |
| 108 | Ga0070675_100137027 | 3300005354 | Bacteria | 2089 |
| 109 | Ga0070675_100324662 | 3300005354 | Bacteria | 1360 |
| 110 | Ga0070675_100384097 | 3300005354 | Bacteria | 1250 |
| 111 | Ga0070675_100466046 | 3300005354 | Bacteria | 1135 |
| 112 | Ga0070675_100817831 | 3300005354 | Unclassified | 852 |
| 113 | Ga0070675_100919647 | 3300005354 | Unclassified | 802 |
| 114 | Ga0070671_100055695 | 3300005355 | Bacteria | 3289 |
| 115 | Ga0070671_100155579 | 3300005355 | Bacteria | 1931 |
| 116 | Ga0070671_100169671 | 3300005355 | Bacteria | 1845 |
| 117 | Ga0070674_100032443 | 3300005356 | Bacteria | 3468 |
| 118 | Ga0070674_100747977 | 3300005356 | Unclassified | 840 |
| 119 | Ga0070674_100753385 | 3300005356 | Bacteria | 837 |
| 120 | Ga0070674_100915458 | 3300005356 | Unclassified | 765 |
| 121 | Ga0070674_100990526 | 3300005356 | Unclassified | 737 |
| 122 | Ga0070673_100008655 | 3300005364 | Bacteria | 6781 |
| 123 | Ga0070673_100034453 | 3300005364 | Bacteria | 3832 |
| 124 | Ga0070673_100051812 | 3300005364 | Bacteria | 3217 |
| 125 | Ga0070673_100056656 | 3300005364 | Bacteria | 3093 |
| 126 | Ga0070673_100074490 | 3300005364 | Bacteria | 2736 |
| 127 | Ga0070673_100188600 | 3300005364 | Bacteria | 1770 |
| 128 | Ga0070673_101111224 | 3300005364 | Unclassified | 739 |
| 129 | Ga0070688_100027363 | 3300005365 | Bacteria | 3396 |
| 130 | Ga0070688_100028663 | 3300005365 | Bacteria | 3326 |
| 131 | Ga0070688_100170237 | 3300005365 | Bacteria | 1502 |
| 132 | Ga0070688_100464008 | 3300005365 | Unclassified | 949 |
| 133 | Ga0070688_100824686 | 3300005365 | Unclassified | 727 |
| 134 | Ga0070659_100037772 | 3300005366 | Bacteria | 3765 |
| 135 | Ga0070667_100008486 | 3300005367 | Bacteria | 8518 |
| 136 | Ga0070667_100013176 | 3300005367 | Bacteria | 6834 |
| 137 | Ga0070667_100146499 | 3300005367 | Bacteria | 2071 |
| 138 | Ga0070667_100273403 | 3300005367 | Bacteria | 1515 |
| 139 | Ga0070667_100396141 | 3300005367 | Bacteria | 1256 |
| 140 | Ga0070667_100437278 | 3300005367 | Bacteria | 1194 |
| 141 | Ga0070667_100472470 | 3300005367 | Unclassified | 1147 |
| 142 | Ga0070667_100483975 | 3300005367 | Bacteria | 1133 |
| 143 | Ga0070667_100635606 | 3300005367 | Unclassified | 985 |
| 144 | Ga0070709_10101345 | 3300005434 | Unclassified | 1919 |
| 145 | Ga0070709_10370843 | 3300005434 | Bacteria | 1062 |
| 146 | Ga0070713_100267422 | 3300005436 | Bacteria | 1565 |
| 147 | Ga0070710_10469579 | 3300005437 | Bacteria | 856 |
| 148 | Ga0070710_10731332 | 3300005437 | Bacteria | 701 |
| 149 | Ga0070701_10003530 | 3300005438 | Bacteria | 6203 |
| 150 | Ga0070701_10038044 | 3300005438 | Bacteria | 2433 |
| 151 | Ga0070701_10096782 | 3300005438 | Bacteria | 1628 |
| 152 | Ga0070701_10248525 | 3300005438 | Bacteria | 1073 |
| 153 | Ga0070711_100367241 | 3300005439 | Bacteria | 1160 |
| 154 | Ga0070705_100043086 | 3300005440 | Unclassified | 2585 |
| 155 | Ga0070705_100556711 | 3300005440 | Unclassified | 880 |
| 156 | Ga0070705_101076244 | 3300005440 | Unclassified | 656 |
| 157 | Ga0070700_100010513 | 3300005441 | Bacteria | 5113 |
| 158 | Ga0070700_100038354 | 3300005441 | Bacteria | 2919 |
| 159 | Ga0070694_100009867 | 3300005444 | Bacteria | 5870 |
| 160 | Ga0070694_100168322 | 3300005444 | Bacteria | 1613 |
| 161 | Ga0070694_100291348 | 3300005444 | Bacteria | 1248 |
| 162 | Ga0070694_100341445 | 3300005444 | Bacteria | 1158 |
| 163 | Ga0070694_100575269 | 3300005444 | Unclassified | 904 |
| 164 | Ga0070708_100378911 | 3300005445 | Unclassified | 1334 |
| 165 | Ga0070708_100576698 | 3300005445 | Unclassified | 1061 |
| 166 | Ga0070708_101094123 | 3300005445 | Unclassified | 746 |
| 167 | Ga0070708_101209960 | 3300005445 | Unclassified | 707 |
| 168 | Ga0070663_100215951 | 3300005455 | Bacteria | 1504 |
| 169 | Ga0070678_100004034 | 3300005456 | Bacteria | 8266 |
| 170 | Ga0070678_100056470 | 3300005456 | Bacteria | 2872 |
| 171 | Ga0070678_100094618 | 3300005456 | Bacteria | 2300 |
| 172 | Ga0070678_100885522 | 3300005456 | Bacteria | 815 |
| 173 | Ga0070662_100245993 | 3300005457 | Bacteria | 1436 |
| 174 | Ga0070662_101197998 | 3300005457 | Unclassified | 653 |
| 175 | Ga0070681_10010262 | 3300005458 | Bacteria | 9242 |
| 176 | Ga0070681_10013494 | 3300005458 | Bacteria | 8120 |
| 177 | Ga0070681_10064420 | 3300005458 | Bacteria | 3635 |
| 178 | Ga0070681_10290219 | 3300005458 | Bacteria | 1546 |
| 179 | Ga0068867_100000898 | 3300005459 | Bacteria | 20171 |
| 180 | Ga0068867_100007475 | 3300005459 | Bacteria | 7727 |
| 181 | Ga0068867_100014622 | 3300005459 | Bacteria | 5561 |
| 182 | Ga0068867_100054992 | 3300005459 | Bacteria | 2941 |
| 183 | Ga0068867_100130713 | 3300005459 | Bacteria | 1951 |
| 184 | Ga0068867_100258612 | 3300005459 | Bacteria | 1418 |
| 185 | Ga0068867_100347645 | 3300005459 | Bacteria | 1236 |
| 186 | Ga0068867_100612472 | 3300005459 | Bacteria | 951 |
| 187 | Ga0070685_10079184 | 3300005466 | Unclassified | 1966 |
| 188 | Ga0070685_10171365 | 3300005466 | Bacteria | 1391 |
| 189 | Ga0070685_10317003 | 3300005466 | Bacteria | 1055 |
| 190 | Ga0070707_100229824 | 3300005468 | Bacteria | 1806 |
| 191 | Ga0070707_101071705 | 3300005468 | Bacteria | 772 |
| 192 | Ga0070698_101054681 | 3300005471 | Unclassified | 761 |
| 193 | Ga0070699_100410760 | 3300005518 | Bacteria | 1225 |
| 194 | Ga0070699_100563940 | 3300005518 | Unclassified | 1037 |
| 195 | Ga0070679_100012895 | 3300005530 | Bacteria | 8002 |
| 196 | Ga0070679_100050628 | 3300005530 | Bacteria | 4137 |
| 197 | Ga0070679_100073633 | 3300005530 | Bacteria | 3407 |
| 198 | Ga0070679_100076852 | 3300005530 | Unclassified | 3327 |
| 199 | Ga0070684_100000686 | 3300005535 | Bacteria | 23355 |
| 200 | Ga0070684_100227943 | 3300005535 | Bacteria | 1701 |
| 201 | Ga0070684_100272808 | 3300005535 | Bacteria | 1549 |
| 202 | Ga0070684_100306170 | 3300005535 | Bacteria | 1459 |
| 203 | Ga0070684_100583377 | 3300005535 | Bacteria | 1039 |
| 204 | Ga0068853_100013515 | 3300005539 | Bacteria | 6669 |
| 205 | Ga0068853_100071915 | 3300005539 | Unclassified | 3013 |
| 206 | Ga0068853_100136091 | 3300005539 | Bacteria | 2203 |
| 207 | Ga0068853_100326225 | 3300005539 | Bacteria | 1424 |
| 208 | Ga0068853_100341633 | 3300005539 | Bacteria | 1391 |
| 209 | Ga0068853_100415734 | 3300005539 | Unclassified | 1260 |
| 210 | Ga0070672_100033588 | 3300005543 | Bacteria | 3886 |
| 211 | Ga0070672_100046100 | 3300005543 | Bacteria | 3376 |
| 212 | Ga0070672_100052061 | 3300005543 | Bacteria | 3195 |
| 213 | Ga0070672_100061480 | 3300005543 | Unclassified | 2961 |
| 214 | Ga0070672_100085283 | 3300005543 | Bacteria | 2538 |
| 215 | Ga0070672_100093177 | 3300005543 | Bacteria | 2433 |
| 216 | Ga0070672_100133153 | 3300005543 | Bacteria | 2045 |
| 217 | Ga0070672_100498076 | 3300005543 | Unclassified | 1054 |
| 218 | Ga0070672_100502039 | 3300005543 | Bacteria | 1049 |
| 219 | Ga0070672_100670395 | 3300005543 | Unclassified | 907 |
| 220 | Ga0070686_100016391 | 3300005544 | Unclassified | 4311 |
| 221 | Ga0070686_100166673 | 3300005544 | Unclassified | 1555 |
| 222 | Ga0070686_100302434 | 3300005544 | Bacteria | 1187 |
| 223 | Ga0070686_100329493 | 3300005544 | Bacteria | 1141 |
| 224 | Ga0070686_100501945 | 3300005544 | Bacteria | 941 |
| 225 | Ga0070686_100818335 | 3300005544 | Unclassified | 752 |
| 226 | Ga0070686_100825890 | 3300005544 | Unclassified | 749 |
| 227 | Ga0070686_101091704 | 3300005544 | Unclassified | 659 |
| 228 | Ga0070695_100109052 | 3300005545 | Bacteria | 1876 |
| 229 | Ga0070695_100161546 | 3300005545 | Bacteria | 1573 |
| 230 | Ga0070695_100278729 | 3300005545 | Bacteria | 1227 |
| 231 | Ga0070695_100591478 | 3300005545 | Unclassified | 870 |
| 232 | Ga0070695_101087944 | 3300005545 | Bacteria | 654 |
| 233 | Ga0070696_100077321 | 3300005546 | Bacteria | 2352 |
| 234 | Ga0070696_100176990 | 3300005546 | Bacteria | 1581 |
| 235 | Ga0070696_100181098 | 3300005546 | Unclassified | 1563 |
| 236 | Ga0070696_100488859 | 3300005546 | Unclassified | 977 |
| 237 | Ga0070696_100929214 | 3300005546 | Unclassified | 723 |
| 238 | Ga0070665_100066267 | 3300005548 | Bacteria | 3623 |
| 239 | Ga0070665_100069879 | 3300005548 | Unclassified | 3519 |
| 240 | Ga0070665_100237681 | 3300005548 | Bacteria | 1822 |
| 241 | Ga0070665_100253431 | 3300005548 | Bacteria | 1761 |
| 242 | Ga0070704_100006391 | 3300005549 | Bacteria | 6947 |
| 243 | Ga0070704_100095090 | 3300005549 | Bacteria | 2231 |
| 244 | Ga0070704_100120553 | 3300005549 | Bacteria | 2014 |
| 245 | Ga0070704_100669043 | 3300005549 | Unclassified | 918 |
| 246 | Ga0068855_100048876 | 3300005563 | Unclassified | 4991 |
| 247 | Ga0068855_100079772 | 3300005563 | Bacteria | 3796 |
| 248 | Ga0068855_100232806 | 3300005563 | Bacteria | 2062 |
| 249 | Ga0068855_100711845 | 3300005563 | Bacteria | 1074 |
| 250 | Ga0070664_100168905 | 3300005564 | Bacteria | 1939 |
| 251 | Ga0070664_100371284 | 3300005564 | Bacteria | 1304 |
| 252 | Ga0070664_100399255 | 3300005564 | Bacteria | 1257 |
| 253 | Ga0070664_100888807 | 3300005564 | Unclassified | 835 |
| 254 | Ga0068857_100001723 | 3300005577 | Bacteria | 17599 |
| 255 | Ga0068857_100013627 | 3300005577 | Bacteria | 7084 |
| 256 | Ga0068857_100077163 | 3300005577 | Unclassified | 2972 |
| 257 | Ga0068857_100081572 | 3300005577 | Bacteria | 2888 |
| 258 | Ga0068857_100151507 | 3300005577 | Bacteria | 2101 |
| 259 | Ga0068854_100005751 | 3300005578 | Bacteria | 7843 |
| 260 | Ga0068854_100108817 | 3300005578 | Bacteria | 2088 |
| 261 | Ga0068856_100003074 | 3300005614 | Bacteria | 17036 |
| 262 | Ga0068856_100024019 | 3300005614 | Bacteria | 5930 |
| 263 | Ga0068856_100143017 | 3300005614 | Bacteria | 2399 |
| 264 | Ga0068856_100202771 | 3300005614 | Unclassified | 1998 |
| 265 | Ga0068856_100583066 | 3300005614 | Unclassified | 1139 |
| 266 | Ga0070702_100025563 | 3300005615 | Bacteria | 3165 |
| 267 | Ga0070702_100107701 | 3300005615 | Bacteria | 1721 |
| 268 | Ga0070702_100144463 | 3300005615 | Unclassified | 1519 |
| 269 | Ga0070702_100293266 | 3300005615 | Bacteria | 1122 |
| 270 | Ga0070702_100341074 | 3300005615 | Bacteria | 1052 |
| 271 | Ga0068852_100004765 | 3300005616 | Bacteria | 9634 |
| 272 | Ga0068852_100162470 | 3300005616 | Bacteria | 2086 |
| 273 | Ga0068852_100176436 | 3300005616 | Bacteria | 2006 |
| 274 | Ga0068852_101255527 | 3300005616 | Unclassified | 762 |
| 275 | Ga0068859_100000942 | 3300005617 | Bacteria | 29786 |
| 276 | Ga0068859_100007715 | 3300005617 | Bacteria | 10928 |
| 277 | Ga0068859_100015193 | 3300005617 | Bacteria | 7728 |
| 278 | Ga0068859_100041903 | 3300005617 | Bacteria | 4599 |
| 279 | Ga0068859_100064018 | 3300005617 | Bacteria | 3709 |
| 280 | Ga0068859_100106707 | 3300005617 | Bacteria | 2860 |
| 281 | Ga0068859_100136850 | 3300005617 | Bacteria | 2522 |
| 282 | Ga0068859_100162902 | 3300005617 | Bacteria | 2309 |
| 283 | Ga0068859_100239373 | 3300005617 | Bacteria | 1904 |
| 284 | Ga0068859_100376769 | 3300005617 | Unclassified | 1515 |
| 285 | Ga0068859_100570123 | 3300005617 | Bacteria | 1226 |
| 286 | Ga0068859_100738089 | 3300005617 | Bacteria | 1074 |
| 287 | Ga0068859_100894406 | 3300005617 | Unclassified | 973 |
| 288 | Ga0068859_101445197 | 3300005617 | Bacteria | 759 |
| 289 | Ga0068864_100016200 | 3300005618 | Bacteria | 6205 |
| 290 | Ga0068864_100046995 | 3300005618 | Unclassified | 3705 |
| 291 | Ga0068864_100059994 | 3300005618 | Bacteria | 3293 |
| 292 | Ga0068864_100083878 | 3300005618 | Bacteria | 2799 |
| 293 | Ga0068864_100547607 | 3300005618 | Bacteria | 1118 |
| 294 | Ga0068864_100879421 | 3300005618 | Unclassified | 884 |
| 295 | Ga0068864_100921191 | 3300005618 | Bacteria | 864 |
| 296 | Ga0068866_10021155 | 3300005718 | Bacteria | 2993 |
| 297 | Ga0068866_10026122 | 3300005718 | Unclassified | 2753 |
| 298 | Ga0068866_10300711 | 3300005718 | Bacteria | 1002 |
| 299 | Ga0068866_10325162 | 3300005718 | Unclassified | 969 |
| 300 | Ga0068861_100166951 | 3300005719 | Unclassified | 1821 |
| 301 | Ga0068861_100189992 | 3300005719 | Bacteria | 1716 |
| 302 | Ga0068861_100217553 | 3300005719 | Bacteria | 1612 |
| 303 | Ga0068861_100344695 | 3300005719 | Bacteria | 1305 |
| 304 | Ga0068861_100464815 | 3300005719 | Bacteria | 1136 |
| 305 | Ga0068851_10040510 | 3300005834 | Unclassified | 2341 |
| 306 | Ga0068851_10056395 | 3300005834 | Bacteria | 2004 |
| 307 | Ga0068851_10060858 | 3300005834 | Bacteria | 1934 |
| 308 | Ga0068870_10000192 | 3300005840 | Bacteria | 21774 |
| 309 | Ga0068870_10026859 | 3300005840 | Bacteria | 2874 |
| 310 | Ga0068870_10031021 | 3300005840 | Bacteria | 2705 |
| 311 | Ga0068870_10056652 | 3300005840 | Bacteria | 2093 |
| 312 | Ga0068870_10062330 | 3300005840 | Unclassified | 2008 |
| 313 | Ga0068870_10212369 | 3300005840 | Unclassified | 1180 |
| 314 | Ga0068870_10549857 | 3300005840 | Unclassified | 777 |
| 315 | Ga0068863_100056915 | 3300005841 | Bacteria | 3701 |
| 316 | Ga0068863_100064599 | 3300005841 | Bacteria | 3461 |
| 317 | Ga0068863_100096215 | 3300005841 | Bacteria | 2811 |
| 318 | Ga0068863_100359118 | 3300005841 | Bacteria | 1420 |
| 319 | Ga0068863_100471370 | 3300005841 | Unclassified | 1234 |
| 320 | Ga0068863_100524905 | 3300005841 | Bacteria | 1168 |
| 321 | Ga0068863_100763841 | 3300005841 | Bacteria | 963 |
| 322 | Ga0068863_100902909 | 3300005841 | Bacteria | 884 |
| 323 | Ga0068858_100003479 | 3300005842 | Bacteria | 15610 |
| 324 | Ga0068858_100007617 | 3300005842 | Bacteria | 10456 |
| 325 | Ga0068858_100034638 | 3300005842 | Bacteria | 4684 |
| 326 | Ga0068858_100110507 | 3300005842 | Bacteria | 2567 |
| 327 | Ga0068858_100146416 | 3300005842 | Unclassified | 2218 |
| 328 | Ga0068858_100180141 | 3300005842 | Bacteria | 1995 |
| 329 | Ga0068858_100283255 | 3300005842 | Bacteria | 1578 |
| 330 | Ga0068858_100747344 | 3300005842 | Unclassified | 953 |
| 331 | Ga0068858_101676034 | 3300005842 | Unclassified | 628 |
| 332 | Ga0068860_100002423 | 3300005843 | Bacteria | 19584 |
| 333 | Ga0068860_100010508 | 3300005843 | Bacteria | 9152 |
| 334 | Ga0068860_100085132 | 3300005843 | Bacteria | 3007 |
| 335 | Ga0068860_100105001 | 3300005843 | Bacteria | 2697 |
| 336 | Ga0068860_100179620 | 3300005843 | Bacteria | 2046 |
| 337 | Ga0068860_100550700 | 3300005843 | Bacteria | 1156 |
| 338 | Ga0068860_100630863 | 3300005843 | Bacteria | 1079 |
| 339 | Ga0068860_100733267 | 3300005843 | Unclassified | 999 |
| 340 | Ga0068860_100831517 | 3300005843 | Unclassified | 938 |
| 341 | Ga0068862_100004844 | 3300005844 | Bacteria | 11336 |
| 342 | Ga0068862_100022719 | 3300005844 | Bacteria | 5248 |
| 343 | Ga0068862_100352551 | 3300005844 | Unclassified | 1366 |
| 344 | Ga0068862_100395750 | 3300005844 | Bacteria | 1291 |
| 345 | Ga0068862_100532586 | 3300005844 | Unclassified | 1119 |
| 346 | Ga0068862_100767944 | 3300005844 | Unclassified | 939 |
| 347 | Ga0068862_100858566 | 3300005844 | Unclassified | 890 |
| 348 | Ga0081455_10063215 | 3300005937 | Bacteria | 3107 |
| 349 | Ga0075368_10082332 | 3300006042 | Bacteria | 1311 |
| 350 | Ga0075432_10050045 | 3300006058 | Bacteria | 1473 |
| 351 | Ga0075432_10232679 | 3300006058 | Bacteria | 741 |
| 352 | Ga0070715_10072635 | 3300006163 | Unclassified | 1541 |
| 353 | Ga0070716_100443727 | 3300006173 | Bacteria | 944 |
| 354 | Ga0070712_100816347 | 3300006175 | Unclassified | 801 |
| 355 | Ga0097621_100000897 | 3300006237 | Bacteria | 20878 |
| 356 | Ga0097621_100026878 | 3300006237 | Bacteria | 4520 |
| 357 | Ga0097621_100043866 | 3300006237 | Bacteria | 3606 |
| 358 | Ga0097621_100047407 | 3300006237 | Bacteria | 3482 |
| 359 | Ga0097621_100137181 | 3300006237 | Bacteria | 2087 |
| 360 | Ga0097621_100267770 | 3300006237 | Unclassified | 1500 |
| 361 | Ga0097621_100329099 | 3300006237 | Unclassified | 1355 |
| 362 | Ga0097621_100433608 | 3300006237 | Unclassified | 1181 |
| 363 | Ga0097621_100543354 | 3300006237 | Unclassified | 1057 |
| 364 | Ga0068871_100007271 | 3300006358 | Bacteria | 7898 |
| 365 | Ga0068871_100051962 | 3300006358 | Bacteria | 3318 |
| 366 | Ga0068871_100062489 | 3300006358 | Bacteria | 3044 |
| 367 | Ga0068871_100124894 | 3300006358 | Bacteria | 2177 |
| 368 | Ga0068871_100192444 | 3300006358 | Unclassified | 1758 |
| 369 | Ga0068871_100253739 | 3300006358 | Bacteria | 1533 |
| 370 | Ga0068871_100303275 | 3300006358 | Bacteria | 1402 |
| 371 | Ga0068871_100502713 | 3300006358 | Unclassified | 1093 |
| 372 | Ga0075428_100090306 | 3300006844 | Bacteria | 3341 |
| 373 | Ga0075428_100924432 | 3300006844 | Bacteria | 925 |
| 374 | Ga0075430_100001748 | 3300006846 | Bacteria | 17731 |
| 375 | Ga0075433_10000163 | 3300006852 | Bacteria | 36379 |
| 376 | Ga0075433_10026369 | 3300006852 | Bacteria | 4919 |
| 377 | Ga0075433_10057273 | 3300006852 | Bacteria | 3407 |
| 378 | Ga0075433_10089438 | 3300006852 | Bacteria | 2722 |
| 379 | Ga0075434_100013654 | 3300006871 | Bacteria | 7742 |
| 380 | Ga0075434_100024659 | 3300006871 | Bacteria | 5881 |
| 381 | Ga0075434_100041785 | 3300006871 | Unclassified | 4543 |
| 382 | Ga0075434_100095884 | 3300006871 | Bacteria | 2971 |
| 383 | Ga0075434_100422031 | 3300006871 | Bacteria | 1355 |
| 384 | Ga0075434_100511025 | 3300006871 | Bacteria | 1222 |
| 385 | Ga0075434_101032732 | 3300006871 | Unclassified | 836 |
| 386 | Ga0075434_101186243 | 3300006871 | Bacteria | 776 |
| 387 | Ga0075434_101250751 | 3300006871 | Bacteria | 754 |
| 388 | Ga0075429_100056763 | 3300006880 | Bacteria | 3409 |
| 389 | Ga0075429_100101578 | 3300006880 | Bacteria | 2511 |
| 390 | Ga0075429_100113089 | 3300006880 | Bacteria | 2373 |
| 391 | Ga0075429_101156006 | 3300006880 | Unclassified | 676 |
| 392 | Ga0068865_100005059 | 3300006881 | Bacteria | 7980 |
| 393 | Ga0068865_100163513 | 3300006881 | Unclassified | 1700 |
| 394 | Ga0068865_100216258 | 3300006881 | Bacteria | 1496 |
| 395 | Ga0097620_100000942 | 3300006931 | Bacteria | 29786 |
| 396 | Ga0097620_100007715 | 3300006931 | Bacteria | 10928 |
| 397 | Ga0097620_100015192 | 3300006931 | Bacteria | 7728 |
| 398 | Ga0097620_100041902 | 3300006931 | Bacteria | 4599 |
| 399 | Ga0097620_100064020 | 3300006931 | Bacteria | 3709 |
| 400 | Ga0097620_100106707 | 3300006931 | Bacteria | 2860 |
| 401 | Ga0097620_100136852 | 3300006931 | Bacteria | 2522 |
| 402 | Ga0097620_100162894 | 3300006931 | Bacteria | 2309 |
| 403 | Ga0097620_100239372 | 3300006931 | Bacteria | 1904 |
| 404 | Ga0097620_100376769 | 3300006931 | Unclassified | 1515 |
| 405 | Ga0097620_100570061 | 3300006931 | Bacteria | 1226 |
| 406 | Ga0097620_100738261 | 3300006931 | Bacteria | 1074 |
| 407 | Ga0097620_100806427 | 3300006931 | Bacteria | 1026 |
| 408 | Ga0097620_101445340 | 3300006931 | Bacteria | 759 |
| 409 | Ga0075435_100213936 | 3300007076 | Bacteria | 1636 |
| 410 | Ga0075435_100256247 | 3300007076 | Bacteria | 1490 |
| 411 | Ga0099795_10010530 | 3300007788 | Bacteria | 2727 |
| 412 | Ga0099795_10105546 | 3300007788 | Unclassified | 1110 |
| 413 | Ga0105251_10284940 | 3300009011 | Unclassified | 747 |
| 414 | Ga0105240_10016319 | 3300009093 | Bacteria | 10059 |
| 415 | Ga0105240_10054577 | 3300009093 | Bacteria | 5007 |
| 416 | Ga0105240_10217939 | 3300009093 | Unclassified | 2225 |
| 417 | Ga0105240_10326187 | 3300009093 | Bacteria | 1748 |
| 418 | Ga0105240_10651498 | 3300009093 | Unclassified | 1154 |
| 419 | Ga0105240_11724918 | 3300009093 | Unclassified | 653 |
| 420 | Ga0111539_10001989 | 3300009094 | Bacteria | 27254 |
| 421 | Ga0111539_10007265 | 3300009094 | Bacteria | 14185 |
| 422 | Ga0111539_10084724 | 3300009094 | Bacteria | 3726 |
| 423 | Ga0111539_10262686 | 3300009094 | Bacteria | 2009 |
| 424 | Ga0111539_10326513 | 3300009094 | Bacteria | 1786 |
| 425 | Ga0111539_10369883 | 3300009094 | Bacteria | 1669 |
| 426 | Ga0111539_10390502 | 3300009094 | Bacteria | 1621 |
| 427 | Ga0111539_10392062 | 3300009094 | Bacteria | 1617 |
| 428 | Ga0105245_10004042 | 3300009098 | Bacteria | 13042 |
| 429 | Ga0105245_10006936 | 3300009098 | Bacteria | 9931 |
| 430 | Ga0105245_10030011 | 3300009098 | Bacteria | 4807 |
| 431 | Ga0105245_10359887 | 3300009098 | Bacteria | 1444 |
| 432 | Ga0105245_10610102 | 3300009098 | Bacteria | 1118 |
| 433 | Ga0105245_11123326 | 3300009098 | Bacteria | 832 |
| 434 | Ga0105247_10047368 | 3300009101 | Bacteria | 2639 |
| 435 | Ga0105247_10081480 | 3300009101 | Bacteria | 2040 |
| 436 | Ga0105247_10157607 | 3300009101 | Bacteria | 1500 |
| 437 | Ga0114129_10007250 | 3300009147 | Bacteria | 15785 |
| 438 | Ga0114129_10098075 | 3300009147 | Bacteria | 4056 |
| 439 | Ga0114129_10104941 | 3300009147 | Bacteria | 3905 |
| 440 | Ga0114129_10159295 | 3300009147 | Bacteria | 3085 |
| 441 | Ga0114129_10633701 | 3300009147 | Bacteria | 1381 |
| 442 | Ga0114129_11065212 | 3300009147 | Bacteria | 1014 |
| 443 | Ga0114129_11507640 | 3300009147 | Unclassified | 826 |
| 444 | Ga0105243_10001279 | 3300009148 | Bacteria | 22573 |
| 445 | Ga0105243_10185066 | 3300009148 | Bacteria | 1814 |
| 446 | Ga0105243_10342088 | 3300009148 | Bacteria | 1371 |
| 447 | Ga0105243_11072984 | 3300009148 | Unclassified | 812 |
| 448 | Ga0105241_10037368 | 3300009174 | Bacteria | 3658 |
| 449 | Ga0105241_10069753 | 3300009174 | Unclassified | 2726 |
| 450 | Ga0105241_10706879 | 3300009174 | Unclassified | 921 |
| 451 | Ga0105241_10875950 | 3300009174 | Unclassified | 832 |
| 452 | Ga0105241_11075613 | 3300009174 | Bacteria | 756 |
| 453 | Ga0105242_10004043 | 3300009176 | Bacteria | 11395 |
| 454 | Ga0105242_10005299 | 3300009176 | Bacteria | 9957 |
| 455 | Ga0105242_10008066 | 3300009176 | Bacteria | 8107 |
| 456 | Ga0105242_10093821 | 3300009176 | Bacteria | 2531 |
| 457 | Ga0105242_10422650 | 3300009176 | Bacteria | 1249 |
| 458 | Ga0105242_11082708 | 3300009176 | Bacteria | 814 |
| 459 | Ga0105242_11301810 | 3300009176 | Unclassified | 750 |
| 460 | Ga0105242_11827432 | 3300009176 | Unclassified | 646 |
| 461 | Ga0105248_10009933 | 3300009177 | Bacteria | 10475 |
| 462 | Ga0105248_10039929 | 3300009177 | Bacteria | 5260 |
| 463 | Ga0105248_10048288 | 3300009177 | Bacteria | 4774 |
| 464 | Ga0105248_10125576 | 3300009177 | Unclassified | 2895 |
| 465 | Ga0105248_10135672 | 3300009177 | Bacteria | 2776 |
| 466 | Ga0105248_10192213 | 3300009177 | Bacteria | 2300 |
| 467 | Ga0105248_10192602 | 3300009177 | Bacteria | 2297 |
| 468 | Ga0105248_10209773 | 3300009177 | Bacteria | 2195 |
| 469 | Ga0105248_10499622 | 3300009177 | Unclassified | 1371 |
| 470 | Ga0105248_10707859 | 3300009177 | Bacteria | 1136 |
| 471 | Ga0105248_11147088 | 3300009177 | Unclassified | 879 |
| 472 | Ga0105248_11308643 | 3300009177 | Unclassified | 820 |
| 473 | Ga0105237_10011728 | 3300009545 | Bacteria | 9270 |
| 474 | Ga0105237_10018144 | 3300009545 | Bacteria | 7286 |
| 475 | Ga0105237_10145955 | 3300009545 | Bacteria | 2361 |
| 476 | Ga0105237_10180962 | 3300009545 | Bacteria | 2108 |
| 477 | Ga0105238_10000849 | 3300009551 | Bacteria | 31444 |
| 478 | Ga0105238_10001232 | 3300009551 | Bacteria | 25744 |
| 479 | Ga0105238_10024027 | 3300009551 | Bacteria | 6215 |
| 480 | Ga0105238_10033651 | 3300009551 | Bacteria | 5215 |
| 481 | Ga0105238_10036598 | 3300009551 | Unclassified | 4991 |
| 482 | Ga0105238_10251783 | 3300009551 | Bacteria | 1745 |
| 483 | Ga0105238_10253922 | 3300009551 | Bacteria | 1737 |
| 484 | Ga0105238_10422998 | 3300009551 | Bacteria | 1327 |
| 485 | Ga0105238_11775139 | 3300009551 | Bacteria | 649 |
| 486 | Ga0105249_10001729 | 3300009553 | Bacteria | 19110 |
| 487 | Ga0105249_10043358 | 3300009553 | Bacteria | 4092 |
| 488 | Ga0105249_10143927 | 3300009553 | Bacteria | 2288 |
| 489 | Ga0105249_10892685 | 3300009553 | Bacteria | 956 |
| 490 | Ga0105249_11019436 | 3300009553 | Unclassified | 897 |
| 491 | Ga0105249_11054609 | 3300009553 | Unclassified | 882 |
| 492 | Ga0105239_10010043 | 3300010375 | Bacteria | 10614 |
| 493 | Ga0105239_10012533 | 3300010375 | Bacteria | 9444 |
| 494 | Ga0105239_10064265 | 3300010375 | Bacteria | 4029 |
| 495 | Ga0105239_10130067 | 3300010375 | Bacteria | 2799 |
| 496 | Ga0105239_10499996 | 3300010375 | Bacteria | 1382 |
| 497 | Ga0105239_12162935 | 3300010375 | Unclassified | 647 |
| 498 | Ga0105246_10015063 | 3300011119 | Bacteria | 4873 |
| 499 | Ga0105246_10052626 | 3300011119 | Bacteria | 2799 |
| 500 | Ga0105246_10064861 | 3300011119 | Bacteria | 2553 |
| 501 | Ga0105246_10434080 | 3300011119 | Unclassified | 1100 |
| 502 | Ga0105246_10437056 | 3300011119 | Bacteria | 1096 |
| 503 | Ga0105246_10461185 | 3300011119 | Unclassified | 1070 |
| 504 | Ga0105246_11149702 | 3300011119 | Bacteria | 712 |
| 505 | Ga0157373_10891108 | 3300013100 | Unclassified | 660 |
| 506 | Ga0157371_10166629 | 3300013102 | Bacteria | 1573 |
| 507 | Ga0157370_10022349 | 3300013104 | Bacteria | 6294 |
| 508 | Ga0157370_10159105 | 3300013104 | Bacteria | 2102 |
| 509 | Ga0157369_10004883 | 3300013105 | Bacteria | 15725 |
| 510 | Ga0157369_10081249 | 3300013105 | Bacteria | 3469 |
| 511 | Ga0157369_10319511 | 3300013105 | Unclassified | 1614 |
| 512 | Ga0157369_10529497 | 3300013105 | Unclassified | 1219 |
| 513 | Ga0157374_10086910 | 3300013296 | Bacteria | 2976 |
| 514 | Ga0157374_10101635 | 3300013296 | Bacteria | 2756 |
| 515 | Ga0157374_10147748 | 3300013296 | Bacteria | 2284 |
| 516 | Ga0157374_10259160 | 3300013296 | Bacteria | 1712 |
| 517 | Ga0157374_10329109 | 3300013296 | Unclassified | 1515 |
| 518 | Ga0157374_10471764 | 3300013296 | Bacteria | 1257 |
| 519 | Ga0157374_10712086 | 3300013296 | Unclassified | 1017 |
| 520 | Ga0157378_10007429 | 3300013297 | Bacteria | 9574 |
| 521 | Ga0157378_10024970 | 3300013297 | Bacteria | 5263 |
| 522 | Ga0157378_10047677 | 3300013297 | Bacteria | 3809 |
| 523 | Ga0157378_10661096 | 3300013297 | Bacteria | 1061 |
| 524 | Ga0157378_10668687 | 3300013297 | Unclassified | 1056 |
| 525 | Ga0157378_10691071 | 3300013297 | Bacteria | 1039 |
| 526 | Ga0157378_10875635 | 3300013297 | Unclassified | 928 |
| 527 | Ga0157378_11539705 | 3300013297 | Unclassified | 710 |
| 528 | Ga0163162_10009293 | 3300013306 | Bacteria | 9561 |
| 529 | Ga0163162_10096289 | 3300013306 | Bacteria | 3048 |
| 530 | Ga0163162_10239598 | 3300013306 | Bacteria | 1945 |
| 531 | Ga0163162_10269670 | 3300013306 | Bacteria | 1834 |
| 532 | Ga0163162_10306040 | 3300013306 | Bacteria | 1722 |
| 533 | Ga0163162_10329540 | 3300013306 | Bacteria | 1659 |
| 534 | Ga0163162_10360816 | 3300013306 | Bacteria | 1586 |
| 535 | Ga0163162_10375808 | 3300013306 | Bacteria | 1554 |
| 536 | Ga0163162_10519671 | 3300013306 | Unclassified | 1320 |
| 537 | Ga0163162_10841212 | 3300013306 | Unclassified | 1033 |
| 538 | Ga0163162_10896393 | 3300013306 | Unclassified | 1000 |
| 539 | Ga0163162_11029831 | 3300013306 | Bacteria | 931 |
| 540 | Ga0163162_12314489 | 3300013306 | Unclassified | 617 |
| 541 | Ga0157372_10063730 | 3300013307 | Bacteria | 4134 |
| 542 | Ga0157372_10199556 | 3300013307 | Bacteria | 2317 |
| 543 | Ga0157372_10323416 | 3300013307 | Unclassified | 1796 |
| 544 | Ga0157375_10040638 | 3300013308 | Bacteria | 4485 |
| 545 | Ga0157375_10070513 | 3300013308 | Unclassified | 3505 |
| 546 | Ga0157375_10106202 | 3300013308 | Bacteria | 2899 |
| 547 | Ga0157375_10110475 | 3300013308 | Unclassified | 2847 |
| 548 | Ga0157375_10144322 | 3300013308 | Bacteria | 2510 |
| 549 | Ga0157375_10303357 | 3300013308 | Bacteria | 1761 |
| 550 | Ga0157375_10636665 | 3300013308 | Unclassified | 1223 |
| 551 | Ga0163163_10000361 | 3300014325 | Bacteria | 43656 |
| 552 | Ga0163163_10001459 | 3300014325 | Bacteria | 19984 |
| 553 | Ga0163163_10005428 | 3300014325 | Bacteria | 11024 |
| 554 | Ga0163163_10015032 | 3300014325 | Bacteria | 7137 |
| 555 | Ga0163163_10021529 | 3300014325 | Bacteria | 6086 |
| 556 | Ga0163163_10032762 | 3300014325 | Bacteria | 5021 |
| 557 | Ga0163163_10037686 | 3300014325 | Bacteria | 4705 |
| 558 | Ga0163163_10065912 | 3300014325 | Bacteria | 3596 |
| 559 | Ga0163163_10120865 | 3300014325 | Unclassified | 2653 |
| 560 | Ga0163163_10164998 | 3300014325 | Bacteria | 2261 |
| 561 | Ga0163163_10598923 | 3300014325 | Bacteria | 1165 |
| 562 | Ga0157380_10029086 | 3300014326 | Unclassified | 4222 |
| 563 | Ga0157380_10044230 | 3300014326 | Bacteria | 3489 |
| 564 | Ga0157380_10128698 | 3300014326 | Bacteria | 2157 |
| 565 | Ga0157380_10129518 | 3300014326 | Unclassified | 2150 |
| 566 | Ga0157380_10510759 | 3300014326 | Bacteria | 1170 |
| 567 | Ga0157377_10037240 | 3300014745 | Bacteria | 2680 |
| 568 | Ga0157377_10190939 | 3300014745 | Bacteria | 1294 |
| 569 | Ga0157377_10442009 | 3300014745 | Bacteria | 896 |
| 570 | Ga0157379_10032746 | 3300014968 | Bacteria | 4635 |
| 571 | Ga0157379_10108621 | 3300014968 | Bacteria | 2491 |
| 572 | Ga0157379_10513130 | 3300014968 | Bacteria | 1112 |
| 573 | Ga0157379_10599316 | 3300014968 | Bacteria | 1028 |
| 574 | Ga0157379_10853834 | 3300014968 | Bacteria | 862 |
| 575 | Ga0157379_11236078 | 3300014968 | Bacteria | 719 |
| 576 | Ga0157379_11392486 | 3300014968 | Unclassified | 679 |
| 577 | Ga0157376_10016956 | 3300014969 | Bacteria | 5545 |
| 578 | Ga0157376_10047574 | 3300014969 | Bacteria | 3542 |
| 579 | Ga0157376_10079794 | 3300014969 | Bacteria | 2806 |
| 580 | Ga0157376_10123948 | 3300014969 | Bacteria | 2294 |
| 581 | Ga0157376_10290350 | 3300014969 | Bacteria | 1544 |
| 582 | Ga0157376_10474909 | 3300014969 | Unclassified | 1224 |
| 583 | Ga0157376_11848168 | 3300014969 | Unclassified | 641 |
| 584 | Ga0163161_10034563 | 3300017792 | Bacteria | 3617 |
| 585 | Ga0163161_10064361 | 3300017792 | Bacteria | 2675 |
| 586 | Ga0163161_10436867 | 3300017792 | Unclassified | 1056 |
| 587 | Ga0163161_10457790 | 3300017792 | Unclassified | 1032 |
| 588 | Ga0163161_10689515 | 3300017792 | Unclassified | 850 |
| 589 | Ga0197907_10421835 | 3300020069 | Bacteria | 1944 |
| 590 | Ga0207427_105203 | 3300025231 | Bacteria | 1900 |
| 591 | Ga0209233_1000015 | 3300025261 | Bacteria | 980563 |
| 592 | Ga0207673_1001094 | 3300025290 | Bacteria | 2924 |
| 593 | Ga0207697_10113503 | 3300025315 | Unclassified | 1161 |
| 594 | Ga0207697_10153462 | 3300025315 | Unclassified | 1003 |
| 595 | Ga0207656_10033635 | 3300025321 | Unclassified | 2137 |
| 596 | Ga0207656_10035796 | 3300025321 | Bacteria | 2081 |
| 597 | Ga0207653_10125981 | 3300025885 | Unclassified | 926 |
| 598 | Ga0207682_10001552 | 3300025893 | Bacteria | 10537 |
| 599 | Ga0207682_10002307 | 3300025893 | Bacteria | 8596 |
| 600 | Ga0207682_10131487 | 3300025893 | Bacteria | 1117 |
| 601 | Ga0207642_10019271 | 3300025899 | Bacteria | 2639 |
| 602 | Ga0207642_10181108 | 3300025899 | Bacteria | 1148 |
| 603 | Ga0207710_10080581 | 3300025900 | Unclassified | 1510 |
| 604 | Ga0207688_10018673 | 3300025901 | Bacteria | 3770 |
| 605 | Ga0207688_10038963 | 3300025901 | Bacteria | 2640 |
| 606 | Ga0207680_10012330 | 3300025903 | Bacteria | 4350 |
| 607 | Ga0207680_10033879 | 3300025903 | Bacteria | 2917 |
| 608 | Ga0207680_10198679 | 3300025903 | Unclassified | 1365 |
| 609 | Ga0207680_10699508 | 3300025903 | Unclassified | 726 |
| 610 | Ga0207699_10049909 | 3300025906 | Bacteria | 2465 |
| 611 | Ga0207699_10126601 | 3300025906 | Unclassified | 1660 |
| 612 | Ga0207699_10434357 | 3300025906 | Bacteria | 940 |
| 613 | Ga0207645_10014193 | 3300025907 | Bacteria | 5336 |
| 614 | Ga0207645_10043728 | 3300025907 | Bacteria | 2867 |
| 615 | Ga0207645_10102888 | 3300025907 | Bacteria | 1844 |
| 616 | Ga0207645_10160763 | 3300025907 | Unclassified | 1469 |
| 617 | Ga0207645_10237411 | 3300025907 | Bacteria | 1204 |
| 618 | Ga0207643_10000798 | 3300025908 | Bacteria | 19183 |
| 619 | Ga0207643_10013855 | 3300025908 | Bacteria | 4373 |
| 620 | Ga0207643_10019999 | 3300025908 | Bacteria | 3672 |
| 621 | Ga0207643_10020115 | 3300025908 | Bacteria | 3663 |
| 622 | Ga0207643_10021415 | 3300025908 | Bacteria | 3552 |
| 623 | Ga0207643_10034947 | 3300025908 | Unclassified | 2817 |
| 624 | Ga0207643_10084745 | 3300025908 | Unclassified | 1840 |
| 625 | Ga0207643_10085865 | 3300025908 | Unclassified | 1828 |
| 626 | Ga0207643_10256420 | 3300025908 | Unclassified | 1079 |
| 627 | Ga0207705_10114537 | 3300025909 | Bacteria | 1995 |
| 628 | Ga0207654_10004648 | 3300025911 | Bacteria | 6938 |
| 629 | Ga0207654_10088212 | 3300025911 | Bacteria | 1884 |
| 630 | Ga0207654_10169691 | 3300025911 | Bacteria | 1416 |
| 631 | Ga0207654_10320770 | 3300025911 | Bacteria | 1059 |
| 632 | Ga0207654_10366289 | 3300025911 | Unclassified | 995 |
| 633 | Ga0207654_10556955 | 3300025911 | Unclassified | 815 |
| 634 | Ga0207707_10001529 | 3300025912 | Bacteria | 21351 |
| 635 | Ga0207707_10096014 | 3300025912 | Bacteria | 2590 |
| 636 | Ga0207707_10168131 | 3300025912 | Bacteria | 1916 |
| 637 | Ga0207707_10339748 | 3300025912 | Bacteria | 1295 |
| 638 | Ga0207695_10003423 | 3300025913 | Bacteria | 22383 |
| 639 | Ga0207695_10071698 | 3300025913 | Bacteria | 3538 |
| 640 | Ga0207695_10378269 | 3300025913 | Bacteria | 1302 |
| 641 | Ga0207695_10448896 | 3300025913 | Unclassified | 1173 |
| 642 | Ga0207695_10689554 | 3300025913 | Bacteria | 902 |
| 643 | Ga0207671_10009867 | 3300025914 | Bacteria | 7939 |
| 644 | Ga0207671_10039236 | 3300025914 | Bacteria | 3507 |
| 645 | Ga0207671_10277042 | 3300025914 | Bacteria | 1322 |
| 646 | Ga0207671_10714911 | 3300025914 | Unclassified | 796 |
| 647 | Ga0207663_10187128 | 3300025916 | Bacteria | 1484 |
| 648 | Ga0207663_10212571 | 3300025916 | Unclassified | 1403 |
| 649 | Ga0207663_10560404 | 3300025916 | Bacteria | 894 |
| 650 | Ga0207660_10019478 | 3300025917 | Bacteria | 4537 |
| 651 | Ga0207660_10116398 | 3300025917 | Unclassified | 2019 |
| 652 | Ga0207662_10008158 | 3300025918 | Bacteria | 5726 |
| 653 | Ga0207662_10016059 | 3300025918 | Bacteria | 4220 |
| 654 | Ga0207662_10040381 | 3300025918 | Bacteria | 2743 |
| 655 | Ga0207662_10054175 | 3300025918 | Bacteria | 2391 |
| 656 | Ga0207662_10537783 | 3300025918 | Unclassified | 808 |
| 657 | Ga0207657_10019241 | 3300025919 | Bacteria | 6488 |
| 658 | Ga0207657_10030748 | 3300025919 | Bacteria | 4870 |
| 659 | Ga0207657_10645223 | 3300025919 | Unclassified | 824 |
| 660 | Ga0207649_10153743 | 3300025920 | Bacteria | 1587 |
| 661 | Ga0207649_10486372 | 3300025920 | Unclassified | 937 |
| 662 | Ga0207652_10072593 | 3300025921 | Bacteria | 2993 |
| 663 | Ga0207652_10085387 | 3300025921 | Bacteria | 2766 |
| 664 | Ga0207646_10342059 | 3300025922 | Bacteria | 1352 |
| 665 | Ga0207681_10002323 | 3300025923 | Bacteria | 12097 |
| 666 | Ga0207694_10000624 | 3300025924 | Bacteria | 32177 |
| 667 | Ga0207694_10001139 | 3300025924 | Bacteria | 23040 |
| 668 | Ga0207694_10032845 | 3300025924 | Unclassified | 3974 |
| 669 | Ga0207694_10063865 | 3300025924 | Bacteria | 2868 |
| 670 | Ga0207694_10114304 | 3300025924 | Bacteria | 2150 |
| 671 | Ga0207694_10155778 | 3300025924 | Bacteria | 1842 |
| 672 | Ga0207694_10451603 | 3300025924 | Unclassified | 1073 |
| 673 | Ga0207650_10019082 | 3300025925 | Bacteria | 4819 |
| 674 | Ga0207650_10067002 | 3300025925 | Unclassified | 2693 |
| 675 | Ga0207650_10204184 | 3300025925 | Bacteria | 1584 |
| 676 | Ga0207650_10537474 | 3300025925 | Bacteria | 979 |
| 677 | Ga0207650_10736012 | 3300025925 | Bacteria | 834 |
| 678 | Ga0207659_10000105 | 3300025926 | Bacteria | 50176 |
| 679 | Ga0207659_10024654 | 3300025926 | Bacteria | 4034 |
| 680 | Ga0207659_10273626 | 3300025926 | Unclassified | 1378 |
| 681 | Ga0207659_10336558 | 3300025926 | Unclassified | 1249 |
| 682 | Ga0207659_10407395 | 3300025926 | Bacteria | 1138 |
| 683 | Ga0207659_10629882 | 3300025926 | Unclassified | 916 |
| 684 | Ga0207659_10792633 | 3300025926 | Bacteria | 814 |
| 685 | Ga0207687_10003518 | 3300025927 | Bacteria | 10536 |
| 686 | Ga0207687_10003843 | 3300025927 | Bacteria | 10085 |
| 687 | Ga0207687_10079795 | 3300025927 | Bacteria | 2360 |
| 688 | Ga0207687_10129887 | 3300025927 | Bacteria | 1897 |
| 689 | Ga0207644_10034620 | 3300025931 | Bacteria | 3535 |
| 690 | Ga0207644_10050756 | 3300025931 | Bacteria | 2974 |
| 691 | Ga0207644_10412280 | 3300025931 | Unclassified | 1106 |
| 692 | Ga0207644_10454512 | 3300025931 | Unclassified | 1052 |
| 693 | Ga0207690_10168330 | 3300025932 | Bacteria | 1639 |
| 694 | Ga0207706_10004735 | 3300025933 | Bacteria | 12740 |
| 695 | Ga0207706_10031615 | 3300025933 | Bacteria | 4715 |
| 696 | Ga0207706_10940725 | 3300025933 | Bacteria | 728 |
| 697 | Ga0207686_10008754 | 3300025934 | Bacteria | 5467 |
| 698 | Ga0207686_10027723 | 3300025934 | Bacteria | 3320 |
| 699 | Ga0207686_10036186 | 3300025934 | Unclassified | 2970 |
| 700 | Ga0207686_10133254 | 3300025934 | Bacteria | 1707 |
| 701 | Ga0207686_10194765 | 3300025934 | Bacteria | 1447 |
| 702 | Ga0207686_10480517 | 3300025934 | Bacteria | 961 |
| 703 | Ga0207686_10973272 | 3300025934 | Unclassified | 688 |
| 704 | Ga0207686_11162172 | 3300025934 | Unclassified | 631 |
| 705 | Ga0207709_10001549 | 3300025935 | Bacteria | 15798 |
| 706 | Ga0207709_10032156 | 3300025935 | Unclassified | 3070 |
| 707 | Ga0207709_10055347 | 3300025935 | Bacteria | 2450 |
| 708 | Ga0207709_10351390 | 3300025935 | Unclassified | 1113 |
| 709 | Ga0207670_10005628 | 3300025936 | Bacteria | 6891 |
| 710 | Ga0207670_10008307 | 3300025936 | Bacteria | 5851 |
| 711 | Ga0207670_10131820 | 3300025936 | Bacteria | 1832 |
| 712 | Ga0207670_10197782 | 3300025936 | Bacteria | 1525 |
| 713 | Ga0207670_10443913 | 3300025936 | Bacteria | 1045 |
| 714 | Ga0207670_11018791 | 3300025936 | Unclassified | 697 |
| 715 | Ga0207669_10069686 | 3300025937 | Bacteria | 2201 |
| 716 | Ga0207669_10417463 | 3300025937 | Unclassified | 1055 |
| 717 | Ga0207669_10420585 | 3300025937 | Unclassified | 1052 |
| 718 | Ga0207669_10439617 | 3300025937 | Bacteria | 1031 |
| 719 | Ga0207704_10096844 | 3300025938 | Bacteria | 1955 |
| 720 | Ga0207704_10200572 | 3300025938 | Bacteria | 1460 |
| 721 | Ga0207704_10263593 | 3300025938 | Unclassified | 1300 |
| 722 | Ga0207704_10320770 | 3300025938 | Bacteria | 1195 |
| 723 | Ga0207704_10351884 | 3300025938 | Unclassified | 1147 |
| 724 | Ga0207691_10018369 | 3300025940 | Bacteria | 6625 |
| 725 | Ga0207691_10092753 | 3300025940 | Bacteria | 2704 |
| 726 | Ga0207691_10093984 | 3300025940 | Bacteria | 2683 |
| 727 | Ga0207691_10114985 | 3300025940 | Bacteria | 2390 |
| 728 | Ga0207691_10178784 | 3300025940 | Bacteria | 1854 |
| 729 | Ga0207691_10180676 | 3300025940 | Bacteria | 1844 |
| 730 | Ga0207691_10213787 | 3300025940 | Bacteria | 1674 |
| 731 | Ga0207711_10008109 | 3300025941 | Bacteria | 8792 |
| 732 | Ga0207711_10045439 | 3300025941 | Bacteria | 3753 |
| 733 | Ga0207711_10100108 | 3300025941 | Bacteria | 2563 |
| 734 | Ga0207711_10118360 | 3300025941 | Bacteria | 2363 |
| 735 | Ga0207711_10124681 | 3300025941 | Bacteria | 2303 |
| 736 | Ga0207711_10149472 | 3300025941 | Bacteria | 2107 |
| 737 | Ga0207711_10155115 | 3300025941 | Bacteria | 2069 |
| 738 | Ga0207711_10165616 | 3300025941 | Unclassified | 2003 |
| 739 | Ga0207711_10249144 | 3300025941 | Bacteria | 1631 |
| 740 | Ga0207711_10275598 | 3300025941 | Bacteria | 1548 |
| 741 | Ga0207711_10316394 | 3300025941 | Bacteria | 1442 |
| 742 | Ga0207711_10520701 | 3300025941 | Unclassified | 1109 |
| 743 | Ga0207689_10006162 | 3300025942 | Bacteria | 10610 |
| 744 | Ga0207689_10028459 | 3300025942 | Bacteria | 4676 |
| 745 | Ga0207689_10052460 | 3300025942 | Bacteria | 3360 |
| 746 | Ga0207689_10102687 | 3300025942 | Unclassified | 2349 |
| 747 | Ga0207689_10113792 | 3300025942 | Unclassified | 2224 |
| 748 | Ga0207689_10123447 | 3300025942 | Bacteria | 2130 |
| 749 | Ga0207689_10130486 | 3300025942 | Bacteria | 2068 |
| 750 | Ga0207689_10161911 | 3300025942 | Bacteria | 1844 |
| 751 | Ga0207689_10227314 | 3300025942 | Bacteria | 1542 |
| 752 | Ga0207689_10284758 | 3300025942 | Bacteria | 1369 |
| 753 | Ga0207689_10350789 | 3300025942 | Bacteria | 1227 |
| 754 | Ga0207661_10000440 | 3300025944 | Bacteria | 26788 |
| 755 | Ga0207661_10256458 | 3300025944 | Unclassified | 1556 |
| 756 | Ga0207661_10291435 | 3300025944 | Bacteria | 1461 |
| 757 | Ga0207679_10003442 | 3300025945 | Bacteria | 9766 |
| 758 | Ga0207679_10276353 | 3300025945 | Bacteria | 1439 |
| 759 | Ga0207679_10620460 | 3300025945 | Unclassified | 976 |
| 760 | Ga0207667_10003148 | 3300025949 | Bacteria | 20418 |
| 761 | Ga0207667_10163885 | 3300025949 | Bacteria | 2286 |
| 762 | Ga0207651_10002639 | 3300025960 | Bacteria | 8570 |
| 763 | Ga0207651_10041856 | 3300025960 | Bacteria | 3044 |
| 764 | Ga0207651_10082790 | 3300025960 | Bacteria | 2318 |
| 765 | Ga0207651_10111037 | 3300025960 | Bacteria | 2058 |
| 766 | Ga0207651_10174935 | 3300025960 | Bacteria | 1697 |
| 767 | Ga0207651_10747914 | 3300025960 | Bacteria | 864 |
| 768 | Ga0207651_10875513 | 3300025960 | Unclassified | 799 |
| 769 | Ga0207651_11067159 | 3300025960 | Bacteria | 723 |
| 770 | Ga0207712_10017205 | 3300025961 | Bacteria | 4692 |
| 771 | Ga0207712_10061861 | 3300025961 | Bacteria | 2659 |
| 772 | Ga0207712_10194884 | 3300025961 | Bacteria | 1602 |
| 773 | Ga0207712_10196972 | 3300025961 | Bacteria | 1594 |
| 774 | Ga0207712_10699297 | 3300025961 | Bacteria | 885 |
| 775 | Ga0207668_10503927 | 3300025972 | Bacteria | 1042 |
| 776 | Ga0207668_10906152 | 3300025972 | Unclassified | 785 |
| 777 | Ga0207640_10070375 | 3300025981 | Archaea | 2353 |
| 778 | Ga0207640_10271757 | 3300025981 | Unclassified | 1326 |
| 779 | Ga0207640_11320049 | 3300025981 | Unclassified | 644 |
| 780 | Ga0207658_10046204 | 3300025986 | Bacteria | 3178 |
| 781 | Ga0207658_10074635 | 3300025986 | Unclassified | 2577 |
| 782 | Ga0207658_10089572 | 3300025986 | Bacteria | 2382 |
| 783 | Ga0207658_10382217 | 3300025986 | Bacteria | 1233 |
| 784 | Ga0207658_10517252 | 3300025986 | Unclassified | 1065 |
| 785 | Ga0207658_10545971 | 3300025986 | Bacteria | 1037 |
| 786 | Ga0207658_11165745 | 3300025986 | Bacteria | 704 |
| 787 | Ga0207677_10032256 | 3300026023 | Bacteria | 3365 |
| 788 | Ga0207677_10101523 | 3300026023 | Bacteria | 2118 |
| 789 | Ga0207677_10107740 | 3300026023 | Bacteria | 2067 |
| 790 | Ga0207677_10186482 | 3300026023 | Unclassified | 1637 |
| 791 | Ga0207677_10201096 | 3300026023 | Bacteria | 1584 |
| 792 | Ga0207703_10008840 | 3300026035 | Bacteria | 7942 |
| 793 | Ga0207703_10009347 | 3300026035 | Bacteria | 7704 |
| 794 | Ga0207703_10028701 | 3300026035 | Bacteria | 4389 |
| 795 | Ga0207703_10045830 | 3300026035 | Bacteria | 3518 |
| 796 | Ga0207703_10076337 | 3300026035 | Bacteria | 2779 |
| 797 | Ga0207703_10171073 | 3300026035 | Bacteria | 1911 |
| 798 | Ga0207703_10212594 | 3300026035 | Unclassified | 1725 |
| 799 | Ga0207639_10036023 | 3300026041 | Unclassified | 3664 |
| 800 | Ga0207639_10058508 | 3300026041 | Bacteria | 2965 |
| 801 | Ga0207639_10093330 | 3300026041 | Unclassified | 2413 |
| 802 | Ga0207639_10153410 | 3300026041 | Bacteria | 1932 |
| 803 | Ga0207639_10372324 | 3300026041 | Unclassified | 1281 |
| 804 | Ga0207639_10608920 | 3300026041 | Bacteria | 1008 |
| 805 | Ga0207678_10684803 | 3300026067 | Unclassified | 902 |
| 806 | Ga0207678_10950159 | 3300026067 | Unclassified | 760 |
| 807 | Ga0207708_10013738 | 3300026075 | Bacteria | 6051 |
| 808 | Ga0207708_10031656 | 3300026075 | Bacteria | 4016 |
| 809 | Ga0207708_10074218 | 3300026075 | Bacteria | 2607 |
| 810 | Ga0207708_10078656 | 3300026075 | Bacteria | 2533 |
| 811 | Ga0207708_10129157 | 3300026075 | Bacteria | 1975 |
| 812 | Ga0207708_10633618 | 3300026075 | Bacteria | 909 |
| 813 | Ga0207702_10007504 | 3300026078 | Bacteria | 9297 |
| 814 | Ga0207702_10182119 | 3300026078 | Bacteria | 1935 |
| 815 | Ga0207702_10190438 | 3300026078 | Unclassified | 1895 |
| 816 | Ga0207702_10214051 | 3300026078 | Bacteria | 1793 |
| 817 | Ga0207702_10811037 | 3300026078 | Unclassified | 925 |
| 818 | Ga0207641_10017321 | 3300026088 | Bacteria | 5897 |
| 819 | Ga0207641_10162254 | 3300026088 | Bacteria | 2033 |
| 820 | Ga0207641_10342890 | 3300026088 | Bacteria | 1422 |
| 821 | Ga0207641_10345991 | 3300026088 | Bacteria | 1416 |
| 822 | Ga0207641_10500081 | 3300026088 | Unclassified | 1180 |
| 823 | Ga0207641_10523834 | 3300026088 | Unclassified | 1153 |
| 824 | Ga0207641_10593807 | 3300026088 | Bacteria | 1083 |
| 825 | Ga0207648_10002414 | 3300026089 | Bacteria | 20118 |
| 826 | Ga0207648_10052045 | 3300026089 | Bacteria | 3580 |
| 827 | Ga0207648_10069740 | 3300026089 | Bacteria | 3063 |
| 828 | Ga0207648_10112445 | 3300026089 | Bacteria | 2391 |
| 829 | Ga0207648_10124833 | 3300026089 | Bacteria | 2264 |
| 830 | Ga0207648_10231822 | 3300026089 | Bacteria | 1642 |
| 831 | Ga0207648_10595273 | 3300026089 | Unclassified | 1019 |
| 832 | Ga0207648_11092935 | 3300026089 | Bacteria | 748 |
| 833 | Ga0207676_10014803 | 3300026095 | Bacteria | 5618 |
| 834 | Ga0207676_10063294 | 3300026095 | Bacteria | 2938 |
| 835 | Ga0207676_10073867 | 3300026095 | Bacteria | 2745 |
| 836 | Ga0207676_10106727 | 3300026095 | Bacteria | 2334 |
| 837 | Ga0207676_10127202 | 3300026095 | Bacteria | 2160 |
| 838 | Ga0207676_10136823 | 3300026095 | Bacteria | 2091 |
| 839 | Ga0207676_10279074 | 3300026095 | Bacteria | 1516 |
| 840 | Ga0207676_10288616 | 3300026095 | Bacteria | 1493 |
| 841 | Ga0207676_10293377 | 3300026095 | Unclassified | 1482 |
| 842 | Ga0207676_10507336 | 3300026095 | Bacteria | 1146 |
| 843 | Ga0207676_10956103 | 3300026095 | Unclassified | 842 |
| 844 | Ga0207674_10001214 | 3300026116 | Bacteria | 33550 |
| 845 | Ga0207674_10002954 | 3300026116 | Bacteria | 21110 |
| 846 | Ga0207674_10037435 | 3300026116 | Bacteria | 5046 |
| 847 | Ga0207674_10041715 | 3300026116 | Bacteria | 4744 |
| 848 | Ga0207674_10045562 | 3300026116 | Bacteria | 4510 |
| 849 | Ga0207674_10130834 | 3300026116 | Unclassified | 2473 |
| 850 | Ga0207674_10302372 | 3300026116 | Bacteria | 1549 |
| 851 | Ga0207674_10343952 | 3300026116 | Bacteria | 1442 |
| 852 | Ga0207674_10392169 | 3300026116 | Unclassified | 1342 |
| 853 | Ga0207675_100008002 | 3300026118 | Bacteria | 9961 |
| 854 | Ga0207675_100011835 | 3300026118 | Bacteria | 8156 |
| 855 | Ga0207675_100041840 | 3300026118 | Bacteria | 4278 |
| 856 | Ga0207675_100100074 | 3300026118 | Bacteria | 2731 |
| 857 | Ga0207675_100130326 | 3300026118 | Bacteria | 2384 |
| 858 | Ga0207675_100168452 | 3300026118 | Unclassified | 2093 |
| 859 | Ga0207675_100237964 | 3300026118 | Bacteria | 1758 |
| 860 | Ga0207675_100355090 | 3300026118 | Unclassified | 1437 |
| 861 | Ga0207675_100419591 | 3300026118 | Bacteria | 1321 |
| 862 | Ga0207675_100510765 | 3300026118 | Unclassified | 1197 |
| 863 | Ga0207675_100741039 | 3300026118 | Bacteria | 993 |
| 864 | Ga0207683_10007588 | 3300026121 | Bacteria | 9293 |
| 865 | Ga0207683_10015647 | 3300026121 | Bacteria | 6457 |
| 866 | Ga0207683_10019890 | 3300026121 | Bacteria | 5736 |
| 867 | Ga0207683_10029512 | 3300026121 | Bacteria | 4749 |
| 868 | Ga0207683_10042168 | 3300026121 | Bacteria | 3985 |
| 869 | Ga0207683_10110848 | 3300026121 | Bacteria | 2457 |
| 870 | Ga0207683_10436090 | 3300026121 | Bacteria | 1207 |
| 871 | Ga0207683_11012894 | 3300026121 | Bacteria | 771 |
| 872 | Ga0207698_10078502 | 3300026142 | Bacteria | 2651 |
| 873 | Ga0207698_10195044 | 3300026142 | Bacteria | 1808 |
| 874 | Ga0209996_1009649 | 3300027395 | Unclassified | 1274 |
| 875 | Ga0209179_1003916 | 3300027512 | Bacteria | 2199 |
| 876 | Ga0209974_10041910 | 3300027876 | Bacteria | 1524 |
| 877 | Ga0207428_10002147 | 3300027907 | Bacteria | 19816 |
| 878 | Ga0207428_10006528 | 3300027907 | Bacteria | 10759 |
| 879 | Ga0207428_10018399 | 3300027907 | Bacteria | 5970 |
| 880 | Ga0207428_10178002 | 3300027907 | Bacteria | 1608 |
| 881 | Ga0207428_10226658 | 3300027907 | Bacteria | 1399 |
| 882 | Ga0207428_10621396 | 3300027907 | Unclassified | 777 |
| 883 | Ga0268266_10018050 | 3300028379 | Bacteria | 6013 |
| 884 | Ga0268266_10049466 | 3300028379 | Unclassified | 3605 |
| 885 | Ga0268266_10118119 | 3300028379 | Bacteria | 2357 |
| 886 | Ga0268266_10121578 | 3300028379 | Bacteria | 2324 |
| 887 | Ga0268265_10002294 | 3300028380 | Bacteria | 14564 |
| 888 | Ga0268265_10013612 | 3300028380 | Bacteria | 5531 |
| 889 | Ga0268265_10362758 | 3300028380 | Bacteria | 1327 |
| 890 | Ga0268265_10373655 | 3300028380 | Bacteria | 1309 |
| 891 | Ga0268265_10506205 | 3300028380 | Unclassified | 1139 |
| 892 | Ga0268265_10894232 | 3300028380 | Bacteria | 872 |
| 893 | Ga0268264_10004132 | 3300028381 | Bacteria | 12418 |
| 894 | Ga0268264_10004498 | 3300028381 | Bacteria | 11891 |
| 895 | Ga0268264_10042979 | 3300028381 | Bacteria | 3743 |
| 896 | Ga0268264_10095187 | 3300028381 | Bacteria | 2576 |
| 897 | Ga0268264_10119876 | 3300028381 | Bacteria | 2317 |
| 898 | Ga0268264_10294959 | 3300028381 | Bacteria | 1524 |
| 899 | Ga0268264_10300397 | 3300028381 | Unclassified | 1511 |
| 900 | Ga0268264_10450644 | 3300028381 | Bacteria | 1246 |
| 901 | Ga0268264_11278363 | 3300028381 | Unclassified | 744 |
| 902 | Ga0265337_1001333 | 3300028556 | Bacteria | 12242 |
| 903 | Ga0265319_1053056 | 3300028563 | Unclassified | 1333 |
| 904 | Ga0265334_10003224 | 3300028573 | Bacteria | 7447 |
| 905 | Ga0265318_10008720 | 3300028577 | Unclassified | 4493 |
| 906 | Ga0265338_10344360 | 3300028800 | Unclassified | 1073 |
| 907 | Ga0265766_1013085 | 3300030863 | Bacteria | 619 |
| 908 | Ga0265770_1073202 | 3300030878 | Unclassified | 658 |
| 909 | Ga0265779_101300 | 3300031043 | Bacteria | 1090 |
| 910 | Ga0265330_10039117 | 3300031235 | Bacteria | 2108 |
| 911 | Ga0265328_10023384 | 3300031239 | Bacteria | 2346 |
| 912 | Ga0265320_10045118 | 3300031240 | Bacteria | 2167 |
| 913 | Ga0265325_10011366 | 3300031241 | Bacteria | 5116 |
| 914 | Ga0265329_10025089 | 3300031242 | Bacteria | 1975 |
| 915 | Ga0265331_10000991 | 3300031250 | Bacteria | 22304 |
| 916 | Ga0265331_10106578 | 3300031250 | Bacteria | 1287 |
| 917 | Ga0265316_10010483 | 3300031344 | Bacteria | 8440 |
| 918 | Ga0265313_10006487 | 3300031595 | Bacteria | 8268 |
| 919 | Ga0265313_10040068 | 3300031595 | Bacteria | 2319 |
| 920 | Ga0265314_10000277 | 3300031711 | Bacteria | 74718 |
| 921 | Ga0265314_10002727 | 3300031711 | Bacteria | 17658 |
| 922 | Ga0265314_10051768 | 3300031711 | Bacteria | 2859 |
| 923 | Ga0265314_10123611 | 3300031711 | Bacteria | 1625 |
| 924 | Ga0307416_100645561 | 3300032002 | Bacteria | 1143 |
| 925 | Ga0373938_0026288 | 3300034957 | Unclassified | 1217 |
| 926 | Ga0373934_0282294 | 3300035086 | Bacteria | 688 |
| 927 | Ga0373949_0114447 | 3300035090 | Unclassified | 752 |
| 928 | Ga0373949_0195878 | 3300035090 | Bacteria | 605 |
| 929 | Ga0373951_0044619 | 3300035091 | Unclassified | 1077 |
| 930 | Ga0373936_0339512 | 3300035113 | Unclassified | 683 |
| 931 | Ga0373939_0023471 | 3300035114 | Bacteria | 1709 |
| 932 | Ga0373945_0037397 | 3300035116 | Bacteria | 1742 |
| 933 | Ga0373953_0229957 | 3300035117 | Unclassified | 804 |
| 934 | Ga0373954_0205448 | 3300035118 | Bacteria | 968 |
| 935 | Ga0373943_0001872 | 3300035170 | Bacteria | 9516 |
| 936 | Ga0373946_0144012 | 3300035171 | Bacteria | 1107 |
| 937 | Ga0373946_0182868 | 3300035171 | Bacteria | 996 |
| 938 | Ga0373946_0266263 | 3300035171 | Unclassified | 840 |
| 939 | Ga0373942_0007237 | 3300035207 | Bacteria | 2572 |
| 940 | Ga0373942_0027018 | 3300035207 | Bacteria | 1490 |
| 941 | Ga0373961_0014069 | 3300035241 | Bacteria | 2028 |
| 942 | Ga0373962_0009519 | 3300035242 | Bacteria | 2410 |
| 943 | Ga0373962_0087497 | 3300035242 | Bacteria | 955 |
| 944 | Ga0373924_0096458 | 3300035410 | Bacteria | 1269 |
| 945 | Ga0373931_0014369 | 3300035691 | Bacteria | 3867 |
| 946 | Ga0373931_0051309 | 3300035691 | Bacteria | 2197 |
| 947 | Ga0373931_0165144 | 3300035691 | Bacteria | 1300 |
| 948 | Ga0373931_0253117 | 3300035691 | Bacteria | 1072 |
| 949 | Ga0373935_0043797 | 3300035692 | Bacteria | 2818 |
| 950 | Ga0373927_0166580 | 3300035695 | Bacteria | 1444 |
| 951 | Ga0373927_0366441 | 3300035695 | Bacteria | 950 |
| 952 | Ga0373933_0123202 | 3300035724 | Bacteria | 1625 |
| 953 | Ga0373933_0605088 | 3300035724 | Unclassified | 720 |
| 954 | Ga0373947_0002238 | 3300035725 | Bacteria | 11697 |
| 955 | Ga0373947_0080496 | 3300035725 | Bacteria | 2015 |
| 956 | Ga0373937_0070565 | 3300036401 | Unclassified | 3223 |
| 957 | Ga0373937_0094591 | 3300036401 | Bacteria | 2771 |
| 958 | Ga0373937_0100932 | 3300036401 | Bacteria | 2678 |
| 959 | Ga0373937_0112639 | 3300036401 | Bacteria | 2531 |
| 960 | Ga0373925_0046983 | 3300037068 | Bacteria | 3212 |
| 961 | Ga0373925_0721254 | 3300037068 | Bacteria | 822 |
| 962 | Ga0436364_0421318 | 3300037853 | Unclassified | 681 |
| 963 | Ga0436364_1037684 | 3300037853 | Bacteria | 1015 |
| 964 | Ga0436365_1618975 | 3300039437 | Bacteria | 2493 |
| 965 | Ga0436363_0177020 | 3300039450 | Bacteria | 1537 |
| 966 | Ga0436363_1275821 | 3300039450 | Unclassified | 1248 |
| 967 | Ga0451853_2100878 | 3300041512 | Bacteria | 1128 |
| 968 | Ga0439434_0144096 | 3300042435 | Unclassified | 786 |
| 969 | Ga0439444_0014056 | 3300042437 | Bacteria | 1333 |
| 970 | Ga0453683_0223505 | 3300044673 | Bacteria | 1198 |
| 971 | Ga0466963_0182391 | 3300044694 | Bacteria | 1466 |
| 972 | Ga0451576_0040309 | 3300045051 | Bacteria | 4944 |
| 973 | Ga0466967_0329392 | 3300045976 | Unclassified | 1474 |
| 974 | Ga0495603_0152915 | 3300046455 | Unclassified | 1340 |
| 975 | Ga0495629_0514811 | 3300046459 | Viruses | 806 |
| 976 | Ga0495650_0167094 | 3300046471 | Bacteria | 781 |
| 977 | Ga0495582_0215025 | 3300046473 | Unclassified | 1099 |
| 978 | Ga0495582_0280401 | 3300046473 | Bacteria | 957 |
| 979 | Ga0495582_0295699 | 3300046473 | Unclassified | 931 |
| 980 | Ga0495639_0081638 | 3300046475 | Unclassified | 1507 |
| 981 | Ga0495584_0120907 | 3300046491 | Bacteria | 1326 |
| 982 | Ga0495585_0133167 | 3300046492 | Bacteria | 1307 |
| 983 | Ga0495594_0075565 | 3300046499 | Bacteria | 1878 |
| 984 | Ga0495594_0318204 | 3300046499 | Unclassified | 886 |
| 985 | Ga0495596_0241848 | 3300046500 | Bacteria | 701 |
| 986 | Ga0495628_0555715 | 3300046516 | Bacteria | 824 |
| 987 | Ga0495630_0496490 | 3300046517 | Bacteria | 936 |
| 988 | Ga0495630_0918046 | 3300046517 | Unclassified | 667 |
| 989 | Ga0495631_0274007 | 3300046518 | Unclassified | 719 |
| 990 | Ga0495644_0110161 | 3300046523 | Bacteria | 1044 |
| 991 | Ga0495642_0085588 | 3300046528 | Unclassified | 1331 |
| 992 | Ga0495642_0241067 | 3300046528 | Unclassified | 790 |
| 993 | Ga0495665_0055515 | 3300046531 | Bacteria | 2091 |
| 994 | Ga0495665_0220081 | 3300046531 | Bacteria | 981 |
| 995 | Ga0495640_0519088 | 3300046533 | Unclassified | 724 |
| 996 | Ga0495586_0039826 | 3300046535 | Bacteria | 2527 |
| 997 | Ga0495586_0171064 | 3300046535 | Bacteria | 1228 |
| 998 | Ga0495586_0291118 | 3300046535 | Bacteria | 935 |
| 999 | Ga0495587_0483187 | 3300046536 | Bacteria | 685 |
| 1000 | Ga0495587_0592830 | 3300046536 | Unclassified | 610 |
| 1001 | Ga0495609_0061694 | 3300046538 | Unclassified | 1656 |
| 1002 | Ga0495621_0047402 | 3300046539 | Bacteria | 1528 |
| 1003 | Ga0495621_0078573 | 3300046539 | Bacteria | 1227 |
| 1004 | Ga0495667_0401021 | 3300046559 | Bacteria | 864 |
| 1005 | Ga0495634_0543770 | 3300046642 | Unclassified | 678 |
| 1006 | Ga0495611_0052573 | 3300046648 | Unclassified | 1838 |
| 1007 | Ga0495659_0026141 | 3300046664 | Bacteria | 2003 |
| 1008 | Ga0495659_0082970 | 3300046664 | Unclassified | 1220 |
| 1009 | Ga0495659_0270302 | 3300046664 | Unclassified | 712 |
| 1010 | Ga0495657_0208135 | 3300046675 | Bacteria | 1190 |
| 1011 | Ga0495623_0207302 | 3300046679 | Unclassified | 1124 |
| 1012 | Ga0495658_0045681 | 3300046683 | Bacteria | 2459 |
| 1013 | Ga0495658_0282263 | 3300046683 | Unclassified | 1048 |
| 1014 | Ga0495624_0506264 | 3300046690 | Bacteria | 722 |
| 1015 | Ga0495670_0152473 | 3300046691 | Unclassified | 1212 |
| 1016 | Ga0495671_0278895 | 3300046692 | Bacteria | 805 |
| 1017 | Ga0495660_0409995 | 3300046810 | Bacteria | 592 |
| 1018 | Ga0495604_0108998 | 3300047317 | Bacteria | 2022 |
| 1019 | Ga0495636_0017175 | 3300047318 | Bacteria | 2895 |
| 1020 | Ga0495676_0481556 | 3300047321 | Bacteria | 816 |
| 1021 | Ga0495675_0237439 | 3300047444 | Unclassified | 1098 |
| 1022 | Ga0495677_0110752 | 3300047445 | Unclassified | 1044 |
| 1023 | Ga0495614_0385747 | 3300048089 | Unclassified | 657 |
| 1024 | Ga0495614_0435779 | 3300048089 | Unclassified | 619 |
| 1025 | Ga0495615_0151397 | 3300048090 | Unclassified | 691 |
| 1026 | Ga0496100_0302110 | 3300048903 | Bacteria | 1198 |
| 1027 | Ga0496101_0093742 | 3300048904 | Bacteria | 2237 |
| 1028 | Ga0496102_0144900 | 3300048905 | Unclassified | 2229 |
| 1029 | Ga0496104_0134125 | 3300048907 | Bacteria | 2379 |
| 1030 | Ga0496105_0354963 | 3300048908 | Bacteria | 1170 |
| 1031 | Ga0496108_0386900 | 3300048911 | Bacteria | 1221 |
| 1032 | Ga0496108_0476558 | 3300048911 | Bacteria | 1090 |
| 1033 | Ga0496108_0860903 | 3300048911 | Unclassified | 780 |
| 1034 | Ga0496109_0133336 | 3300048912 | Bacteria | 2320 |
| 1035 | Ga0496109_0468415 | 3300048912 | Bacteria | 1190 |
| 1036 | Ga0496110_0109838 | 3300048913 | Bacteria | 2477 |
| 1037 | Ga0496110_0525656 | 3300048913 | Unclassified | 1076 |
| 1038 | Ga0496112_0008426 | 3300048915 | Bacteria | 9233 |
| 1039 | Ga0496112_0329134 | 3300048915 | Bacteria | 1472 |
| 1040 | Ga0496113_0135923 | 3300048916 | Bacteria | 1932 |
| 1041 | Ga0496113_0993691 | 3300048916 | Unclassified | 661 |
| 1042 | Ga0496115_0085330 | 3300048918 | Bacteria | 2575 |
| 1043 | Ga0496115_0768556 | 3300048918 | Bacteria | 752 |
| 1044 | Ga0501031_0122088 | 3300049568 | Unclassified | 1702 |
| 1045 | Ga0501031_0183972 | 3300049568 | Bacteria | 1365 |
| 1046 | Ga0501036_0030543 | 3300049572 | Bacteria | 4550 |
| 1047 | Ga0501036_0586479 | 3300049572 | Unclassified | 925 |
| 1048 | Ga0501039_0211147 | 3300049575 | Unclassified | 1526 |
| 1049 | Ga0501039_0400824 | 3300049575 | Bacteria | 1077 |
| 1050 | Ga0501041_0028086 | 3300049577 | Unclassified | 3393 |
| 1051 | Ga0501042_0173619 | 3300049578 | Bacteria | 1555 |
| 1052 | Ga0501043_0103194 | 3300049579 | Bacteria | 2241 |
| 1053 | Ga0501046_0370554 | 3300049580 | Bacteria | 1038 |
| 1054 | Ga0501048_0041623 | 3300049582 | Bacteria | 3290 |
| 1055 | Ga0501068_0194132 | 3300049584 | Unclassified | 1287 |
| 1056 | Ga0501069_0153810 | 3300049585 | Unclassified | 1323 |
| 1057 | Ga0501070_0825314 | 3300049586 | Unclassified | 727 |
| 1058 | Ga0501072_0060653 | 3300049588 | Bacteria | 2982 |
| 1059 | Ga0501074_0383248 | 3300049590 | Unclassified | 997 |
| 1060 | Ga0501075_0038936 | 3300049591 | Bacteria | 3556 |
| 1061 | Ga0501075_0289405 | 3300049591 | Unclassified | 1248 |
| 1062 | Ga0501076_0014997 | 3300049592 | Bacteria | 5851 |
| 1063 | Ga0501259_116618 | 3300049688 | Unclassified | 630 |
| 1064 | Ga0501079_0056877 | 3300049741 | Bacteria | 3018 |
| 1065 | Ga0501079_0097824 | 3300049741 | Bacteria | 2275 |
| 1066 | Ga0501080_0457271 | 3300049742 | Bacteria | 1144 |
| 1067 | Ga0501081_0711439 | 3300049743 | Bacteria | 754 |
| 1068 | Ga0501045_0369061 | 3300049824 | Bacteria | 1068 |
| 1069 | nmdc:mga0yw44_567387_c1 | 3300050492 | Bacteria | 771 |
| 1070 | nmdc:mga05p37_165436_c1 | 3300050507 | Bacteria | 2700 |
| 1071 | nmdc:mga05p37_29994_c1 | 3300050507 | Bacteria | 6636 |
| 1072 | nmdc:mga05p37_39948_c1 | 3300050507 | Bacteria | 5761 |
| 1073 | nmdc:mga05p37_507054_c1 | 3300050507 | Bacteria | 1383 |
| 1074 | nmdc:mga09592_129105_c1 | 3300050508 | Bacteria | 2174 |
| 1075 | nmdc:mga09592_53072_c1 | 3300050508 | Bacteria | 3422 |
| 1076 | nmdc:mga09592_81991_c1 | 3300050508 | Bacteria | 2749 |
| 1077 | nmdc:mga0qj67_542322_c1 | 3300050509 | Bacteria | 933 |
| 1078 | nmdc:mga0qj67_71952_c1 | 3300050509 | Bacteria | 2760 |
| 1079 | nmdc:mga08y16_1035244_c1 | 3300050511 | Unclassified | 799 |
| 1080 | nmdc:mga08y16_10962_c1 | 3300050511 | Bacteria | 9521 |
| 1081 | nmdc:mga08y16_239971_c1 | 3300050511 | Bacteria | 1874 |
| 1082 | nmdc:mga08y16_28255_c1 | 3300050511 | Bacteria | 5912 |
| 1083 | nmdc:mga08y16_383054_c1 | 3300050511 | Bacteria | 1441 |
| 1084 | nmdc:mga08y16_52878_c1 | 3300050511 | Bacteria | 4248 |
| 1085 | nmdc:mga08y16_533285_c1 | 3300050511 | Bacteria | 1189 |
| 1086 | nmdc:mga0n895_1568_c1 | 3300050512 | Bacteria | 17188 |
| 1087 | nmdc:mga0n895_164140_c1 | 3300050512 | Bacteria | 2253 |
| 1088 | nmdc:mga0n895_18550_c1 | 3300050512 | Bacteria | 6441 |
| 1089 | nmdc:mga0n895_336428_c1 | 3300050512 | Bacteria | 1529 |
| 1090 | nmdc:mga0n895_408317_c1 | 3300050512 | Bacteria | 1373 |
| 1091 | nmdc:mga0n895_494403_c1 | 3300050512 | Bacteria | 1233 |
| 1092 | nmdc:mga0rr50_186517_c1 | 3300050513 | Unclassified | 1698 |
| 1093 | nmdc:mga0rr50_581520_c1 | 3300050513 | Unclassified | 954 |
| 1094 | nmdc:mga0rr50_599744_c1 | 3300050513 | Bacteria | 939 |
| 1095 | nmdc:mga08x19_74519_c1 | 3300050514 | Bacteria | 2218 |
| 1096 | nmdc:mga0a205_16064_c1 | 3300050515 | Bacteria | 7007 |
| 1097 | nmdc:mga0a205_31076_c1 | 3300050515 | Bacteria | 5115 |
| 1098 | nmdc:mga0a205_33077_c1 | 3300050515 | Bacteria | 4959 |
| 1099 | nmdc:mga0a205_901929_c1 | 3300050515 | Bacteria | 731 |
| 1100 | Ga0495595_0082051 | 3300053084 | Bacteria | 1537 |
| 1101 | Ga0500642_0321498 | 3300053130 | Bacteria | 694 |
| 1102 | Ga0500559_0180776 | 3300053136 | Unclassified | 994 |
| 1103 | Ga0501084_0116330 | 3300054114 | Bacteria | 2248 |
| 1104 | Ga0501082_0015291 | 3300060353 | Bacteria | 6607 |
| 1105 | Ga0530510_0010125 | 3300061734 | Bacteria | 6610 |
| 1106 | Ga0207682_10042443 | |||
| 1107 | SwRhRL2b_contig_3032446 | |||
| 1108 | ARcpr5oldR_c010840 | |||
| 1109 | JGI24746J21847_1001423 | |||
| 1110 | JGI24751J29686_10005177 | |||
| 1111 | JGI24751J29686_10033568 | |||
| 1112 | Ga0006778J45830_1027403 | |||
| 1113 | JGI25165J46597_1000003 | |||
| 1114 | Ga0007410J51695_1020453 | |||
| 1115 | Ga0058859_11478325 | |||
| 1116 | Ga0058863_11154503 | |||
| 1117 | Ga0058861_11345411 | |||
| 1118 | Ga0058861_11619973 | |||
| 1119 | Ga0058861_11964324 | |||
| 1120 | Ga0058860_12099259 | |||
| 1121 | Ga0058860_12204101 | |||
| 1122 | Ga0058862_11744529 | |||
| 1123 | Ga0058862_12769194 | |||
| 1124 | Ga0065714_10120588 | |||
| 1125 | Ga0065704_10004042 | |||
| 1126 | Ga0065704_10005168 | |||
| 1127 | Ga0065712_10074022 | |||
| 1128 | Ga0065712_10128508 | |||
| 1129 | Ga0065712_10136592 | |||
| 1130 | Ga0065712_10149591 | |||
| 1131 | Ga0065715_10010752 | |||
| 1132 | Ga0065715_10023454 | |||
| 1133 | Ga0065715_10024118 | |||
| 1134 | Ga0065715_10163698 | |||
| 1135 | Ga0065715_10203398 | |||
| 1136 | Ga0065707_10001405 | |||
| 1137 | Ga0065707_10008883 | |||
| 1138 | Ga0065707_10120166 | |||
| 1139 | Ga0065707_10563363 | |||
| 1140 | Ga0070658_10080659 | |||
| 1141 | Ga0070658_10137220 | |||
| 1142 | Ga0070676_10028387 | |||
| 1143 | Ga0070676_10111141 | |||
| 1144 | Ga0070676_10138907 | |||
| 1145 | Ga0070676_10246314 | |||
| 1146 | Ga0070683_100016713 | |||
| 1147 | Ga0070683_100251636 | |||
| 1148 | Ga0070683_100773368 | |||
| 1149 | Ga0070683_100880943 | |||
| 1150 | Ga0070690_100008406 | |||
| 1151 | Ga0070690_100011868 | |||
| 1152 | Ga0070690_100026704 | |||
| 1153 | Ga0070690_100415323 | |||
| 1154 | Ga0070670_100101198 | |||
| 1155 | Ga0070670_100147006 | |||
| 1156 | Ga0070670_100262808 | |||
| 1157 | Ga0070677_10016768 | |||
| 1158 | Ga0070677_10081654 | |||
| 1159 | Ga0070677_10167176 | |||
| 1160 | Ga0070677_10186852 | |||
| 1161 | Ga0070677_10229593 | |||
| 1162 | Ga0070677_10333397 | |||
| 1163 | Ga0070677_10426231 | |||
| 1164 | Ga0068869_100001817 | |||
| 1165 | Ga0068869_100069007 | |||
| 1166 | Ga0068869_100079712 | |||
| 1167 | Ga0068869_100086889 | |||
| 1168 | Ga0068869_100246937 | |||
| 1169 | Ga0068869_100256085 | |||
| 1170 | Ga0068869_100291877 | |||
| 1171 | Ga0068869_100305928 | |||
| 1172 | Ga0068869_100437615 | |||
| 1173 | Ga0070666_10003881 | |||
| 1174 | Ga0070666_10095913 | |||
| 1175 | Ga0070666_10464080 | |||
| 1176 | Ga0070680_100150655 | |||
| 1177 | Ga0070680_100192119 | |||
| 1178 | Ga0070680_100457047 | |||
| 1179 | Ga0070682_100751685 | |||
| 1180 | Ga0068868_100146382 | |||
| 1181 | Ga0068868_100181846 | |||
| 1182 | Ga0068868_100205591 | |||
| 1183 | Ga0070660_100060000 | |||
| 1184 | Ga0070660_100104038 | |||
| 1185 | Ga0070660_100106393 | |||
| 1186 | Ga0070689_100009051 | |||
| 1187 | Ga0070689_100031685 | |||
| 1188 | Ga0070689_100082585 | |||
| 1189 | Ga0070689_100116610 | |||
| 1190 | Ga0070689_100293399 | |||
| 1191 | Ga0070689_100691174 | |||
| 1192 | Ga0070691_10002877 | |||
| 1193 | Ga0070691_10023689 | |||
| 1194 | Ga0070687_100004448 | |||
| 1195 | Ga0070687_100131437 | |||
| 1196 | Ga0070661_100047551 | |||
| 1197 | Ga0070661_100058230 | |||
| 1198 | Ga0070661_100156916 | |||
| 1199 | Ga0070661_100463929 | |||
| 1200 | Ga0070692_10434984 | |||
| 1201 | Ga0070692_10687571 | |||
| 1202 | Ga0070668_100010486 | |||
| 1203 | Ga0070668_100428177 | |||
| 1204 | Ga0070668_100449992 | |||
| 1205 | Ga0070668_100729695 | |||
| 1206 | Ga0070669_100010337 | |||
| 1207 | Ga0070669_100058864 | |||
| 1208 | Ga0070669_100084280 | |||
| 1209 | Ga0070669_100642073 | |||
| 1210 | Ga0070675_100000464 | |||
| 1211 | Ga0070675_100089079 | |||
| 1212 | Ga0070675_100105755 | |||
| 1213 | Ga0070675_100137027 | |||
| 1214 | Ga0070675_100324662 | |||
| 1215 | Ga0070675_100384097 | |||
| 1216 | Ga0070675_100466046 | |||
| 1217 | Ga0070675_100817831 | |||
| 1218 | Ga0070675_100919647 | |||
| 1219 | Ga0070671_100055695 | |||
| 1220 | Ga0070671_100155579 | |||
| 1221 | Ga0070671_100169671 | |||
| 1222 | Ga0070674_100032443 | |||
| 1223 | Ga0070674_100747977 | |||
| 1224 | Ga0070674_100753385 | |||
| 1225 | Ga0070674_100915458 | |||
| 1226 | Ga0070674_100990526 | |||
| 1227 | Ga0070673_100008655 | |||
| 1228 | Ga0070673_100034453 | |||
| 1229 | Ga0070673_100051812 | |||
| 1230 | Ga0070673_100056656 | |||
| 1231 | Ga0070673_100074490 | |||
| 1232 | Ga0070673_100188600 | |||
| 1233 | Ga0070673_101111224 | |||
| 1234 | Ga0070688_100027363 | |||
| 1235 | Ga0070688_100028663 | |||
| 1236 | Ga0070688_100170237 | |||
| 1237 | Ga0070688_100464008 | |||
| 1238 | Ga0070688_100824686 | |||
| 1239 | Ga0070659_100037772 | |||
| 1240 | Ga0070667_100008486 | |||
| 1241 | Ga0070667_100013176 | |||
| 1242 | Ga0070667_100146499 | |||
| 1243 | Ga0070667_100273403 | |||
| 1244 | Ga0070667_100396141 | |||
| 1245 | Ga0070667_100437278 | |||
| 1246 | Ga0070667_100472470 | |||
| 1247 | Ga0070667_100483975 | |||
| 1248 | Ga0070667_100635606 | |||
| 1249 | Ga0070709_10101345 | |||
| 1250 | Ga0070709_10370843 | |||
| 1251 | Ga0070713_100267422 | |||
| 1252 | Ga0070710_10469579 | |||
| 1253 | Ga0070710_10731332 | |||
| 1254 | Ga0070701_10003530 | |||
| 1255 | Ga0070701_10038044 | |||
| 1256 | Ga0070701_10096782 | |||
| 1257 | Ga0070701_10248525 | |||
| 1258 | Ga0070711_100367241 | |||
| 1259 | Ga0070705_100043086 | |||
| 1260 | Ga0070705_100556711 | |||
| 1261 | Ga0070705_101076244 | |||
| 1262 | Ga0070700_100010513 | |||
| 1263 | Ga0070700_100038354 | |||
| 1264 | Ga0070694_100009867 | |||
| 1265 | Ga0070694_100168322 | |||
| 1266 | Ga0070694_100291348 | |||
| 1267 | Ga0070694_100341445 | |||
| 1268 | Ga0070694_100575269 | |||
| 1269 | Ga0070708_100378911 | |||
| 1270 | Ga0070708_100576698 | |||
| 1271 | Ga0070708_101094123 | |||
| 1272 | Ga0070708_101209960 | |||
| 1273 | Ga0070663_100215951 | |||
| 1274 | Ga0070678_100004034 | |||
| 1275 | Ga0070678_100056470 | |||
| 1276 | Ga0070678_100094618 | |||
| 1277 | Ga0070678_100885522 | |||
| 1278 | Ga0070662_100245993 | |||
| 1279 | Ga0070662_101197998 | |||
| 1280 | Ga0070681_10010262 | |||
| 1281 | Ga0070681_10013494 | |||
| 1282 | Ga0070681_10064420 | |||
| 1283 | Ga0070681_10290219 | |||
| 1284 | Ga0068867_100000898 | |||
| 1285 | Ga0068867_100007475 | |||
| 1286 | Ga0068867_100014622 | |||
| 1287 | Ga0068867_100054992 | |||
| 1288 | Ga0068867_100130713 | |||
| 1289 | Ga0068867_100258612 | |||
| 1290 | Ga0068867_100347645 | |||
| 1291 | Ga0068867_100612472 | |||
| 1292 | Ga0070685_10079184 | |||
| 1293 | Ga0070685_10171365 | |||
| 1294 | Ga0070685_10317003 | |||
| 1295 | Ga0070707_100229824 | |||
| 1296 | Ga0070707_101071705 | |||
| 1297 | Ga0070698_101054681 | |||
| 1298 | Ga0070699_100410760 | |||
| 1299 | Ga0070699_100563940 | |||
| 1300 | Ga0070679_100012895 | |||
| 1301 | Ga0070679_100050628 | |||
| 1302 | Ga0070679_100073633 | |||
| 1303 | Ga0070679_100076852 | |||
| 1304 | Ga0070684_100000686 | |||
| 1305 | Ga0070684_100227943 | |||
| 1306 | Ga0070684_100272808 | |||
| 1307 | Ga0070684_100306170 | |||
| 1308 | Ga0070684_100583377 | |||
| 1309 | Ga0068853_100013515 | |||
| 1310 | Ga0068853_100071915 | |||
| 1311 | Ga0068853_100136091 | |||
| 1312 | Ga0068853_100326225 | |||
| 1313 | Ga0068853_100341633 | |||
| 1314 | Ga0068853_100415734 | |||
| 1315 | Ga0070672_100033588 | |||
| 1316 | Ga0070672_100046100 | |||
| 1317 | Ga0070672_100052061 | |||
| 1318 | Ga0070672_100061480 | |||
| 1319 | Ga0070672_100085283 | |||
| 1320 | Ga0070672_100093177 | |||
| 1321 | Ga0070672_100133153 | |||
| 1322 | Ga0070672_100498076 | |||
| 1323 | Ga0070672_100502039 | |||
| 1324 | Ga0070672_100670395 | |||
| 1325 | Ga0070686_100016391 | |||
| 1326 | Ga0070686_100166673 | |||
| 1327 | Ga0070686_100302434 | |||
| 1328 | Ga0070686_100329493 | |||
| 1329 | Ga0070686_100501945 | |||
| 1330 | Ga0070686_100818335 | |||
| 1331 | Ga0070686_100825890 | |||
| 1332 | Ga0070686_101091704 | |||
| 1333 | Ga0070695_100109052 | |||
| 1334 | Ga0070695_100161546 | |||
| 1335 | Ga0070695_100278729 | |||
| 1336 | Ga0070695_100591478 | |||
| 1337 | Ga0070695_101087944 | |||
| 1338 | Ga0070696_100077321 | |||
| 1339 | Ga0070696_100176990 | |||
| 1340 | Ga0070696_100181098 | |||
| 1341 | Ga0070696_100488859 | |||
| 1342 | Ga0070696_100929214 | |||
| 1343 | Ga0070665_100066267 | |||
| 1344 | Ga0070665_100069879 | |||
| 1345 | Ga0070665_100237681 | |||
| 1346 | Ga0070665_100253431 | |||
| 1347 | Ga0070704_100006391 | |||
| 1348 | Ga0070704_100095090 | |||
| 1349 | Ga0070704_100120553 | |||
| 1350 | Ga0070704_100669043 | |||
| 1351 | Ga0068855_100048876 | |||
| 1352 | Ga0068855_100079772 | |||
| 1353 | Ga0068855_100232806 | |||
| 1354 | Ga0068855_100711845 | |||
| 1355 | Ga0070664_100168905 | |||
| 1356 | Ga0070664_100371284 | |||
| 1357 | Ga0070664_100399255 | |||
| 1358 | Ga0070664_100888807 | |||
| 1359 | Ga0068857_100001723 | |||
| 1360 | Ga0068857_100013627 | |||
| 1361 | Ga0068857_100077163 | |||
| 1362 | Ga0068857_100081572 | |||
| 1363 | Ga0068857_100151507 | |||
| 1364 | Ga0068854_100005751 | |||
| 1365 | Ga0068854_100108817 | |||
| 1366 | Ga0068856_100003074 | |||
| 1367 | Ga0068856_100024019 | |||
| 1368 | Ga0068856_100143017 | |||
| 1369 | Ga0068856_100202771 | |||
| 1370 | Ga0068856_100583066 | |||
| 1371 | Ga0070702_100025563 | |||
| 1372 | Ga0070702_100107701 | |||
| 1373 | Ga0070702_100144463 | |||
| 1374 | Ga0070702_100293266 | |||
| 1375 | Ga0070702_100341074 | |||
| 1376 | Ga0068852_100004765 | |||
| 1377 | Ga0068852_100162470 | |||
| 1378 | Ga0068852_100176436 | |||
| 1379 | Ga0068852_101255527 | |||
| 1380 | Ga0068859_100000942 | |||
| 1381 | Ga0068859_100007715 | |||
| 1382 | Ga0068859_100015193 | |||
| 1383 | Ga0068859_100041903 | |||
| 1384 | Ga0068859_100064018 | |||
| 1385 | Ga0068859_100106707 | |||
| 1386 | Ga0068859_100136850 | |||
| 1387 | Ga0068859_100162902 | |||
| 1388 | Ga0068859_100239373 | |||
| 1389 | Ga0068859_100376769 | |||
| 1390 | Ga0068859_100570123 | |||
| 1391 | Ga0068859_100738089 | |||
| 1392 | Ga0068859_100894406 | |||
| 1393 | Ga0068859_101445197 | |||
| 1394 | Ga0068864_100016200 | |||
| 1395 | Ga0068864_100046995 | |||
| 1396 | Ga0068864_100059994 | |||
| 1397 | Ga0068864_100083878 | |||
| 1398 | Ga0068864_100547607 | |||
| 1399 | Ga0068864_100879421 | |||
| 1400 | Ga0068864_100921191 | |||
| 1401 | Ga0068866_10021155 | |||
| 1402 | Ga0068866_10026122 | |||
| 1403 | Ga0068866_10300711 | |||
| 1404 | Ga0068866_10325162 | |||
| 1405 | Ga0068861_100166951 | |||
| 1406 | Ga0068861_100189992 | |||
| 1407 | Ga0068861_100217553 | |||
| 1408 | Ga0068861_100344695 | |||
| 1409 | Ga0068861_100464815 | |||
| 1410 | Ga0068851_10040510 | |||
| 1411 | Ga0068851_10056395 | |||
| 1412 | Ga0068851_10060858 | |||
| 1413 | Ga0068870_10000192 | |||
| 1414 | Ga0068870_10026859 | |||
| 1415 | Ga0068870_10031021 | |||
| 1416 | Ga0068870_10056652 | |||
| 1417 | Ga0068870_10062330 | |||
| 1418 | Ga0068870_10212369 | |||
| 1419 | Ga0068870_10549857 | |||
| 1420 | Ga0068863_100056915 | |||
| 1421 | Ga0068863_100064599 | |||
| 1422 | Ga0068863_100096215 | |||
| 1423 | Ga0068863_100359118 | |||
| 1424 | Ga0068863_100471370 | |||
| 1425 | Ga0068863_100524905 | |||
| 1426 | Ga0068863_100763841 | |||
| 1427 | Ga0068863_100902909 | |||
| 1428 | Ga0068858_100003479 | |||
| 1429 | Ga0068858_100007617 | |||
| 1430 | Ga0068858_100034638 | |||
| 1431 | Ga0068858_100110507 | |||
| 1432 | Ga0068858_100146416 | |||
| 1433 | Ga0068858_100180141 | |||
| 1434 | Ga0068858_100283255 | |||
| 1435 | Ga0068858_100747344 | |||
| 1436 | Ga0068858_101676034 | |||
| 1437 | Ga0068860_100002423 | |||
| 1438 | Ga0068860_100010508 | |||
| 1439 | Ga0068860_100085132 | |||
| 1440 | Ga0068860_100105001 | |||
| 1441 | Ga0068860_100179620 | |||
| 1442 | Ga0068860_100550700 | |||
| 1443 | Ga0068860_100630863 | |||
| 1444 | Ga0068860_100733267 | |||
| 1445 | Ga0068860_100831517 | |||
| 1446 | Ga0068862_100004844 | |||
| 1447 | Ga0068862_100022719 | |||
| 1448 | Ga0068862_100352551 | |||
| 1449 | Ga0068862_100395750 | |||
| 1450 | Ga0068862_100532586 | |||
| 1451 | Ga0068862_100767944 | |||
| 1452 | Ga0068862_100858566 | |||
| 1453 | Ga0081455_10063215 | |||
| 1454 | Ga0075368_10082332 | |||
| 1455 | Ga0075432_10050045 | |||
| 1456 | Ga0075432_10232679 | |||
| 1457 | Ga0070715_10072635 | |||
| 1458 | Ga0070716_100443727 | |||
| 1459 | Ga0070712_100816347 | |||
| 1460 | Ga0097621_100000897 | |||
| 1461 | Ga0097621_100026878 | |||
| 1462 | Ga0097621_100043866 | |||
| 1463 | Ga0097621_100047407 | |||
| 1464 | Ga0097621_100137181 | |||
| 1465 | Ga0097621_100267770 | |||
| 1466 | Ga0097621_100329099 | |||
| 1467 | Ga0097621_100433608 | |||
| 1468 | Ga0097621_100543354 | |||
| 1469 | Ga0068871_100007271 | |||
| 1470 | Ga0068871_100051962 | |||
| 1471 | Ga0068871_100062489 | |||
| 1472 | Ga0068871_100124894 | |||
| 1473 | Ga0068871_100192444 | |||
| 1474 | Ga0068871_100253739 | |||
| 1475 | Ga0068871_100303275 | |||
| 1476 | Ga0068871_100502713 | |||
| 1477 | Ga0075428_100090306 | |||
| 1478 | Ga0075428_100924432 | |||
| 1479 | Ga0075430_100001748 | |||
| 1480 | Ga0075433_10000163 | |||
| 1481 | Ga0075433_10026369 | |||
| 1482 | Ga0075433_10057273 | |||
| 1483 | Ga0075433_10089438 | |||
| 1484 | Ga0075434_100013654 | |||
| 1485 | Ga0075434_100024659 | |||
| 1486 | Ga0075434_100041785 | |||
| 1487 | Ga0075434_100095884 | |||
| 1488 | Ga0075434_100422031 | |||
| 1489 | Ga0075434_100511025 | |||
| 1490 | Ga0075434_101032732 | |||
| 1491 | Ga0075434_101186243 | |||
| 1492 | Ga0075434_101250751 | |||
| 1493 | Ga0075429_100056763 | |||
| 1494 | Ga0075429_100101578 | |||
| 1495 | Ga0075429_100113089 | |||
| 1496 | Ga0075429_101156006 | |||
| 1497 | Ga0068865_100005059 | |||
| 1498 | Ga0068865_100163513 | |||
| 1499 | Ga0068865_100216258 | |||
| 1500 | Ga0097620_100000942 | |||
| 1501 | Ga0097620_100007715 | |||
| 1502 | Ga0097620_100015192 | |||
| 1503 | Ga0097620_100041902 | |||
| 1504 | Ga0097620_100064020 | |||
| 1505 | Ga0097620_100106707 | |||
| 1506 | Ga0097620_100136852 | |||
| 1507 | Ga0097620_100162894 | |||
| 1508 | Ga0097620_100239372 | |||
| 1509 | Ga0097620_100376769 | |||
| 1510 | Ga0097620_100570061 | |||
| 1511 | Ga0097620_100738261 | |||
| 1512 | Ga0097620_100806427 | |||
| 1513 | Ga0097620_101445340 | |||
| 1514 | Ga0075435_100213936 | |||
| 1515 | Ga0075435_100256247 | |||
| 1516 | Ga0099795_10010530 | |||
| 1517 | Ga0099795_10105546 | |||
| 1518 | Ga0105251_10284940 | |||
| 1519 | Ga0105240_10016319 | |||
| 1520 | Ga0105240_10054577 | |||
| 1521 | Ga0105240_10217939 | |||
| 1522 | Ga0105240_10326187 | |||
| 1523 | Ga0105240_10651498 | |||
| 1524 | Ga0105240_11724918 | |||
| 1525 | Ga0111539_10001989 | |||
| 1526 | Ga0111539_10007265 | |||
| 1527 | Ga0111539_10084724 | |||
| 1528 | Ga0111539_10262686 | |||
| 1529 | Ga0111539_10326513 | |||
| 1530 | Ga0111539_10369883 | |||
| 1531 | Ga0111539_10390502 | |||
| 1532 | Ga0111539_10392062 | |||
| 1533 | Ga0105245_10004042 | |||
| 1534 | Ga0105245_10006936 | |||
| 1535 | Ga0105245_10030011 | |||
| 1536 | Ga0105245_10359887 | |||
| 1537 | Ga0105245_10610102 | |||
| 1538 | Ga0105245_11123326 | |||
| 1539 | Ga0105247_10047368 | |||
| 1540 | Ga0105247_10081480 | |||
| 1541 | Ga0105247_10157607 | |||
| 1542 | Ga0114129_10007250 | |||
| 1543 | Ga0114129_10098075 | |||
| 1544 | Ga0114129_10104941 | |||
| 1545 | Ga0114129_10159295 | |||
| 1546 | Ga0114129_10633701 | |||
| 1547 | Ga0114129_11065212 | |||
| 1548 | Ga0114129_11507640 | |||
| 1549 | Ga0105243_10001279 | |||
| 1550 | Ga0105243_10185066 | |||
| 1551 | Ga0105243_10342088 | |||
| 1552 | Ga0105243_11072984 | |||
| 1553 | Ga0105241_10037368 | |||
| 1554 | Ga0105241_10069753 | |||
| 1555 | Ga0105241_10706879 | |||
| 1556 | Ga0105241_10875950 | |||
| 1557 | Ga0105241_11075613 | |||
| 1558 | Ga0105242_10004043 | |||
| 1559 | Ga0105242_10005299 | |||
| 1560 | Ga0105242_10008066 | |||
| 1561 | Ga0105242_10093821 | |||
| 1562 | Ga0105242_10422650 | |||
| 1563 | Ga0105242_11082708 | |||
| 1564 | Ga0105242_11301810 | |||
| 1565 | Ga0105242_11827432 | |||
| 1566 | Ga0105248_10009933 | |||
| 1567 | Ga0105248_10039929 | |||
| 1568 | Ga0105248_10048288 | |||
| 1569 | Ga0105248_10125576 | |||
| 1570 | Ga0105248_10135672 | |||
| 1571 | Ga0105248_10192213 | |||
| 1572 | Ga0105248_10192602 | |||
| 1573 | Ga0105248_10209773 | |||
| 1574 | Ga0105248_10499622 | |||
| 1575 | Ga0105248_10707859 | |||
| 1576 | Ga0105248_11147088 | |||
| 1577 | Ga0105248_11308643 | |||
| 1578 | Ga0105237_10011728 | |||
| 1579 | Ga0105237_10018144 | |||
| 1580 | Ga0105237_10145955 | |||
| 1581 | Ga0105237_10180962 | |||
| 1582 | Ga0105238_10000849 | |||
| 1583 | Ga0105238_10001232 | |||
| 1584 | Ga0105238_10024027 | |||
| 1585 | Ga0105238_10033651 | |||
| 1586 | Ga0105238_10036598 | |||
| 1587 | Ga0105238_10251783 | |||
| 1588 | Ga0105238_10253922 | |||
| 1589 | Ga0105238_10422998 | |||
| 1590 | Ga0105238_11775139 | |||
| 1591 | Ga0105249_10001729 | |||
| 1592 | Ga0105249_10043358 | |||
| 1593 | Ga0105249_10143927 | |||
| 1594 | Ga0105249_10892685 | |||
| 1595 | Ga0105249_11019436 | |||
| 1596 | Ga0105249_11054609 | |||
| 1597 | Ga0105239_10010043 | |||
| 1598 | Ga0105239_10012533 | |||
| 1599 | Ga0105239_10064265 | |||
| 1600 | Ga0105239_10130067 | |||
| 1601 | Ga0105239_10499996 | |||
| 1602 | Ga0105239_12162935 | |||
| 1603 | Ga0105246_10015063 | |||
| 1604 | Ga0105246_10052626 | |||
| 1605 | Ga0105246_10064861 | |||
| 1606 | Ga0105246_10434080 | |||
| 1607 | Ga0105246_10437056 | |||
| 1608 | Ga0105246_10461185 | |||
| 1609 | Ga0105246_11149702 | |||
| 1610 | Ga0157373_10891108 | |||
| 1611 | Ga0157371_10166629 | |||
| 1612 | Ga0157370_10022349 | |||
| 1613 | Ga0157370_10159105 | |||
| 1614 | Ga0157369_10004883 | |||
| 1615 | Ga0157369_10081249 | |||
| 1616 | Ga0157369_10319511 | |||
| 1617 | Ga0157369_10529497 | |||
| 1618 | Ga0157374_10086910 | |||
| 1619 | Ga0157374_10101635 | |||
| 1620 | Ga0157374_10147748 | |||
| 1621 | Ga0157374_10259160 | |||
| 1622 | Ga0157374_10329109 | |||
| 1623 | Ga0157374_10471764 | |||
| 1624 | Ga0157374_10712086 | |||
| 1625 | Ga0157378_10007429 | |||
| 1626 | Ga0157378_10024970 | |||
| 1627 | Ga0157378_10047677 | |||
| 1628 | Ga0157378_10661096 | |||
| 1629 | Ga0157378_10668687 | |||
| 1630 | Ga0157378_10691071 | |||
| 1631 | Ga0157378_10875635 | |||
| 1632 | Ga0157378_11539705 | |||
| 1633 | Ga0163162_10009293 | |||
| 1634 | Ga0163162_10096289 | |||
| 1635 | Ga0163162_10239598 | |||
| 1636 | Ga0163162_10269670 | |||
| 1637 | Ga0163162_10306040 | |||
| 1638 | Ga0163162_10329540 | |||
| 1639 | Ga0163162_10360816 | |||
| 1640 | Ga0163162_10375808 | |||
| 1641 | Ga0163162_10519671 | |||
| 1642 | Ga0163162_10841212 | |||
| 1643 | Ga0163162_10896393 | |||
| 1644 | Ga0163162_11029831 | |||
| 1645 | Ga0163162_12314489 | |||
| 1646 | Ga0157372_10063730 | |||
| 1647 | Ga0157372_10199556 | |||
| 1648 | Ga0157372_10323416 | |||
| 1649 | Ga0157375_10040638 | |||
| 1650 | Ga0157375_10070513 | |||
| 1651 | Ga0157375_10106202 | |||
| 1652 | Ga0157375_10110475 | |||
| 1653 | Ga0157375_10144322 | |||
| 1654 | Ga0157375_10303357 | |||
| 1655 | Ga0157375_10636665 | |||
| 1656 | Ga0163163_10000361 | |||
| 1657 | Ga0163163_10001459 | |||
| 1658 | Ga0163163_10005428 | |||
| 1659 | Ga0163163_10015032 | |||
| 1660 | Ga0163163_10021529 | |||
| 1661 | Ga0163163_10032762 | |||
| 1662 | Ga0163163_10037686 | |||
| 1663 | Ga0163163_10065912 | |||
| 1664 | Ga0163163_10120865 | |||
| 1665 | Ga0163163_10164998 | |||
| 1666 | Ga0163163_10598923 | |||
| 1667 | Ga0157380_10029086 | |||
| 1668 | Ga0157380_10044230 | |||
| 1669 | Ga0157380_10128698 | |||
| 1670 | Ga0157380_10129518 | |||
| 1671 | Ga0157380_10510759 | |||
| 1672 | Ga0157377_10037240 | |||
| 1673 | Ga0157377_10190939 | |||
| 1674 | Ga0157377_10442009 | |||
| 1675 | Ga0157379_10032746 | |||
| 1676 | Ga0157379_10108621 | |||
| 1677 | Ga0157379_10513130 | |||
| 1678 | Ga0157379_10599316 | |||
| 1679 | Ga0157379_10853834 | |||
| 1680 | Ga0157379_11236078 | |||
| 1681 | Ga0157379_11392486 | |||
| 1682 | Ga0157376_10016956 | |||
| 1683 | Ga0157376_10047574 | |||
| 1684 | Ga0157376_10079794 | |||
| 1685 | Ga0157376_10123948 | |||
| 1686 | Ga0157376_10290350 | |||
| 1687 | Ga0157376_10474909 | |||
| 1688 | Ga0157376_11848168 | |||
| 1689 | Ga0163161_10034563 | |||
| 1690 | Ga0163161_10064361 | |||
| 1691 | Ga0163161_10436867 | |||
| 1692 | Ga0163161_10457790 | |||
| 1693 | Ga0163161_10689515 | |||
| 1694 | Ga0197907_10421835 | |||
| 1695 | Ga0207427_105203 | |||
| 1696 | Ga0209233_1000015 | |||
| 1697 | Ga0207673_1001094 | |||
| 1698 | Ga0207697_10113503 | |||
| 1699 | Ga0207697_10153462 | |||
| 1700 | Ga0207656_10033635 | |||
| 1701 | Ga0207656_10035796 | |||
| 1702 | Ga0207653_10125981 | |||
| 1703 | Ga0207682_10001552 | |||
| 1704 | Ga0207682_10002307 | |||
| 1705 | Ga0207682_10131487 | |||
| 1706 | Ga0207642_10019271 | |||
| 1707 | Ga0207642_10181108 | |||
| 1708 | Ga0207710_10080581 | |||
| 1709 | Ga0207688_10018673 | |||
| 1710 | Ga0207688_10038963 | |||
| 1711 | Ga0207680_10012330 | |||
| 1712 | Ga0207680_10033879 | |||
| 1713 | Ga0207680_10198679 | |||
| 1714 | Ga0207680_10699508 | |||
| 1715 | Ga0207699_10049909 | |||
| 1716 | Ga0207699_10126601 | |||
| 1717 | Ga0207699_10434357 | |||
| 1718 | Ga0207645_10014193 | |||
| 1719 | Ga0207645_10043728 | |||
| 1720 | Ga0207645_10102888 | |||
| 1721 | Ga0207645_10160763 | |||
| 1722 | Ga0207645_10237411 | |||
| 1723 | Ga0207643_10000798 | |||
| 1724 | Ga0207643_10013855 | |||
| 1725 | Ga0207643_10019999 | |||
| 1726 | Ga0207643_10020115 | |||
| 1727 | Ga0207643_10021415 | |||
| 1728 | Ga0207643_10034947 | |||
| 1729 | Ga0207643_10084745 | |||
| 1730 | Ga0207643_10085865 | |||
| 1731 | Ga0207643_10256420 | |||
| 1732 | Ga0207705_10114537 | |||
| 1733 | Ga0207654_10004648 | |||
| 1734 | Ga0207654_10088212 | |||
| 1735 | Ga0207654_10169691 | |||
| 1736 | Ga0207654_10320770 | |||
| 1737 | Ga0207654_10366289 | |||
| 1738 | Ga0207654_10556955 | |||
| 1739 | Ga0207707_10001529 | |||
| 1740 | Ga0207707_10096014 | |||
| 1741 | Ga0207707_10168131 | |||
| 1742 | Ga0207707_10339748 | |||
| 1743 | Ga0207695_10003423 | |||
| 1744 | Ga0207695_10071698 | |||
| 1745 | Ga0207695_10378269 | |||
| 1746 | Ga0207695_10448896 | |||
| 1747 | Ga0207695_10689554 | |||
| 1748 | Ga0207671_10009867 | |||
| 1749 | Ga0207671_10039236 | |||
| 1750 | Ga0207671_10277042 | |||
| 1751 | Ga0207671_10714911 | |||
| 1752 | Ga0207663_10187128 | |||
| 1753 | Ga0207663_10212571 | |||
| 1754 | Ga0207663_10560404 | |||
| 1755 | Ga0207660_10019478 | |||
| 1756 | Ga0207660_10116398 | |||
| 1757 | Ga0207662_10008158 | |||
| 1758 | Ga0207662_10016059 | |||
| 1759 | Ga0207662_10040381 | |||
| 1760 | Ga0207662_10054175 | |||
| 1761 | Ga0207662_10537783 | |||
| 1762 | Ga0207657_10019241 | |||
| 1763 | Ga0207657_10030748 | |||
| 1764 | Ga0207657_10645223 | |||
| 1765 | Ga0207649_10153743 | |||
| 1766 | Ga0207649_10486372 | |||
| 1767 | Ga0207652_10072593 | |||
| 1768 | Ga0207652_10085387 | |||
| 1769 | Ga0207646_10342059 | |||
| 1770 | Ga0207681_10002323 | |||
| 1771 | Ga0207694_10000624 | |||
| 1772 | Ga0207694_10001139 | |||
| 1773 | Ga0207694_10032845 | |||
| 1774 | Ga0207694_10063865 | |||
| 1775 | Ga0207694_10114304 | |||
| 1776 | Ga0207694_10155778 | |||
| 1777 | Ga0207694_10451603 | |||
| 1778 | Ga0207650_10019082 | |||
| 1779 | Ga0207650_10067002 | |||
| 1780 | Ga0207650_10204184 | |||
| 1781 | Ga0207650_10537474 | |||
| 1782 | Ga0207650_10736012 | |||
| 1783 | Ga0207659_10000105 | |||
| 1784 | Ga0207659_10024654 | |||
| 1785 | Ga0207659_10273626 | |||
| 1786 | Ga0207659_10336558 | |||
| 1787 | Ga0207659_10407395 | |||
| 1788 | Ga0207659_10629882 | |||
| 1789 | Ga0207659_10792633 | |||
| 1790 | Ga0207687_10003518 | |||
| 1791 | Ga0207687_10003843 | |||
| 1792 | Ga0207687_10079795 | |||
| 1793 | Ga0207687_10129887 | |||
| 1794 | Ga0207644_10034620 | |||
| 1795 | Ga0207644_10050756 | |||
| 1796 | Ga0207644_10412280 | |||
| 1797 | Ga0207644_10454512 | |||
| 1798 | Ga0207690_10168330 | |||
| 1799 | Ga0207706_10004735 | |||
| 1800 | Ga0207706_10031615 | |||
| 1801 | Ga0207706_10940725 | |||
| 1802 | Ga0207686_10008754 | |||
| 1803 | Ga0207686_10027723 | |||
| 1804 | Ga0207686_10036186 | |||
| 1805 | Ga0207686_10133254 | |||
| 1806 | Ga0207686_10194765 | |||
| 1807 | Ga0207686_10480517 | |||
| 1808 | Ga0207686_10973272 | |||
| 1809 | Ga0207686_11162172 | |||
| 1810 | Ga0207709_10001549 | |||
| 1811 | Ga0207709_10032156 | |||
| 1812 | Ga0207709_10055347 | |||
| 1813 | Ga0207709_10351390 | |||
| 1814 | Ga0207670_10005628 | |||
| 1815 | Ga0207670_10008307 | |||
| 1816 | Ga0207670_10131820 | |||
| 1817 | Ga0207670_10197782 | |||
| 1818 | Ga0207670_10443913 | |||
| 1819 | Ga0207670_11018791 | |||
| 1820 | Ga0207669_10069686 | |||
| 1821 | Ga0207669_10417463 | |||
| 1822 | Ga0207669_10420585 | |||
| 1823 | Ga0207669_10439617 | |||
| 1824 | Ga0207704_10096844 | |||
| 1825 | Ga0207704_10200572 | |||
| 1826 | Ga0207704_10263593 | |||
| 1827 | Ga0207704_10320770 | |||
| 1828 | Ga0207704_10351884 | |||
| 1829 | Ga0207691_10018369 | |||
| 1830 | Ga0207691_10092753 | |||
| 1831 | Ga0207691_10093984 | |||
| 1832 | Ga0207691_10114985 | |||
| 1833 | Ga0207691_10178784 | |||
| 1834 | Ga0207691_10180676 | |||
| 1835 | Ga0207691_10213787 | |||
| 1836 | Ga0207711_10008109 | |||
| 1837 | Ga0207711_10045439 | |||
| 1838 | Ga0207711_10100108 | |||
| 1839 | Ga0207711_10118360 | |||
| 1840 | Ga0207711_10124681 | |||
| 1841 | Ga0207711_10149472 | |||
| 1842 | Ga0207711_10155115 | |||
| 1843 | Ga0207711_10165616 | |||
| 1844 | Ga0207711_10249144 | |||
| 1845 | Ga0207711_10275598 | |||
| 1846 | Ga0207711_10316394 | |||
| 1847 | Ga0207711_10520701 | |||
| 1848 | Ga0207689_10006162 | |||
| 1849 | Ga0207689_10028459 | |||
| 1850 | Ga0207689_10052460 | |||
| 1851 | Ga0207689_10102687 | |||
| 1852 | Ga0207689_10113792 | |||
| 1853 | Ga0207689_10123447 | |||
| 1854 | Ga0207689_10130486 | |||
| 1855 | Ga0207689_10161911 | |||
| 1856 | Ga0207689_10227314 | |||
| 1857 | Ga0207689_10284758 | |||
| 1858 | Ga0207689_10350789 | |||
| 1859 | Ga0207661_10000440 | |||
| 1860 | Ga0207661_10256458 | |||
| 1861 | Ga0207661_10291435 | |||
| 1862 | Ga0207679_10003442 | |||
| 1863 | Ga0207679_10276353 | |||
| 1864 | Ga0207679_10620460 | |||
| 1865 | Ga0207667_10003148 | |||
| 1866 | Ga0207667_10163885 | |||
| 1867 | Ga0207651_10002639 | |||
| 1868 | Ga0207651_10041856 | |||
| 1869 | Ga0207651_10082790 | |||
| 1870 | Ga0207651_10111037 | |||
| 1871 | Ga0207651_10174935 | |||
| 1872 | Ga0207651_10747914 | |||
| 1873 | Ga0207651_10875513 | |||
| 1874 | Ga0207651_11067159 | |||
| 1875 | Ga0207712_10017205 | |||
| 1876 | Ga0207712_10061861 | |||
| 1877 | Ga0207712_10194884 | |||
| 1878 | Ga0207712_10196972 | |||
| 1879 | Ga0207712_10699297 | |||
| 1880 | Ga0207668_10503927 | |||
| 1881 | Ga0207668_10906152 | |||
| 1882 | Ga0207640_10070375 | |||
| 1883 | Ga0207640_10271757 | |||
| 1884 | Ga0207640_11320049 | |||
| 1885 | Ga0207658_10046204 | |||
| 1886 | Ga0207658_10074635 | |||
| 1887 | Ga0207658_10089572 | |||
| 1888 | Ga0207658_10382217 | |||
| 1889 | Ga0207658_10517252 | |||
| 1890 | Ga0207658_10545971 | |||
| 1891 | Ga0207658_11165745 | |||
| 1892 | Ga0207677_10032256 | |||
| 1893 | Ga0207677_10101523 | |||
| 1894 | Ga0207677_10107740 | |||
| 1895 | Ga0207677_10186482 | |||
| 1896 | Ga0207677_10201096 | |||
| 1897 | Ga0207703_10008840 | |||
| 1898 | Ga0207703_10009347 | |||
| 1899 | Ga0207703_10028701 | |||
| 1900 | Ga0207703_10045830 | |||
| 1901 | Ga0207703_10076337 | |||
| 1902 | Ga0207703_10171073 | |||
| 1903 | Ga0207703_10212594 | |||
| 1904 | Ga0207639_10036023 | |||
| 1905 | Ga0207639_10058508 | |||
| 1906 | Ga0207639_10093330 | |||
| 1907 | Ga0207639_10153410 | |||
| 1908 | Ga0207639_10372324 | |||
| 1909 | Ga0207639_10608920 | |||
| 1910 | Ga0207678_10684803 | |||
| 1911 | Ga0207678_10950159 | |||
| 1912 | Ga0207708_10013738 | |||
| 1913 | Ga0207708_10031656 | |||
| 1914 | Ga0207708_10074218 | |||
| 1915 | Ga0207708_10078656 | |||
| 1916 | Ga0207708_10129157 | |||
| 1917 | Ga0207708_10633618 | |||
| 1918 | Ga0207702_10007504 | |||
| 1919 | Ga0207702_10182119 | |||
| 1920 | Ga0207702_10190438 | |||
| 1921 | Ga0207702_10214051 | |||
| 1922 | Ga0207702_10811037 | |||
| 1923 | Ga0207641_10017321 | |||
| 1924 | Ga0207641_10162254 | |||
| 1925 | Ga0207641_10342890 | |||
| 1926 | Ga0207641_10345991 | |||
| 1927 | Ga0207641_10500081 | |||
| 1928 | Ga0207641_10523834 | |||
| 1929 | Ga0207641_10593807 | |||
| 1930 | Ga0207648_10002414 | |||
| 1931 | Ga0207648_10052045 | |||
| 1932 | Ga0207648_10069740 | |||
| 1933 | Ga0207648_10112445 | |||
| 1934 | Ga0207648_10124833 | |||
| 1935 | Ga0207648_10231822 | |||
| 1936 | Ga0207648_10595273 | |||
| 1937 | Ga0207648_11092935 | |||
| 1938 | Ga0207676_10014803 | |||
| 1939 | Ga0207676_10063294 | |||
| 1940 | Ga0207676_10073867 | |||
| 1941 | Ga0207676_10106727 | |||
| 1942 | Ga0207676_10127202 | |||
| 1943 | Ga0207676_10136823 | |||
| 1944 | Ga0207676_10279074 | |||
| 1945 | Ga0207676_10288616 | |||
| 1946 | Ga0207676_10293377 | |||
| 1947 | Ga0207676_10507336 | |||
| 1948 | Ga0207676_10956103 | |||
| 1949 | Ga0207674_10001214 | |||
| 1950 | Ga0207674_10002954 | |||
| 1951 | Ga0207674_10037435 | |||
| 1952 | Ga0207674_10041715 | |||
| 1953 | Ga0207674_10045562 | |||
| 1954 | Ga0207674_10130834 | |||
| 1955 | Ga0207674_10302372 | |||
| 1956 | Ga0207674_10343952 | |||
| 1957 | Ga0207674_10392169 | |||
| 1958 | Ga0207675_100008002 | |||
| 1959 | Ga0207675_100011835 | |||
| 1960 | Ga0207675_100041840 | |||
| 1961 | Ga0207675_100100074 | |||
| 1962 | Ga0207675_100130326 | |||
| 1963 | Ga0207675_100168452 | |||
| 1964 | Ga0207675_100237964 | |||
| 1965 | Ga0207675_100355090 | |||
| 1966 | Ga0207675_100419591 | |||
| 1967 | Ga0207675_100510765 | |||
| 1968 | Ga0207675_100741039 | |||
| 1969 | Ga0207683_10007588 | |||
| 1970 | Ga0207683_10015647 | |||
| 1971 | Ga0207683_10019890 | |||
| 1972 | Ga0207683_10029512 | |||
| 1973 | Ga0207683_10042168 | |||
| 1974 | Ga0207683_10110848 | |||
| 1975 | Ga0207683_10436090 | |||
| 1976 | Ga0207683_11012894 | |||
| 1977 | Ga0207698_10078502 | |||
| 1978 | Ga0207698_10195044 | |||
| 1979 | Ga0209996_1009649 | |||
| 1980 | Ga0209179_1003916 | |||
| 1981 | Ga0209974_10041910 | |||
| 1982 | Ga0207428_10002147 | |||
| 1983 | Ga0207428_10006528 | |||
| 1984 | Ga0207428_10018399 | |||
| 1985 | Ga0207428_10178002 | |||
| 1986 | Ga0207428_10226658 | |||
| 1987 | Ga0207428_10621396 | |||
| 1988 | Ga0268266_10018050 | |||
| 1989 | Ga0268266_10049466 | |||
| 1990 | Ga0268266_10118119 | |||
| 1991 | Ga0268266_10121578 | |||
| 1992 | Ga0268265_10002294 | |||
| 1993 | Ga0268265_10013612 | |||
| 1994 | Ga0268265_10362758 | |||
| 1995 | Ga0268265_10373655 | |||
| 1996 | Ga0268265_10506205 | |||
| 1997 | Ga0268265_10894232 | |||
| 1998 | Ga0268264_10004132 | |||
| 1999 | Ga0268264_10004498 | |||
| 2000 | Ga0268264_10042979 | |||
| 2001 | Ga0268264_10095187 | |||
| 2002 | Ga0268264_10119876 | |||
| 2003 | Ga0268264_10294959 | |||
| 2004 | Ga0268264_10300397 | |||
| 2005 | Ga0268264_10450644 | |||
| 2006 | Ga0268264_11278363 | |||
| 2007 | Ga0265337_1001333 | |||
| 2008 | Ga0265319_1053056 | |||
| 2009 | Ga0265334_10003224 | |||
| 2010 | Ga0265318_10008720 | |||
| 2011 | Ga0265338_10344360 | |||
| 2012 | Ga0265766_1013085 | |||
| 2013 | Ga0265770_1073202 | |||
| 2014 | Ga0265779_101300 | |||
| 2015 | Ga0265330_10039117 | |||
| 2016 | Ga0265328_10023384 | |||
| 2017 | Ga0265320_10045118 | |||
| 2018 | Ga0265325_10011366 | |||
| 2019 | Ga0265329_10025089 | |||
| 2020 | Ga0265331_10000991 | |||
| 2021 | Ga0265331_10106578 | |||
| 2022 | Ga0265316_10010483 | |||
| 2023 | Ga0265313_10006487 | |||
| 2024 | Ga0265313_10040068 | |||
| 2025 | Ga0265314_10000277 | |||
| 2026 | Ga0265314_10002727 | |||
| 2027 | Ga0265314_10051768 | |||
| 2028 | Ga0265314_10123611 | |||
| 2029 | Ga0307416_100645561 | |||
| 2030 | Ga0373938_0026288 | |||
| 2031 | Ga0373934_0282294 | |||
| 2032 | Ga0373949_0114447 | |||
| 2033 | Ga0373949_0195878 | |||
| 2034 | Ga0373951_0044619 | |||
| 2035 | Ga0373936_0339512 | |||
| 2036 | Ga0373939_0023471 | |||
| 2037 | Ga0373945_0037397 | |||
| 2038 | Ga0373953_0229957 | |||
| 2039 | Ga0373954_0205448 | |||
| 2040 | Ga0373943_0001872 | |||
| 2041 | Ga0373946_0144012 | |||
| 2042 | Ga0373946_0182868 | |||
| 2043 | Ga0373946_0266263 | |||
| 2044 | Ga0373942_0007237 | |||
| 2045 | Ga0373942_0027018 | |||
| 2046 | Ga0373961_0014069 | |||
| 2047 | Ga0373962_0009519 | |||
| 2048 | Ga0373962_0087497 | |||
| 2049 | Ga0373924_0096458 | |||
| 2050 | Ga0373931_0014369 | |||
| 2051 | Ga0373931_0051309 | |||
| 2052 | Ga0373931_0165144 | |||
| 2053 | Ga0373931_0253117 | |||
| 2054 | Ga0373935_0043797 | |||
| 2055 | Ga0373927_0166580 | |||
| 2056 | Ga0373927_0366441 | |||
| 2057 | Ga0373933_0123202 | |||
| 2058 | Ga0373933_0605088 | |||
| 2059 | Ga0373947_0002238 | |||
| 2060 | Ga0373947_0080496 | |||
| 2061 | Ga0373937_0070565 | |||
| 2062 | Ga0373937_0094591 | |||
| 2063 | Ga0373937_0100932 | |||
| 2064 | Ga0373937_0112639 | |||
| 2065 | Ga0373925_0046983 | |||
| 2066 | Ga0373925_0721254 | |||
| 2067 | Ga0436364_0421318 | |||
| 2068 | Ga0436364_1037684 | |||
| 2069 | Ga0436365_1618975 | |||
| 2070 | Ga0436363_0177020 | |||
| 2071 | Ga0436363_1275821 | |||
| 2072 | Ga0451853_2100878 | |||
| 2073 | Ga0439434_0144096 | |||
| 2074 | Ga0439444_0014056 | |||
| 2075 | Ga0453683_0223505 | |||
| 2076 | Ga0466963_0182391 | |||
| 2077 | Ga0451576_0040309 | |||
| 2078 | Ga0466967_0329392 | |||
| 2079 | Ga0495603_0152915 | |||
| 2080 | Ga0495629_0514811 | |||
| 2081 | Ga0495650_0167094 | |||
| 2082 | Ga0495582_0215025 | |||
| 2083 | Ga0495582_0280401 | |||
| 2084 | Ga0495582_0295699 | |||
| 2085 | Ga0495639_0081638 | |||
| 2086 | Ga0495584_0120907 | |||
| 2087 | Ga0495585_0133167 | |||
| 2088 | Ga0495594_0075565 | |||
| 2089 | Ga0495594_0318204 | |||
| 2090 | Ga0495596_0241848 | |||
| 2091 | Ga0495628_0555715 | |||
| 2092 | Ga0495630_0496490 | |||
| 2093 | Ga0495630_0918046 | |||
| 2094 | Ga0495631_0274007 | |||
| 2095 | Ga0495644_0110161 | |||
| 2096 | Ga0495642_0085588 | |||
| 2097 | Ga0495642_0241067 | |||
| 2098 | Ga0495665_0055515 | |||
| 2099 | Ga0495665_0220081 | |||
| 2100 | Ga0495640_0519088 | |||
| 2101 | Ga0495586_0039826 | |||
| 2102 | Ga0495586_0171064 | |||
| 2103 | Ga0495586_0291118 | |||
| 2104 | Ga0495587_0483187 | |||
| 2105 | Ga0495587_0592830 | |||
| 2106 | Ga0495609_0061694 | |||
| 2107 | Ga0495621_0047402 | |||
| 2108 | Ga0495621_0078573 | |||
| 2109 | Ga0495667_0401021 | |||
| 2110 | Ga0495634_0543770 | |||
| 2111 | Ga0495611_0052573 | |||
| 2112 | Ga0495659_0026141 | |||
| 2113 | Ga0495659_0082970 | |||
| 2114 | Ga0495659_0270302 | |||
| 2115 | Ga0495657_0208135 | |||
| 2116 | Ga0495623_0207302 | |||
| 2117 | Ga0495658_0045681 | |||
| 2118 | Ga0495658_0282263 | |||
| 2119 | Ga0495624_0506264 | |||
| 2120 | Ga0495670_0152473 | |||
| 2121 | Ga0495671_0278895 | |||
| 2122 | Ga0495660_0409995 | |||
| 2123 | Ga0495604_0108998 | |||
| 2124 | Ga0495636_0017175 | |||
| 2125 | Ga0495676_0481556 | |||
| 2126 | Ga0495675_0237439 | |||
| 2127 | Ga0495677_0110752 | |||
| 2128 | Ga0495614_0385747 | |||
| 2129 | Ga0495614_0435779 | |||
| 2130 | Ga0495615_0151397 | |||
| 2131 | Ga0496100_0302110 | |||
| 2132 | Ga0496101_0093742 | |||
| 2133 | Ga0496102_0144900 | |||
| 2134 | Ga0496104_0134125 | |||
| 2135 | Ga0496105_0354963 | |||
| 2136 | Ga0496108_0386900 | |||
| 2137 | Ga0496108_0476558 | |||
| 2138 | Ga0496108_0860903 | |||
| 2139 | Ga0496109_0133336 | |||
| 2140 | Ga0496109_0468415 | |||
| 2141 | Ga0496110_0109838 | |||
| 2142 | Ga0496110_0525656 | |||
| 2143 | Ga0496112_0008426 | |||
| 2144 | Ga0496112_0329134 | |||
| 2145 | Ga0496113_0135923 | |||
| 2146 | Ga0496113_0993691 | |||
| 2147 | Ga0496115_0085330 | |||
| 2148 | Ga0496115_0768556 | |||
| 2149 | Ga0501031_0122088 | |||
| 2150 | Ga0501031_0183972 | |||
| 2151 | Ga0501036_0030543 | |||
| 2152 | Ga0501036_0586479 | |||
| 2153 | Ga0501039_0211147 | |||
| 2154 | Ga0501039_0400824 | |||
| 2155 | Ga0501041_0028086 | |||
| 2156 | Ga0501042_0173619 | |||
| 2157 | Ga0501043_0103194 | |||
| 2158 | Ga0501046_0370554 | |||
| 2159 | Ga0501048_0041623 | |||
| 2160 | Ga0501068_0194132 | |||
| 2161 | Ga0501069_0153810 | |||
| 2162 | Ga0501070_0825314 | |||
| 2163 | Ga0501072_0060653 | |||
| 2164 | Ga0501074_0383248 | |||
| 2165 | Ga0501075_0038936 | |||
| 2166 | Ga0501075_0289405 | |||
| 2167 | Ga0501076_0014997 | |||
| 2168 | Ga0501259_116618 | |||
| 2169 | Ga0501079_0056877 | |||
| 2170 | Ga0501079_0097824 | |||
| 2171 | Ga0501080_0457271 | |||
| 2172 | Ga0501081_0711439 | |||
| 2173 | Ga0501045_0369061 | |||
| 2174 | nmdc:mga0yw44_567387_c1 | |||
| 2175 | nmdc:mga05p37_165436_c1 | |||
| 2176 | nmdc:mga05p37_29994_c1 | |||
| 2177 | nmdc:mga05p37_39948_c1 | |||
| 2178 | nmdc:mga05p37_507054_c1 | |||
| 2179 | nmdc:mga09592_129105_c1 | |||
| 2180 | nmdc:mga09592_53072_c1 | |||
| 2181 | nmdc:mga09592_81991_c1 | |||
| 2182 | nmdc:mga0qj67_542322_c1 | |||
| 2183 | nmdc:mga0qj67_71952_c1 | |||
| 2184 | nmdc:mga08y16_1035244_c1 | |||
| 2185 | nmdc:mga08y16_10962_c1 | |||
| 2186 | nmdc:mga08y16_239971_c1 | |||
| 2187 | nmdc:mga08y16_28255_c1 | |||
| 2188 | nmdc:mga08y16_383054_c1 | |||
| 2189 | nmdc:mga08y16_52878_c1 | |||
| 2190 | nmdc:mga08y16_533285_c1 | |||
| 2191 | nmdc:mga0n895_1568_c1 | |||
| 2192 | nmdc:mga0n895_164140_c1 | |||
| 2193 | nmdc:mga0n895_18550_c1 | |||
| 2194 | nmdc:mga0n895_336428_c1 | |||
| 2195 | nmdc:mga0n895_408317_c1 | |||
| 2196 | nmdc:mga0n895_494403_c1 | |||
| 2197 | nmdc:mga0rr50_186517_c1 | |||
| 2198 | nmdc:mga0rr50_581520_c1 | |||
| 2199 | nmdc:mga0rr50_599744_c1 | |||
| 2200 | nmdc:mga08x19_74519_c1 | |||
| 2201 | nmdc:mga0a205_16064_c1 | |||
| 2202 | nmdc:mga0a205_31076_c1 | |||
| 2203 | nmdc:mga0a205_33077_c1 | |||
| 2204 | nmdc:mga0a205_901929_c1 | |||
| 2205 | Ga0495595_0082051 | |||
| 2206 | Ga0500642_0321498 | |||
| 2207 | Ga0500559_0180776 | |||
| 2208 | Ga0501084_0116330 | |||
| 2209 | Ga0501082_0015291 | |||
| 2210 | Ga0530510_0010125 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xts-assembly1.cif.gz_B | crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus | 0.8167 | 31 | 162 |
| 7b21-assembly1.cif.gz_AAA | the x183 domain from cellvibrio japonicus cbp2d | 0.6455 | 58 | 137 |
| 1c6r-assembly1.cif.gz_A | crystal structure of reduced cytochrome c6 from the green algae scenedesmus obliquus | 0.6279 | 60 | 137 |
| 2xts-assembly1.cif.gz_B | crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus | 0.6174 | 31 | 162 |
| 6tr1-assembly3.cif.gz_E | native cytochrome c6 from thermosynechococcus elongatus in space group h3 | 0.6157 | 60 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xtsD01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.817 | 35 | 161 | 1.10.760.10 |
| 2xtsD01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7567 | 35 | 161 | 1.10.760.10 |
| 4pwaC00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6099 | 90 | 136 | 1.10.760.10 |
| 1ls9A00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.5797 | 60 | 133 | 1.10.760.10 |
| 2v08B00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.5548 | 60 | 137 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8DP02-F1-model_v4 | Cytochrome c domain-containing protein | 0.9681 | 62 | 159 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A2V8F9J0-F1-model_v4 | Cytochrome c domain-containing protein | 0.9511 | 46 | 179 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-H7GH64-F1-model_v4 | Cytochrome c | 0.9413 | 92 | 156 |
GO:0009055
GO:0020037 |
| AF-A0A3B9U2K0-F1-model_v4 | deleted | 0.9279 | 98 | 163 |
|
| AF-A0A3M1BCA1-F1-model_v4 | Uncharacterized protein | 0.9179 | 97 | 153 |
GO:0009055
GO:0016020 GO:0020037 |