F490050

General Info

Members Datasets Scaffolds Average Seq Length
1100 316 1099 91

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10932259|Ga0111539_109322592
Length 92
Sequence MLSPQTNEPPRDAETIGLAALAATLTDDRRAERFLALTGLSPEGIRERIGERSLLAACLSFLEAHEPDLLAVAGALDQEPEALIAARRELER

Samples

Sample ID Description Type Environment
1 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
205 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
218 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
219 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
220 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
221 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
224 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
225 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
226 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
227 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
228 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
229 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
230 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
231 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
232 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
233 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
234 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
242 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
243 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
271 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
272 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
273 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
296 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
297 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
298 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
299 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
300 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
301 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
302 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
303 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
304 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
305 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
306 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
307 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
315 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.09
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 4.73
Rhizosphere 94
Stem 0
Stem Tuber 0.09
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1054661 3300001915 Bacteria 588
2 JGI24746J21847_1005522 3300001977 Bacteria 1972
3 JGI24740J21852_10001260 3300001979 Bacteria 11466
4 JGI24740J21852_10028840 3300001979 Bacteria 1829
5 JGI24739J22299_10005176 3300001989 Bacteria 4969
6 JGI24739J22299_10013165 3300001989 Bacteria 3026
7 JGI24739J22299_10021092 3300001989 Bacteria 2322
8 JGI24739J22299_10143764 3300001989 Bacteria 706
9 JGI24737J22298_10000023 3300001990 Bacteria 45192
10 JGI24737J22298_10109904 3300001990 Bacteria 816
11 JGI24737J22298_10119600 3300001990 Bacteria 778
12 JGI24737J22298_10224261 3300001990 Bacteria 555
13 JGI24735J21928_10007666 3300002067 Bacteria 3515
14 JGI24735J21928_10013549 3300002067 Bacteria 2561
15 JGI24735J21928_10166383 3300002067 Bacteria 637
16 JGI24735J21928_10191892 3300002067 Bacteria 592
17 JGI24748J21848_1018590 3300002074 Bacteria 834
18 JGI24738J21930_10000447 3300002075 Bacteria 11684
19 JGI24738J21930_10057980 3300002075 Bacteria 793
20 JGI24744J21845_10010813 3300002077 Bacteria 1868
21 JGI24744J21845_10051819 3300002077 Bacteria 755
22 JGI24035J26624_1000812 3300002126 Bacteria 2938
23 JGI24034J26672_10001078 3300002239 Bacteria 3568
24 JGI24034J26672_10009700 3300002239 Bacteria 1423
25 JGI24742J22300_10018591 3300002244 Bacteria 1178
26 JGI24751J29686_10140676 3300002459 Bacteria 511
27 rootH1_10103358 3300003323 Bacteria 1354
28 Ga0065712_10128548 3300005290 Bacteria 1577
29 Ga0065712_10427565 3300005290 Bacteria 691
30 Ga0065715_10000657 3300005293 Bacteria 17035
31 Ga0065715_10020001 3300005293 Bacteria 2211
32 Ga0065715_10141163 3300005293 Bacteria 1852
33 Ga0070658_10002256 3300005327 Bacteria 16177
34 Ga0070658_10006784 3300005327 Bacteria 9264
35 Ga0070658_10010906 3300005327 Bacteria 7285
36 Ga0070658_10020956 3300005327 Bacteria 5236
37 Ga0070658_10041320 3300005327 Bacteria 3720
38 Ga0070658_10141320 3300005327 Bacteria 2011
39 Ga0070658_10204592 3300005327 Bacteria 1666
40 Ga0070658_10210431 3300005327 Bacteria 1643
41 Ga0070658_10600740 3300005327 Bacteria 954
42 Ga0070658_10704354 3300005327 Bacteria 876
43 Ga0070658_11445235 3300005327 Bacteria 596
44 Ga0070658_11820091 3300005327 Bacteria 526
45 Ga0070676_10001980 3300005328 Bacteria 10410
46 Ga0070676_10080226 3300005328 Bacteria 1978
47 Ga0070676_10081899 3300005328 Bacteria 1960
48 Ga0070676_10976406 3300005328 Bacteria 635
49 Ga0070676_11037480 3300005328 Bacteria 617
50 Ga0070683_100563325 3300005329 Bacteria 1090
51 Ga0070683_100661215 3300005329 Bacteria 1000
52 Ga0070683_100689394 3300005329 Bacteria 978
53 Ga0070683_100870799 3300005329 Bacteria 864
54 Ga0070683_101789386 3300005329 Bacteria 590
55 Ga0070690_100081968 3300005330 Bacteria 2112
56 Ga0070690_100112306 3300005330 Bacteria 1820
57 Ga0070690_100324088 3300005330 Bacteria 1111
58 Ga0070670_100003331 3300005331 Bacteria 13295
59 Ga0070670_100006052 3300005331 Bacteria 10232
60 Ga0070670_100050265 3300005331 Bacteria 3583
61 Ga0070670_100064137 3300005331 Bacteria 3152
62 Ga0070670_100148953 3300005331 Bacteria 2025
63 Ga0070670_100170022 3300005331 Bacteria 1890
64 Ga0070670_100204578 3300005331 Bacteria 1715
65 Ga0070670_100280962 3300005331 Bacteria 1453
66 Ga0070670_100577998 3300005331 Bacteria 1004
67 Ga0070670_100723448 3300005331 Bacteria 896
68 Ga0070670_101023490 3300005331 Bacteria 752
69 Ga0070677_10006396 3300005333 Bacteria 3912
70 Ga0070677_10030588 3300005333 Bacteria 2051
71 Ga0070677_10075044 3300005333 Bacteria 1432
72 Ga0068869_100058558 3300005334 Bacteria 2817
73 Ga0068869_100236649 3300005334 Bacteria 1453
74 Ga0068869_100291571 3300005334 Bacteria 1315
75 Ga0068869_100823291 3300005334 Bacteria 799
76 Ga0068869_100860966 3300005334 Bacteria 782
77 Ga0070666_10027523 3300005335 Bacteria 3724
78 Ga0070666_10105013 3300005335 Bacteria 1951
79 Ga0070666_10174584 3300005335 Bacteria 1506
80 Ga0070680_100104058 3300005336 Bacteria 2359
81 Ga0070680_100223552 3300005336 Bacteria 1589
82 Ga0070680_100350890 3300005336 Bacteria 1254
83 Ga0070682_101652043 3300005337 Bacteria 555
84 Ga0068868_100023524 3300005338 Bacteria 4663
85 Ga0068868_100210732 3300005338 Bacteria 1624
86 Ga0068868_100354838 3300005338 Bacteria 1257
87 Ga0068868_101327410 3300005338 Bacteria 669
88 Ga0070660_100001246 3300005339 Bacteria 17310
89 Ga0070660_100003129 3300005339 Bacteria 11371
90 Ga0070660_100004229 3300005339 Bacteria 9916
91 Ga0070660_100023619 3300005339 Bacteria 4556
92 Ga0070660_100055965 3300005339 Bacteria 3051
93 Ga0070660_100139681 3300005339 Bacteria 1943
94 Ga0070660_100389642 3300005339 Bacteria 1151
95 Ga0070660_100522620 3300005339 Bacteria 988
96 Ga0070660_100532674 3300005339 Bacteria 979
97 Ga0070660_101644580 3300005339 Bacteria 547
98 Ga0070660_101921566 3300005339 Bacteria 504
99 Ga0070689_100090219 3300005340 Bacteria 2415
100 Ga0070689_100241167 3300005340 Bacteria 1489
101 Ga0070691_10962075 3300005341 Bacteria 530
102 Ga0070687_100539446 3300005343 Bacteria 792
103 Ga0070661_100031531 3300005344 Bacteria 3834
104 Ga0070661_100060868 3300005344 Bacteria 2770
105 Ga0070661_100151273 3300005344 Bacteria 1754
106 Ga0070661_100466240 3300005344 Bacteria 1007
107 Ga0070661_100641479 3300005344 Bacteria 861
108 Ga0070661_100912484 3300005344 Bacteria 725
109 Ga0070661_101026451 3300005344 Bacteria 685
110 Ga0070661_101341913 3300005344 Bacteria 601
111 Ga0070661_101435735 3300005344 Bacteria 581
112 Ga0070661_101612587 3300005344 Bacteria 549
113 Ga0070692_10166038 3300005345 Bacteria 1269
114 Ga0070692_10380285 3300005345 Bacteria 886
115 Ga0070692_10567279 3300005345 Bacteria 746
116 Ga0070668_100027935 3300005347 Bacteria 4282
117 Ga0070668_100114050 3300005347 Bacteria 2153
118 Ga0070668_100222191 3300005347 Bacteria 1558
119 Ga0070668_100406973 3300005347 Bacteria 1163
120 Ga0070668_100743460 3300005347 Bacteria 868
121 Ga0070668_101040719 3300005347 Bacteria 737
122 Ga0070669_100000519 3300005353 Bacteria 28959
123 Ga0070669_100027810 3300005353 Bacteria 4070
124 Ga0070669_100056860 3300005353 Bacteria 2869
125 Ga0070669_100212798 3300005353 Bacteria 1526
126 Ga0070669_100441116 3300005353 Bacteria 1072
127 Ga0070675_100001154 3300005354 Bacteria 19084
128 Ga0070675_100008885 3300005354 Bacteria 7811
129 Ga0070675_100017343 3300005354 Bacteria 5720
130 Ga0070675_100023699 3300005354 Bacteria 4910
131 Ga0070675_100486035 3300005354 Bacteria 1111
132 Ga0070671_100002137 3300005355 Bacteria 15253
133 Ga0070671_100003480 3300005355 Bacteria 12284
134 Ga0070671_100004634 3300005355 Bacteria 10905
135 Ga0070671_100006871 3300005355 Bacteria 9111
136 Ga0070671_100008338 3300005355 Bacteria 8299
137 Ga0070671_100026947 3300005355 Bacteria 4728
138 Ga0070671_100033244 3300005355 Bacteria 4264
139 Ga0070671_100036507 3300005355 Bacteria 4075
140 Ga0070671_100089455 3300005355 Bacteria 2578
141 Ga0070671_100403800 3300005355 Bacteria 1169
142 Ga0070674_100001511 3300005356 Bacteria 12400
143 Ga0070674_100008292 3300005356 Bacteria 6182
144 Ga0070674_100023217 3300005356 Bacteria 4011
145 Ga0070673_100000168 3300005364 Bacteria 31506
146 Ga0070673_100006134 3300005364 Bacteria 7790
147 Ga0070673_100015570 3300005364 Bacteria 5348
148 Ga0070673_100025924 3300005364 Bacteria 4323
149 Ga0070673_100029483 3300005364 Bacteria 4092
150 Ga0070673_100066401 3300005364 Bacteria 2881
151 Ga0070673_100407659 3300005364 Bacteria 1217
152 Ga0070673_100441122 3300005364 Bacteria 1170
153 Ga0070673_100931351 3300005364 Bacteria 807
154 Ga0070673_101363228 3300005364 Bacteria 667
155 Ga0070659_100003143 3300005366 Bacteria 11758
156 Ga0070659_100086341 3300005366 Bacteria 2510
157 Ga0070659_100301972 3300005366 Bacteria 1335
158 Ga0070659_100328343 3300005366 Bacteria 1280
159 Ga0070659_101485837 3300005366 Bacteria 603
160 Ga0070659_101959968 3300005366 Bacteria 526
161 Ga0070667_100002206 3300005367 Bacteria 17134
162 Ga0070667_100002596 3300005367 Bacteria 15685
163 Ga0070667_100016410 3300005367 Bacteria 6129
164 Ga0070667_100052914 3300005367 Bacteria 3426
165 Ga0070667_100353903 3300005367 Bacteria 1330
166 Ga0070667_101960443 3300005367 Bacteria 551
167 Ga0070667_102017399 3300005367 Unclassified 543
168 Ga0070714_100189975 3300005435 Bacteria 1873
169 Ga0070701_10043227 3300005438 Bacteria 2304
170 Ga0070700_100160946 3300005441 Bacteria 1545
171 Ga0070694_100113454 3300005444 Bacteria 1934
172 Ga0070663_100000985 3300005455 Bacteria 15478
173 Ga0070663_100069178 3300005455 Bacteria 2564
174 Ga0070663_100097627 3300005455 Bacteria 2187
175 Ga0070663_100288432 3300005455 Bacteria 1310
176 Ga0070663_100368563 3300005455 Bacteria 1167
177 Ga0070663_100395099 3300005455 Bacteria 1129
178 Ga0070663_100609597 3300005455 Bacteria 919
179 Ga0070663_100759367 3300005455 Bacteria 829
180 Ga0070678_100161100 3300005456 Bacteria 1818
181 Ga0070678_100409642 3300005456 Bacteria 1179
182 Ga0070662_100000298 3300005457 Bacteria 29356
183 Ga0070662_100005160 3300005457 Bacteria 8328
184 Ga0070662_100126963 3300005457 Bacteria 1962
185 Ga0070662_100201471 3300005457 Bacteria 1579
186 Ga0070662_100331990 3300005457 Bacteria 1242
187 Ga0070662_100580248 3300005457 Bacteria 942
188 Ga0070662_100617699 3300005457 Bacteria 913
189 Ga0070681_10048498 3300005458 Bacteria 4243
190 Ga0070681_10417461 3300005458 Bacteria 1254
191 Ga0070681_10444920 3300005458 Bacteria 1208
192 Ga0070681_10725948 3300005458 Bacteria 910
193 Ga0070681_11059145 3300005458 Bacteria 731
194 Ga0068867_100001233 3300005459 Bacteria 17620
195 Ga0068867_100086884 3300005459 Bacteria 2367
196 Ga0068867_101087067 3300005459 Bacteria 729
197 Ga0070685_10838420 3300005466 Bacteria 680
198 Ga0070706_100028793 3300005467 Bacteria 5116
199 Ga0070679_100249758 3300005530 Bacteria 1730
200 Ga0070679_100277884 3300005530 Bacteria 1628
201 Ga0070679_100865771 3300005530 Bacteria 847
202 Ga0070679_101921820 3300005530 Bacteria 540
203 Ga0070684_101194840 3300005535 Bacteria 715
204 Ga0068853_100002745 3300005539 Bacteria 13289
205 Ga0068853_100199668 3300005539 Bacteria 1820
206 Ga0068853_100353859 3300005539 Bacteria 1367
207 Ga0068853_100670440 3300005539 Bacteria 988
208 Ga0068853_100884427 3300005539 Bacteria 857
209 Ga0070672_100000212 3300005543 Bacteria 32213
210 Ga0070672_100002634 3300005543 Bacteria 11475
211 Ga0070672_100096560 3300005543 Bacteria 2391
212 Ga0070672_100321689 3300005543 Bacteria 1315
213 Ga0070672_100403667 3300005543 Bacteria 1172
214 Ga0070672_101457858 3300005543 Bacteria 613
215 Ga0070686_100606581 3300005544 Bacteria 863
216 Ga0070695_100075268 3300005545 Bacteria 2220
217 Ga0070695_101056114 3300005545 Bacteria 663
218 Ga0070696_100021044 3300005546 Bacteria 4420
219 Ga0070696_100166873 3300005546 Bacteria 1625
220 Ga0070696_101110683 3300005546 Bacteria 665
221 Ga0070693_100129286 3300005547 Bacteria 1577
222 Ga0070693_100573833 3300005547 Bacteria 811
223 Ga0070693_100804497 3300005547 Bacteria 697
224 Ga0070665_100000568 3300005548 Bacteria 51571
225 Ga0070665_100011268 3300005548 Bacteria 9042
226 Ga0070665_100012756 3300005548 Bacteria 8465
227 Ga0070665_100015546 3300005548 Bacteria 7644
228 Ga0070665_100757454 3300005548 Bacteria 984
229 Ga0070665_102620434 3300005548 Unclassified 505
230 Ga0070704_101259404 3300005549 Bacteria 676
231 Ga0068855_100006824 3300005563 Bacteria 13852
232 Ga0068855_100007337 3300005563 Bacteria 13359
233 Ga0068855_100540548 3300005563 Bacteria 1262
234 Ga0068855_101071246 3300005563 Bacteria 844
235 Ga0070664_100012419 3300005564 Bacteria 6920
236 Ga0070664_100073400 3300005564 Bacteria 2935
237 Ga0070664_100083144 3300005564 Bacteria 2762
238 Ga0070664_100113791 3300005564 Bacteria 2363
239 Ga0070664_100199675 3300005564 Bacteria 1784
240 Ga0070664_100382227 3300005564 Bacteria 1285
241 Ga0070664_100464116 3300005564 Bacteria 1164
242 Ga0070664_100494681 3300005564 Bacteria 1127
243 Ga0070664_101174740 3300005564 Bacteria 724
244 Ga0068857_100002000 3300005577 Bacteria 16528
245 Ga0068857_100161939 3300005577 Bacteria 2030
246 Ga0068857_100612894 3300005577 Bacteria 1030
247 Ga0068857_100630865 3300005577 Bacteria 1014
248 Ga0068854_100000490 3300005578 Bacteria 24108
249 Ga0068854_100043479 3300005578 Bacteria 3184
250 Ga0068854_100083375 3300005578 Bacteria 2364
251 Ga0068854_100206093 3300005578 Bacteria 1548
252 Ga0068854_100211572 3300005578 Bacteria 1530
253 Ga0068854_100801118 3300005578 Bacteria 821
254 Ga0068854_101369841 3300005578 Bacteria 639
255 Ga0068854_102067114 3300005578 Bacteria 526
256 Ga0068856_100027149 3300005614 Bacteria 5586
257 Ga0068856_100357340 3300005614 Bacteria 1479
258 Ga0070702_100856114 3300005615 Bacteria 708
259 Ga0068852_100001243 3300005616 Bacteria 16977
260 Ga0068852_100073666 3300005616 Bacteria 3005
261 Ga0068852_100293094 3300005616 Bacteria 1572
262 Ga0068852_100704581 3300005616 Bacteria 1020
263 Ga0068852_100727509 3300005616 Bacteria 1004
264 Ga0068852_102735468 3300005616 Unclassified 512
265 Ga0068859_100000136 3300005617 Bacteria 68907
266 Ga0068859_100003807 3300005617 Bacteria 15397
267 Ga0068859_100010301 3300005617 Bacteria 9408
268 Ga0068859_100704300 3300005617 Bacteria 1100
269 Ga0068859_100791065 3300005617 Bacteria 1036
270 Ga0068859_101088191 3300005617 Bacteria 879
271 Ga0068864_100000651 3300005618 Bacteria 29025
272 Ga0068864_100004268 3300005618 Bacteria 11755
273 Ga0068864_100042038 3300005618 Bacteria 3910
274 Ga0068864_100298062 3300005618 Bacteria 1509
275 Ga0068864_100339684 3300005618 Bacteria 1415
276 Ga0068864_100482765 3300005618 Bacteria 1190
277 Ga0068864_100618698 3300005618 Bacteria 1052
278 Ga0068864_100695381 3300005618 Bacteria 993
279 Ga0068864_100785541 3300005618 Bacteria 935
280 Ga0068864_101450994 3300005618 Bacteria 689
281 Ga0068866_10026092 3300005718 Bacteria 2755
282 Ga0068861_100006790 3300005719 Bacteria 7818
283 Ga0068861_100054610 3300005719 Bacteria 3043
284 Ga0068861_101134307 3300005719 Bacteria 753
285 Ga0068861_101562225 3300005719 Bacteria 649
286 Ga0068851_10022381 3300005834 Bacteria 3078
287 Ga0068851_10061181 3300005834 Bacteria 1929
288 Ga0068851_10145331 3300005834 Bacteria 1293
289 Ga0068863_100000140 3300005841 Bacteria 76175
290 Ga0068863_100012641 3300005841 Bacteria 8144
291 Ga0068863_100145426 3300005841 Bacteria 2267
292 Ga0068863_100180453 3300005841 Bacteria 2026
293 Ga0068858_100005794 3300005842 Bacteria 12065
294 Ga0068858_100011264 3300005842 Bacteria 8450
295 Ga0068858_100121517 3300005842 Bacteria 2442
296 Ga0068858_100150303 3300005842 Bacteria 2190
297 Ga0068858_100696478 3300005842 Bacteria 988
298 Ga0068858_101144882 3300005842 Bacteria 764
299 Ga0068860_100004881 3300005843 Bacteria 13665
300 Ga0068860_100012745 3300005843 Bacteria 8267
301 Ga0068860_100065839 3300005843 Bacteria 3441
302 Ga0068860_100113331 3300005843 Bacteria 2593
303 Ga0068860_100165474 3300005843 Bacteria 2135
304 Ga0068860_100337669 3300005843 Bacteria 1481
305 Ga0068862_100003397 3300005844 Bacteria 13728
306 Ga0068862_100017319 3300005844 Bacteria 5998
307 Ga0068862_100051138 3300005844 Bacteria 3533
308 Ga0068862_100063509 3300005844 Bacteria 3177
309 Ga0068862_100143860 3300005844 Bacteria 2118
310 Ga0068862_100168303 3300005844 Bacteria 1960
311 Ga0068862_100295230 3300005844 Bacteria 1490
312 Ga0081539_10052655 3300005985 Bacteria 2284
313 Ga0075364_10080347 3300006051 Bacteria 2155
314 Ga0075432_10208763 3300006058 Bacteria 776
315 Ga0070712_100106327 3300006175 Bacteria 2086
316 Ga0075362_10052132 3300006177 Bacteria 1833
317 Ga0075366_10218500 3300006195 Bacteria 1161
318 Ga0097621_100136717 3300006237 Bacteria 2091
319 Ga0097621_100710188 3300006237 Bacteria 926
320 Ga0097621_100757540 3300006237 Bacteria 897
321 Ga0097621_100786428 3300006237 Bacteria 881
322 Ga0068871_100626711 3300006358 Bacteria 980
323 Ga0068871_100702913 3300006358 Bacteria 926
324 Ga0068871_101489805 3300006358 Bacteria 639
325 Ga0075428_100050761 3300006844 Bacteria 4548
326 Ga0075428_100655910 3300006844 Bacteria 1119
327 Ga0075433_10778804 3300006852 Bacteria 836
328 Ga0075434_100483459 3300006871 Bacteria 1259
329 Ga0075434_101256972 3300006871 Bacteria 752
330 Ga0068865_100004989 3300006881 Bacteria 8025
331 Ga0075436_100335575 3300006914 Bacteria 1088
332 Ga0097620_100000136 3300006931 Bacteria 68907
333 Ga0097620_100003807 3300006931 Bacteria 15397
334 Ga0097620_100010302 3300006931 Bacteria 9408
335 Ga0097620_100704314 3300006931 Bacteria 1100
336 Ga0097620_100791054 3300006931 Bacteria 1036
337 Ga0097620_101088249 3300006931 Bacteria 879
338 Ga0105250_10031848 3300009092 Bacteria 2117
339 Ga0105250_10180872 3300009092 Bacteria 885
340 Ga0111539_10016465 3300009094 Bacteria 9167
341 Ga0111539_10236743 3300009094 Bacteria 2125
342 Ga0111539_10932259 3300009094 Bacteria 1010
343 Ga0105245_10049261 3300009098 Bacteria 3772
344 Ga0105245_11454104 3300009098 Bacteria 736
345 Ga0105247_10027310 3300009101 Bacteria 3452
346 Ga0105247_10101375 3300009101 Bacteria 1841
347 Ga0105247_10237342 3300009101 Bacteria 1241
348 Ga0105247_10905512 3300009101 Bacteria 682
349 Ga0114129_10170049 3300009147 Bacteria 2972
350 Ga0114129_10525425 3300009147 Bacteria 1542
351 Ga0105243_10181840 3300009148 Bacteria 1829
352 Ga0105243_10226777 3300009148 Bacteria 1655
353 Ga0105243_13024679 3300009148 Bacteria 510
354 Ga0105241_10058028 3300009174 Bacteria 2971
355 Ga0105241_10469153 3300009174 Bacteria 1117
356 Ga0105242_10312701 3300009176 Bacteria 1438
357 Ga0105248_10001074 3300009177 Bacteria 30223
358 Ga0105248_10002545 3300009177 Bacteria 20302
359 Ga0105248_10010278 3300009177 Bacteria 10302
360 Ga0105248_10028673 3300009177 Bacteria 6203
361 Ga0105248_10032137 3300009177 Bacteria 5866
362 Ga0105248_10035928 3300009177 Bacteria 5543
363 Ga0105248_10045272 3300009177 Bacteria 4934
364 Ga0105248_10596421 3300009177 Bacteria 1246
365 Ga0105248_10893086 3300009177 Bacteria 1003
366 Ga0105248_10930767 3300009177 Bacteria 982
367 Ga0105248_13238986 3300009177 Bacteria 518
368 Ga0105238_10071081 3300009551 Bacteria 3478
369 Ga0105238_10243761 3300009551 Bacteria 1775
370 Ga0105238_12381123 3300009551 Bacteria 565
371 Ga0105249_10033280 3300009553 Bacteria 4666
372 Ga0105249_10229695 3300009553 Bacteria 1830
373 Ga0105249_10307090 3300009553 Bacteria 1593
374 Ga0105249_10445881 3300009553 Bacteria 1332
375 Ga0105249_11298782 3300009553 Bacteria 799
376 Ga0105249_11430543 3300009553 Bacteria 763
377 Ga0105239_11250205 3300010375 Bacteria 856
378 Ga0105246_10053362 3300011119 Bacteria 2781
379 Ga0105246_10438553 3300011119 Bacteria 1095
380 Ga0105246_10762018 3300011119 Bacteria 855
381 Ga0105246_10867253 3300011119 Bacteria 807
382 Ga0157327_1012426 3300012512 Bacteria 840
383 Ga0157373_10022007 3300013100 Bacteria 4626
384 Ga0157373_10139541 3300013100 Bacteria 1704
385 Ga0157373_10400189 3300013100 Bacteria 984
386 Ga0157373_10419327 3300013100 Bacteria 961
387 Ga0157373_10657246 3300013100 Bacteria 766
388 Ga0157371_10000512 3300013102 Bacteria 46614
389 Ga0157371_10001515 3300013102 Bacteria 24008
390 Ga0157371_10075185 3300013102 Bacteria 2392
391 Ga0157371_10076627 3300013102 Bacteria 2368
392 Ga0157371_10117261 3300013102 Bacteria 1892
393 Ga0157371_10264635 3300013102 Bacteria 1240
394 Ga0157371_10312493 3300013102 Bacteria 1139
395 Ga0157371_10518344 3300013102 Bacteria 881
396 Ga0157371_10763645 3300013102 Bacteria 727
397 Ga0157370_10032358 3300013104 Bacteria 5107
398 Ga0157370_10576175 3300013104 Bacteria 1031
399 Ga0157370_11463426 3300013104 Bacteria 614
400 Ga0157369_10610250 3300013105 Bacteria 1126
401 Ga0157369_10741813 3300013105 Bacteria 1010
402 Ga0157369_10840135 3300013105 Bacteria 943
403 Ga0157369_10914652 3300013105 Bacteria 899
404 Ga0157374_10228279 3300013296 Bacteria 1828
405 Ga0157378_10006998 3300013297 Bacteria 9843
406 Ga0157378_11926241 3300013297 Bacteria 640
407 Ga0157378_12299157 3300013297 Bacteria 591
408 Ga0163162_10064131 3300013306 Bacteria 3719
409 Ga0163162_10476865 3300013306 Bacteria 1379
410 Ga0157372_10009727 3300013307 Bacteria 10225
411 Ga0157372_10151372 3300013307 Bacteria 2678
412 Ga0157372_10152213 3300013307 Bacteria 2670
413 Ga0157372_11023414 3300013307 Bacteria 956
414 Ga0157372_12307419 3300013307 Bacteria 618
415 Ga0157375_10034513 3300013308 Bacteria 4821
416 Ga0157375_10085994 3300013308 Bacteria 3194
417 Ga0157375_10237605 3300013308 Bacteria 1981
418 Ga0157375_10628841 3300013308 Bacteria 1231
419 Ga0157375_11072531 3300013308 Bacteria 942
420 Ga0163163_10001010 3300014325 Bacteria 23813
421 Ga0163163_10254735 3300014325 Bacteria 1806
422 Ga0163163_10538503 3300014325 Bacteria 1230
423 Ga0157380_12740926 3300014326 Unclassified 559
424 Ga0182008_10718676 3300014497 Bacteria 572
425 Ga0157377_10025952 3300014745 Bacteria 3130
426 Ga0157379_10009976 3300014968 Bacteria 8276
427 Ga0157379_10824317 3300014968 Bacteria 877
428 Ga0157379_11022722 3300014968 Bacteria 788
429 Ga0163161_10018665 3300017792 Bacteria 4862
430 Ga0213875_10010269 3300021388 Bacteria 4694
431 Ga0207673_1008958 3300025290 Bacteria 1273
432 Ga0207697_10000134 3300025315 Bacteria 35648
433 Ga0207697_10000170 3300025315 Bacteria 33079
434 Ga0207697_10021260 3300025315 Bacteria 2657
435 Ga0207697_10291166 3300025315 Bacteria 724
436 Ga0207656_10090353 3300025321 Bacteria 1389
437 Ga0207682_10000527 3300025893 Bacteria 17568
438 Ga0207682_10045540 3300025893 Bacteria 1801
439 Ga0207682_10297835 3300025893 Bacteria 756
440 Ga0207682_10562792 3300025893 Bacteria 538
441 Ga0207642_10035029 3300025899 Bacteria 2140
442 Ga0207710_10080968 3300025900 Bacteria 1506
443 Ga0207688_10000457 3300025901 Bacteria 19423
444 Ga0207688_10032990 3300025901 Bacteria 2862
445 Ga0207688_10912958 3300025901 Bacteria 556
446 Ga0207688_10935984 3300025901 Bacteria 548
447 Ga0207680_10253977 3300025903 Bacteria 1215
448 Ga0207647_10001654 3300025904 Bacteria 17155
449 Ga0207647_10026066 3300025904 Bacteria 3828
450 Ga0207647_10070135 3300025904 Bacteria 2118
451 Ga0207645_10002479 3300025907 Bacteria 14486
452 Ga0207645_10004693 3300025907 Bacteria 10055
453 Ga0207645_10037886 3300025907 Bacteria 3094
454 Ga0207645_10073431 3300025907 Bacteria 2190
455 Ga0207645_10580907 3300025907 Bacteria 760
456 Ga0207643_10988091 3300025908 Bacteria 545
457 Ga0207705_10000294 3300025909 Bacteria 46555
458 Ga0207705_10003090 3300025909 Bacteria 12697
459 Ga0207705_10009941 3300025909 Bacteria 6927
460 Ga0207705_10068425 3300025909 Bacteria 2571
461 Ga0207705_10100600 3300025909 Bacteria 2126
462 Ga0207705_10138435 3300025909 Bacteria 1816
463 Ga0207705_10192043 3300025909 Bacteria 1545
464 Ga0207705_10195368 3300025909 Bacteria 1532
465 Ga0207705_10209459 3300025909 Bacteria 1478
466 Ga0207705_10215160 3300025909 Bacteria 1458
467 Ga0207705_10463287 3300025909 Bacteria 983
468 Ga0207705_11036652 3300025909 Bacteria 633
469 Ga0207684_10217235 3300025910 Bacteria 1650
470 Ga0207654_10014454 3300025911 Bacteria 4078
471 Ga0207707_10009510 3300025912 Bacteria 8432
472 Ga0207707_10258743 3300025912 Bacteria 1511
473 Ga0207693_10147881 3300025915 Bacteria 1847
474 Ga0207660_10002416 3300025917 Bacteria 12266
475 Ga0207660_10089378 3300025917 Bacteria 2280
476 Ga0207660_10522028 3300025917 Bacteria 964
477 Ga0207662_10331850 3300025918 Bacteria 1017
478 Ga0207662_11204518 3300025918 Unclassified 538
479 Ga0207657_10000165 3300025919 Bacteria 67173
480 Ga0207657_10000659 3300025919 Bacteria 36733
481 Ga0207657_10001152 3300025919 Bacteria 28121
482 Ga0207657_10025787 3300025919 Bacteria 5414
483 Ga0207657_10034258 3300025919 Bacteria 4569
484 Ga0207657_10065416 3300025919 Bacteria 3099
485 Ga0207657_10080148 3300025919 Bacteria 2745
486 Ga0207657_10109325 3300025919 Bacteria 2285
487 Ga0207657_10156085 3300025919 Bacteria 1856
488 Ga0207657_10218800 3300025919 Bacteria 1526
489 Ga0207649_10018809 3300025920 Bacteria 3938
490 Ga0207649_10019211 3300025920 Bacteria 3903
491 Ga0207649_10078558 3300025920 Bacteria 2130
492 Ga0207649_10128389 3300025920 Bacteria 1719
493 Ga0207649_10204876 3300025920 Bacteria 1396
494 Ga0207649_10232102 3300025920 Bacteria 1320
495 Ga0207649_10288759 3300025920 Bacteria 1195
496 Ga0207649_10605419 3300025920 Bacteria 843
497 Ga0207649_10721857 3300025920 Bacteria 774
498 Ga0207649_10775760 3300025920 Bacteria 747
499 Ga0207649_10802098 3300025920 Bacteria 735
500 Ga0207649_11112109 3300025920 Bacteria 623
501 Ga0207652_10077906 3300025921 Bacteria 2893
502 Ga0207652_10183978 3300025921 Bacteria 1878
503 Ga0207652_10384358 3300025921 Bacteria 1267
504 Ga0207652_10424315 3300025921 Bacteria 1199
505 Ga0207652_10662094 3300025921 Bacteria 933
506 Ga0207681_10000330 3300025923 Bacteria 34082
507 Ga0207681_10002811 3300025923 Bacteria 11017
508 Ga0207681_10041666 3300025923 Bacteria 3063
509 Ga0207681_10384078 3300025923 Bacteria 1131
510 Ga0207681_10860299 3300025923 Bacteria 758
511 Ga0207694_10625477 3300025924 Bacteria 906
512 Ga0207650_10002625 3300025925 Bacteria 12437
513 Ga0207650_10011136 3300025925 Bacteria 6185
514 Ga0207650_10019500 3300025925 Bacteria 4767
515 Ga0207650_10026165 3300025925 Bacteria 4159
516 Ga0207650_10029646 3300025925 Bacteria 3935
517 Ga0207650_10072007 3300025925 Bacteria 2601
518 Ga0207650_10160165 3300025925 Bacteria 1783
519 Ga0207650_10223401 3300025925 Bacteria 1516
520 Ga0207650_10300029 3300025925 Bacteria 1312
521 Ga0207650_10322136 3300025925 Bacteria 1266
522 Ga0207650_10418550 3300025925 Bacteria 1111
523 Ga0207650_10665204 3300025925 Bacteria 878
524 Ga0207650_11810853 3300025925 Bacteria 516
525 Ga0207659_10000877 3300025926 Bacteria 17877
526 Ga0207659_10020281 3300025926 Bacteria 4392
527 Ga0207659_10058975 3300025926 Bacteria 2757
528 Ga0207659_10089799 3300025926 Bacteria 2292
529 Ga0207659_10138995 3300025926 Bacteria 1884
530 Ga0207659_10866898 3300025926 Bacteria 776
531 Ga0207687_10005078 3300025927 Bacteria 8713
532 Ga0207700_10735198 3300025928 Bacteria 881
533 Ga0207664_10157921 3300025929 Bacteria 1932
534 Ga0207644_10001989 3300025931 Bacteria 13220
535 Ga0207644_10014508 3300025931 Bacteria 5270
536 Ga0207644_10016492 3300025931 Bacteria 4971
537 Ga0207644_10021474 3300025931 Bacteria 4399
538 Ga0207644_10049143 3300025931 Bacteria 3018
539 Ga0207644_10051599 3300025931 Bacteria 2953
540 Ga0207644_10204836 3300025931 Bacteria 1557
541 Ga0207644_10206628 3300025931 Bacteria 1551
542 Ga0207644_10810647 3300025931 Bacteria 783
543 Ga0207690_10002756 3300025932 Bacteria 10610
544 Ga0207690_10019941 3300025932 Bacteria 4134
545 Ga0207690_10048424 3300025932 Bacteria 2826
546 Ga0207690_10050538 3300025932 Bacteria 2776
547 Ga0207690_10100429 3300025932 Bacteria 2065
548 Ga0207690_10444310 3300025932 Bacteria 1041
549 Ga0207690_10456634 3300025932 Bacteria 1028
550 Ga0207690_11004559 3300025932 Bacteria 694
551 Ga0207706_10001155 3300025933 Bacteria 26876
552 Ga0207706_10001215 3300025933 Bacteria 26023
553 Ga0207706_10004718 3300025933 Bacteria 12764
554 Ga0207706_10008348 3300025933 Bacteria 9551
555 Ga0207706_10013175 3300025933 Bacteria 7525
556 Ga0207706_10029521 3300025933 Bacteria 4895
557 Ga0207706_10067824 3300025933 Bacteria 3140
558 Ga0207706_10227867 3300025933 Bacteria 1631
559 Ga0207706_10356297 3300025933 Bacteria 1272
560 Ga0207706_10990953 3300025933 Bacteria 706
561 Ga0207706_11068405 3300025933 Bacteria 676
562 Ga0207686_10171860 3300025934 Bacteria 1529
563 Ga0207709_10095107 3300025935 Bacteria 1957
564 Ga0207709_10909197 3300025935 Bacteria 716
565 Ga0207670_10035308 3300025936 Bacteria 3241
566 Ga0207670_10908325 3300025936 Bacteria 738
567 Ga0207669_10011991 3300025937 Bacteria 4243
568 Ga0207669_10058906 3300025937 Bacteria 2346
569 Ga0207704_10000676 3300025938 Bacteria 15087
570 Ga0207704_10439622 3300025938 Bacteria 1039
571 Ga0207704_10594127 3300025938 Bacteria 905
572 Ga0207704_11699673 3300025938 Bacteria 543
573 Ga0207691_10000893 3300025940 Bacteria 29579
574 Ga0207691_10011660 3300025940 Bacteria 8439
575 Ga0207691_10021919 3300025940 Bacteria 6028
576 Ga0207691_10307602 3300025940 Bacteria 1361
577 Ga0207691_10425362 3300025940 Bacteria 1131
578 Ga0207691_10995923 3300025940 Bacteria 699
579 Ga0207691_11133031 3300025940 Bacteria 650
580 Ga0207711_10000105 3300025941 Bacteria 90036
581 Ga0207711_10006500 3300025941 Bacteria 9841
582 Ga0207711_10010952 3300025941 Bacteria 7535
583 Ga0207711_10012212 3300025941 Bacteria 7142
584 Ga0207711_10017343 3300025941 Bacteria 5982
585 Ga0207711_10060038 3300025941 Bacteria 3276
586 Ga0207711_10102417 3300025941 Bacteria 2535
587 Ga0207711_10620627 3300025941 Bacteria 1009
588 Ga0207711_10763789 3300025941 Bacteria 901
589 Ga0207689_10000671 3300025942 Bacteria 32680
590 Ga0207689_10288950 3300025942 Bacteria 1358
591 Ga0207689_10579209 3300025942 Bacteria 943
592 Ga0207689_10739561 3300025942 Bacteria 830
593 Ga0207689_10997089 3300025942 Bacteria 707
594 Ga0207661_10186913 3300025944 Bacteria 1814
595 Ga0207661_10500642 3300025944 Bacteria 1110
596 Ga0207661_10628622 3300025944 Bacteria 986
597 Ga0207679_10067757 3300025945 Bacteria 2679
598 Ga0207679_10130200 3300025945 Bacteria 2017
599 Ga0207679_10147929 3300025945 Bacteria 1908
600 Ga0207679_10249341 3300025945 Bacteria 1508
601 Ga0207679_10273899 3300025945 Bacteria 1445
602 Ga0207679_10363475 3300025945 Bacteria 1264
603 Ga0207679_10440196 3300025945 Bacteria 1154
604 Ga0207679_10461187 3300025945 Bacteria 1128
605 Ga0207679_10950092 3300025945 Bacteria 787
606 Ga0207679_11932580 3300025945 Bacteria 538
607 Ga0207667_10000579 3300025949 Bacteria 47716
608 Ga0207667_10005733 3300025949 Bacteria 15150
609 Ga0207667_11146147 3300025949 Bacteria 759
610 Ga0207651_10004770 3300025960 Bacteria 6891
611 Ga0207651_10007231 3300025960 Bacteria 5904
612 Ga0207651_10017517 3300025960 Bacteria 4235
613 Ga0207651_10029827 3300025960 Bacteria 3463
614 Ga0207651_10212169 3300025960 Bacteria 1559
615 Ga0207651_10295792 3300025960 Bacteria 1344
616 Ga0207651_10403911 3300025960 Bacteria 1163
617 Ga0207651_11223828 3300025960 Bacteria 674
618 Ga0207712_10171131 3300025961 Bacteria 1698
619 Ga0207712_10316831 3300025961 Bacteria 1285
620 Ga0207668_10019734 3300025972 Bacteria 4267
621 Ga0207668_10037160 3300025972 Bacteria 3257
622 Ga0207668_10051841 3300025972 Bacteria 2836
623 Ga0207668_10176974 3300025972 Bacteria 1679
624 Ga0207668_10531592 3300025972 Bacteria 1016
625 Ga0207668_10782544 3300025972 Bacteria 843
626 Ga0207640_10001707 3300025981 Bacteria 11778
627 Ga0207640_10015366 3300025981 Bacteria 4430
628 Ga0207640_10179261 3300025981 Bacteria 1587
629 Ga0207640_10221467 3300025981 Bacteria 1449
630 Ga0207640_10388149 3300025981 Bacteria 1133
631 Ga0207640_10963836 3300025981 Bacteria 748
632 Ga0207640_12016454 3300025981 Bacteria 523
633 Ga0207658_10003869 3300025986 Bacteria 10543
634 Ga0207658_10007908 3300025986 Bacteria 7243
635 Ga0207658_10022041 3300025986 Bacteria 4430
636 Ga0207658_10033936 3300025986 Bacteria 3643
637 Ga0207658_10105838 3300025986 Bacteria 2213
638 Ga0207658_10300586 3300025986 Bacteria 1382
639 Ga0207658_10315612 3300025986 Bacteria 1351
640 Ga0207658_12033919 3300025986 Bacteria 522
641 Ga0207677_10013599 3300026023 Bacteria 4722
642 Ga0207677_10680302 3300026023 Bacteria 911
643 Ga0207703_10000947 3300026035 Bacteria 28126
644 Ga0207703_10033991 3300026035 Bacteria 4044
645 Ga0207703_10144299 3300026035 Bacteria 2069
646 Ga0207703_10420442 3300026035 Bacteria 1244
647 Ga0207703_10439776 3300026035 Bacteria 1216
648 Ga0207703_10679677 3300026035 Bacteria 978
649 Ga0207639_10029473 3300026041 Bacteria 4018
650 Ga0207639_10205603 3300026041 Bacteria 1692
651 Ga0207639_10520591 3300026041 Bacteria 1089
652 Ga0207639_10715017 3300026041 Bacteria 930
653 Ga0207639_10937627 3300026041 Bacteria 810
654 Ga0207678_10000455 3300026067 Bacteria 37036
655 Ga0207678_10000487 3300026067 Bacteria 35968
656 Ga0207678_10079073 3300026067 Bacteria 2816
657 Ga0207678_10252722 3300026067 Bacteria 1510
658 Ga0207678_10330217 3300026067 Bacteria 1313
659 Ga0207678_10777948 3300026067 Bacteria 844
660 Ga0207678_10816987 3300026067 Bacteria 823
661 Ga0207678_10875936 3300026067 Bacteria 794
662 Ga0207678_11160847 3300026067 Bacteria 684
663 Ga0207708_10056464 3300026075 Bacteria 2995
664 Ga0207708_11408792 3300026075 Bacteria 612
665 Ga0207702_10018713 3300026078 Bacteria 5729
666 Ga0207641_10000172 3300026088 Bacteria 90549
667 Ga0207641_10021403 3300026088 Bacteria 5314
668 Ga0207641_10026599 3300026088 Bacteria 4776
669 Ga0207648_10001007 3300026089 Bacteria 31713
670 Ga0207648_10029237 3300026089 Bacteria 4887
671 Ga0207648_10163536 3300026089 Bacteria 1966
672 Ga0207676_10000678 3300026095 Bacteria 27227
673 Ga0207676_10002051 3300026095 Bacteria 14619
674 Ga0207676_10017015 3300026095 Bacteria 5267
675 Ga0207676_10112548 3300026095 Bacteria 2280
676 Ga0207676_10372268 3300026095 Bacteria 1327
677 Ga0207676_10732618 3300026095 Bacteria 960
678 Ga0207674_10001599 3300026116 Bacteria 29166
679 Ga0207674_10003053 3300026116 Bacteria 20715
680 Ga0207674_10045302 3300026116 Bacteria 4525
681 Ga0207674_10095598 3300026116 Bacteria 2957
682 Ga0207675_100069530 3300026118 Bacteria 3291
683 Ga0207675_100135001 3300026118 Bacteria 2340
684 Ga0207675_100902672 3300026118 Bacteria 900
685 Ga0207675_101154659 3300026118 Bacteria 795
686 Ga0207675_101566978 3300026118 Bacteria 679
687 Ga0207675_101652693 3300026118 Bacteria 661
688 Ga0207683_10101192 3300026121 Bacteria 2573
689 Ga0207683_10220627 3300026121 Bacteria 1728
690 Ga0207683_10521091 3300026121 Bacteria 1098
691 Ga0207683_11216926 3300026121 Bacteria 698
692 Ga0207683_11246682 3300026121 Bacteria 689
693 Ga0207698_10110506 3300026142 Bacteria 2302
694 Ga0207698_10466974 3300026142 Bacteria 1221
695 Ga0207698_10829410 3300026142 Bacteria 928
696 Ga0207698_11133880 3300026142 Bacteria 795
697 Ga0207698_11441904 3300026142 Bacteria 704
698 Ga0207698_12242867 3300026142 Bacteria 558
699 Ga0209967_1006328 3300027364 Bacteria 1605
700 Ga0209971_1105638 3300027682 Bacteria 690
701 Ga0207428_10540183 3300027907 Bacteria 844
702 Ga0268266_10000949 3300028379 Bacteria 36940
703 Ga0268266_10011140 3300028379 Bacteria 7829
704 Ga0268266_10017850 3300028379 Bacteria 6046
705 Ga0268266_10250794 3300028379 Bacteria 1637
706 Ga0268266_10647319 3300028379 Bacteria 1017
707 Ga0268266_10710350 3300028379 Bacteria 969
708 Ga0268266_11090713 3300028379 Bacteria 772
709 Ga0268265_10002567 3300028380 Bacteria 13576
710 Ga0268265_10003031 3300028380 Bacteria 12250
711 Ga0268265_10060662 3300028380 Bacteria 2899
712 Ga0268265_10184605 3300028380 Bacteria 1795
713 Ga0268265_10196720 3300028380 Bacteria 1745
714 Ga0268265_10331104 3300028380 Bacteria 1383
715 Ga0268265_10672243 3300028380 Bacteria 997
716 Ga0268265_11747313 3300028380 Bacteria 628
717 Ga0268264_10001846 3300028381 Bacteria 19295
718 Ga0268264_10022763 3300028381 Bacteria 5114
719 Ga0268264_10096684 3300028381 Bacteria 2558
720 Ga0268264_10246616 3300028381 Bacteria 1657
721 Ga0268264_10979570 3300028381 Bacteria 851
722 Ga0307515_10126608 3300028794 Bacteria 2848
723 Ga0316182_1360793 3300030745 Bacteria 1595
724 Ga0307408_100107545 3300031548 Bacteria 2136
725 Ga0307408_100167070 3300031548 Bacteria 1753
726 Ga0307408_100293757 3300031548 Bacteria 1358
727 Ga0307408_100589003 3300031548 Bacteria 986
728 Ga0307408_100600804 3300031548 Bacteria 977
729 Ga0307408_100960373 3300031548 Bacteria 785
730 Ga0307408_101194001 3300031548 Bacteria 709
731 Ga0307408_101272595 3300031548 Bacteria 688
732 Ga0307408_101903009 3300031548 Bacteria 570
733 Ga0307408_102053181 3300031548 Bacteria 550
734 Ga0307405_10048725 3300031731 Bacteria 2614
735 Ga0307405_10057465 3300031731 Bacteria 2444
736 Ga0307405_10074165 3300031731 Bacteria 2199
737 Ga0307405_10293425 3300031731 Bacteria 1230
738 Ga0307405_10449239 3300031731 Bacteria 1021
739 Ga0307405_10545619 3300031731 Bacteria 937
740 Ga0307405_10555093 3300031731 Bacteria 930
741 Ga0307405_10692026 3300031731 Bacteria 843
742 Ga0307405_11390352 3300031731 Bacteria 613
743 Ga0307405_11535409 3300031731 Bacteria 586
744 Ga0307413_10014495 3300031824 Bacteria 4006
745 Ga0307413_10025191 3300031824 Bacteria 3257
746 Ga0307413_10074454 3300031824 Bacteria 2150
747 Ga0307413_10079815 3300031824 Bacteria 2093
748 Ga0307413_10193167 3300031824 Bacteria 1463
749 Ga0307413_10259465 3300031824 Bacteria 1294
750 Ga0307413_10415903 3300031824 Bacteria 1057
751 Ga0307413_10597414 3300031824 Bacteria 903
752 Ga0307413_11068982 3300031824 Bacteria 695
753 Ga0307413_11272379 3300031824 Bacteria 642
754 Ga0307410_10014529 3300031852 Bacteria 4636
755 Ga0307410_10027012 3300031852 Bacteria 3623
756 Ga0307410_10028176 3300031852 Bacteria 3560
757 Ga0307410_10048002 3300031852 Bacteria 2857
758 Ga0307410_10053170 3300031852 Bacteria 2739
759 Ga0307410_10115055 3300031852 Bacteria 1952
760 Ga0307410_10164640 3300031852 Bacteria 1665
761 Ga0307410_10197525 3300031852 Bacteria 1534
762 Ga0307410_10233798 3300031852 Bacteria 1420
763 Ga0307410_10333138 3300031852 Bacteria 1208
764 Ga0307410_10644320 3300031852 Bacteria 888
765 Ga0307410_10661073 3300031852 Bacteria 877
766 Ga0307410_10934345 3300031852 Bacteria 745
767 Ga0307410_11791325 3300031852 Bacteria 545
768 Ga0307410_11804012 3300031852 Bacteria 543
769 Ga0307406_10008277 3300031901 Bacteria 5793
770 Ga0307406_10009128 3300031901 Bacteria 5552
771 Ga0307406_10028456 3300031901 Bacteria 3377
772 Ga0307406_10088496 3300031901 Bacteria 2078
773 Ga0307406_10092491 3300031901 Bacteria 2039
774 Ga0307406_10124151 3300031901 Bacteria 1800
775 Ga0307406_10161044 3300031901 Bacteria 1613
776 Ga0307406_10306644 3300031901 Bacteria 1222
777 Ga0307406_10610486 3300031901 Bacteria 900
778 Ga0307407_10014811 3300031903 Bacteria 3830
779 Ga0307407_10086021 3300031903 Bacteria 1914
780 Ga0307407_10113528 3300031903 Bacteria 1705
781 Ga0307407_10169744 3300031903 Bacteria 1435
782 Ga0307407_10243934 3300031903 Bacteria 1227
783 Ga0307407_10267189 3300031903 Bacteria 1179
784 Ga0307407_10955115 3300031903 Bacteria 660
785 Ga0307412_10016717 3300031911 Bacteria 4376
786 Ga0307412_10125222 3300031911 Bacteria 1857
787 Ga0307412_10186379 3300031911 Bacteria 1565
788 Ga0307412_10233394 3300031911 Bacteria 1418
789 Ga0307412_10347013 3300031911 Bacteria 1190
790 Ga0307412_10682578 3300031911 Bacteria 880
791 Ga0307412_10858270 3300031911 Bacteria 792
792 Ga0307412_10921512 3300031911 Bacteria 767
793 Ga0307412_10951483 3300031911 Bacteria 756
794 Ga0307409_100004691 3300031995 Bacteria 7735
795 Ga0307409_100010724 3300031995 Bacteria 5721
796 Ga0307409_100021228 3300031995 Bacteria 4448
797 Ga0307409_100057833 3300031995 Bacteria 3007
798 Ga0307409_100154762 3300031995 Bacteria 1996
799 Ga0307409_100177649 3300031995 Bacteria 1881
800 Ga0307409_100382788 3300031995 Bacteria 1338
801 Ga0307409_100767264 3300031995 Bacteria 969
802 Ga0307409_100976116 3300031995 Bacteria 864
803 Ga0307409_101723781 3300031995 Bacteria 655
804 Ga0307409_102677210 3300031995 Bacteria 527
805 Ga0307416_100001909 3300032002 Bacteria 11628
806 Ga0307416_100010906 3300032002 Bacteria 6028
807 Ga0307416_100036007 3300032002 Bacteria 3789
808 Ga0307416_100062291 3300032002 Bacteria 3049
809 Ga0307416_100111399 3300032002 Bacteria 2413
810 Ga0307416_100144709 3300032002 Bacteria 2168
811 Ga0307416_100148891 3300032002 Bacteria 2143
812 Ga0307416_100162970 3300032002 Bacteria 2064
813 Ga0307416_100192353 3300032002 Bacteria 1926
814 Ga0307416_101040451 3300032002 Bacteria 922
815 Ga0307416_101429417 3300032002 Bacteria 797
816 Ga0307414_10006145 3300032004 Bacteria 6672
817 Ga0307414_10063509 3300032004 Bacteria 2625
818 Ga0307414_10223729 3300032004 Bacteria 1546
819 Ga0307414_10224120 3300032004 Bacteria 1545
820 Ga0307414_10237605 3300032004 Bacteria 1506
821 Ga0307414_10470111 3300032004 Bacteria 1107
822 Ga0307414_10640953 3300032004 Bacteria 957
823 Ga0307414_11298136 3300032004 Bacteria 675
824 Ga0307414_11409862 3300032004 Bacteria 647
825 Ga0307414_11971449 3300032004 Bacteria 545
826 Ga0307411_10020978 3300032005 Bacteria 3812
827 Ga0307411_10024290 3300032005 Bacteria 3610
828 Ga0307411_10044251 3300032005 Bacteria 2854
829 Ga0307411_10057529 3300032005 Bacteria 2569
830 Ga0307411_10070246 3300032005 Bacteria 2369
831 Ga0307411_10072656 3300032005 Bacteria 2336
832 Ga0307411_10098879 3300032005 Bacteria 2057
833 Ga0307411_10174280 3300032005 Bacteria 1625
834 Ga0307411_10219667 3300032005 Bacteria 1473
835 Ga0307411_10403791 3300032005 Bacteria 1130
836 Ga0307411_10488773 3300032005 Bacteria 1038
837 Ga0307411_10536026 3300032005 Bacteria 996
838 Ga0307411_10694064 3300032005 Bacteria 886
839 Ga0307411_10772679 3300032005 Bacteria 843
840 Ga0307411_11088132 3300032005 Bacteria 720
841 Ga0307415_100002880 3300032126 Bacteria 8614
842 Ga0307415_100044257 3300032126 Bacteria 2975
843 Ga0307415_100053452 3300032126 Bacteria 2752
844 Ga0307415_100094508 3300032126 Bacteria 2174
845 Ga0307415_100097210 3300032126 Bacteria 2148
846 Ga0307415_100157758 3300032126 Bacteria 1754
847 Ga0307415_100341550 3300032126 Bacteria 1257
848 Ga0307415_100639613 3300032126 Bacteria 952
849 Ga0307415_100764409 3300032126 Bacteria 878
850 Ga0307415_100896750 3300032126 Bacteria 817
851 Ga0307415_101183095 3300032126 Bacteria 719
852 Ga0373958_0163981 3300034819 Bacteria 564
853 Ga0373940_0038310 3300035088 Bacteria 1308
854 Ga0373955_0377598 3300035172 Bacteria 860
855 Ga0373942_0089121 3300035207 Bacteria 927
856 Ga0373942_0335306 3300035207 Bacteria 531
857 Ga0373961_0170609 3300035241 Bacteria 752
858 Ga0373947_0957549 3300035725 Bacteria 584
859 Ga0373925_0723169 3300037068 Bacteria 821
860 Ga0395899_0000129 3300037312 Bacteria 118043
861 Ga0395899_0019311 3300037312 Bacteria 5178
862 Ga0395899_0045149 3300037312 Bacteria 3283
863 Ga0395899_0063584 3300037312 Bacteria 2714
864 Ga0395899_0176397 3300037312 Bacteria 1502
865 Ga0395899_0209181 3300037312 Bacteria 1356
866 Ga0395899_0751308 3300037312 Bacteria 607
867 Ga0395899_0893109 3300037312 Bacteria 542
868 Ga0395900_0001038 3300037418 Bacteria 35617
869 Ga0395900_0002548 3300037418 Bacteria 19966
870 Ga0395900_0116599 3300037418 Bacteria 2740
871 Ga0395900_0131864 3300037418 Bacteria 2560
872 Ga0395900_0145223 3300037418 Bacteria 2426
873 Ga0395900_0258555 3300037418 Bacteria 1740
874 Ga0395900_0305121 3300037418 Bacteria 1577
875 Ga0395900_0556027 3300037418 Bacteria 1091
876 Ga0395900_0583483 3300037418 Bacteria 1060
877 Ga0395900_0677908 3300037418 Bacteria 966
878 Ga0395900_1585243 3300037418 Bacteria 566
879 Ga0395898_0018519 3300037466 Bacteria 7097
880 Ga0395898_0025707 3300037466 Bacteria 5929
881 Ga0395898_0235873 3300037466 Bacteria 1744
882 Ga0395898_0611126 3300037466 Bacteria 1033
883 Ga0395905_0000409 3300037471 Bacteria 60283
884 Ga0395905_0004864 3300037471 Bacteria 13845
885 Ga0395905_0015335 3300037471 Bacteria 7285
886 Ga0395905_0025948 3300037471 Bacteria 5524
887 Ga0395905_0037428 3300037471 Bacteria 4555
888 Ga0395905_0053376 3300037471 Bacteria 3783
889 Ga0395905_0057214 3300037471 Bacteria 3647
890 Ga0395905_0093242 3300037471 Bacteria 2824
891 Ga0395905_0170603 3300037471 Bacteria 2043
892 Ga0395905_0296126 3300037471 Bacteria 1505
893 Ga0395905_0432976 3300037471 Bacteria 1212
894 Ga0395905_0501039 3300037471 Bacteria 1114
895 Ga0395905_0529645 3300037471 Bacteria 1079
896 Ga0395905_0662759 3300037471 Bacteria 945
897 Ga0395905_0926518 3300037471 Bacteria 774
898 Ga0395905_1080517 3300037471 Bacteria 705
899 Ga0395905_1451273 3300037471 Bacteria 590
900 Ga0395905_1674711 3300037471 Bacteria 541
901 Ga0436364_1041850 3300037853 Bacteria 4856
902 Ga0395901_0000320 3300038443 Bacteria 59479
903 Ga0395901_0025087 3300038443 Bacteria 6120
904 Ga0395901_0135113 3300038443 Bacteria 2592
905 Ga0395901_0340512 3300038443 Bacteria 1549
906 Ga0395901_0660643 3300038443 Bacteria 1047
907 Ga0395901_1891170 3300038443 Bacteria 544
908 Ga0395901_2110502 3300038443 Bacteria 508
909 Ga0439465_0103702 3300041413 Bacteria 984
910 Ga0451807_2579779 3300041486 Bacteria 972
911 Ga0451839_1402395 3300041496 Bacteria 534
912 Ga0451847_0086637 3300041503 Unclassified 883
913 Ga0451851_0585291 3300041507 Bacteria 713
914 Ga0439445_0270682 3300042004 Bacteria 509
915 Ga0439432_030364 3300042006 Bacteria 1753
916 Ga0439432_080721 3300042006 Bacteria 985
917 Ga0439449_0299973 3300042007 Bacteria 606
918 Ga0450914_018774 3300042118 Bacteria 753
919 Ga0450917_001513 3300042120 Bacteria 1664
920 Ga0450890_007187 3300042127 Bacteria 1421
921 Ga0450891_014517 3300042129 Bacteria 743
922 Ga0450892_005265 3300042130 Bacteria 1064
923 Ga0450905_000807 3300042142 Bacteria 3880
924 Ga0450889_000518 3300042144 Bacteria 4304
925 Ga0450889_004353 3300042144 Bacteria 1400
926 Ga0439458_0133009 3300042157 Bacteria 660
927 Ga0439464_0006222 3300042439 Bacteria 3106
928 Ga0439460_0022785 3300042461 Bacteria 1721
929 Ga0466969_0604428 3300044656 Bacteria 503
930 Ga0466972_0054673 3300044658 Bacteria 1920
931 Ga0466972_0150347 3300044658 Bacteria 1095
932 Ga0466972_0365319 3300044658 Bacteria 675
933 Ga0466965_0391234 3300044683 Bacteria 767
934 Ga0466966_0000021 3300044684 Bacteria 116714
935 Ga0466966_0071477 3300044684 Bacteria 2174
936 Ga0466966_0073540 3300044684 Bacteria 2137
937 Ga0466961_0036749 3300044693 Bacteria 3143
938 Ga0466961_0050292 3300044693 Bacteria 2662
939 Ga0466961_0138872 3300044693 Bacteria 1522
940 Ga0466963_0049397 3300044694 Bacteria 2782
941 Ga0466963_0283979 3300044694 Bacteria 1163
942 Ga0453684_1194802 3300044712 Bacteria 799
943 Ga0466971_0040567 3300044719 Bacteria 2091
944 Ga0466971_0081731 3300044719 Bacteria 1474
945 Ga0466971_0151579 3300044719 Bacteria 1083
946 Ga0466970_0008752 3300044765 Bacteria 5100
947 Ga0466970_0142004 3300044765 Bacteria 1323
948 Ga0466970_0604120 3300044765 Bacteria 636
949 Ga0466970_0774583 3300044765 Bacteria 561
950 Ga0466957_0128761 3300044842 Bacteria 1619
951 Ga0466957_0147739 3300044842 Bacteria 1518
952 Ga0466957_0227235 3300044842 Bacteria 1234
953 Ga0466957_0326003 3300044842 Bacteria 1037
954 Ga0466960_0021758 3300044901 Bacteria 2859
955 Ga0466960_0097166 3300044901 Bacteria 1511
956 Ga0466960_0543294 3300044901 Bacteria 685
957 Ga0466959_0156974 3300045049 Bacteria 1601
958 Ga0466959_0254197 3300045049 Bacteria 1211
959 Ga0451576_0619909 3300045051 Bacteria 1137
960 Ga0466958_1101131 3300045836 Bacteria 518
961 Ga0466967_0196153 3300045976 Bacteria 1910
962 Ga0466967_0238520 3300045976 Bacteria 1734
963 Ga0466967_0489711 3300045976 Bacteria 1205
964 Ga0466967_0954424 3300045976 Bacteria 853
965 Ga0495629_0400252 3300046459 Bacteria 933
966 Ga0495582_0731011 3300046473 Bacteria 573
967 Ga0495585_0021307 3300046492 Bacteria 3722
968 Ga0495631_0435880 3300046518 Bacteria 558
969 Ga0495643_0257029 3300046522 Bacteria 813
970 Ga0495644_0221909 3300046523 Bacteria 731
971 Ga0495663_0001665 3300046525 Bacteria 6928
972 Ga0495663_0009303 3300046525 Bacteria 2724
973 Ga0495663_0009379 3300046525 Bacteria 2713
974 Ga0495642_0058118 3300046528 Bacteria 1601
975 Ga0495642_0085040 3300046528 Bacteria 1335
976 Ga0495598_0000294 3300046537 Bacteria 9015
977 Ga0495598_0068613 3300046537 Bacteria 1111
978 Ga0495621_0006447 3300046539 Bacteria 3426
979 Ga0495621_0008469 3300046539 Bacteria 3086
980 Ga0495621_0020027 3300046539 Bacteria 2190
981 Ga0495621_0052163 3300046539 Bacteria 1465
982 Ga0495633_0011112 3300046558 Bacteria 4879
983 Ga0495633_0038579 3300046558 Bacteria 2281
984 Ga0495656_0098078 3300046615 Bacteria 1351
985 Ga0495656_0173410 3300046615 Bacteria 1056
986 Ga0495668_0041720 3300046616 Bacteria 2555
987 Ga0495668_0295028 3300046616 Bacteria 888
988 Ga0495625_0741123 3300046660 Bacteria 577
989 Ga0495659_0024788 3300046664 Bacteria 2049
990 Ga0495659_0053404 3300046664 Bacteria 1476
991 Ga0495659_0137629 3300046664 Bacteria 972
992 Ga0495659_0330791 3300046664 Bacteria 648
993 Ga0495661_0047982 3300046665 Bacteria 2597
994 Ga0495669_0000570 3300046684 Bacteria 16324
995 Ga0495669_0008258 3300046684 Bacteria 4372
996 Ga0495669_0037414 3300046684 Bacteria 2147
997 Ga0495669_0242856 3300046684 Bacteria 864
998 Ga0495669_0414266 3300046684 Bacteria 653
999 Ga0495670_0006028 3300046691 Bacteria 5939
1000 Ga0495670_0023654 3300046691 Bacteria 3032
1001 Ga0495670_0027330 3300046691 Bacteria 2826
1002 Ga0495670_0087690 3300046691 Bacteria 1590
1003 Ga0495670_0113843 3300046691 Bacteria 1401
1004 Ga0495670_0119891 3300046691 Bacteria 1366
1005 Ga0495636_0092698 3300047318 Bacteria 1313
1006 Ga0495683_0276796 3300047323 Bacteria 728
1007 Ga0495677_0006798 3300047445 Bacteria 4304
1008 Ga0495677_0063342 3300047445 Bacteria 1373
1009 Ga0495677_0364203 3300047445 Bacteria 571
1010 Ga0495685_058768 3300047447 Bacteria 1298
1011 Ga0495685_221481 3300047447 Bacteria 604
1012 Ga0495681_0169716 3300047470 Bacteria 903
1013 Ga0495615_0263618 3300048090 Bacteria 549
1014 Ga0496100_0318130 3300048903 Bacteria 1168
1015 Ga0496100_0547529 3300048903 Bacteria 895
1016 Ga0496100_1295351 3300048903 Bacteria 575
1017 Ga0496101_0017116 3300048904 Bacteria 4911
1018 Ga0496101_1376034 3300048904 Bacteria 551
1019 Ga0496102_1044016 3300048905 Bacteria 737
1020 Ga0496103_0147766 3300048906 Bacteria 1505
1021 Ga0496103_0928908 3300048906 Bacteria 544
1022 Ga0496104_0386744 3300048907 Bacteria 1311
1023 Ga0496105_0229980 3300048908 Bacteria 1507
1024 Ga0496106_0266887 3300048909 Bacteria 1370
1025 Ga0496106_0616016 3300048909 Bacteria 869
1026 Ga0496106_1548607 3300048909 Bacteria 509
1027 Ga0496107_0024108 3300048910 Bacteria 4303
1028 Ga0496107_0076677 3300048910 Bacteria 2435
1029 Ga0496107_0131703 3300048910 Bacteria 1846
1030 Ga0496107_0366688 3300048910 Bacteria 1071
1031 Ga0496108_0085798 3300048911 Bacteria 2673
1032 Ga0496108_0092514 3300048911 Bacteria 2571
1033 Ga0496108_1103169 3300048911 Bacteria 674
1034 Ga0496109_0005425 3300048912 Bacteria 10667
1035 Ga0496109_0017447 3300048912 Bacteria 6294
1036 Ga0496109_0568284 3300048912 Bacteria 1069
1037 Ga0496109_0613092 3300048912 Bacteria 1025
1038 Ga0496109_1062673 3300048912 Bacteria 747
1039 Ga0496109_1104328 3300048912 Bacteria 730
1040 Ga0496109_1329512 3300048912 Bacteria 655
1041 Ga0496110_0002543 3300048913 Bacteria 13715
1042 Ga0496110_0030598 3300048913 Bacteria 4641
1043 Ga0496110_0134371 3300048913 Bacteria 2235
1044 Ga0496110_0166746 3300048913 Bacteria 1997
1045 Ga0496110_0812308 3300048913 Bacteria 840
1046 Ga0496111_0003794 3300048914 Bacteria 9425
1047 Ga0496111_0541010 3300048914 Bacteria 855
1048 Ga0496111_0544445 3300048914 Bacteria 852
1049 Ga0496111_0609766 3300048914 Bacteria 799
1050 Ga0496111_0788831 3300048914 Bacteria 688
1051 Ga0496112_0005134 3300048915 Bacteria 11253
1052 Ga0496112_0084606 3300048915 Bacteria 3137
1053 Ga0496112_0542440 3300048915 Bacteria 1097
1054 Ga0496112_0755888 3300048915 Bacteria 898
1055 Ga0496112_1159914 3300048915 Bacteria 690
1056 Ga0496113_0008196 3300048916 Bacteria 6790
1057 Ga0496113_0178346 3300048916 Bacteria 1684
1058 Ga0496113_0581390 3300048916 Bacteria 897
1059 Ga0496113_0701019 3300048916 Bacteria 808
1060 Ga0496113_1089474 3300048916 Bacteria 627
1061 Ga0496113_1592609 3300048916 Bacteria 503
1062 Ga0496114_0076782 3300048917 Bacteria 2815
1063 Ga0496114_0122386 3300048917 Bacteria 2239
1064 Ga0496115_0001325 3300048918 Bacteria 17649
1065 Ga0501298_075485 3300049521 Bacteria 734
1066 Ga0501040_0395643 3300049576 Bacteria 992
1067 Ga0501048_1291106 3300049582 Bacteria 525
1068 Ga0501067_0394184 3300049583 Bacteria 772
1069 Ga0501067_0733498 3300049583 Bacteria 556
1070 Ga0501076_0380233 3300049592 Bacteria 1161
1071 Ga0501209_133263 3300049656 Bacteria 742
1072 Ga0501209_288365 3300049656 Bacteria 516
1073 Ga0501216_033158 3300049660 Bacteria 962
1074 Ga0501223_005821 3300049663 Bacteria 2576
1075 Ga0501223_041756 3300049663 Bacteria 890
1076 Ga0501224_009989 3300049664 Bacteria 1390
1077 Ga0501233_001896 3300049668 Bacteria 3632
1078 Ga0501235_098151 3300049669 Bacteria 713
1079 Ga0501240_053981 3300049673 Bacteria 695
1080 Ga0501247_008328 3300049677 Bacteria 1208
1081 Ga0501249_008674 3300049679 Bacteria 2110
1082 Ga0501249_037463 3300049679 Bacteria 1094
1083 Ga0501253_045930 3300049683 Bacteria 899
1084 Ga0501245_059819 3300049708 Bacteria 694
1085 Ga0501268_000416 3300049765 Bacteria 4568
1086 Ga0501279_041107 3300049775 Bacteria 710
1087 nmdc:mga00v17_33350_c1 3300050491 Bacteria 3050
1088 nmdc:mga0k408_198361_c1 3300050493 Bacteria 1198
1089 nmdc:mga05p37_243419_c1 3300050507 Bacteria 2161
1090 nmdc:mga08y16_1127347_c1 3300050511 Bacteria 758
1091 nmdc:mga08y16_135508_c1 3300050511 Bacteria 2559
1092 nmdc:mga08y16_1406653_c1 3300050511 Bacteria 661
1093 nmdc:mga08y16_61453_c1 3300050511 Bacteria 3923
1094 nmdc:mga0n895_476361_c1 3300050512 Bacteria 1259
1095 nmdc:mga0a205_473327_c1 3300050515 Bacteria 1111
1096 Ga0500658_0000032 3300053134 Bacteria 90863
1097 Ga0587091_194501 3300059511 Bacteria 541
1098 Ga0466962_0091152 3300061719 Bacteria 1460
1099 Ga0466962_0143308 3300061719 Bacteria 1158

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2885427238 2885429377 84
2 3300001989 JGI24739J22299_10013165 JGI24739J22299_100131654 86
3 3300032004 Ga0307414_10470111 Ga0307414_104701112 86
4 3300005353 Ga0070669_100212798 Ga0070669_1002127983 87
5 3300005546 Ga0070696_100166873 Ga0070696_1001668732 87
6 3300031548 Ga0307408_100960373 Ga0307408_1009603732 87
7 3300032005 Ga0307411_10536026 Ga0307411_105360262 87
8 3300001977 JGI24746J21847_1005522 JGI24746J21847_10055223 88
9 3300001989 JGI24739J22299_10143764 JGI24739J22299_101437642 88
10 3300001990 JGI24737J22298_10119600 JGI24737J22298_101196002 88
11 3300002074 JGI24748J21848_1018590 JGI24748J21848_10185902 88
12 3300002077 JGI24744J21845_10051819 JGI24744J21845_100518192 88
13 3300002239 JGI24034J26672_10001078 JGI24034J26672_100010784 88
14 3300002244 JGI24742J22300_10018591 JGI24742J22300_100185912 88
15 3300005290 Ga0065712_10128548 Ga0065712_101285482 88
16 3300005293 Ga0065715_10000657 Ga0065715_1000065713 88
17 3300005293 Ga0065715_10020001 Ga0065715_100200014 88
18 3300005327 Ga0070658_10041320 Ga0070658_100413204 88
19 3300005328 Ga0070676_10001980 Ga0070676_100019806 88
20 3300005328 Ga0070676_10976406 Ga0070676_109764062 88
21 3300005329 Ga0070683_100689394 Ga0070683_1006893941 88
22 3300005330 Ga0070690_100112306 Ga0070690_1001123063 88
23 3300005331 Ga0070670_100003331 Ga0070670_1000033313 88
24 3300005331 Ga0070670_100006052 Ga0070670_1000060523 88
25 3300005331 Ga0070670_100148953 Ga0070670_1001489532 88
26 3300005331 Ga0070670_100170022 Ga0070670_1001700225 88
27 3300005331 Ga0070670_100204578 Ga0070670_1002045781 88
28 3300005333 Ga0070677_10006396 Ga0070677_100063964 88
29 3300005333 Ga0070677_10030588 Ga0070677_100305883 88
30 3300005334 Ga0068869_100236649 Ga0068869_1002366493 88
31 3300005334 Ga0068869_100860966 Ga0068869_1008609662 88
32 3300005335 Ga0070666_10174584 Ga0070666_101745843 88
33 3300005339 Ga0070660_100055965 Ga0070660_1000559653 88
34 3300005339 Ga0070660_100532674 Ga0070660_1005326742 88
35 3300005340 Ga0070689_100241167 Ga0070689_1002411671 88
36 3300005341 Ga0070691_10962075 Ga0070691_109620752 88
37 3300005344 Ga0070661_100060868 Ga0070661_1000608683 88
38 3300005344 Ga0070661_101341913 Ga0070661_1013419131 88
39 3300005344 Ga0070661_101435735 Ga0070661_1014357352 88
40 3300005345 Ga0070692_10567279 Ga0070692_105672792 88
41 3300005347 Ga0070668_100114050 Ga0070668_1001140503 88
42 3300005353 Ga0070669_100027810 Ga0070669_1000278103 88
43 3300005353 Ga0070669_100056860 Ga0070669_1000568605 88
44 3300005354 Ga0070675_100001154 Ga0070675_10000115422 88
45 3300005354 Ga0070675_100008885 Ga0070675_1000088858 88
46 3300005354 Ga0070675_100023699 Ga0070675_1000236995 88
47 3300005355 Ga0070671_100004634 Ga0070671_10000463413 88
48 3300005355 Ga0070671_100033244 Ga0070671_1000332442 88
49 3300005355 Ga0070671_100036507 Ga0070671_1000365073 88
50 3300005356 Ga0070674_100008292 Ga0070674_1000082925 88
51 3300005356 Ga0070674_100023217 Ga0070674_1000232172 88
52 3300005364 Ga0070673_100006134 Ga0070673_1000061346 88
53 3300005364 Ga0070673_100066401 Ga0070673_1000664014 88
54 3300005364 Ga0070673_100931351 Ga0070673_1009313512 88
55 3300005367 Ga0070667_100016410 Ga0070667_1000164104 88
56 3300005367 Ga0070667_100052914 Ga0070667_1000529144 88
57 3300005438 Ga0070701_10043227 Ga0070701_100432274 88
58 3300005441 Ga0070700_100160946 Ga0070700_1001609462 88
59 3300005455 Ga0070663_100288432 Ga0070663_1002884323 88
60 3300005456 Ga0070678_100161100 Ga0070678_1001611002 88
61 3300005456 Ga0070678_100409642 Ga0070678_1004096422 88
62 3300005457 Ga0070662_100126963 Ga0070662_1001269631 88
63 3300005457 Ga0070662_100201471 Ga0070662_1002014713 88
64 3300005459 Ga0068867_100086884 Ga0068867_1000868842 88
65 3300005535 Ga0070684_101194840 Ga0070684_1011948402 88
66 3300005539 Ga0068853_100670440 Ga0068853_1006704403 88
67 3300005543 Ga0070672_100002634 Ga0070672_10000263411 88
68 3300005543 Ga0070672_100096560 Ga0070672_1000965602 88
69 3300005543 Ga0070672_100403667 Ga0070672_1004036672 88
70 3300005545 Ga0070695_101056114 Ga0070695_1010561142 88
71 3300005564 Ga0070664_100012419 Ga0070664_1000124198 88
72 3300005564 Ga0070664_100464116 Ga0070664_1004641162 88
73 3300005564 Ga0070664_101174740 Ga0070664_1011747402 88
74 3300005577 Ga0068857_100612894 Ga0068857_1006128942 88
75 3300005578 Ga0068854_100083375 Ga0068854_1000833752 88
76 3300005578 Ga0068854_100801118 Ga0068854_1008011182 88
77 3300005617 Ga0068859_100010301 Ga0068859_1000103019 88
78 3300005617 Ga0068859_100791065 Ga0068859_1007910652 88
79 3300005618 Ga0068864_100042038 Ga0068864_1000420383 88
80 3300005618 Ga0068864_100298062 Ga0068864_1002980622 88
81 3300005618 Ga0068864_100482765 Ga0068864_1004827652 88
82 3300005618 Ga0068864_100785541 Ga0068864_1007855412 88
83 3300005618 Ga0068864_101450994 Ga0068864_1014509942 88
84 3300005719 Ga0068861_100006790 Ga0068861_1000067903 88
85 3300005842 Ga0068858_100150303 Ga0068858_1001503034 88
86 3300005842 Ga0068858_101144882 Ga0068858_1011448822 88
87 3300005843 Ga0068860_100065839 Ga0068860_1000658392 88
88 3300005843 Ga0068860_100337669 Ga0068860_1003376691 88
89 3300005844 Ga0068862_100017319 Ga0068862_1000173194 88
90 3300005844 Ga0068862_100168303 Ga0068862_1001683032 88
91 3300005985 Ga0081539_10052655 Ga0081539_100526553 88
92 3300006058 Ga0075432_10208763 Ga0075432_102087632 88
93 3300006237 Ga0097621_100710188 Ga0097621_1007101881 88
94 3300006358 Ga0068871_100702913 Ga0068871_1007029131 88
95 3300006844 Ga0075428_100655910 Ga0075428_1006559103 88
96 3300006852 Ga0075433_10778804 Ga0075433_107788042 88
97 3300006871 Ga0075434_101256972 Ga0075434_1012569722 88
98 3300006931 Ga0097620_100010302 Ga0097620_1000103024 88
99 3300006931 Ga0097620_100791054 Ga0097620_1007910542 88
100 3300009094 Ga0111539_10236743 Ga0111539_102367432 88
101 3300009094 Ga0111539_10932259 Ga0111539_109322592 88
102 3300009101 Ga0105247_10101375 Ga0105247_101013754 88
103 3300009148 Ga0105243_10226777 Ga0105243_102267774 88
104 3300009177 Ga0105248_10010278 Ga0105248_100102788 88
105 3300009177 Ga0105248_10035928 Ga0105248_100359285 88
106 3300009177 Ga0105248_10930767 Ga0105248_109307672 88
107 3300009177 Ga0105248_13238986 Ga0105248_132389861 88
108 3300009553 Ga0105249_10229695 Ga0105249_102296953 88
109 3300009553 Ga0105249_10307090 Ga0105249_103070902 88
110 3300009553 Ga0105249_11430543 Ga0105249_114305432 88
111 3300011119 Ga0105246_10762018 Ga0105246_107620182 88
112 3300011119 Ga0105246_10867253 Ga0105246_108672532 88
113 3300012512 Ga0157327_1012426 Ga0157327_10124262 88
114 3300013100 Ga0157373_10419327 Ga0157373_104193272 88
115 3300013100 Ga0157373_10657246 Ga0157373_106572462 88
116 3300013102 Ga0157371_10076627 Ga0157371_100766273 88
117 3300013306 Ga0163162_10476865 Ga0163162_104768652 88
118 3300013308 Ga0157375_10085994 Ga0157375_100859942 88
119 3300013308 Ga0157375_10237605 Ga0157375_102376053 88
120 3300014325 Ga0163163_10254735 Ga0163163_102547353 88
121 3300014325 Ga0163163_10538503 Ga0163163_105385033 88
122 3300017792 Ga0163161_10018665 Ga0163161_100186655 88
123 3300025315 Ga0207697_10000134 Ga0207697_100001345 88
124 3300025315 Ga0207697_10291166 Ga0207697_102911662 88
125 3300025893 Ga0207682_10000527 Ga0207682_100005278 88
126 3300025893 Ga0207682_10297835 Ga0207682_102978352 88
127 3300025900 Ga0207710_10080968 Ga0207710_100809681 88
128 3300025901 Ga0207688_10935984 Ga0207688_109359842 88
129 3300025907 Ga0207645_10004693 Ga0207645_100046938 88
130 3300025908 Ga0207643_10988091 Ga0207643_109880911 88
131 3300025909 Ga0207705_10209459 Ga0207705_102094593 88
132 3300025918 Ga0207662_10331850 Ga0207662_103318502 88
133 3300025919 Ga0207657_10156085 Ga0207657_101560854 88
134 3300025920 Ga0207649_10078558 Ga0207649_100785583 88
135 3300025920 Ga0207649_11112109 Ga0207649_111121091 88
136 3300025923 Ga0207681_10002811 Ga0207681_100028114 88
137 3300025923 Ga0207681_10041666 Ga0207681_100416665 88
138 3300025923 Ga0207681_10860299 Ga0207681_108602991 88
139 3300025925 Ga0207650_10002625 Ga0207650_1000262514 88
140 3300025925 Ga0207650_10011136 Ga0207650_100111363 88
141 3300025925 Ga0207650_10029646 Ga0207650_100296466 88
142 3300025925 Ga0207650_10072007 Ga0207650_100720073 88
143 3300025925 Ga0207650_10665204 Ga0207650_106652042 88
144 3300025926 Ga0207659_10000877 Ga0207659_1000087715 88
145 3300025926 Ga0207659_10058975 Ga0207659_100589754 88
146 3300025926 Ga0207659_10866898 Ga0207659_108668982 88
147 3300025931 Ga0207644_10001989 Ga0207644_1000198915 88
148 3300025931 Ga0207644_10021474 Ga0207644_100214747 88
149 3300025931 Ga0207644_10204836 Ga0207644_102048363 88
150 3300025933 Ga0207706_10001215 Ga0207706_1000121525 88
151 3300025933 Ga0207706_10008348 Ga0207706_100083481 88
152 3300025933 Ga0207706_10029521 Ga0207706_100295215 88
153 3300025935 Ga0207709_10909197 Ga0207709_109091971 88
154 3300025937 Ga0207669_10011991 Ga0207669_100119914 88
155 3300025937 Ga0207669_10058906 Ga0207669_100589065 88
156 3300025938 Ga0207704_10439622 Ga0207704_104396223 88
157 3300025940 Ga0207691_10011660 Ga0207691_100116606 88
158 3300025940 Ga0207691_10021919 Ga0207691_100219195 88
159 3300025940 Ga0207691_11133031 Ga0207691_111330312 88
160 3300025941 Ga0207711_10010952 Ga0207711_100109528 88
161 3300025941 Ga0207711_10060038 Ga0207711_100600385 88
162 3300025941 Ga0207711_10763789 Ga0207711_107637892 88
163 3300025942 Ga0207689_10579209 Ga0207689_105792092 88
164 3300025942 Ga0207689_10739561 Ga0207689_107395612 88
165 3300025944 Ga0207661_10628622 Ga0207661_106286221 88
166 3300025945 Ga0207679_10130200 Ga0207679_101302002 88
167 3300025945 Ga0207679_10273899 Ga0207679_102738993 88
168 3300025945 Ga0207679_10950092 Ga0207679_109500922 88
169 3300025960 Ga0207651_10017517 Ga0207651_100175176 88
170 3300025960 Ga0207651_10029827 Ga0207651_100298274 88
171 3300025961 Ga0207712_10171131 Ga0207712_101711312 88
172 3300025972 Ga0207668_10019734 Ga0207668_100197344 88
173 3300025981 Ga0207640_10388149 Ga0207640_103881492 88
174 3300025981 Ga0207640_10963836 Ga0207640_109638362 88
175 3300025986 Ga0207658_10033936 Ga0207658_100339365 88
176 3300025986 Ga0207658_10105838 Ga0207658_101058383 88
177 3300026035 Ga0207703_10439776 Ga0207703_104397762 88
178 3300026035 Ga0207703_10679677 Ga0207703_106796772 88
179 3300026041 Ga0207639_10937627 Ga0207639_109376272 88
180 3300026067 Ga0207678_10079073 Ga0207678_100790734 88
181 3300026067 Ga0207678_10330217 Ga0207678_103302172 88
182 3300026075 Ga0207708_10056464 Ga0207708_100564644 88
183 3300026089 Ga0207648_10163536 Ga0207648_101635363 88
184 3300026095 Ga0207676_10017015 Ga0207676_100170155 88
185 3300026095 Ga0207676_10112548 Ga0207676_101125484 88
186 3300026116 Ga0207674_10095598 Ga0207674_100955984 88
187 3300026118 Ga0207675_100135001 Ga0207675_1001350012 88
188 3300026118 Ga0207675_101652693 Ga0207675_1016526931 88
189 3300026121 Ga0207683_10101192 Ga0207683_101011924 88
190 3300026121 Ga0207683_10521091 Ga0207683_105210912 88
191 3300027364 Ga0209967_1006328 Ga0209967_10063285 88
192 3300027682 Ga0209971_1105638 Ga0209971_11056382 88
193 3300027907 Ga0207428_10540183 Ga0207428_105401832 88
194 3300028380 Ga0268265_10672243 Ga0268265_106722432 88
195 3300028380 Ga0268265_11747313 Ga0268265_117473132 88
196 3300028381 Ga0268264_10096684 Ga0268264_100966841 88
197 3300028381 Ga0268264_10979570 Ga0268264_109795702 88
198 3300030745 Ga0316182_1360793 Ga0316182_13607934 88
199 3300031548 Ga0307408_100107545 Ga0307408_1001075453 88
200 3300031548 Ga0307408_100167070 Ga0307408_1001670702 88
201 3300031548 Ga0307408_100589003 Ga0307408_1005890032 88
202 3300031548 Ga0307408_101194001 Ga0307408_1011940012 88
203 3300031548 Ga0307408_101272595 Ga0307408_1012725952 88
204 3300031548 Ga0307408_101903009 Ga0307408_1019030092 88
205 3300031548 Ga0307408_102053181 Ga0307408_1020531812 88
206 3300031731 Ga0307405_10048725 Ga0307405_100487251 88
207 3300031731 Ga0307405_10057465 Ga0307405_100574652 88
208 3300031731 Ga0307405_10293425 Ga0307405_102934252 88
209 3300031731 Ga0307405_10449239 Ga0307405_104492392 88
210 3300031731 Ga0307405_10545619 Ga0307405_105456192 88
211 3300031824 Ga0307413_10025191 Ga0307413_100251915 88
212 3300031824 Ga0307413_10074454 Ga0307413_100744544 88
213 3300031824 Ga0307413_10079815 Ga0307413_100798152 88
214 3300031824 Ga0307413_10415903 Ga0307413_104159032 88
215 3300031824 Ga0307413_10597414 Ga0307413_105974142 88
216 3300031824 Ga0307413_11272379 Ga0307413_112723792 88
217 3300031852 Ga0307410_10014529 Ga0307410_100145295 88
218 3300031852 Ga0307410_10027012 Ga0307410_100270126 88
219 3300031852 Ga0307410_10048002 Ga0307410_100480025 88
220 3300031852 Ga0307410_10115055 Ga0307410_101150553 88
221 3300031852 Ga0307410_10164640 Ga0307410_101646403 88
222 3300031852 Ga0307410_10333138 Ga0307410_103331382 88
223 3300031852 Ga0307410_10644320 Ga0307410_106443202 88
224 3300031852 Ga0307410_10661073 Ga0307410_106610732 88
225 3300031852 Ga0307410_10934345 Ga0307410_109343452 88
226 3300031852 Ga0307410_11791325 Ga0307410_117913252 88
227 3300031852 Ga0307410_11804012 Ga0307410_118040121 88
228 3300031901 Ga0307406_10008277 Ga0307406_100082775 88
229 3300031901 Ga0307406_10009128 Ga0307406_100091283 88
230 3300031901 Ga0307406_10088496 Ga0307406_100884963 88
231 3300031901 Ga0307406_10092491 Ga0307406_100924913 88
232 3300031901 Ga0307406_10124151 Ga0307406_101241514 88
233 3300031901 Ga0307406_10306644 Ga0307406_103066442 88
234 3300031901 Ga0307406_10610486 Ga0307406_106104861 88
235 3300031903 Ga0307407_10014811 Ga0307407_100148115 88
236 3300031903 Ga0307407_10243934 Ga0307407_102439342 88
237 3300031903 Ga0307407_10267189 Ga0307407_102671892 88
238 3300031903 Ga0307407_10955115 Ga0307407_109551152 88
239 3300031911 Ga0307412_10016717 Ga0307412_100167175 88
240 3300031911 Ga0307412_10125222 Ga0307412_101252222 88
241 3300031911 Ga0307412_10233394 Ga0307412_102333942 88
242 3300031911 Ga0307412_10682578 Ga0307412_106825782 88
243 3300031911 Ga0307412_10858270 Ga0307412_108582702 88
244 3300031995 Ga0307409_100004691 Ga0307409_1000046915 88
245 3300031995 Ga0307409_100057833 Ga0307409_1000578335 88
246 3300031995 Ga0307409_100767264 Ga0307409_1007672642 88
247 3300031995 Ga0307409_100976116 Ga0307409_1009761162 88
248 3300031995 Ga0307409_101723781 Ga0307409_1017237812 88
249 3300031995 Ga0307409_102677210 Ga0307409_1026772102 88
250 3300032002 Ga0307416_100001909 Ga0307416_1000019093 88
251 3300032002 Ga0307416_100010906 Ga0307416_1000109062 88
252 3300032002 Ga0307416_100036007 Ga0307416_1000360075 88
253 3300032002 Ga0307416_100062291 Ga0307416_1000622913 88
254 3300032002 Ga0307416_100111399 Ga0307416_1001113992 88
255 3300032002 Ga0307416_100148891 Ga0307416_1001488912 88
256 3300032002 Ga0307416_100192353 Ga0307416_1001923533 88
257 3300032002 Ga0307416_101429417 Ga0307416_1014294172 88
258 3300032004 Ga0307414_10006145 Ga0307414_1000614510 88
259 3300032004 Ga0307414_10063509 Ga0307414_100635094 88
260 3300032004 Ga0307414_10223729 Ga0307414_102237293 88
261 3300032004 Ga0307414_10224120 Ga0307414_102241202 88
262 3300032004 Ga0307414_10237605 Ga0307414_102376053 88
263 3300032004 Ga0307414_10640953 Ga0307414_106409532 88
264 3300032004 Ga0307414_11409862 Ga0307414_114098621 88
265 3300032004 Ga0307414_11971449 Ga0307414_119714492 88
266 3300032005 Ga0307411_10020978 Ga0307411_100209783 88
267 3300032005 Ga0307411_10044251 Ga0307411_100442512 88
268 3300032005 Ga0307411_10057529 Ga0307411_100575293 88
269 3300032005 Ga0307411_10070246 Ga0307411_100702465 88
270 3300032005 Ga0307411_10072656 Ga0307411_100726564 88
271 3300032005 Ga0307411_10219667 Ga0307411_102196672 88
272 3300032005 Ga0307411_10403791 Ga0307411_104037913 88
273 3300032005 Ga0307411_10488773 Ga0307411_104887733 88
274 3300032005 Ga0307411_10694064 Ga0307411_106940642 88
275 3300032005 Ga0307411_10772679 Ga0307411_107726792 88
276 3300032005 Ga0307411_11088132 Ga0307411_110881322 88
277 3300032126 Ga0307415_100002880 Ga0307415_1000028808 88
278 3300032126 Ga0307415_100097210 Ga0307415_1000972102 88
279 3300032126 Ga0307415_100341550 Ga0307415_1003415503 88
280 3300032126 Ga0307415_100639613 Ga0307415_1006396132 88
281 3300032126 Ga0307415_100764409 Ga0307415_1007644092 88
282 3300032126 Ga0307415_100896750 Ga0307415_1008967502 88
283 3300032126 Ga0307415_101183095 Ga0307415_1011830952 88
284 3300035088 Ga0373940_0038310 Ga0373940_0038310_634_900 88
285 3300035207 Ga0373942_0335306 Ga0373942_0335306_149_415 88
286 3300035241 Ga0373961_0170609 Ga0373961_0170609_320_586 88
287 3300041486 Ga0451807_2579779 Ga0451807_2579779_252_518 88
288 3300041503 Ga0451847_0086637 Ga0451847_0086637_70_348 88
289 3300041507 Ga0451851_0585291 Ga0451851_0585291_53_331 88
290 3300042004 Ga0439445_0270682 Ga0439445_0270682_36_302 88
291 3300042006 Ga0439432_030364 Ga0439432_030364_636_902 88
292 3300042007 Ga0439449_0299973 Ga0439449_0299973_96_362 88
293 3300042144 Ga0450889_004353 Ga0450889_004353_973_1239 88
294 3300044712 Ga0453684_1194802 Ga0453684_1194802_297_563 88
295 3300044901 Ga0466960_0543294 Ga0466960_0543294_17_283 88
296 3300046492 Ga0495585_0021307 Ga0495585_0021307_2607_2873 88
297 3300046518 Ga0495631_0435880 Ga0495631_0435880_192_470 88
298 3300046523 Ga0495644_0221909 Ga0495644_0221909_244_510 88
299 3300046525 Ga0495663_0001665 Ga0495663_0001665_6363_6641 88
300 3300046525 Ga0495663_0009303 Ga0495663_0009303_1155_1421 88
301 3300046525 Ga0495663_0009379 Ga0495663_0009379_991_1269 88
302 3300046528 Ga0495642_0058118 Ga0495642_0058118_104_370 88
303 3300046528 Ga0495642_0085040 Ga0495642_0085040_826_1104 88
304 3300046537 Ga0495598_0000294 Ga0495598_0000294_665_931 88
305 3300046537 Ga0495598_0068613 Ga0495598_0068613_590_868 88
306 3300046539 Ga0495621_0006447 Ga0495621_0006447_1236_1502 88
307 3300046539 Ga0495621_0008469 Ga0495621_0008469_1744_2022 88
308 3300046539 Ga0495621_0020027 Ga0495621_0020027_1684_1962 88
309 3300046539 Ga0495621_0052163 Ga0495621_0052163_566_844 88
310 3300046558 Ga0495633_0011112 Ga0495633_0011112_1574_1840 88
311 3300046558 Ga0495633_0038579 Ga0495633_0038579_1909_2187 88
312 3300046615 Ga0495656_0098078 Ga0495656_0098078_978_1244 88
313 3300046615 Ga0495656_0173410 Ga0495656_0173410_353_631 88
314 3300046660 Ga0495625_0741123 Ga0495625_0741123_114_380 88
315 3300046664 Ga0495659_0024788 Ga0495659_0024788_549_827 88
316 3300046664 Ga0495659_0053404 Ga0495659_0053404_842_1120 88
317 3300046664 Ga0495659_0137629 Ga0495659_0137629_564_842 88
318 3300046664 Ga0495659_0330791 Ga0495659_0330791_130_408 88
319 3300046665 Ga0495661_0047982 Ga0495661_0047982_931_1197 88
320 3300046684 Ga0495669_0000570 Ga0495669_0000570_15676_15942 88
321 3300046684 Ga0495669_0008258 Ga0495669_0008258_3113_3379 88
322 3300046684 Ga0495669_0242856 Ga0495669_0242856_167_445 88
323 3300046691 Ga0495670_0006028 Ga0495670_0006028_1669_1947 88
324 3300046691 Ga0495670_0023654 Ga0495670_0023654_1718_1996 88
325 3300046691 Ga0495670_0027330 Ga0495670_0027330_1574_1840 88
326 3300046691 Ga0495670_0087690 Ga0495670_0087690_1256_1534 88
327 3300046691 Ga0495670_0113843 Ga0495670_0113843_991_1269 88
328 3300047318 Ga0495636_0092698 Ga0495636_0092698_415_693 88
329 3300047323 Ga0495683_0276796 Ga0495683_0276796_138_404 88
330 3300047445 Ga0495677_0006798 Ga0495677_0006798_1280_1546 88
331 3300047445 Ga0495677_0063342 Ga0495677_0063342_292_570 88
332 3300047447 Ga0495685_058768 Ga0495685_058768_56_334 88
333 3300047447 Ga0495685_221481 Ga0495685_221481_123_401 88
334 3300047470 Ga0495681_0169716 Ga0495681_0169716_470_736 88
335 3300048090 Ga0495615_0263618 Ga0495615_0263618_91_369 88
336 3300048904 Ga0496101_1376034 Ga0496101_1376034_226_492 88
337 3300048905 Ga0496102_1044016 Ga0496102_1044016_228_494 88
338 3300048906 Ga0496103_0147766 Ga0496103_0147766_428_694 88
339 3300048909 Ga0496106_0616016 Ga0496106_0616016_112_378 88
340 3300048909 Ga0496106_1548607 Ga0496106_1548607_136_402 88
341 3300048911 Ga0496108_0085798 Ga0496108_0085798_2058_2324 88
342 3300048911 Ga0496108_1103169 Ga0496108_1103169_278_544 88
343 3300048912 Ga0496109_0017447 Ga0496109_0017447_1412_1678 88
344 3300048912 Ga0496109_0613092 Ga0496109_0613092_525_791 88
345 3300048912 Ga0496109_1329512 Ga0496109_1329512_324_602 88
346 3300048913 Ga0496110_0002543 Ga0496110_0002543_1716_1982 88
347 3300048914 Ga0496111_0541010 Ga0496111_0541010_10_276 88
348 3300048914 Ga0496111_0544445 Ga0496111_0544445_508_786 88
349 3300048914 Ga0496111_0788831 Ga0496111_0788831_324_590 88
350 3300048916 Ga0496113_1089474 Ga0496113_1089474_236_502 88
351 3300048917 Ga0496114_0076782 Ga0496114_0076782_470_736 88
352 3300049576 Ga0501040_0395643 Ga0501040_0395643_602_880 88
353 3300049582 Ga0501048_1291106 Ga0501048_1291106_75_341 88
354 3300049592 Ga0501076_0380233 Ga0501076_0380233_212_478 88
355 3300050511 nmdc:mga08y16_1127347_c1 nmdc:mga08y16_1127347_c1_113_391 88
356 3300050511 nmdc:mga08y16_135508_c1 nmdc:mga08y16_135508_c1_1588_1866 88
357 3300050511 nmdc:mga08y16_1406653_c1 nmdc:mga08y16_1406653_c1_76_354 88
358 3300050515 nmdc:mga0a205_473327_c1 nmdc:mga0a205_473327_c1_263_541 88
359 3300002067 JGI24735J21928_10007666 JGI24735J21928_100076662 89
360 3300005329 Ga0070683_100661215 Ga0070683_1006612152 89
361 3300005345 Ga0070692_10380285 Ga0070692_103802852 89
362 3300005366 Ga0070659_101485837 Ga0070659_1014858372 89
363 3300005455 Ga0070663_100000985 Ga0070663_1000009852 89
364 3300005457 Ga0070662_100331990 Ga0070662_1003319902 89
365 3300005458 Ga0070681_11059145 Ga0070681_110591451 89
366 3300005539 Ga0068853_100884427 Ga0068853_1008844272 89
367 3300005547 Ga0070693_100129286 Ga0070693_1001292862 89
368 3300005563 Ga0068855_100540548 Ga0068855_1005405482 89
369 3300005564 Ga0070664_100382227 Ga0070664_1003822273 89
370 3300005577 Ga0068857_100630865 Ga0068857_1006308652 89
371 3300005578 Ga0068854_100043479 Ga0068854_1000434796 89
372 3300005616 Ga0068852_100704581 Ga0068852_1007045812 89
373 3300006237 Ga0097621_100136717 Ga0097621_1001367172 89
374 3300013100 Ga0157373_10400189 Ga0157373_104001892 89
375 3300013102 Ga0157371_10763645 Ga0157371_107636452 89
376 3300013307 Ga0157372_10151372 Ga0157372_101513726 89
377 3300025909 Ga0207705_10009941 Ga0207705_100099414 89
378 3300025912 Ga0207707_10009510 Ga0207707_100095109 89
379 3300025917 Ga0207660_10002416 Ga0207660_100024162 89
380 3300025919 Ga0207657_10080148 Ga0207657_100801482 89
381 3300025920 Ga0207649_10288759 Ga0207649_102887592 89
382 3300025921 Ga0207652_10077906 Ga0207652_100779066 89
383 3300025932 Ga0207690_10019941 Ga0207690_100199413 89
384 3300025933 Ga0207706_10004718 Ga0207706_100047184 89
385 3300025944 Ga0207661_10186913 Ga0207661_101869132 89
386 3300025949 Ga0207667_11146147 Ga0207667_111461471 89
387 3300025981 Ga0207640_10015366 Ga0207640_100153662 89
388 3300026041 Ga0207639_10029473 Ga0207639_100294736 89
389 3300026067 Ga0207678_10000455 Ga0207678_1000045523 89
390 3300026116 Ga0207674_10003053 Ga0207674_100030539 89
391 3300026118 Ga0207675_100902672 Ga0207675_1009026722 89
392 3300026142 Ga0207698_10829410 Ga0207698_108294102 89
393 3300031548 Ga0307408_100600804 Ga0307408_1006008042 89
394 3300031731 Ga0307405_10074165 Ga0307405_100741655 89
395 3300031824 Ga0307413_10259465 Ga0307413_102594651 89
396 3300031852 Ga0307410_10233798 Ga0307410_102337982 89
397 3300031903 Ga0307407_10169744 Ga0307407_101697443 89
398 3300032005 Ga0307411_10098879 Ga0307411_100988793 89
399 3300032126 Ga0307415_100157758 Ga0307415_1001577584 89
400 3300041413 Ga0439465_0103702 Ga0439465_0103702_675_950 89
401 3300042006 Ga0439432_080721 Ga0439432_080721_413_688 89
402 3300045051 Ga0451576_0619909 Ga0451576_0619909_519_794 89
403 3300048906 Ga0496103_0928908 Ga0496103_0928908_112_381 89
404 3300049521 Ga0501298_075485 Ga0501298_075485_308_583 89
405 3300049656 Ga0501209_133263 Ga0501209_133263_180_455 89
406 3300049660 Ga0501216_033158 Ga0501216_033158_514_789 89
407 3300049663 Ga0501223_005821 Ga0501223_005821_759_1034 89
408 3300049664 Ga0501224_009989 Ga0501224_009989_508_783 89
409 3300049668 Ga0501233_001896 Ga0501233_001896_2584_2859 89
410 3300049669 Ga0501235_098151 Ga0501235_098151_63_338 89
411 3300049673 Ga0501240_053981 Ga0501240_053981_401_676 89
412 3300049677 Ga0501247_008328 Ga0501247_008328_596_871 89
413 3300049679 Ga0501249_037463 Ga0501249_037463_145_420 89
414 3300049683 Ga0501253_045930 Ga0501253_045930_66_341 89
415 3300049708 Ga0501245_059819 Ga0501245_059819_400_675 89
416 3300049765 Ga0501268_000416 Ga0501268_000416_2908_3183 89
417 3300049775 Ga0501279_041107 Ga0501279_041107_144_419 89
418 3300001990 JGI24737J22298_10224261 JGI24737J22298_102242611 90
419 3300002067 JGI24735J21928_10166383 JGI24735J21928_101663832 90
420 3300002067 JGI24735J21928_10191892 JGI24735J21928_101918922 90
421 3300002459 JGI24751J29686_10140676 JGI24751J29686_101406761 90
422 3300003323 rootH1_10103358 rootH1_101033581 90
423 3300005290 Ga0065712_10427565 Ga0065712_104275652 90
424 3300005293 Ga0065715_10141163 Ga0065715_101411634 90
425 3300005327 Ga0070658_10002256 Ga0070658_100022567 90
426 3300005327 Ga0070658_10006784 Ga0070658_1000678411 90
427 3300005327 Ga0070658_10010906 Ga0070658_100109066 90
428 3300005327 Ga0070658_10210431 Ga0070658_102104312 90
429 3300005329 Ga0070683_100870799 Ga0070683_1008707991 90
430 3300005330 Ga0070690_100324088 Ga0070690_1003240883 90
431 3300005331 Ga0070670_100050265 Ga0070670_1000502652 90
432 3300005331 Ga0070670_100723448 Ga0070670_1007234482 90
433 3300005331 Ga0070670_101023490 Ga0070670_1010234902 90
434 3300005333 Ga0070677_10075044 Ga0070677_100750442 90
435 3300005334 Ga0068869_100823291 Ga0068869_1008232911 90
436 3300005336 Ga0070680_100104058 Ga0070680_1001040584 90
437 3300005336 Ga0070680_100223552 Ga0070680_1002235522 90
438 3300005339 Ga0070660_100003129 Ga0070660_10000312914 90
439 3300005339 Ga0070660_100004229 Ga0070660_1000042294 90
440 3300005339 Ga0070660_100139681 Ga0070660_1001396812 90
441 3300005339 Ga0070660_100389642 Ga0070660_1003896422 90
442 3300005339 Ga0070660_100522620 Ga0070660_1005226202 90
443 3300005339 Ga0070660_101644580 Ga0070660_1016445802 90
444 3300005344 Ga0070661_100151273 Ga0070661_1001512732 90
445 3300005344 Ga0070661_100466240 Ga0070661_1004662402 90
446 3300005344 Ga0070661_101612587 Ga0070661_1016125871 90
447 3300005345 Ga0070692_10166038 Ga0070692_101660383 90
448 3300005354 Ga0070675_100017343 Ga0070675_1000173438 90
449 3300005355 Ga0070671_100003480 Ga0070671_1000034807 90
450 3300005355 Ga0070671_100006871 Ga0070671_1000068717 90
451 3300005355 Ga0070671_100008338 Ga0070671_1000083381 90
452 3300005355 Ga0070671_100089455 Ga0070671_1000894553 90
453 3300005364 Ga0070673_100015570 Ga0070673_1000155705 90
454 3300005364 Ga0070673_100407659 Ga0070673_1004076592 90
455 3300005364 Ga0070673_101363228 Ga0070673_1013632282 90
456 3300005366 Ga0070659_100086341 Ga0070659_1000863415 90
457 3300005366 Ga0070659_100328343 Ga0070659_1003283431 90
458 3300005366 Ga0070659_101959968 Ga0070659_1019599681 90
459 3300005367 Ga0070667_102017399 Ga0070667_1020173992 90
460 3300005444 Ga0070694_100113454 Ga0070694_1001134545 90
461 3300005455 Ga0070663_100759367 Ga0070663_1007593672 90
462 3300005457 Ga0070662_100580248 Ga0070662_1005802482 90
463 3300005458 Ga0070681_10048498 Ga0070681_100484985 90
464 3300005458 Ga0070681_10417461 Ga0070681_104174613 90
465 3300005458 Ga0070681_10444920 Ga0070681_104449201 90
466 3300005458 Ga0070681_10725948 Ga0070681_107259481 90
467 3300005467 Ga0070706_100028793 Ga0070706_1000287934 90
468 3300005530 Ga0070679_100249758 Ga0070679_1002497583 90
469 3300005530 Ga0070679_100865771 Ga0070679_1008657712 90
470 3300005530 Ga0070679_101921820 Ga0070679_1019218202 90
471 3300005543 Ga0070672_100321689 Ga0070672_1003216891 90
472 3300005543 Ga0070672_101457858 Ga0070672_1014578582 90
473 3300005544 Ga0070686_100606581 Ga0070686_1006065812 90
474 3300005545 Ga0070695_100075268 Ga0070695_1000752683 90
475 3300005546 Ga0070696_100021044 Ga0070696_1000210445 90
476 3300005547 Ga0070693_100573833 Ga0070693_1005738332 90
477 3300005548 Ga0070665_100757454 Ga0070665_1007574542 90
478 3300005548 Ga0070665_102620434 Ga0070665_1026204342 90
479 3300005549 Ga0070704_101259404 Ga0070704_1012594042 90
480 3300005563 Ga0068855_100006824 Ga0068855_1000068242 90
481 3300005564 Ga0070664_100073400 Ga0070664_1000734002 90
482 3300005564 Ga0070664_100083144 Ga0070664_1000831443 90
483 3300005564 Ga0070664_100113791 Ga0070664_1001137912 90
484 3300005578 Ga0068854_100211572 Ga0068854_1002115722 90
485 3300005614 Ga0068856_100027149 Ga0068856_1000271495 90
486 3300005616 Ga0068852_100073666 Ga0068852_1000736665 90
487 3300005616 Ga0068852_100727509 Ga0068852_1007275092 90
488 3300005616 Ga0068852_102735468 Ga0068852_1027354681 90
489 3300005618 Ga0068864_100339684 Ga0068864_1003396843 90
490 3300005618 Ga0068864_100695381 Ga0068864_1006953812 90
491 3300005834 Ga0068851_10022381 Ga0068851_100223811 90
492 3300005844 Ga0068862_100143860 Ga0068862_1001438603 90
493 3300006051 Ga0075364_10080347 Ga0075364_100803472 90
494 3300006177 Ga0075362_10052132 Ga0075362_100521322 90
495 3300006195 Ga0075366_10218500 Ga0075366_102185002 90
496 3300006237 Ga0097621_100786428 Ga0097621_1007864282 90
497 3300006871 Ga0075434_100483459 Ga0075434_1004834592 90
498 3300009094 Ga0111539_10016465 Ga0111539_1001646510 90
499 3300009147 Ga0114129_10525425 Ga0114129_105254252 90
500 3300009148 Ga0105243_13024679 Ga0105243_130246792 90
501 3300009177 Ga0105248_10028673 Ga0105248_100286734 90
502 3300009177 Ga0105248_10032137 Ga0105248_100321377 90
503 3300009177 Ga0105248_10893086 Ga0105248_108930862 90
504 3300013102 Ga0157371_10001515 Ga0157371_100015159 90
505 3300013102 Ga0157371_10117261 Ga0157371_101172614 90
506 3300013102 Ga0157371_10518344 Ga0157371_105183442 90
507 3300013104 Ga0157370_10032358 Ga0157370_100323583 90
508 3300013104 Ga0157370_10576175 Ga0157370_105761753 90
509 3300013105 Ga0157369_10914652 Ga0157369_109146522 90
510 3300013296 Ga0157374_10228279 Ga0157374_102282795 90
511 3300013307 Ga0157372_12307419 Ga0157372_123074192 90
512 3300013308 Ga0157375_10628841 Ga0157375_106288412 90
513 3300014968 Ga0157379_10824317 Ga0157379_108243172 90
514 3300025315 Ga0207697_10021260 Ga0207697_100212604 90
515 3300025893 Ga0207682_10045540 Ga0207682_100455402 90
516 3300025901 Ga0207688_10912958 Ga0207688_109129582 90
517 3300025904 Ga0207647_10026066 Ga0207647_100260666 90
518 3300025909 Ga0207705_10000294 Ga0207705_1000029437 90
519 3300025909 Ga0207705_10003090 Ga0207705_100030906 90
520 3300025909 Ga0207705_10100600 Ga0207705_101006005 90
521 3300025909 Ga0207705_10138435 Ga0207705_101384352 90
522 3300025909 Ga0207705_10215160 Ga0207705_102151602 90
523 3300025910 Ga0207684_10217235 Ga0207684_102172355 90
524 3300025912 Ga0207707_10258743 Ga0207707_102587434 90
525 3300025917 Ga0207660_10089378 Ga0207660_100893782 90
526 3300025917 Ga0207660_10522028 Ga0207660_105220282 90
527 3300025919 Ga0207657_10000165 Ga0207657_1000016528 90
528 3300025919 Ga0207657_10000659 Ga0207657_100006594 90
529 3300025919 Ga0207657_10034258 Ga0207657_100342583 90
530 3300025919 Ga0207657_10109325 Ga0207657_101093254 90
531 3300025919 Ga0207657_10218800 Ga0207657_102188002 90
532 3300025920 Ga0207649_10128389 Ga0207649_101283893 90
533 3300025920 Ga0207649_10204876 Ga0207649_102048763 90
534 3300025920 Ga0207649_10232102 Ga0207649_102321022 90
535 3300025920 Ga0207649_10605419 Ga0207649_106054192 90
536 3300025920 Ga0207649_10721857 Ga0207649_107218572 90
537 3300025921 Ga0207652_10183978 Ga0207652_101839784 90
538 3300025921 Ga0207652_10384358 Ga0207652_103843584 90
539 3300025921 Ga0207652_10662094 Ga0207652_106620942 90
540 3300025925 Ga0207650_10019500 Ga0207650_100195002 90
541 3300025925 Ga0207650_10026165 Ga0207650_100261655 90
542 3300025925 Ga0207650_10160165 Ga0207650_101601653 90
543 3300025925 Ga0207650_10300029 Ga0207650_103000292 90
544 3300025926 Ga0207659_10020281 Ga0207659_100202813 90
545 3300025926 Ga0207659_10138995 Ga0207659_101389953 90
546 3300025928 Ga0207700_10735198 Ga0207700_107351982 90
547 3300025931 Ga0207644_10014508 Ga0207644_100145084 90
548 3300025931 Ga0207644_10051599 Ga0207644_100515994 90
549 3300025931 Ga0207644_10810647 Ga0207644_108106472 90
550 3300025932 Ga0207690_10048424 Ga0207690_100484242 90
551 3300025932 Ga0207690_10100429 Ga0207690_101004294 90
552 3300025932 Ga0207690_10444310 Ga0207690_104443102 90
553 3300025933 Ga0207706_10067824 Ga0207706_100678243 90
554 3300025933 Ga0207706_10356297 Ga0207706_103562973 90
555 3300025933 Ga0207706_10990953 Ga0207706_109909531 90
556 3300025933 Ga0207706_11068405 Ga0207706_110684051 90
557 3300025938 Ga0207704_11699673 Ga0207704_116996732 90
558 3300025940 Ga0207691_10307602 Ga0207691_103076023 90
559 3300025940 Ga0207691_10425362 Ga0207691_104253621 90
560 3300025941 Ga0207711_10012212 Ga0207711_100122127 90
561 3300025941 Ga0207711_10102417 Ga0207711_101024175 90
562 3300025941 Ga0207711_10620627 Ga0207711_106206272 90
563 3300025945 Ga0207679_10067757 Ga0207679_100677573 90
564 3300025945 Ga0207679_10249341 Ga0207679_102493414 90
565 3300025945 Ga0207679_10363475 Ga0207679_103634752 90
566 3300025945 Ga0207679_10440196 Ga0207679_104401962 90
567 3300025949 Ga0207667_10000579 Ga0207667_100005795 90
568 3300025960 Ga0207651_10212169 Ga0207651_102121692 90
569 3300025960 Ga0207651_10295792 Ga0207651_102957923 90
570 3300025960 Ga0207651_10403911 Ga0207651_104039112 90
571 3300025960 Ga0207651_11223828 Ga0207651_112238282 90
572 3300025981 Ga0207640_10179261 Ga0207640_101792612 90
573 3300026041 Ga0207639_10715017 Ga0207639_107150172 90
574 3300026067 Ga0207678_10875936 Ga0207678_108759362 90
575 3300026078 Ga0207702_10018713 Ga0207702_100187135 90
576 3300026095 Ga0207676_10372268 Ga0207676_103722683 90
577 3300026142 Ga0207698_11133880 Ga0207698_111338802 90
578 3300026142 Ga0207698_12242867 Ga0207698_122428672 90
579 3300028379 Ga0268266_10647319 Ga0268266_106473192 90
580 3300028379 Ga0268266_10710350 Ga0268266_107103502 90
581 3300028380 Ga0268265_10060662 Ga0268265_100606623 90
582 3300031731 Ga0307405_11535409 Ga0307405_115354092 90
583 3300031824 Ga0307413_11068982 Ga0307413_110689822 90
584 3300031852 Ga0307410_10028176 Ga0307410_100281763 90
585 3300031852 Ga0307410_10197525 Ga0307410_101975251 90
586 3300031901 Ga0307406_10161044 Ga0307406_101610442 90
587 3300031911 Ga0307412_10347013 Ga0307412_103470132 90
588 3300031995 Ga0307409_100154762 Ga0307409_1001547623 90
589 3300031995 Ga0307409_100177649 Ga0307409_1001776493 90
590 3300031995 Ga0307409_100382788 Ga0307409_1003827882 90
591 3300032002 Ga0307416_100162970 Ga0307416_1001629703 90
592 3300032005 Ga0307411_10024290 Ga0307411_100242906 90
593 3300032126 Ga0307415_100053452 Ga0307415_1000534523 90
594 3300034819 Ga0373958_0163981 Ga0373958_0163981_164_436 90
595 3300035207 Ga0373942_0089121 Ga0373942_0089121_326_598 90
596 3300037312 Ga0395899_0000129 Ga0395899_0000129_96098_96370 90
597 3300037312 Ga0395899_0019311 Ga0395899_0019311_2958_3230 90
598 3300037312 Ga0395899_0045149 Ga0395899_0045149_562_834 90
599 3300037312 Ga0395899_0063584 Ga0395899_0063584_2224_2496 90
600 3300037312 Ga0395899_0176397 Ga0395899_0176397_592_864 90
601 3300037312 Ga0395899_0209181 Ga0395899_0209181_698_970 90
602 3300037312 Ga0395899_0751308 Ga0395899_0751308_110_382 90
603 3300037312 Ga0395899_0893109 Ga0395899_0893109_192_464 90
604 3300037418 Ga0395900_0001038 Ga0395900_0001038_27396_27668 90
605 3300037418 Ga0395900_0131864 Ga0395900_0131864_286_558 90
606 3300037418 Ga0395900_0145223 Ga0395900_0145223_1450_1722 90
607 3300037418 Ga0395900_0556027 Ga0395900_0556027_755_1027 90
608 3300037466 Ga0395898_0018519 Ga0395898_0018519_2966_3238 90
609 3300037466 Ga0395898_0025707 Ga0395898_0025707_1682_1954 90
610 3300037466 Ga0395898_0235873 Ga0395898_0235873_1310_1582 90
611 3300037466 Ga0395898_0611126 Ga0395898_0611126_747_1019 90
612 3300037471 Ga0395905_0025948 Ga0395905_0025948_1627_1899 90
613 3300037471 Ga0395905_0057214 Ga0395905_0057214_1926_2198 90
614 3300037471 Ga0395905_0170603 Ga0395905_0170603_611_883 90
615 3300037471 Ga0395905_0432976 Ga0395905_0432976_803_1075 90
616 3300037471 Ga0395905_0662759 Ga0395905_0662759_286_558 90
617 3300037471 Ga0395905_1080517 Ga0395905_1080517_46_318 90
618 3300037471 Ga0395905_1451273 Ga0395905_1451273_131_403 90
619 3300038443 Ga0395901_0000320 Ga0395901_0000320_38003_38275 90
620 3300038443 Ga0395901_0025087 Ga0395901_0025087_4688_4960 90
621 3300038443 Ga0395901_0340512 Ga0395901_0340512_923_1195 90
622 3300038443 Ga0395901_0660643 Ga0395901_0660643_73_345 90
623 3300038443 Ga0395901_1891170 Ga0395901_1891170_224_496 90
624 3300038443 Ga0395901_2110502 Ga0395901_2110502_144_416 90
625 3300042118 Ga0450914_018774 Ga0450914_018774_165_437 90
626 3300042120 Ga0450917_001513 Ga0450917_001513_628_900 90
627 3300042127 Ga0450890_007187 Ga0450890_007187_537_809 90
628 3300042129 Ga0450891_014517 Ga0450891_014517_395_667 90
629 3300042130 Ga0450892_005265 Ga0450892_005265_57_329 90
630 3300042142 Ga0450905_000807 Ga0450905_000807_1826_2098 90
631 3300042144 Ga0450889_000518 Ga0450889_000518_2595_2867 90
632 3300044658 Ga0466972_0054673 Ga0466972_0054673_250_522 90
633 3300044658 Ga0466972_0150347 Ga0466972_0150347_202_522 90
634 3300044658 Ga0466972_0365319 Ga0466972_0365319_254_526 90
635 3300044683 Ga0466965_0391234 Ga0466965_0391234_337_609 90
636 3300044684 Ga0466966_0073540 Ga0466966_0073540_104_376 90
637 3300044693 Ga0466961_0050292 Ga0466961_0050292_451_726 90
638 3300044693 Ga0466961_0138872 Ga0466961_0138872_19_291 90
639 3300044694 Ga0466963_0049397 Ga0466963_0049397_2309_2581 90
640 3300044694 Ga0466963_0283979 Ga0466963_0283979_420_692 90
641 3300044719 Ga0466971_0040567 Ga0466971_0040567_468_740 90
642 3300044719 Ga0466971_0081731 Ga0466971_0081731_543_815 90
643 3300044719 Ga0466971_0151579 Ga0466971_0151579_594_869 90
644 3300044765 Ga0466970_0008752 Ga0466970_0008752_533_808 90
645 3300044765 Ga0466970_0142004 Ga0466970_0142004_444_716 90
646 3300044765 Ga0466970_0604120 Ga0466970_0604120_122_394 90
647 3300044765 Ga0466970_0774583 Ga0466970_0774583_212_484 90
648 3300044842 Ga0466957_0128761 Ga0466957_0128761_1213_1485 90
649 3300044842 Ga0466957_0147739 Ga0466957_0147739_71_343 90
650 3300044842 Ga0466957_0227235 Ga0466957_0227235_633_905 90
651 3300044842 Ga0466957_0326003 Ga0466957_0326003_506_781 90
652 3300044901 Ga0466960_0021758 Ga0466960_0021758_593_865 90
653 3300044901 Ga0466960_0097166 Ga0466960_0097166_1028_1300 90
654 3300045049 Ga0466959_0156974 Ga0466959_0156974_985_1257 90
655 3300045836 Ga0466958_1101131 Ga0466958_1101131_116_388 90
656 3300045976 Ga0466967_0196153 Ga0466967_0196153_236_508 90
657 3300045976 Ga0466967_0489711 Ga0466967_0489711_321_593 90
658 3300045976 Ga0466967_0954424 Ga0466967_0954424_395_667 90
659 3300046459 Ga0495629_0400252 Ga0495629_0400252_226_498 90
660 3300046522 Ga0495643_0257029 Ga0495643_0257029_265_537 90
661 3300046691 Ga0495670_0119891 Ga0495670_0119891_556_828 90
662 3300048903 Ga0496100_0318130 Ga0496100_0318130_380_652 90
663 3300048903 Ga0496100_0547529 Ga0496100_0547529_479_751 90
664 3300048903 Ga0496100_1295351 Ga0496100_1295351_282_554 90
665 3300048904 Ga0496101_0017116 Ga0496101_0017116_133_405 90
666 3300048907 Ga0496104_0386744 Ga0496104_0386744_670_942 90
667 3300048908 Ga0496105_0229980 Ga0496105_0229980_757_1029 90
668 3300048910 Ga0496107_0024108 Ga0496107_0024108_830_1102 90
669 3300048910 Ga0496107_0076677 Ga0496107_0076677_1891_2163 90
670 3300048911 Ga0496108_0092514 Ga0496108_0092514_1570_1842 90
671 3300048912 Ga0496109_0005425 Ga0496109_0005425_9801_10073 90
672 3300048912 Ga0496109_0568284 Ga0496109_0568284_769_1041 90
673 3300048912 Ga0496109_1062673 Ga0496109_1062673_12_284 90
674 3300048913 Ga0496110_0134371 Ga0496110_0134371_1540_1812 90
675 3300048913 Ga0496110_0166746 Ga0496110_0166746_192_464 90
676 3300048913 Ga0496110_0812308 Ga0496110_0812308_372_644 90
677 3300048914 Ga0496111_0003794 Ga0496111_0003794_4751_5023 90
678 3300048915 Ga0496112_0005134 Ga0496112_0005134_10252_10524 90
679 3300048915 Ga0496112_0084606 Ga0496112_0084606_681_953 90
680 3300048915 Ga0496112_0755888 Ga0496112_0755888_52_324 90
681 3300048915 Ga0496112_1159914 Ga0496112_1159914_77_361 90
682 3300048916 Ga0496113_0008196 Ga0496113_0008196_3923_4195 90
683 3300048916 Ga0496113_0178346 Ga0496113_0178346_723_995 90
684 3300048916 Ga0496113_1592609 Ga0496113_1592609_135_407 90
685 3300048917 Ga0496114_0122386 Ga0496114_0122386_1838_2110 90
686 3300048918 Ga0496115_0001325 Ga0496115_0001325_15904_16176 90
687 3300050491 nmdc:mga00v17_33350_c1 nmdc:mga00v17_33350_c1_203_478 90
688 3300050493 nmdc:mga0k408_198361_c1 nmdc:mga0k408_198361_c1_543_818 90
689 3300050511 nmdc:mga08y16_61453_c1 nmdc:mga08y16_61453_c1_339_611 90
690 3300050512 nmdc:mga0n895_476361_c1 nmdc:mga0n895_476361_c1_175_447 90
691 3300059511 Ga0587091_194501 Ga0587091_194501_248_520 90
692 3300061719 Ga0466962_0091152 Ga0466962_0091152_852_1124 90
693 3300061719 Ga0466962_0143308 Ga0466962_0143308_558_830 90
694 3300001979 JGI24740J21852_10001260 JGI24740J21852_100012606 91
695 3300001989 JGI24739J22299_10005176 JGI24739J22299_100051765 91
696 3300001990 JGI24737J22298_10000023 JGI24737J22298_1000002326 91
697 3300002075 JGI24738J21930_10000447 JGI24738J21930_100004476 91
698 3300002077 JGI24744J21845_10010813 JGI24744J21845_100108132 91
699 3300002126 JGI24035J26624_1000812 JGI24035J26624_10008126 91
700 3300002239 JGI24034J26672_10009700 JGI24034J26672_100097002 91
701 3300005327 Ga0070658_10020956 Ga0070658_100209564 91
702 3300005328 Ga0070676_10080226 Ga0070676_100802261 91
703 3300005328 Ga0070676_10081899 Ga0070676_100818992 91
704 3300005330 Ga0070690_100081968 Ga0070690_1000819682 91
705 3300005331 Ga0070670_100280962 Ga0070670_1002809622 91
706 3300005334 Ga0068869_100058558 Ga0068869_1000585582 91
707 3300005335 Ga0070666_10105013 Ga0070666_101050134 91
708 3300005338 Ga0068868_100023524 Ga0068868_1000235247 91
709 3300005338 Ga0068868_101327410 Ga0068868_1013274102 91
710 3300005339 Ga0070660_100001246 Ga0070660_10000124615 91
711 3300005340 Ga0070689_100090219 Ga0070689_1000902193 91
712 3300005343 Ga0070687_100539446 Ga0070687_1005394462 91
713 3300005344 Ga0070661_100641479 Ga0070661_1006414791 91
714 3300005344 Ga0070661_101026451 Ga0070661_1010264512 91
715 3300005347 Ga0070668_100027935 Ga0070668_1000279353 91
716 3300005347 Ga0070668_100222191 Ga0070668_1002221911 91
717 3300005347 Ga0070668_100743460 Ga0070668_1007434601 91
718 3300005353 Ga0070669_100000519 Ga0070669_10000051919 91
719 3300005353 Ga0070669_100441116 Ga0070669_1004411161 91
720 3300005354 Ga0070675_100486035 Ga0070675_1004860352 91
721 3300005355 Ga0070671_100002137 Ga0070671_10000213717 91
722 3300005355 Ga0070671_100026947 Ga0070671_1000269476 91
723 3300005356 Ga0070674_100001511 Ga0070674_10000151110 91
724 3300005364 Ga0070673_100000168 Ga0070673_10000016825 91
725 3300005364 Ga0070673_100025924 Ga0070673_1000259245 91
726 3300005366 Ga0070659_100003143 Ga0070659_1000031432 91
727 3300005367 Ga0070667_100002206 Ga0070667_1000022063 91
728 3300005367 Ga0070667_100002596 Ga0070667_10000259611 91
729 3300005367 Ga0070667_100353903 Ga0070667_1003539032 91
730 3300005455 Ga0070663_100368563 Ga0070663_1003685633 91
731 3300005455 Ga0070663_100395099 Ga0070663_1003950992 91
732 3300005455 Ga0070663_100609597 Ga0070663_1006095972 91
733 3300005457 Ga0070662_100000298 Ga0070662_10000029817 91
734 3300005457 Ga0070662_100617699 Ga0070662_1006176992 91
735 3300005459 Ga0068867_100001233 Ga0068867_1000012335 91
736 3300005459 Ga0068867_101087067 Ga0068867_1010870672 91
737 3300005466 Ga0070685_10838420 Ga0070685_108384202 91
738 3300005539 Ga0068853_100002745 Ga0068853_10000274515 91
739 3300005539 Ga0068853_100199668 Ga0068853_1001996684 91
740 3300005543 Ga0070672_100000212 Ga0070672_1000002128 91
741 3300005546 Ga0070696_101110683 Ga0070696_1011106831 91
742 3300005547 Ga0070693_100804497 Ga0070693_1008044972 91
743 3300005548 Ga0070665_100000568 Ga0070665_10000056822 91
744 3300005548 Ga0070665_100011268 Ga0070665_1000112687 91
745 3300005563 Ga0068855_100007337 Ga0068855_1000073377 91
746 3300005564 Ga0070664_100494681 Ga0070664_1004946812 91
747 3300005577 Ga0068857_100002000 Ga0068857_1000020007 91
748 3300005578 Ga0068854_100000490 Ga0068854_10000049010 91
749 3300005578 Ga0068854_101369841 Ga0068854_1013698411 91
750 3300005578 Ga0068854_102067114 Ga0068854_1020671142 91
751 3300005615 Ga0070702_100856114 Ga0070702_1008561141 91
752 3300005616 Ga0068852_100001243 Ga0068852_10000124317 91
753 3300005616 Ga0068852_100293094 Ga0068852_1002930941 91
754 3300005617 Ga0068859_100000136 Ga0068859_10000013624 91
755 3300005617 Ga0068859_100003807 Ga0068859_10000380711 91
756 3300005617 Ga0068859_100704300 Ga0068859_1007043002 91
757 3300005617 Ga0068859_101088191 Ga0068859_1010881912 91
758 3300005618 Ga0068864_100000651 Ga0068864_10000065111 91
759 3300005618 Ga0068864_100004268 Ga0068864_1000042682 91
760 3300005718 Ga0068866_10026092 Ga0068866_100260925 91
761 3300005719 Ga0068861_100054610 Ga0068861_1000546102 91
762 3300005719 Ga0068861_101562225 Ga0068861_1015622252 91
763 3300005834 Ga0068851_10061181 Ga0068851_100611813 91
764 3300005834 Ga0068851_10145331 Ga0068851_101453312 91
765 3300005841 Ga0068863_100000140 Ga0068863_10000014026 91
766 3300005841 Ga0068863_100012641 Ga0068863_1000126414 91
767 3300005841 Ga0068863_100145426 Ga0068863_1001454261 91
768 3300005841 Ga0068863_100180453 Ga0068863_1001804531 91
769 3300005842 Ga0068858_100005794 Ga0068858_10000579416 91
770 3300005842 Ga0068858_100011264 Ga0068858_1000112642 91
771 3300005842 Ga0068858_100696478 Ga0068858_1006964781 91
772 3300005843 Ga0068860_100004881 Ga0068860_1000048813 91
773 3300005843 Ga0068860_100012745 Ga0068860_1000127452 91
774 3300005843 Ga0068860_100113331 Ga0068860_1001133312 91
775 3300005844 Ga0068862_100063509 Ga0068862_1000635095 91
776 3300006237 Ga0097621_100757540 Ga0097621_1007575402 91
777 3300006358 Ga0068871_100626711 Ga0068871_1006267111 91
778 3300006358 Ga0068871_101489805 Ga0068871_1014898051 91
779 3300006844 Ga0075428_100050761 Ga0075428_1000507616 91
780 3300006881 Ga0068865_100004989 Ga0068865_10000498910 91
781 3300006931 Ga0097620_100000136 Ga0097620_10000013624 91
782 3300006931 Ga0097620_100003807 Ga0097620_10000380711 91
783 3300006931 Ga0097620_100704314 Ga0097620_1007043142 91
784 3300006931 Ga0097620_101088249 Ga0097620_1010882492 91
785 3300009092 Ga0105250_10031848 Ga0105250_100318482 91
786 3300009092 Ga0105250_10180872 Ga0105250_101808722 91
787 3300009098 Ga0105245_10049261 Ga0105245_100492615 91
788 3300009098 Ga0105245_11454104 Ga0105245_114541042 91
789 3300009101 Ga0105247_10027310 Ga0105247_100273101 91
790 3300009101 Ga0105247_10237342 Ga0105247_102373423 91
791 3300009101 Ga0105247_10905512 Ga0105247_109055122 91
792 3300009147 Ga0114129_10170049 Ga0114129_101700492 91
793 3300009148 Ga0105243_10181840 Ga0105243_101818403 91
794 3300009174 Ga0105241_10058028 Ga0105241_100580282 91
795 3300009176 Ga0105242_10312701 Ga0105242_103127012 91
796 3300009177 Ga0105248_10001074 Ga0105248_1000107418 91
797 3300009177 Ga0105248_10002545 Ga0105248_1000254516 91
798 3300009177 Ga0105248_10045272 Ga0105248_100452726 91
799 3300009551 Ga0105238_10071081 Ga0105238_100710811 91
800 3300009551 Ga0105238_10243761 Ga0105238_102437611 91
801 3300009551 Ga0105238_12381123 Ga0105238_123811231 91
802 3300009553 Ga0105249_10033280 Ga0105249_100332804 91
803 3300009553 Ga0105249_10445881 Ga0105249_104458812 91
804 3300010375 Ga0105239_11250205 Ga0105239_112502052 91
805 3300011119 Ga0105246_10053362 Ga0105246_100533625 91
806 3300011119 Ga0105246_10438553 Ga0105246_104385533 91
807 3300013100 Ga0157373_10022007 Ga0157373_100220072 91
808 3300013102 Ga0157371_10000512 Ga0157371_1000051223 91
809 3300013102 Ga0157371_10312493 Ga0157371_103124932 91
810 3300013105 Ga0157369_10741813 Ga0157369_107418132 91
811 3300013297 Ga0157378_10006998 Ga0157378_100069984 91
812 3300013297 Ga0157378_11926241 Ga0157378_119262411 91
813 3300013297 Ga0157378_12299157 Ga0157378_122991572 91
814 3300013306 Ga0163162_10064131 Ga0163162_100641317 91
815 3300013307 Ga0157372_10009727 Ga0157372_1000972710 91
816 3300013308 Ga0157375_10034513 Ga0157375_100345132 91
817 3300013308 Ga0157375_11072531 Ga0157375_110725312 91
818 3300014325 Ga0163163_10001010 Ga0163163_100010105 91
819 3300014326 Ga0157380_12740926 Ga0157380_127409261 91
820 3300014745 Ga0157377_10025952 Ga0157377_100259523 91
821 3300014968 Ga0157379_10009976 Ga0157379_100099764 91
822 3300014968 Ga0157379_11022722 Ga0157379_110227222 91
823 3300025290 Ga0207673_1008958 Ga0207673_10089582 91
824 3300025315 Ga0207697_10000170 Ga0207697_1000017010 91
825 3300025321 Ga0207656_10090353 Ga0207656_100903532 91
826 3300025899 Ga0207642_10035029 Ga0207642_100350292 91
827 3300025901 Ga0207688_10000457 Ga0207688_1000045710 91
828 3300025903 Ga0207680_10253977 Ga0207680_102539772 91
829 3300025904 Ga0207647_10001654 Ga0207647_1000165410 91
830 3300025907 Ga0207645_10002479 Ga0207645_1000247910 91
831 3300025907 Ga0207645_10073431 Ga0207645_100734314 91
832 3300025909 Ga0207705_10068425 Ga0207705_100684254 91
833 3300025911 Ga0207654_10014454 Ga0207654_100144543 91
834 3300025918 Ga0207662_11204518 Ga0207662_112045182 91
835 3300025919 Ga0207657_10001152 Ga0207657_100011527 91
836 3300025920 Ga0207649_10775760 Ga0207649_107757602 91
837 3300025920 Ga0207649_10802098 Ga0207649_108020982 91
838 3300025923 Ga0207681_10000330 Ga0207681_100003309 91
839 3300025924 Ga0207694_10625477 Ga0207694_106254772 91
840 3300025925 Ga0207650_10223401 Ga0207650_102234012 91
841 3300025925 Ga0207650_11810853 Ga0207650_118108531 91
842 3300025926 Ga0207659_10089799 Ga0207659_100897992 91
843 3300025927 Ga0207687_10005078 Ga0207687_1000507810 91
844 3300025931 Ga0207644_10016492 Ga0207644_100164922 91
845 3300025931 Ga0207644_10049143 Ga0207644_100491435 91
846 3300025932 Ga0207690_10002756 Ga0207690_100027565 91
847 3300025932 Ga0207690_11004559 Ga0207690_110045592 91
848 3300025933 Ga0207706_10001155 Ga0207706_100011555 91
849 3300025933 Ga0207706_10227867 Ga0207706_102278674 91
850 3300025934 Ga0207686_10171860 Ga0207686_101718602 91
851 3300025935 Ga0207709_10095107 Ga0207709_100951074 91
852 3300025936 Ga0207670_10035308 Ga0207670_100353085 91
853 3300025936 Ga0207670_10908325 Ga0207670_109083252 91
854 3300025938 Ga0207704_10000676 Ga0207704_100006767 91
855 3300025940 Ga0207691_10000893 Ga0207691_100008938 91
856 3300025941 Ga0207711_10000105 Ga0207711_1000010518 91
857 3300025941 Ga0207711_10006500 Ga0207711_100065009 91
858 3300025941 Ga0207711_10017343 Ga0207711_100173435 91
859 3300025942 Ga0207689_10000671 Ga0207689_1000067126 91
860 3300025942 Ga0207689_10997089 Ga0207689_109970892 91
861 3300025945 Ga0207679_10147929 Ga0207679_101479293 91
862 3300025945 Ga0207679_11932580 Ga0207679_119325802 91
863 3300025949 Ga0207667_10005733 Ga0207667_100057337 91
864 3300025960 Ga0207651_10004770 Ga0207651_100047706 91
865 3300025960 Ga0207651_10007231 Ga0207651_100072313 91
866 3300025961 Ga0207712_10316831 Ga0207712_103168312 91
867 3300025972 Ga0207668_10051841 Ga0207668_100518412 91
868 3300025972 Ga0207668_10531592 Ga0207668_105315921 91
869 3300025981 Ga0207640_10001707 Ga0207640_1000170712 91
870 3300025986 Ga0207658_10003869 Ga0207658_1000386910 91
871 3300025986 Ga0207658_10007908 Ga0207658_100079089 91
872 3300025986 Ga0207658_10022041 Ga0207658_100220412 91
873 3300025986 Ga0207658_10300586 Ga0207658_103005862 91
874 3300026023 Ga0207677_10013599 Ga0207677_100135995 91
875 3300026023 Ga0207677_10680302 Ga0207677_106803021 91
876 3300026035 Ga0207703_10000947 Ga0207703_1000094725 91
877 3300026035 Ga0207703_10033991 Ga0207703_100339912 91
878 3300026035 Ga0207703_10420442 Ga0207703_104204422 91
879 3300026041 Ga0207639_10205603 Ga0207639_102056034 91
880 3300026041 Ga0207639_10520591 Ga0207639_105205912 91
881 3300026067 Ga0207678_10252722 Ga0207678_102527223 91
882 3300026067 Ga0207678_10816987 Ga0207678_108169872 91
883 3300026088 Ga0207641_10000172 Ga0207641_1000017277 91
884 3300026088 Ga0207641_10021403 Ga0207641_100214036 91
885 3300026088 Ga0207641_10026599 Ga0207641_100265995 91
886 3300026089 Ga0207648_10001007 Ga0207648_1000100726 91
887 3300026089 Ga0207648_10029237 Ga0207648_100292373 91
888 3300026095 Ga0207676_10000678 Ga0207676_100006787 91
889 3300026095 Ga0207676_10002051 Ga0207676_100020518 91
890 3300026116 Ga0207674_10001599 Ga0207674_100015997 91
891 3300026118 Ga0207675_100069530 Ga0207675_1000695303 91
892 3300026118 Ga0207675_101566978 Ga0207675_1015669782 91
893 3300026121 Ga0207683_10220627 Ga0207683_102206274 91
894 3300026121 Ga0207683_11216926 Ga0207683_112169261 91
895 3300026121 Ga0207683_11246682 Ga0207683_112466822 91
896 3300026142 Ga0207698_10110506 Ga0207698_101105064 91
897 3300026142 Ga0207698_11441904 Ga0207698_114419042 91
898 3300028379 Ga0268266_10000949 Ga0268266_1000094930 91
899 3300028379 Ga0268266_10017850 Ga0268266_100178508 91
900 3300028380 Ga0268265_10184605 Ga0268265_101846054 91
901 3300028380 Ga0268265_10196720 Ga0268265_101967202 91
902 3300028381 Ga0268264_10001846 Ga0268264_1000184619 91
903 3300028381 Ga0268264_10022763 Ga0268264_100227637 91
904 3300028381 Ga0268264_10246616 Ga0268264_102466162 91
905 3300031731 Ga0307405_10555093 Ga0307405_105550932 91
906 3300031824 Ga0307413_10193167 Ga0307413_101931674 91
907 3300031901 Ga0307406_10028456 Ga0307406_100284566 91
908 3300031903 Ga0307407_10113528 Ga0307407_101135282 91
909 3300031911 Ga0307412_10186379 Ga0307412_101863794 91
910 3300031911 Ga0307412_10951483 Ga0307412_109514832 91
911 3300031995 Ga0307409_100021228 Ga0307409_1000212286 91
912 3300032002 Ga0307416_100144709 Ga0307416_1001447091 91
913 3300032002 Ga0307416_101040451 Ga0307416_1010404512 91
914 3300032004 Ga0307414_11298136 Ga0307414_112981362 91
915 3300032126 Ga0307415_100044257 Ga0307415_1000442574 91
916 3300037418 Ga0395900_0305121 Ga0395900_0305121_872_1147 91
917 3300042157 Ga0439458_0133009 Ga0439458_0133009_291_566 91
918 3300046473 Ga0495582_0731011 Ga0495582_0731011_124_402 91
919 3300046616 Ga0495668_0041720 Ga0495668_0041720_947_1225 91
920 3300046684 Ga0495669_0414266 Ga0495669_0414266_109_387 91
921 3300048910 Ga0496107_0131703 Ga0496107_0131703_216_494 91
922 3300049583 Ga0501067_0733498 Ga0501067_0733498_233_511 91
923 3300050507 nmdc:mga05p37_243419_c1 nmdc:mga05p37_243419_c1_1479_1754 91
924 3300053134 Ga0500658_0000032 Ga0500658_0000032_89196_89474 91
925 3300001915 JGI24741J21665_1054661 JGI24741J21665_10546611 92
926 3300001979 JGI24740J21852_10028840 JGI24740J21852_100288401 92
927 3300001989 JGI24739J22299_10021092 JGI24739J22299_100210924 92
928 3300001990 JGI24737J22298_10109904 JGI24737J22298_101099042 92
929 3300002067 JGI24735J21928_10013549 JGI24735J21928_100135494 92
930 3300002075 JGI24738J21930_10057980 JGI24738J21930_100579801 92
931 3300005327 Ga0070658_10141320 Ga0070658_101413201 92
932 3300005327 Ga0070658_10204592 Ga0070658_102045923 92
933 3300005327 Ga0070658_10600740 Ga0070658_106007403 92
934 3300005327 Ga0070658_10704354 Ga0070658_107043541 92
935 3300005327 Ga0070658_11445235 Ga0070658_114452352 92
936 3300005327 Ga0070658_11820091 Ga0070658_118200911 92
937 3300005328 Ga0070676_11037480 Ga0070676_110374802 92
938 3300005329 Ga0070683_100563325 Ga0070683_1005633251 92
939 3300005329 Ga0070683_101789386 Ga0070683_1017893861 92
940 3300005331 Ga0070670_100064137 Ga0070670_1000641375 92
941 3300005331 Ga0070670_100577998 Ga0070670_1005779982 92
942 3300005334 Ga0068869_100291571 Ga0068869_1002915713 92
943 3300005335 Ga0070666_10027523 Ga0070666_100275233 92
944 3300005336 Ga0070680_100350890 Ga0070680_1003508902 92
945 3300005337 Ga0070682_101652043 Ga0070682_1016520431 92
946 3300005338 Ga0068868_100210732 Ga0068868_1002107321 92
947 3300005338 Ga0068868_100354838 Ga0068868_1003548381 92
948 3300005339 Ga0070660_100023619 Ga0070660_1000236195 92
949 3300005339 Ga0070660_101921566 Ga0070660_1019215662 92
950 3300005344 Ga0070661_100031531 Ga0070661_1000315312 92
951 3300005344 Ga0070661_100912484 Ga0070661_1009124841 92
952 3300005347 Ga0070668_100406973 Ga0070668_1004069732 92
953 3300005347 Ga0070668_101040719 Ga0070668_1010407192 92
954 3300005355 Ga0070671_100403800 Ga0070671_1004038002 92
955 3300005364 Ga0070673_100029483 Ga0070673_1000294832 92
956 3300005364 Ga0070673_100441122 Ga0070673_1004411222 92
957 3300005366 Ga0070659_100301972 Ga0070659_1003019721 92
958 3300005367 Ga0070667_101960443 Ga0070667_1019604432 92
959 3300005435 Ga0070714_100189975 Ga0070714_1001899753 92
960 3300005455 Ga0070663_100069178 Ga0070663_1000691782 92
961 3300005455 Ga0070663_100097627 Ga0070663_1000976272 92
962 3300005457 Ga0070662_100005160 Ga0070662_1000051608 92
963 3300005530 Ga0070679_100277884 Ga0070679_1002778844 92
964 3300005539 Ga0068853_100353859 Ga0068853_1003538594 92
965 3300005548 Ga0070665_100012756 Ga0070665_1000127569 92
966 3300005548 Ga0070665_100015546 Ga0070665_1000155465 92
967 3300005563 Ga0068855_101071246 Ga0068855_1010712462 92
968 3300005564 Ga0070664_100199675 Ga0070664_1001996755 92
969 3300005577 Ga0068857_100161939 Ga0068857_1001619394 92
970 3300005578 Ga0068854_100206093 Ga0068854_1002060932 92
971 3300005614 Ga0068856_100357340 Ga0068856_1003573403 92
972 3300005618 Ga0068864_100618698 Ga0068864_1006186982 92
973 3300005719 Ga0068861_101134307 Ga0068861_1011343071 92
974 3300005842 Ga0068858_100121517 Ga0068858_1001215173 92
975 3300005843 Ga0068860_100165474 Ga0068860_1001654743 92
976 3300005844 Ga0068862_100003397 Ga0068862_1000033977 92
977 3300005844 Ga0068862_100051138 Ga0068862_1000511382 92
978 3300005844 Ga0068862_100295230 Ga0068862_1002952303 92
979 3300006175 Ga0070712_100106327 Ga0070712_1001063272 92
980 3300006914 Ga0075436_100335575 Ga0075436_1003355752 92
981 3300009174 Ga0105241_10469153 Ga0105241_104691532 92
982 3300009177 Ga0105248_10596421 Ga0105248_105964213 92
983 3300009553 Ga0105249_11298782 Ga0105249_112987822 92
984 3300013100 Ga0157373_10139541 Ga0157373_101395415 92
985 3300013102 Ga0157371_10075185 Ga0157371_100751854 92
986 3300013102 Ga0157371_10264635 Ga0157371_102646353 92
987 3300013104 Ga0157370_11463426 Ga0157370_114634262 92
988 3300013105 Ga0157369_10610250 Ga0157369_106102502 92
989 3300013105 Ga0157369_10840135 Ga0157369_108401352 92
990 3300013307 Ga0157372_10152213 Ga0157372_101522132 92
991 3300013307 Ga0157372_11023414 Ga0157372_110234141 92
992 3300014497 Ga0182008_10718676 Ga0182008_107186761 92
993 3300021388 Ga0213875_10010269 Ga0213875_100102693 92
994 3300025893 Ga0207682_10562792 Ga0207682_105627922 92
995 3300025901 Ga0207688_10032990 Ga0207688_100329905 92
996 3300025904 Ga0207647_10070135 Ga0207647_100701353 92
997 3300025907 Ga0207645_10037886 Ga0207645_100378865 92
998 3300025907 Ga0207645_10580907 Ga0207645_105809072 92
999 3300025909 Ga0207705_10192043 Ga0207705_101920432 92
1000 3300025909 Ga0207705_10195368 Ga0207705_101953682 92
1001 3300025909 Ga0207705_10463287 Ga0207705_104632872 92
1002 3300025909 Ga0207705_11036652 Ga0207705_110366522 92
1003 3300025915 Ga0207693_10147881 Ga0207693_101478813 92
1004 3300025919 Ga0207657_10025787 Ga0207657_100257873 92
1005 3300025919 Ga0207657_10065416 Ga0207657_100654164 92
1006 3300025920 Ga0207649_10018809 Ga0207649_100188092 92
1007 3300025920 Ga0207649_10019211 Ga0207649_100192116 92
1008 3300025921 Ga0207652_10424315 Ga0207652_104243152 92
1009 3300025923 Ga0207681_10384078 Ga0207681_103840781 92
1010 3300025925 Ga0207650_10322136 Ga0207650_103221362 92
1011 3300025925 Ga0207650_10418550 Ga0207650_104185502 92
1012 3300025929 Ga0207664_10157921 Ga0207664_101579213 92
1013 3300025931 Ga0207644_10206628 Ga0207644_102066283 92
1014 3300025932 Ga0207690_10050538 Ga0207690_100505385 92
1015 3300025932 Ga0207690_10456634 Ga0207690_104566342 92
1016 3300025933 Ga0207706_10013175 Ga0207706_100131753 92
1017 3300025938 Ga0207704_10594127 Ga0207704_105941273 92
1018 3300025940 Ga0207691_10995923 Ga0207691_109959232 92
1019 3300025942 Ga0207689_10288950 Ga0207689_102889502 92
1020 3300025944 Ga0207661_10500642 Ga0207661_105006422 92
1021 3300025945 Ga0207679_10461187 Ga0207679_104611872 92
1022 3300025972 Ga0207668_10037160 Ga0207668_100371605 92
1023 3300025972 Ga0207668_10176974 Ga0207668_101769742 92
1024 3300025972 Ga0207668_10782544 Ga0207668_107825442 92
1025 3300025981 Ga0207640_10221467 Ga0207640_102214672 92
1026 3300025981 Ga0207640_12016454 Ga0207640_120164541 92
1027 3300025986 Ga0207658_10315612 Ga0207658_103156122 92
1028 3300025986 Ga0207658_12033919 Ga0207658_120339191 92
1029 3300026035 Ga0207703_10144299 Ga0207703_101442993 92
1030 3300026067 Ga0207678_10000487 Ga0207678_100004879 92
1031 3300026067 Ga0207678_10777948 Ga0207678_107779482 92
1032 3300026067 Ga0207678_11160847 Ga0207678_111608472 92
1033 3300026075 Ga0207708_11408792 Ga0207708_114087922 92
1034 3300026095 Ga0207676_10732618 Ga0207676_107326182 92
1035 3300026116 Ga0207674_10045302 Ga0207674_100453026 92
1036 3300026118 Ga0207675_101154659 Ga0207675_1011546591 92
1037 3300026142 Ga0207698_10466974 Ga0207698_104669742 92
1038 3300028379 Ga0268266_10011140 Ga0268266_100111403 92
1039 3300028379 Ga0268266_10250794 Ga0268266_102507942 92
1040 3300028379 Ga0268266_11090713 Ga0268266_110907132 92
1041 3300028380 Ga0268265_10002567 Ga0268265_1000256713 92
1042 3300028380 Ga0268265_10003031 Ga0268265_100030315 92
1043 3300028380 Ga0268265_10331104 Ga0268265_103311041 92
1044 3300028794 Ga0307515_10126608 Ga0307515_101266083 92
1045 3300031548 Ga0307408_100293757 Ga0307408_1002937572 92
1046 3300031731 Ga0307405_10692026 Ga0307405_106920262 92
1047 3300031731 Ga0307405_11390352 Ga0307405_113903522 92
1048 3300031824 Ga0307413_10014495 Ga0307413_100144953 92
1049 3300031852 Ga0307410_10053170 Ga0307410_100531703 92
1050 3300031903 Ga0307407_10086021 Ga0307407_100860214 92
1051 3300031911 Ga0307412_10921512 Ga0307412_109215122 92
1052 3300031995 Ga0307409_100010724 Ga0307409_1000107246 92
1053 3300032005 Ga0307411_10174280 Ga0307411_101742803 92
1054 3300032126 Ga0307415_100094508 Ga0307415_1000945083 92
1055 3300035172 Ga0373955_0377598 Ga0373955_0377598_180_461 92
1056 3300035725 Ga0373947_0957549 Ga0373947_0957549_128_409 92
1057 3300037068 Ga0373925_0723169 Ga0373925_0723169_247_528 92
1058 3300037418 Ga0395900_0002548 Ga0395900_0002548_583_864 92
1059 3300037418 Ga0395900_0116599 Ga0395900_0116599_2389_2667 92
1060 3300037418 Ga0395900_0258555 Ga0395900_0258555_1026_1307 92
1061 3300037418 Ga0395900_0583483 Ga0395900_0583483_491_772 92
1062 3300037418 Ga0395900_0677908 Ga0395900_0677908_323_604 92
1063 3300037418 Ga0395900_1585243 Ga0395900_1585243_159_440 92
1064 3300037471 Ga0395905_0000409 Ga0395905_0000409_28263_28544 92
1065 3300037471 Ga0395905_0004864 Ga0395905_0004864_783_1064 92
1066 3300037471 Ga0395905_0015335 Ga0395905_0015335_2205_2486 92
1067 3300037471 Ga0395905_0037428 Ga0395905_0037428_3471_3752 92
1068 3300037471 Ga0395905_0053376 Ga0395905_0053376_793_1074 92
1069 3300037471 Ga0395905_0093242 Ga0395905_0093242_2516_2797 92
1070 3300037471 Ga0395905_0296126 Ga0395905_0296126_973_1254 92
1071 3300037471 Ga0395905_0501039 Ga0395905_0501039_685_963 92
1072 3300037471 Ga0395905_0529645 Ga0395905_0529645_219_500 92
1073 3300037471 Ga0395905_0926518 Ga0395905_0926518_26_307 92
1074 3300037471 Ga0395905_1674711 Ga0395905_1674711_240_521 92
1075 3300037853 Ga0436364_1041850 Ga0436364_1041850_1125_1406 92
1076 3300038443 Ga0395901_0135113 Ga0395901_0135113_1757_2035 92
1077 3300041496 Ga0451839_1402395 Ga0451839_1402395_88_369 92
1078 3300042439 Ga0439464_0006222 Ga0439464_0006222_780_1061 92
1079 3300042461 Ga0439460_0022785 Ga0439460_0022785_1159_1440 92
1080 3300044656 Ga0466969_0604428 Ga0466969_0604428_64_345 92
1081 3300044684 Ga0466966_0000021 Ga0466966_0000021_31778_32056 92
1082 3300044684 Ga0466966_0071477 Ga0466966_0071477_1028_1309 92
1083 3300044693 Ga0466961_0036749 Ga0466961_0036749_1055_1336 92
1084 3300045049 Ga0466959_0254197 Ga0466959_0254197_830_1111 92
1085 3300045976 Ga0466967_0238520 Ga0466967_0238520_713_994 92
1086 3300046616 Ga0495668_0295028 Ga0495668_0295028_336_617 92
1087 3300046684 Ga0495669_0037414 Ga0495669_0037414_487_768 92
1088 3300047445 Ga0495677_0364203 Ga0495677_0364203_75_356 92
1089 3300048909 Ga0496106_0266887 Ga0496106_0266887_753_1031 92
1090 3300048910 Ga0496107_0366688 Ga0496107_0366688_645_926 92
1091 3300048912 Ga0496109_1104328 Ga0496109_1104328_134_418 92
1092 3300048913 Ga0496110_0030598 Ga0496110_0030598_696_977 92
1093 3300048914 Ga0496111_0609766 Ga0496111_0609766_121_402 92
1094 3300048915 Ga0496112_0542440 Ga0496112_0542440_494_778 92
1095 3300048916 Ga0496113_0581390 Ga0496113_0581390_588_872 92
1096 3300048916 Ga0496113_0701019 Ga0496113_0701019_334_615 92
1097 3300049583 Ga0501067_0394184 Ga0501067_0394184_153_434 92
1098 3300049656 Ga0501209_288365 Ga0501209_288365_107_388 92
1099 3300049663 Ga0501223_041756 Ga0501223_041756_436_717 92
1100 3300049679 Ga0501249_008674 Ga0501249_008674_1806_2087 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12096

DUF3572

Protein of unknown function (DUF3572)

10

92

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mfq-assembly1.cif.gz_C crystal structure analysis of a ternary s-domain complex of human signal recognition particle 0.6792 55 91
7cmr-assembly1.cif.gz_A the crystal structure of human myst1 from biortus. 0.4924 40 87
2rn7-assembly1.cif.gz_A nmr solution structure of tnpe protein from shigella flexneri. northeast structural genomics target sfr125 0.4791 36 87
5lqw-assembly1.cif.gz_Z yeast activated spliceosome 0.4688 24 85
2x48-assembly1.cif.gz_A orf 55 from sulfolobus islandicus rudivirus 1 0.4666 49 88
ID Description Score Start End Superfamily
1mfqC00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);Signal recognition particle, SRP54 subunit, M-domain 0.6792 55 91 1.10.260.30
af_Q4DZK1_537_668_1.10.150.310 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tex RuvX-like domain-like 0.6087 28 92 1.10.150.310
af_Q58776_2_71_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.5943 47 87 3.20.20.70
2w96A01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.5363 45 87 1.10.472.10
af_Q21972_79_144_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.525 52 89 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2W4SG09-F1-model_v4 DUF3572 domain-containing protein 0.9789 9 87
AF-A0A7W6F4Y4-F1-model_v4 DUF3572 family protein 0.9785 12 87
AF-A0A501XJ12-F1-model_v4 DUF3572 family protein 0.9777 10 80
AF-A0A839YEW6-F1-model_v4 Adenine/guanine phosphoribosyltransferase-like PRPP-binding protein 0.9775 9 88 GO:0016757
AF-A0A7Y0BRW4-F1-model_v4 DUF3572 domain-containing protein 0.9767 5 86

Feature Viewer

pLDDT pTM Quality
86.14 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map