metagRoot

F490031

General Info

Members	Datasets	Scaffolds	Average Seq Length
1098	629	2196	354

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|2945920336\|2945923673
Length	416
Sequence	APIEQAPIRKAAKQTAPSQQVPAHQEPADQAPADQAPSRLPEPRVAPSVATSTDSHLVITDVTRNFGSQSVLKGVNLSIARGGTTAIVGPSGSGKTTLLRLIAGFDHPVTGSISLNGAKVAGDGAWVPAHKRHIGYVAQDGALFPHLSVGKNVAFGLDPAKLPGGRRAVEDRVRELLEMVSLDPDMAKRRPHQLSGGQQQRVALARALAREPELMLLDEPFSALDAGLRVATRRAVAKVLNKAGVTTILVTHDQAEALSFADQVAVMRGGKLAQIGNPFVVYTRPADRATAEFLGDAVILDAWMEGSLATCSLGGIPVRRPPAQGRVQLMLRPEQIRIAEDGPIRGVVVDTDYFGPETTVRLKLAVPPELASGGDHRYPGGGEIITIRHWNASIARPGMELCLRVVGEGVAFPIEP

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	3300000549	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled	Metagenome	Rhizosphere
3	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
4	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
5	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
6	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
7	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
8	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
9	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
10	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
11	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
12	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
13	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
14	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
15	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
16	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
17	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
18	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
19	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
20	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
21	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
22	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
23	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
24	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
25	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
26	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
27	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
28	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
29	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
30	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
31	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
32	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
33	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
34	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
35	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
36	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
37	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
38	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
39	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
40	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
41	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
42	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
43	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
44	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
45	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
46	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
47	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
48	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
49	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
50	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
51	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
52	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
53	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
54	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
55	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
56	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
57	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
58	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
59	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
60	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
61	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
62	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
63	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
64	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
65	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
66	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
67	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
68	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
69	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
70	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
71	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
72	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
73	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
74	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
75	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
76	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
77	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
78	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
79	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
80	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
81	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
82	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
83	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
84	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
85	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
86	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
87	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
88	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
89	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
90	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
91	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
92	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
93	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
94	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
95	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
96	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
97	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
98	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
99	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
100	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
101	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
102	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
103	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
104	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
105	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
106	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
107	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
108	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
109	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
110	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
111	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
112	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
113	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
114	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
115	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
116	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
117	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
118	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
119	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
120	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
121	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
122	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
123	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
124	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
125	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
126	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
127	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
128	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
129	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
130	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
131	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
132	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
133	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
134	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
135	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
136	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
137	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
138	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
139	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
140	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
141	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
142	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
143	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
144	3300015680	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03	Metagenome	Rhizosphere
145	3300015685	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12	Metagenome	Unclassified
146	3300015687	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08	Metagenome	Rhizosphere
147	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
148	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
149	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
150	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
151	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
152	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
153	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
154	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
155	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
156	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
157	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
158	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
159	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
160	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
161	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
162	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
163	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
164	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
165	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
166	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
167	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
168	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
169	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
170	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
171	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
229	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
231	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
235	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
236	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
237	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
238	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
239	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
240	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
241	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
242	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
243	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
244	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
245	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
246	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
247	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
248	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
249	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
250	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
251	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
252	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
253	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
254	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
255	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
256	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
257	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
258	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
259	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
260	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
261	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
262	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
263	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
264	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
265	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
266	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
267	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
268	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
269	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
270	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
271	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
272	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
273	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
274	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
275	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
276	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
277	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
278	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
279	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
280	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
281	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
282	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
283	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
284	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
285	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
286	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
287	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
288	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
289	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
290	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
291	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
292	3300044669	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E	Metagenome	Unclassified
293	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
294	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
295	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
296	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
297	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
298	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
299	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
300	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
301	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
302	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
303	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
304	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
305	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
306	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
307	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
308	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
309	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
310	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
311	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
312	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
313	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
314	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
315	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
316	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
317	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
318	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
319	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
320	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
321	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
322	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
323	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
324	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
325	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
326	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
327	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
328	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
329	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
330	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
331	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
332	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
333	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
334	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
335	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
336	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
337	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
338	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
339	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
340	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
341	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
342	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
343	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
344	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
345	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
346	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
347	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
348	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
349	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
350	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
351	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
352	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
353	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
354	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
355	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
356	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
357	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
358	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
359	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
360	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
361	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
362	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
363	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
364	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
365	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
366	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
367	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
368	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
369	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
370	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
371	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
372	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
373	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
374	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
375	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
376	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
377	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
378	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
379	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
380	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
381	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
382	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
383	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
384	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
385	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
386	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
387	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
388	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
389	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
390	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
391	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
392	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
393	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
394	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
395	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
396	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
397	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
398	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
399	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
400	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
401	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
402	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
403	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
404	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
405	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
406	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
407	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
408	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
409	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
410	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
411	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
412	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
413	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
414	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
415	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
416	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
417	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
418	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
419	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
420	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
421	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
422	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
423	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
424	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
425	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
426	2945920336	Pseudarthrobacter siccitolerans W1I3	Isolate	Rhizosphere
427	2506783011	Frankia datiscae Dg1	Isolate	Nodule
428	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
429	2515154088	Salinispora arenicola CNT800	Isolate	Rhizosphere
430	2515154129	Salinispora pacifica CNS103	Isolate	Rhizosphere
431	2515154137	Salinispora arenicola CNX482	Isolate	Rhizosphere
432	2515154202	Salinispora pacifica CNT084	Isolate	Rhizosphere
433	2515154203	Salinispora arenicola CNR921	Isolate	Rhizosphere
434	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
435	2527291627	Frankia casuarinae Thr	Isolate	Nodule
436	2527291629	Frankia sp. BMG5.23	Isolate	Nodule
437	2546825537	Frankia sp. CcI6	Isolate	Rhizoplane
438	2547132181	Kosakonia sacchari SP1	Isolate	Stem
439	2551306166	Nocardia tenerifensis NBRC 101015	Isolate	Rhizosphere
440	2554235234	Klebsiella michiganensis SA2	Isolate	Unclassified
441	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
442	2561511199	Enterobacter sp. R4-368	Isolate	Nodule
443	2576861822	Frankia sp. CeD	Isolate	Nodule
444	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
445	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
446	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
447	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
448	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
449	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
450	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
451	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
452	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
453	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
454	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
455	2599185160	Pseudomonas sp. NFPP25	Isolate	Rhizoplane
456	2599185164	Pseudomonas sp. NFPP13	Isolate	Rhizoplane
457	2599185165	Pseudomonas sp. NFPP18	Isolate	Rhizoplane
458	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
459	2599185181	Pseudomonas sp. NFPP17	Isolate	Rhizoplane
460	2599185186	Pseudomonas sp. NFPP15	Isolate	Rhizoplane
461	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
462	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
463	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
464	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
465	2600255256	Enterobacter sp. NFIX08	Isolate	Rhizoplane
466	2600255257	Enterobacter sp. NFIX03	Isolate	Rhizoplane
467	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
468	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
469	2600255287	Klebsiella quasipneumoniae NFIX11	Isolate	Rhizoplane
470	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
471	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
472	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
473	2600255291	Klebsiella quasipneumoniae NFIX19	Isolate	Rhizoplane
474	2600255298	Klebsiella quasipneumoniae NFIX21	Isolate	Rhizoplane
475	2600255299	Klebsiella quasipneumoniae NFIX22	Isolate	Rhizoplane
476	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
477	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
478	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
479	2600255303	Klebsiella quasipneumoniae NFIX36	Isolate	Rhizoplane
480	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
481	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
482	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
483	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
484	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
485	2600255310	Enterobacter sp. NFIX06	Isolate	Rhizoplane
486	2600255311	Enterobacter sp. NFIX04	Isolate	Rhizoplane
487	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
488	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
489	2602042046	Enterobacter sp. NFIX09	Isolate	Rhizoplane
490	2602042047	Enterobacter sp. NFIX59	Isolate	Rhizoplane
491	2602042052	Klebsiella quasipneumoniae NFIX18	Isolate	Rhizoplane
492	2602042053	Klebsiella quasipneumoniae NFIX12	Isolate	Rhizoplane
493	2602042067	Enterobacter sp. NFIX58	Isolate	Rhizoplane
494	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
495	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
496	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
497	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
498	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
499	2602042111	Klebsiella quasipneumoniae NFIX20	Isolate	Rhizoplane
500	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
501	2603880184	Klebsiella quasipneumoniae NFIX27	Isolate	Rhizoplane
502	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
503	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
504	2609459761	Enterobacter sp. NFR05	Isolate	Rhizoplane
505	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
506	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
507	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
508	2636415599	Klebsiella variicola DX120E	Isolate	Unclassified
509	2643221604	Nocardioides sp. Root190	Isolate	Unclassified
510	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
511	2643221711	Terrabacter sp. Root85	Isolate	Unclassified
512	2667528172	Enterobacteriaceae bacterium NFIX31	Isolate	Rhizoplane
513	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
514	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
515	2681812866	Enterobacter asburiae NFIX55	Isolate	Rhizoplane
516	2681812869	Enterobacter ludwigii NFPP41	Isolate	Rhizoplane
517	2684623035	Frankia sp. NRRL B-16219	Isolate	Rhizosphere
518	2684623036	Frankia sp. CgIM4	Isolate	Nodule
519	2687453737	Frankia sp. BMG5.36	Isolate	Nodule
520	2687453743	Frankia colletiae Cc1.17	Isolate	Nodule
521	2690315906	Arthrobacter sp. OY3WO11	Isolate	Unclassified
522	2710264753	Frankia sp. KB5	Isolate	Nodule
523	2738541265	Pseudomonas sp. GV077	Isolate	Unclassified
524	2738541282	Pseudomonas sp. GV058	Isolate	Unclassified
525	2738541303	Pseudomonas sp. GV105	Isolate	Unclassified
526	2751185917	Enterobacter sp. HK169	Isolate	Unclassified
527	2765235842	Enterobacter ludwigii AA4	Isolate	Unclassified
528	2773857762	Nocardioides sp. SAI-095	Isolate	Unclassified
529	2773857763	Microbacterium sp. SAI-030	Isolate	Unclassified
530	2773857924	Frankia sp. CgIS1	Isolate	Nodule
531	2773857933	Frankia sp. BMG5.30	Isolate	Nodule
532	2775506706	Enterobacter asburiae 1216	Isolate	Unclassified
533	2775506735	Arthrobacter sp. S95 1704	Isolate	Unclassified
534	2775507074	Klebsiella sp. D5A	Isolate	Unclassified
535	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
536	2791355010	Kosakonia pseudosacchari NN143	Isolate	Unclassified
537	2808606357	Arthrobacter sp. SLBN-122	Isolate	Unclassified
538	2808606360	Arthrobacter sp. SLBN-112	Isolate	Unclassified
539	2808606366	Arthrobacter sp. SLBN-83	Isolate	Unclassified
540	2808606370	Arthrobacter sp. SLBN-100	Isolate	Unclassified
541	2808606371	Arthrobacter sp. SLBN-53	Isolate	Unclassified
542	2808606439	Nocardioides sp. SLBN-172	Isolate	Unclassified
543	2808606447	Microbacterium sp. HAR-UPW-R2A-48	Isolate	Unclassified
544	2811994871	Arthrobacter sp. SLBN-179	Isolate	Unclassified
545	2811994882	Terrabacter sp. SLBN-196	Isolate	Unclassified
546	2811995292	Kosakonia oryzae Ola 51	Isolate	Unclassified
547	2814123068	Kosakonia radicincitans GXGL-4A	Isolate	Rhizosphere
548	2818991318	Humibacillus xanthopallidus SLBN-155	Isolate	Unclassified
549	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
550	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
551	2818991458	Terrabacter sp. 3211	Isolate	Rhizosphere
552	2818991462	Terrabacter sp. 3264	Isolate	Rhizosphere
553	2821118458	Enterobacter asburiae 609	Isolate	Unclassified
554	2821443989	Inquilinus ginsengisoli 584	Isolate	Unclassified
555	2823373977	Enterobacter ludwigii NCR3	Isolate	Rhizosphere
556	2831905167	Ammoniphilus oxalaticus RAOx-1	Isolate	Rhizosphere
557	2831935698	Jishengella sp. AZ1-13	Isolate	Unclassified
558	2832004796	Micromonospora endophytica JCM 18317	Isolate	Unclassified
559	2837268691	Jiangella endophytica KE2-3	Isolate	Rhizosphere
560	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
561	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
562	2841911363	Bosea caraganae RCAM04685	Isolate	Nodule
563	2841917233	Bosea caraganae RCAM04680	Isolate	Nodule
564	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
565	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
566	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
567	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
568	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
569	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
570	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
571	2842888712	Tsukamurella sp. R-71941	Isolate	Unclassified
572	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
573	2844425489	Enterobacter cloacae SBP-8	Isolate	Rhizosphere
574	2844665904	Pseudomonas protegens H1F10C	Isolate	Unclassified
575	2844849076	Arthrobacter cupressi DSM 24664	Isolate	Rhizosphere
576	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
577	2857740372	Paenarthrobacter sp. R-74611	Isolate	Unclassified
578	2891670763	Buttiauxella sp. B2	Isolate	Rhizosphere
579	2891968417	Nocardioides luteus SAI-037	Isolate	Unclassified
580	2895880812	Frankia sp. BMG5.11	Isolate	Unclassified
581	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
582	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
583	2904497146	Arthrobacter sp. 1276	Isolate	Rhizosphere
584	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
585	2904776348	Paenarthrobacter sp. 1092	Isolate	Rhizosphere
586	2917070673	Pseudomonas protegens CHA0	Isolate	Rhizosphere
587	2919034639	Paenarthrobacter nitroguajacolicus 247	Isolate	Rhizosphere
588	2919051321	Sinomonas atrocyanea 1003	Isolate	Rhizosphere
589	2919059106	Arthrobacter sp. 1088	Isolate	Rhizosphere
590	2919108558	Klebsiella sp. 1400	Isolate	Rhizosphere
591	2919391150	Arthrobacter ipis 2973	Isolate	Unclassified
592	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
593	2919446982	Phycicoccus sp. 3266	Isolate	Rhizosphere
594	2923634449	Enterobacter kobei SLBN-76	Isolate	Rhizosphere
595	2927833300	Enterobacter sp. SLBN-59	Isolate	Rhizosphere
596	2933418574	Jeotgalibacillus campisalis 4120	Isolate	Rhizosphere
597	2937539931	Pantoea sp. LS15	Isolate	Unclassified
598	2939598168	Arthrobacter sp. 754	Isolate	Rhizosphere
599	2939647034	Arthrobacter sp. 2762	Isolate	Rhizosphere
600	2939660829	Mycetocola sp. 2940	Isolate	Rhizosphere
601	2939674588	Arthrobacter bambusae 3552	Isolate	Rhizosphere
602	2945874760	Phytobacter diazotrophicus UAEU22	Isolate	Rhizosphere
603	2945916053	Arthrobacter ulcerisalmonis W1I2	Isolate	Rhizosphere
604	2945941187	Arthrobacter pascens W1I14	Isolate	Rhizosphere
605	2945956166	Arthrobacter globiformus W2I3	Isolate	Rhizosphere
606	2946024296	Arthrobacter woluwensis W4I2	Isolate	Rhizosphere
607	2946037020	Arthrobacter sp. W4I7	Isolate	Rhizosphere
608	2946059875	Arthrobacter sp. SLBN-112	Isolate	Rhizosphere
609	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
610	2971820967	Klebsiella sp. MPUS7	Isolate	Rhizosphere
611	2974302888	Pseudarthrobacter sp. SORGH_AS 212	Isolate	Unclassified
612	2974310843	Enterobacter sp. SORGH_AS 287	Isolate	Unclassified
613	2984559226	Klebsiella variicola SORGH_AS834	Isolate	Aerial Root
614	2984595703	Klebsiella variicola SORGH_AS1070	Isolate	Aerial Root
615	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
616	637000116	Frankia casuarinae CcI3	Isolate	Nodule
617	637000220	Pseudomonas protegens Pf-5	Isolate	Rhizoplane
618	8004021418	Arthrobacter sp. SDTb3-6	Isolate	Rhizosphere
619	8004025490	Arthrobacter wenxiniae AETb3-4	Isolate	Rhizosphere
620	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
621	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
622	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
623	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
624	8018405270	Enterobacter sp. 198	Isolate	Rhizosphere
625	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
626	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
627	8054107350	Arthrobacter rhizosphaerae CCNWLXL 1-35	Isolate	Rhizosphere
628	8055412473	Micromonospora phytophila DSM 105363	Isolate	Nodule
629	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	81.33
Metatranscriptomes	0.09
Isolates	18.58

Biome Distribution

Category	Percentage (%)
Aerial Root	0.18
Bulb	0
Endosphere	7.65
Nodule	3.37
Rhizoplane	11.84
Rhizosphere	61.66
Stem	0.09
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_518715	2162886007	Bacteria	5603
2	LJQas_1000468	3300000549	Bacteria	6687
3	LJQas_1002626	3300000549	Bacteria	2477
4	JGI24746J21847_1001751	3300001977	Bacteria	3481
5	JGI24747J21853_1000246	3300001978	Bacteria	2943
6	JGI24740J21852_10005274	3300001979	Bacteria	5488
7	JGI24745J21846_1003398	3300002073	Bacteria	1663
8	JGI24749J21850_1007932	3300002076	Bacteria	1477
9	JGI25155J39150_1000075	3300002704	Bacteria	62215
10	JGI25156J39149_1000103	3300002705	Bacteria	62289
11	JGI25162J39368_1000004	3300002737	Bacteria	441040
12	JGI25162J39368_1000835	3300002737	Bacteria	20295
13	JGI25162J39368_1001330	3300002737	Bacteria	13780
14	JGI25154J39366_1000018	3300002738	Bacteria	251612
15	JGI25157J39369_1000074	3300002741	Bacteria	88240
16	JGI25163J39215_1000045	3300002771	Bacteria	54643
17	JGI25164J39214_1000031	3300002772	Bacteria	144582
18	JGI25159J45721_1000093	3300002987	Bacteria	42171
19	JGI25151J46595_10010763	3300003187	Bacteria	4233
20	JGI25165J46597_1000011	3300003214	Bacteria	441040
21	JGI25165J46597_1000431	3300003214	Bacteria	42779
22	JGI25165J46597_1001289	3300003214	Bacteria	14549
23	rootH2_10002738	3300003320	Bacteria	36746
24	rootL2_10009232	3300003322	Bacteria	26984
25	rootH1_10051348	3300003323	Bacteria	2101
26	JGI25160J50197_1000044	3300003354	Bacteria	145379
27	JGI25161J50226_1000028	3300003374	Bacteria	145379
28	Ga0055542_1002991	3300003762	Bacteria	4929
29	Ga0055536_1007757	3300003781	Bacteria	4745
30	Ga0055540_1002963	3300003792	Bacteria	8521
31	Ga0058692_1000388	3300003856	Bacteria	21070
32	Ga0058692_1004166	3300003856	Bacteria	4330
33	Ga0055543_1000054	3300004625	Bacteria	104176
34	Ga0065165_1000143	3300005262	Bacteria	124381
35	Ga0065165_1002551	3300005262	Bacteria	15100
36	Ga0065704_10000341	3300005289	Bacteria	49306
37	Ga0070676_10002269	3300005328	Bacteria	9813
38	Ga0070676_10011316	3300005328	Bacteria	4850
39	Ga0070683_100082063	3300005329	Bacteria	3019
40	Ga0070690_100001876	3300005330	Bacteria	11149
41	Ga0070677_10032986	3300005333	Bacteria	1991
42	Ga0068869_100072048	3300005334	Bacteria	2560
43	Ga0068869_100122211	3300005334	Bacteria	1992
44	Ga0070666_10129765	3300005335	Bacteria	1751
45	Ga0070680_100166399	3300005336	Bacteria	1854
46	Ga0070682_100002430	3300005337	Bacteria	10315
47	Ga0070682_100166281	3300005337	Bacteria	1528
48	Ga0068868_100000981	3300005338	Bacteria	19444
49	Ga0068868_100057787	3300005338	Bacteria	3065
50	Ga0070660_100026091	3300005339	Bacteria	4350
51	Ga0070660_100062328	3300005339	Bacteria	2897
52	Ga0070691_10004309	3300005341	Bacteria	6465
53	Ga0070687_100090126	3300005343	Bacteria	1694
54	Ga0070692_10015140	3300005345	Bacteria	3641
55	Ga0070668_100007935	3300005347	Bacteria	7882
56	Ga0070668_100119488	3300005347	Bacteria	2105
57	Ga0070668_100180262	3300005347	Bacteria	1725
58	Ga0070669_100010640	3300005353	Bacteria	6530
59	Ga0070675_100053737	3300005354	Bacteria	3313
60	Ga0070671_100006111	3300005355	Bacteria	9589
61	Ga0070671_100178714	3300005355	Bacteria	1796
62	Ga0070674_100000580	3300005356	Bacteria	18459
63	Ga0070674_100083364	3300005356	Bacteria	2289
64	Ga0070688_100007332	3300005365	Bacteria	5942
65	Ga0070688_100027360	3300005365	Bacteria	3396
66	Ga0070659_100014976	3300005366	Bacteria	5801
67	Ga0070659_100051419	3300005366	Bacteria	3240
68	Ga0070659_100305972	3300005366	Bacteria	1326
69	Ga0070667_100003100	3300005367	Bacteria	14303
70	Ga0070703_10037294	3300005406	Bacteria	1497
71	Ga0070709_10059028	3300005434	Bacteria	2435
72	Ga0070709_10124793	3300005434	Bacteria	1750
73	Ga0070714_100230360	3300005435	Bacteria	1706
74	Ga0070713_100162689	3300005436	Bacteria	1993
75	Ga0070710_10006928	3300005437	Bacteria	5466
76	Ga0070710_10051031	3300005437	Bacteria	2321
77	Ga0070701_10006934	3300005438	Bacteria	4803
78	Ga0070711_100000375	3300005439	Bacteria	23132
79	Ga0070711_100005852	3300005439	Bacteria	7380
80	Ga0070705_100003911	3300005440	Bacteria	7283
81	Ga0070694_100014489	3300005444	Bacteria	4937
82	Ga0070708_100006377	3300005445	Bacteria	9394
83	Ga0070663_100321101	3300005455	Bacteria	1245
84	Ga0070678_100001259	3300005456	Bacteria	13431
85	Ga0070678_100025970	3300005456	Bacteria	3952
86	Ga0070678_100117780	3300005456	Bacteria	2089
87	Ga0070662_100011890	3300005457	Bacteria	5755
88	Ga0070662_100040984	3300005457	Bacteria	3300
89	Ga0070681_10091061	3300005458	Bacteria	3000
90	Ga0068867_100008191	3300005459	Bacteria	7384
91	Ga0068867_100176089	3300005459	Bacteria	1697
92	Ga0070685_10027712	3300005466	Bacteria	3134
93	Ga0070706_100002862	3300005467	Bacteria	17203
94	Ga0070707_100019719	3300005468	Bacteria	6356
95	Ga0070699_100001310	3300005518	Bacteria	22924
96	Ga0070679_100261854	3300005530	Bacteria	1684
97	Ga0070697_100000606	3300005536	Bacteria	27199
98	Ga0068853_100006398	3300005539	Bacteria	9356
99	Ga0070672_100140266	3300005543	Bacteria	1993
100	Ga0070695_100035844	3300005545	Bacteria	3118
101	Ga0070696_100001702	3300005546	Bacteria	14418
102	Ga0070693_100002698	3300005547	Bacteria	8167
103	Ga0070665_100000203	3300005548	Bacteria	104072
104	Ga0070665_100017040	3300005548	Bacteria	7286
105	Ga0070665_100021730	3300005548	Bacteria	6452
106	Ga0070665_100025808	3300005548	Bacteria	5918
107	Ga0070665_100055527	3300005548	Bacteria	3972
108	Ga0070665_100111495	3300005548	Bacteria	2738
109	Ga0070704_100001435	3300005549	Bacteria	12737
110	Ga0070704_100101838	3300005549	Bacteria	2166
111	Ga0068855_100015536	3300005563	Bacteria	9165
112	Ga0068855_100089813	3300005563	Bacteria	3546
113	Ga0068855_100101291	3300005563	Bacteria	3316
114	Ga0068857_100000003	3300005577	Bacteria	174630
115	Ga0068856_100038325	3300005614	Bacteria	4705
116	Ga0068856_100077168	3300005614	Bacteria	3301
117	Ga0070702_100000895	3300005615	Bacteria	11606
118	Ga0070702_100005515	3300005615	Bacteria	5906
119	Ga0068852_100255699	3300005616	Bacteria	1680
120	Ga0068852_100289405	3300005616	Bacteria	1582
121	Ga0068859_100000135	3300005617	Bacteria	69109
122	Ga0068859_100006460	3300005617	Bacteria	11892
123	Ga0068859_100279464	3300005617	Bacteria	1762
124	Ga0068864_100051026	3300005618	Bacteria	3562
125	Ga0068866_10000812	3300005718	Bacteria	13959
126	Ga0068861_100002386	3300005719	Bacteria	12233
127	Ga0068861_100196644	3300005719	Bacteria	1689
128	Ga0068851_10045559	3300005834	Bacteria	2217
129	Ga0068863_100083843	3300005841	Bacteria	3021
130	Ga0068863_100097901	3300005841	Bacteria	2786
131	Ga0068863_100292479	3300005841	Bacteria	1579
132	Ga0068858_100001306	3300005842	Bacteria	25730
133	Ga0068858_100111366	3300005842	Bacteria	2556
134	Ga0068860_100005764	3300005843	Bacteria	12488
135	Ga0068862_100000116	3300005844	Bacteria	94558
136	Ga0068862_100008628	3300005844	Bacteria	8431
137	Ga0081455_10035060	3300005937	Bacteria	4489
138	Ga0081455_10119243	3300005937	Bacteria	2081
139	Ga0081540_1011205	3300005983	Bacteria	6012
140	Ga0070717_10004536	3300006028	Bacteria	10040
141	Ga0075365_10013946	3300006038	Bacteria	4823
142	Ga0075365_10277788	3300006038	Bacteria	1178
143	Ga0075363_100001358	3300006048	Bacteria	9199
144	Ga0075363_100010113	3300006048	Bacteria	4462
145	Ga0075364_10000293	3300006051	Bacteria	24192
146	Ga0075364_10001383	3300006051	Bacteria	13095
147	Ga0075364_10003886	3300006051	Bacteria	8568
148	Ga0075364_10006351	3300006051	Bacteria	6944
149	Ga0075364_10008216	3300006051	Bacteria	6230
150	Ga0075364_10194914	3300006051	Bacteria	1372
151	Ga0075432_10000869	3300006058	Bacteria	9524
152	Ga0075432_10008270	3300006058	Bacteria	3546
153	Ga0070715_10017666	3300006163	Bacteria	2704
154	Ga0070715_10036099	3300006163	Bacteria	2037
155	Ga0070716_100008407	3300006173	Bacteria	5120
156	Ga0070716_100019326	3300006173	Bacteria	3560
157	Ga0070712_100009065	3300006175	Bacteria	6265
158	Ga0070712_100011261	3300006175	Bacteria	5665
159	Ga0070712_100083534	3300006175	Bacteria	2319
160	Ga0070712_100339358	3300006175	Bacteria	1226
161	Ga0075367_10014568	3300006178	Bacteria	4258
162	Ga0075367_10027655	3300006178	Bacteria	3229
163	Ga0075369_10005139	3300006186	Bacteria	4874
164	Ga0075369_10056713	3300006186	Bacteria	1703
165	Ga0097621_100009484	3300006237	Bacteria	7065
166	Ga0097621_100104150	3300006237	Bacteria	2390
167	Ga0075370_10001391	3300006353	Bacteria	10430
168	Ga0075370_10011592	3300006353	Bacteria	4636
169	Ga0075370_10012515	3300006353	Bacteria	4486
170	Ga0068871_100063229	3300006358	Bacteria	3026
171	Ga0075428_100004253	3300006844	Bacteria	15752
172	Ga0075431_100025424	3300006847	Bacteria	6069
173	Ga0068865_100003677	3300006881	Bacteria	9215
174	Ga0068865_100094911	3300006881	Bacteria	2172
175	Ga0068865_100155769	3300006881	Bacteria	1737
176	Ga0097620_100000135	3300006931	Bacteria	69109
177	Ga0097620_100006460	3300006931	Bacteria	11892
178	Ga0097620_100279478	3300006931	Bacteria	1762
179	Ga0079104_1000436	3300006946	Bacteria	47515
180	Ga0079104_1000853	3300006946	Bacteria	25352
181	Ga0079104_1000958	3300006946	Bacteria	22629
182	Ga0075435_100078251	3300007076	Bacteria	2712
183	Ga0105251_10000001	3300009011	Bacteria	466643
184	Ga0105251_10000053	3300009011	Bacteria	106190
185	Ga0105251_10000814	3300009011	Bacteria	28073
186	Ga0105251_10011633	3300009011	Bacteria	5019
187	Ga0105251_10013261	3300009011	Bacteria	4618
188	Ga0105251_10061674	3300009011	Bacteria	1762
189	Ga0105244_10000094	3300009036	Bacteria	94550
190	Ga0105244_10000861	3300009036	Bacteria	25612
191	Ga0105244_10015089	3300009036	Bacteria	4441
192	Ga0105244_10028140	3300009036	Bacteria	3019
193	Ga0105244_10087526	3300009036	Bacteria	1535
194	Ga0105250_10000040	3300009092	Bacteria	133899
195	Ga0105250_10002079	3300009092	Bacteria	10271
196	Ga0105240_10000910	3300009093	Bacteria	52855
197	Ga0111539_10305876	3300009094	Bacteria	1850
198	Ga0105245_10001029	3300009098	Bacteria	25345
199	Ga0105245_10097228	3300009098	Bacteria	2719
200	Ga0105245_10203478	3300009098	Bacteria	1902
201	Ga0105245_10288762	3300009098	Bacteria	1606
202	Ga0105247_10006972	3300009101	Bacteria	6958
203	Ga0105247_10038125	3300009101	Bacteria	2932
204	Ga0105247_10067449	3300009101	Bacteria	2229
205	Ga0114129_10002350	3300009147	Bacteria	26252
206	Ga0114129_10213149	3300009147	Bacteria	2610
207	Ga0105243_10001000	3300009148	Bacteria	26146
208	Ga0105243_10009101	3300009148	Bacteria	7586
209	Ga0105243_10012467	3300009148	Bacteria	6426
210	Ga0105243_10154509	3300009148	Bacteria	1972
211	Ga0105243_10159034	3300009148	Bacteria	1946
212	Ga0105243_10331170	3300009148	Bacteria	1391
213	Ga0105243_10375337	3300009148	Bacteria	1313
214	Ga0105242_10000759	3300009176	Bacteria	25113
215	Ga0105242_10100051	3300009176	Bacteria	2455
216	Ga0105248_10003071	3300009177	Bacteria	18513
217	Ga0105248_10022517	3300009177	Bacteria	6989
218	Ga0105248_10026472	3300009177	Bacteria	6453
219	Ga0105248_10164663	3300009177	Bacteria	2500
220	Ga0105237_10001371	3300009545	Bacteria	32139
221	Ga0105237_10016277	3300009545	Bacteria	7729
222	Ga0105237_10047548	3300009545	Bacteria	4313
223	Ga0105237_10262009	3300009545	Bacteria	1731
224	Ga0105238_10119629	3300009551	Bacteria	2614
225	Ga0105238_10184880	3300009551	Bacteria	2060
226	Ga0105238_10387432	3300009551	Bacteria	1390
227	Ga0105249_10001675	3300009553	Bacteria	19437
228	Ga0105249_10005735	3300009553	Bacteria	10736
229	Ga0105249_10054319	3300009553	Bacteria	3663
230	Ga0105239_10016179	3300010375	Bacteria	8252
231	Ga0105239_10018700	3300010375	Bacteria	7654
232	Ga0105239_10336298	3300010375	Bacteria	1704
233	Ga0105246_10001193	3300011119	Bacteria	15149
234	Ga0105246_10010325	3300011119	Bacteria	5774
235	Ga0105246_10158570	3300011119	Bacteria	1721
236	Ga0105246_10168399	3300011119	Bacteria	1675
237	Ga0157373_10024417	3300013100	Bacteria	4378
238	Ga0157371_10000057	3300013102	Bacteria	171900
239	Ga0157371_10000745	3300013102	Bacteria	37925
240	Ga0157371_10058675	3300013102	Bacteria	2730
241	Ga0157371_10104782	3300013102	Bacteria	2007
242	Ga0157371_10136086	3300013102	Bacteria	1749
243	Ga0157370_10000909	3300013104	Bacteria	37515
244	Ga0157370_10003872	3300013104	Bacteria	17430
245	Ga0157370_10028924	3300013104	Bacteria	5445
246	Ga0157369_10046045	3300013105	Bacteria	4742
247	Ga0157374_10028263	3300013296	Bacteria	5066
248	Ga0157378_10001038	3300013297	Bacteria	25353
249	Ga0157378_10028844	3300013297	Bacteria	4898
250	Ga0163162_10047770	3300013306	Bacteria	4288
251	Ga0163162_10087320	3300013306	Bacteria	3197
252	Ga0163162_10155870	3300013306	Bacteria	2404
253	Ga0157372_10022394	3300013307	Bacteria	6836
254	Ga0157375_10000838	3300013308	Bacteria	26885
255	Ga0157375_10048072	3300013308	Bacteria	4171
256	Ga0157375_10325504	3300013308	Bacteria	1702
257	Ga0163163_10003937	3300014325	Bacteria	12671
258	Ga0163163_10013212	3300014325	Bacteria	7549
259	Ga0157380_10011425	3300014326	Bacteria	6416
260	Ga0182008_10000224	3300014497	Bacteria	44336
261	Ga0157379_10135619	3300014968	Bacteria	2217
262	Ga0182005_1018965	3300015265	Bacteria	1899
263	Ga0183370_1001	3300015680	Bacteria	2743932
264	Ga0183369_1001	3300015685	Bacteria	2743932
265	Ga0183368_1001	3300015687	Bacteria	2743932
266	Ga0163161_10023518	3300017792	Bacteria	4347
267	Ga0163161_10089319	3300017792	Bacteria	2279
268	Ga0163161_10314696	3300017792	Bacteria	1236
269	Ga0206353_10981172	3300020082	Bacteria	5624
270	Ga0213873_10000139	3300021358	Bacteria	13843
271	Ga0213876_10000158	3300021384	Bacteria	70972
272	Ga0213875_10000778	3300021388	Bacteria	23813
273	Ga0213875_10016436	3300021388	Bacteria	3588
274	Ga0209435_100044	3300025206	Bacteria	99051
275	Ga0209760_100032	3300025207	Bacteria	138015
276	Ga0209436_104981	3300025208	Bacteria	3166
277	Ga0209672_103766	3300025228	Bacteria	3017
278	Ga0207427_100003	3300025231	Bacteria	1035004
279	Ga0209437_100002	3300025233	Bacteria	1574801
280	Ga0209437_100050	3300025233	Bacteria	394010
281	Ga0209437_100205	3300025233	Bacteria	115669
282	Ga0207425_1004615	3300025245	Bacteria	4081
283	Ga0209646_1000151	3300025246	Bacteria	99050
284	Ga0209026_1000170	3300025250	Bacteria	99050
285	Ga0209148_1000288	3300025254	Bacteria	75455
286	Ga0209148_1001608	3300025254	Bacteria	10532
287	Ga0209759_1000186	3300025256	Bacteria	100413
288	Ga0209129_1000109	3300025258	Bacteria	153068
289	Ga0209233_1000004	3300025261	Bacteria	1574798
290	Ga0209233_1000037	3300025261	Bacteria	554620
291	Ga0209233_1000187	3300025261	Bacteria	133091
292	Ga0209233_1000232	3300025261	Bacteria	96361
293	Ga0209455_1000806	3300025272	Bacteria	17234
294	Ga0209455_1006594	3300025272	Bacteria	3407
295	Ga0209130_1000093	3300025284	Bacteria	145707
296	Ga0209130_1000342	3300025284	Bacteria	53602
297	Ga0209676_1000547	3300025292	Bacteria	57868
298	Ga0209025_1001288	3300025294	Bacteria	34293
299	Ga0207426_1000012	3300025302	Bacteria	730942
300	Ga0207426_1007080	3300025302	Bacteria	4747
301	Ga0209051_1001831	3300025303	Bacteria	16804
302	Ga0209051_1008709	3300025303	Bacteria	5337
303	Ga0209051_1017046	3300025303	Bacteria	3260
304	Ga0207697_10002763	3300025315	Bacteria	8953
305	Ga0207696_1000077	3300025711	Bacteria	209611
306	Ga0207696_1025499	3300025711	Bacteria	1842
307	Ga0207655_1000032	3300025728	Bacteria	391253
308	Ga0207655_1000102	3300025728	Bacteria	185859
309	Ga0207655_1000820	3300025728	Bacteria	33641
310	Ga0207655_1006340	3300025728	Bacteria	7852
311	Ga0207655_1013285	3300025728	Bacteria	4740
312	Ga0207655_1014743	3300025728	Bacteria	4394
313	Ga0207713_1000021	3300025735	Bacteria	353108
314	Ga0207713_1000040	3300025735	Bacteria	245322
315	Ga0207713_1000117	3300025735	Bacteria	129339
316	Ga0207713_1000147	3300025735	Bacteria	106198
317	Ga0207713_1000440	3300025735	Bacteria	43654
318	Ga0207713_1004808	3300025735	Bacteria	8668
319	Ga0207713_1009101	3300025735	Bacteria	5636
320	Ga0207682_10002817	3300025893	Bacteria	7684
321	Ga0207642_10000117	3300025899	Bacteria	21526
322	Ga0207710_10002181	3300025900	Bacteria	9199
323	Ga0207710_10004229	3300025900	Bacteria	6291
324	Ga0207688_10003291	3300025901	Bacteria	8826
325	Ga0207688_10009637	3300025901	Bacteria	5259
326	Ga0207680_10005559	3300025903	Bacteria	6027
327	Ga0207647_10034165	3300025904	Bacteria	3249
328	Ga0207647_10070355	3300025904	Bacteria	2114
329	Ga0207685_10025209	3300025905	Bacteria	2050
330	Ga0207699_10009138	3300025906	Bacteria	4923
331	Ga0207645_10004199	3300025907	Bacteria	10699
332	Ga0207645_10013384	3300025907	Bacteria	5529
333	Ga0207645_10032885	3300025907	Bacteria	3334
334	Ga0207705_10001355	3300025909	Bacteria	19559
335	Ga0207695_10000427	3300025913	Bacteria	93089
336	Ga0207671_10000288	3300025914	Bacteria	74500
337	Ga0207671_10021085	3300025914	Bacteria	4950
338	Ga0207671_10104728	3300025914	Bacteria	2146
339	Ga0207671_10141135	3300025914	Bacteria	1856
340	Ga0207693_10000930	3300025915	Bacteria	26312
341	Ga0207693_10001479	3300025915	Bacteria	20767
342	Ga0207663_10003213	3300025916	Bacteria	7959
343	Ga0207663_10006894	3300025916	Bacteria	5854
344	Ga0207662_10012772	3300025918	Bacteria	4684
345	Ga0207657_10001803	3300025919	Bacteria	23097
346	Ga0207652_10140680	3300025921	Bacteria	2158
347	Ga0207646_10021446	3300025922	Bacteria	5968
348	Ga0207646_10064645	3300025922	Bacteria	3266
349	Ga0207694_10124257	3300025924	Bacteria	2063
350	Ga0207650_10003161	3300025925	Bacteria	11346
351	Ga0207659_10094802	3300025926	Bacteria	2237
352	Ga0207687_10001128	3300025927	Bacteria	18184
353	Ga0207700_10059658	3300025928	Bacteria	2886
354	Ga0207644_10102110	3300025931	Bacteria	2156
355	Ga0207690_10046209	3300025932	Bacteria	2882
356	Ga0207690_10136756	3300025932	Bacteria	1800
357	Ga0207690_10204331	3300025932	Bacteria	1502
358	Ga0207706_10029347	3300025933	Bacteria	4910
359	Ga0207706_10132171	3300025933	Bacteria	2195
360	Ga0207686_10002045	3300025934	Bacteria	11121
361	Ga0207686_10052665	3300025934	Bacteria	2541
362	Ga0207709_10005909	3300025935	Bacteria	6904
363	Ga0207709_10082893	3300025935	Bacteria	2072
364	Ga0207709_10144235	3300025935	Bacteria	1641
365	Ga0207709_10319197	3300025935	Bacteria	1162
366	Ga0207669_10000297	3300025937	Bacteria	22865
367	Ga0207669_10013054	3300025937	Bacteria	4111
368	Ga0207669_10036227	3300025937	Bacteria	2817
369	Ga0207669_10110220	3300025937	Bacteria	1843
370	Ga0207704_10002558	3300025938	Bacteria	8202
371	Ga0207704_10014878	3300025938	Bacteria	3946
372	Ga0207665_10002468	3300025939	Bacteria	12472
373	Ga0207665_10003248	3300025939	Bacteria	10882
374	Ga0207665_10046974	3300025939	Bacteria	2893
375	Ga0207691_10002149	3300025940	Bacteria	19307
376	Ga0207691_10084487	3300025940	Bacteria	2849
377	Ga0207711_10012376	3300025941	Bacteria	7091
378	Ga0207689_10018892	3300025942	Bacteria	5813
379	Ga0207689_10036523	3300025942	Bacteria	4078
380	Ga0207661_10061731	3300025944	Bacteria	3029
381	Ga0207667_10004039	3300025949	Bacteria	18031
382	Ga0207667_10072679	3300025949	Bacteria	3575
383	Ga0207667_10154905	3300025949	Bacteria	2358
384	Ga0207712_10004913	3300025961	Bacteria	8453
385	Ga0207712_10007450	3300025961	Bacteria	6910
386	Ga0207668_10003771	3300025972	Bacteria	8926
387	Ga0207668_10068589	3300025972	Bacteria	2522
388	Ga0207640_10004996	3300025981	Bacteria	7211
389	Ga0207658_10006512	3300025986	Bacteria	7972
390	Ga0207658_10086660	3300025986	Bacteria	2416
391	Ga0207658_10143475	3300025986	Bacteria	1936
392	Ga0207677_10003489	3300026023	Bacteria	8331
393	Ga0207703_10001189	3300026035	Bacteria	24483
394	Ga0207703_10344814	3300026035	Bacteria	1370
395	Ga0207639_10003053	3300026041	Bacteria	11278
396	Ga0207639_10151392	3300026041	Bacteria	1943
397	Ga0207678_10010201	3300026067	Bacteria	8246
398	Ga0207678_10217964	3300026067	Bacteria	1633
399	Ga0207708_10004036	3300026075	Bacteria	10792
400	Ga0207708_10011449	3300026075	Bacteria	6608
401	Ga0207702_10036608	3300026078	Bacteria	4105
402	Ga0207702_10131074	3300026078	Bacteria	2256
403	Ga0207641_10080909	3300026088	Bacteria	2820
404	Ga0207648_10001361	3300026089	Bacteria	27023
405	Ga0207648_10016998	3300026089	Bacteria	6630
406	Ga0207676_10027519	3300026095	Bacteria	4236
407	Ga0207674_10000043	3300026116	Bacteria	124448
408	Ga0207674_10144672	3300026116	Bacteria	2336
409	Ga0207675_100003845	3300026118	Bacteria	14607
410	Ga0207675_100125954	3300026118	Bacteria	2426
411	Ga0207675_100201901	3300026118	Bacteria	1910
412	Ga0207683_10002759	3300026121	Bacteria	15343
413	Ga0207683_10005268	3300026121	Bacteria	11099
414	Ga0207683_10020625	3300026121	Bacteria	5639
415	Ga0207683_10030503	3300026121	Bacteria	4672
416	Ga0207683_10385420	3300026121	Bacteria	1289
417	Ga0207698_10152272	3300026142	Bacteria	2009
418	Ga0209281_1000122	3300027111	Bacteria	205171
419	Ga0209281_1000275	3300027111	Bacteria	98817
420	Ga0209281_1000622	3300027111	Bacteria	39499
421	Ga0209371_1000001	3300027312	Bacteria	2771503
422	Ga0209371_1000101	3300027312	Bacteria	153288
423	Ga0209371_1001497	3300027312	Bacteria	15561
424	Ga0209371_1003766	3300027312	Bacteria	7075
425	Ga0209371_1004132	3300027312	Bacteria	6511
426	Ga0209371_1004225	3300027312	Bacteria	6386
427	Ga0209371_1006488	3300027312	Bacteria	4320
428	Ga0207428_10011029	3300027907	Bacteria	8033
429	Ga0268266_10000084	3300028379	Bacteria	201874
430	Ga0268266_10024890	3300028379	Bacteria	5093
431	Ga0268266_10038058	3300028379	Bacteria	4096
432	Ga0268266_10139572	3300028379	Bacteria	2174
433	Ga0268265_10000126	3300028380	Bacteria	96627
434	Ga0268265_10019493	3300028380	Bacteria	4716
435	Ga0268265_10095928	3300028380	Bacteria	2382
436	Ga0268264_10005225	3300028381	Bacteria	10994
437	Ga0268264_10117195	3300028381	Bacteria	2342
438	Ga0307515_10021556	3300028794	Bacteria	11416
439	Ga0268256_1000001	3300030500	Bacteria	2771065
440	Ga0268256_1000029	3300030500	Bacteria	430123
441	Ga0268256_1000759	3300030500	Bacteria	23610
442	Ga0268256_1003707	3300030500	Bacteria	6730
443	Ga0268256_1003737	3300030500	Bacteria	6687
444	Ga0268256_1003894	3300030500	Bacteria	6490
445	Ga0268256_1006523	3300030500	Bacteria	4320
446	Ga0265340_10034077	3300031247	Bacteria	2533
447	Ga0265339_10063055	3300031249	Bacteria	1991
448	Ga0265331_10003074	3300031250	Bacteria	10947
449	Ga0307513_10073842	3300031456	Bacteria	3549
450	Ga0307408_100049434	3300031548	Bacteria	3020
451	Ga0307408_100050755	3300031548	Bacteria	2985
452	Ga0307408_100110335	3300031548	Bacteria	2112
453	Ga0265313_10000079	3300031595	Bacteria	95515
454	Ga0307514_10001732	3300031649	Bacteria	24991
455	Ga0316579_10023923	3300031691	Bacteria	2746
456	Ga0265342_10082214	3300031712	Bacteria	1858
457	Ga0316576_10000482	3300031727	Bacteria	18722
458	Ga0316578_10000931	3300031728	Bacteria	11107
459	Ga0307405_10018647	3300031731	Bacteria	3833
460	Ga0307405_10046575	3300031731	Bacteria	2665
461	Ga0307405_10133770	3300031731	Bacteria	1718
462	Ga0307413_10008128	3300031824	Bacteria	4930
463	Ga0307413_10032302	3300031824	Bacteria	2965
464	Ga0307413_10059073	3300031824	Bacteria	2354
465	Ga0307413_10172243	3300031824	Bacteria	1533
466	Ga0307413_10303852	3300031824	Bacteria	1211
467	Ga0307410_10007580	3300031852	Bacteria	5952
468	Ga0307410_10010666	3300031852	Bacteria	5218
469	Ga0307410_10013492	3300031852	Bacteria	4770
470	Ga0307410_10069505	3300031852	Bacteria	2436
471	Ga0307410_10098960	3300031852	Bacteria	2087
472	Ga0307406_10112098	3300031901	Bacteria	1880
473	Ga0307407_10076451	3300031903	Bacteria	2010
474	Ga0307407_10125563	3300031903	Bacteria	1634
475	Ga0307407_10156281	3300031903	Bacteria	1488
476	Ga0307412_10010649	3300031911	Bacteria	5300
477	Ga0307412_10038907	3300031911	Bacteria	3066
478	Ga0307412_10047066	3300031911	Bacteria	2830
479	Ga0307412_10097866	3300031911	Bacteria	2068
480	Ga0307412_10195167	3300031911	Bacteria	1533
481	Ga0307409_100032242	3300031995	Bacteria	3796
482	Ga0307409_100040099	3300031995	Bacteria	3482
483	Ga0307409_100062345	3300031995	Bacteria	2918
484	Ga0307409_100080254	3300031995	Bacteria	2632
485	Ga0307409_100216382	3300031995	Bacteria	1726
486	Ga0307409_100373919	3300031995	Bacteria	1352
487	Ga0307416_100008364	3300032002	Bacteria	6668
488	Ga0307416_100010587	3300032002	Bacteria	6102
489	Ga0307416_100116667	3300032002	Bacteria	2367
490	Ga0307416_100351555	3300032002	Bacteria	1492
491	Ga0307416_100612883	3300032002	Bacteria	1170
492	Ga0307414_10002021	3300032004	Bacteria	10541
493	Ga0307414_10046012	3300032004	Bacteria	2992
494	Ga0307414_10060995	3300032004	Bacteria	2670
495	Ga0307411_10007352	3300032005	Bacteria	5602
496	Ga0307415_100020862	3300032126	Bacteria	4011
497	Ga0307415_100031575	3300032126	Bacteria	3414
498	Ga0307415_100154332	3300032126	Bacteria	1771
499	Ga0307415_100282642	3300032126	Bacteria	1365
500	Ga0307510_10126901	3300033180	Bacteria	2238
501	Ga0373944_0027125	3300035089	Bacteria	1696
502	Ga0373951_0041382	3300035091	Bacteria	1112
503	Ga0373932_0022393	3300035112	Bacteria	1678
504	Ga0373935_0256795	3300035692	Bacteria	1224
505	Ga0316582_0261160	3300036647	Bacteria	1187
506	Ga0316584_0000134	3300036712	Bacteria	32879
507	Ga0395899_0006752	3300037312	Bacteria	8889
508	Ga0395900_0044111	3300037418	Bacteria	4596
509	Ga0395900_0165621	3300037418	Bacteria	2253
510	Ga0395898_0001462	3300037466	Bacteria	33336
511	Ga0395898_0011125	3300037466	Bacteria	9368
512	Ga0395898_0014457	3300037466	Bacteria	8106
513	Ga0395898_0214002	3300037466	Bacteria	1838
514	Ga0395905_0029185	3300037471	Bacteria	5199
515	Ga0395905_0032545	3300037471	Bacteria	4904
516	Ga0395905_0054066	3300037471	Bacteria	3758
517	Ga0316581_0000541	3300037588	Bacteria	7378
518	Ga0436364_0150041	3300037853	Bacteria	12768
519	Ga0436364_0377973	3300037853	Bacteria	58023
520	Ga0436364_0829841	3300037853	Bacteria	3774
521	Ga0395901_0000132	3300038443	Bacteria	96418
522	Ga0395901_0004658	3300038443	Bacteria	13831
523	Ga0395901_0017119	3300038443	Bacteria	7390
524	Ga0395901_0049057	3300038443	Bacteria	4386
525	Ga0395901_0057384	3300038443	Bacteria	4049
526	Ga0237819_07603	3300038705	Bacteria	1546
527	Ga0436365_0098304	3300039437	Bacteria	4258
528	Ga0436365_0571044	3300039437	Bacteria	107748
529	Ga0436362_0900593	3300039453	Bacteria	33555
530	Ga0439436_0005199	3300041404	Bacteria	3989
531	Ga0439436_0019485	3300041404	Bacteria	2025
532	Ga0439439_0013842	3300041406	Bacteria	1958
533	Ga0439466_0012980	3300041411	Bacteria	3057
534	Ga0439465_0000501	3300041413	Bacteria	11678
535	Ga0451789_0815329	3300041443	Bacteria	1124
536	Ga0451853_0144711	3300041512	Bacteria	1484
537	Ga0439433_0001377	3300041999	Bacteria	5005
538	Ga0439442_000063	3300042002	Bacteria	25468
539	Ga0439442_000196	3300042002	Bacteria	15363
540	Ga0439442_004871	3300042002	Bacteria	2673
541	Ga0439442_010005	3300042002	Bacteria	1919
542	Ga0439442_013312	3300042002	Bacteria	1687
543	Ga0439442_023646	3300042002	Bacteria	1277
544	Ga0439432_016304	3300042006	Bacteria	2502
545	Ga0439449_0000390	3300042007	Bacteria	16252
546	Ga0439449_0017159	3300042007	Bacteria	2718
547	Ga0439457_003299	3300042014	Bacteria	4414
548	Ga0439462_0006218	3300042015	Bacteria	2962
549	Ga0450920_000276	3300042122	Bacteria	7732
550	Ga0450920_006233	3300042122	Bacteria	2141
551	Ga0450907_000361	3300042146	Bacteria	13994
552	Ga0439434_0001874	3300042435	Bacteria	6115
553	Ga0439464_0001914	3300042439	Bacteria	5034
554	Ga0450918_003585	3300042531	Bacteria	2877
555	Ga0466981_0000006	3300044669	Bacteria	157389
556	Ga0466968_0009658	3300044735	Bacteria	3716
557	Ga0466968_0085872	3300044735	Bacteria	1389
558	Ga0466970_0000150	3300044765	Bacteria	32514
559	Ga0466967_0123441	3300045976	Bacteria	2396
560	Ga0466967_0132650	3300045976	Bacteria	2314
561	Ga0495617_020005	3300046452	Bacteria	2262
562	Ga0495627_007536	3300046453	Bacteria	4161
563	Ga0495627_026276	3300046453	Bacteria	1878
564	Ga0495592_0040260	3300046454	Bacteria	3507
565	Ga0495591_000172	3300046458	Bacteria	67392
566	Ga0495591_002491	3300046458	Bacteria	10204
567	Ga0495591_026011	3300046458	Bacteria	1826
568	Ga0495638_0124157	3300046460	Bacteria	1523
569	Ga0495651_0031426	3300046462	Bacteria	4140
570	Ga0495653_0001814	3300046463	Bacteria	16828
571	Ga0495653_0035166	3300046463	Bacteria	3955
572	Ga0495650_0000175	3300046471	Bacteria	140965
573	Ga0495650_0008099	3300046471	Bacteria	6191
574	Ga0495650_0011486	3300046471	Bacteria	4846
575	Ga0495650_0013733	3300046471	Bacteria	4262
576	Ga0495580_0009044	3300046472	Bacteria	7860
577	Ga0495582_0019384	3300046473	Bacteria	3718
578	Ga0495605_0000007	3300046474	Bacteria	358289
579	Ga0495605_0000054	3300046474	Bacteria	157560
580	Ga0495639_0002530	3300046475	Bacteria	7975
581	Ga0495639_0060843	3300046475	Bacteria	1731
582	Ga0495584_0001887	3300046491	Bacteria	12086
583	Ga0495585_0004929	3300046492	Bacteria	8538
584	Ga0495594_0003947	3300046499	Bacteria	7632
585	Ga0495594_0110452	3300046499	Bacteria	1550
586	Ga0495607_0000036	3300046501	Bacteria	140259
587	Ga0495607_0015562	3300046501	Bacteria	4927
588	Ga0495583_0000007	3300046506	Bacteria	434661
589	Ga0495583_0001768	3300046506	Bacteria	20619
590	Ga0495606_0000079	3300046507	Bacteria	164788
591	Ga0495606_0100337	3300046507	Bacteria	1763
592	Ga0495610_0012966	3300046512	Bacteria	4981
593	Ga0495616_0005880	3300046513	Bacteria	7485
594	Ga0495616_0033445	3300046513	Bacteria	2678
595	Ga0495620_0000014	3300046515	Bacteria	157890
596	Ga0495620_0000152	3300046515	Bacteria	56303
597	Ga0495620_0008332	3300046515	Bacteria	5569
598	Ga0495620_0039931	3300046515	Bacteria	2070
599	Ga0495628_0005701	3300046516	Bacteria	10906
600	Ga0495630_0108243	3300046517	Bacteria	2105
601	Ga0495631_0005933	3300046518	Bacteria	6356
602	Ga0495631_0012019	3300046518	Bacteria	4243
603	Ga0495632_0062825	3300046519	Bacteria	1799
604	Ga0495637_0000075	3300046520	Bacteria	79690
605	Ga0495643_0010108	3300046522	Bacteria	5822
606	Ga0495644_0002009	3300046523	Bacteria	8183
607	Ga0495648_0006335	3300046524	Bacteria	9679
608	Ga0495648_0064957	3300046524	Bacteria	2148
609	Ga0495648_0111416	3300046524	Bacteria	1488
610	Ga0495642_0012477	3300046528	Bacteria	3276
611	Ga0495652_0124494	3300046529	Bacteria	2050
612	Ga0495654_0003042	3300046530	Bacteria	10442
613	Ga0495654_0003868	3300046530	Bacteria	9043
614	Ga0495654_0010915	3300046530	Bacteria	4936
615	Ga0495665_0004101	3300046531	Bacteria	7851
616	Ga0495665_0030854	3300046531	Bacteria	2867
617	Ga0495640_0052585	3300046533	Bacteria	2796
618	Ga0495586_0001078	3300046535	Bacteria	15403
619	Ga0495586_0008289	3300046535	Bacteria	5533
620	Ga0495587_0002655	3300046536	Bacteria	11943
621	Ga0495609_0000004	3300046538	Bacteria	697346
622	Ga0495609_0000016	3300046538	Bacteria	312882
623	Ga0495597_0000800	3300046542	Bacteria	24862
624	Ga0495645_0045287	3300046543	Bacteria	3209
625	Ga0495633_0000051	3300046558	Bacteria	154944
626	Ga0495667_0007819	3300046559	Bacteria	7241
627	Ga0495667_0055290	3300046559	Bacteria	2610
628	Ga0495668_0057643	3300046616	Bacteria	2144
629	Ga0495611_0001208	3300046648	Bacteria	13357
630	Ga0495659_0023417	3300046664	Bacteria	2098
631	Ga0495661_0000035	3300046665	Bacteria	165551
632	Ga0495661_0000106	3300046665	Bacteria	100351
633	Ga0495661_0029575	3300046665	Bacteria	3495
634	Ga0495588_0001553	3300046674	Bacteria	9825
635	Ga0495588_0017284	3300046674	Bacteria	3499
636	Ga0495657_0028038	3300046675	Bacteria	3965
637	Ga0495599_0002087	3300046678	Bacteria	11591
638	Ga0495624_0045702	3300046690	Bacteria	2786
639	Ga0495670_0025112	3300046691	Bacteria	2947
640	Ga0495670_0071999	3300046691	Bacteria	1750
641	Ga0495671_0047513	3300046692	Bacteria	2144
642	Ga0495589_0002672	3300046794	Bacteria	9857
643	Ga0495600_0005355	3300046809	Bacteria	7732
644	Ga0495600_0031255	3300046809	Bacteria	3449
645	Ga0495660_0015289	3300046810	Bacteria	4434
646	Ga0495581_0000128	3300047315	Bacteria	32831
647	Ga0495581_0002168	3300047315	Bacteria	11085
648	Ga0495581_0031812	3300047315	Bacteria	3057
649	Ga0495581_0036997	3300047315	Bacteria	2824
650	Ga0495604_0005987	3300047317	Bacteria	9655
651	Ga0495674_0084789	3300047319	Bacteria	2714
652	Ga0495680_0075548	3300047322	Bacteria	2556
653	Ga0495680_0081709	3300047322	Bacteria	2439
654	Ga0495683_0000004	3300047323	Bacteria	321136
655	Ga0495675_0004789	3300047444	Bacteria	8224
656	Ga0495675_0039050	3300047444	Bacteria	3023
657	Ga0495679_000086	3300047446	Bacteria	85895
658	Ga0495679_000137	3300047446	Bacteria	65769
659	Ga0495673_0000256	3300047469	Bacteria	74157
660	Ga0495673_0001945	3300047469	Bacteria	15330
661	Ga0495673_0021875	3300047469	Bacteria	3147
662	Ga0495681_0006754	3300047470	Bacteria	7470
663	Ga0495684_0003049	3300047471	Bacteria	13176
664	Ga0495686_0002724	3300047472	Bacteria	16159
665	Ga0495686_0002735	3300047472	Bacteria	16115
666	Ga0495686_0031493	3300047472	Bacteria	3439
667	Ga0495686_0127976	3300047472	Bacteria	1508
668	Ga0496100_0000857	3300048903	Bacteria	14548
669	Ga0496100_0001043	3300048903	Bacteria	13379
670	Ga0496100_0002285	3300048903	Bacteria	9688
671	Ga0496100_0005295	3300048903	Bacteria	6932
672	Ga0496100_0010231	3300048903	Bacteria	5306
673	Ga0496100_0023675	3300048903	Bacteria	3734
674	Ga0496100_0065333	3300048903	Bacteria	2410
675	Ga0496100_0109330	3300048903	Bacteria	1918
676	Ga0496100_0153812	3300048903	Bacteria	1643
677	Ga0496101_0000102	3300048904	Bacteria	88779
678	Ga0496101_0000931	3300048904	Bacteria	17274
679	Ga0496101_0003929	3300048904	Bacteria	9287
680	Ga0496101_0005707	3300048904	Bacteria	7948
681	Ga0496101_0018956	3300048904	Bacteria	4688
682	Ga0496101_0038028	3300048904	Bacteria	3416
683	Ga0496102_0000037	3300048905	Bacteria	199368
684	Ga0496102_0002961	3300048905	Bacteria	14385
685	Ga0496102_0006017	3300048905	Bacteria	10331
686	Ga0496102_0020916	3300048905	Bacteria	5784
687	Ga0496102_0024935	3300048905	Bacteria	5320
688	Ga0496102_0032031	3300048905	Bacteria	4721
689	Ga0496102_0103954	3300048905	Bacteria	2642
690	Ga0496103_0000004	3300048906	Bacteria	510080
691	Ga0496103_0000538	3300048906	Bacteria	30478
692	Ga0496103_0001429	3300048906	Bacteria	16013
693	Ga0496103_0043704	3300048906	Bacteria	2759
694	Ga0496103_0144750	3300048906	Bacteria	1521
695	Ga0496104_0000163	3300048907	Bacteria	60138
696	Ga0496104_0015071	3300048907	Bacteria	6996
697	Ga0496104_0056529	3300048907	Bacteria	3711
698	Ga0496104_0158146	3300048907	Bacteria	2174
699	Ga0496105_0020937	3300048908	Bacteria	5289
700	Ga0496105_0037363	3300048908	Bacteria	3998
701	Ga0496105_0045899	3300048908	Bacteria	3605
702	Ga0496105_0047180	3300048908	Bacteria	3554
703	Ga0496105_0084791	3300048908	Bacteria	2617
704	Ga0496106_0002893	3300048909	Bacteria	12762
705	Ga0496106_0021101	3300048909	Bacteria	4836
706	Ga0496106_0022568	3300048909	Bacteria	4678
707	Ga0496106_0073410	3300048909	Bacteria	2617
708	Ga0496106_0082954	3300048909	Bacteria	2465
709	Ga0496106_0321630	3300048909	Bacteria	1242
710	Ga0496107_0001948	3300048910	Bacteria	13108
711	Ga0496107_0002085	3300048910	Bacteria	12798
712	Ga0496107_0002652	3300048910	Bacteria	11710
713	Ga0496107_0028542	3300048910	Bacteria	3966
714	Ga0496107_0079489	3300048910	Bacteria	2390
715	Ga0496107_0120532	3300048910	Bacteria	1932
716	Ga0496108_0003170	3300048911	Bacteria	13234
717	Ga0496108_0174853	3300048911	Bacteria	1858
718	Ga0496109_0001781	3300048912	Bacteria	17907
719	Ga0496109_0055755	3300048912	Bacteria	3605
720	Ga0496109_0445166	3300048912	Bacteria	1224
721	Ga0496110_0030152	3300048913	Bacteria	4674
722	Ga0496111_0210876	3300048914	Bacteria	1443
723	Ga0496112_0011406	3300048915	Bacteria	8115
724	Ga0496112_0064956	3300048915	Bacteria	3602
725	Ga0496112_0110581	3300048915	Bacteria	2718
726	Ga0496112_0343368	3300048915	Bacteria	1436
727	Ga0496113_0007659	3300048916	Bacteria	6970
728	Ga0496113_0021432	3300048916	Bacteria	4559
729	Ga0496113_0082126	3300048916	Bacteria	2471
730	Ga0496114_0000183	3300048917	Bacteria	44987
731	Ga0496114_0010345	3300048917	Bacteria	7422
732	Ga0496114_0037902	3300048917	Bacteria	3988
733	Ga0496114_0049614	3300048917	Bacteria	3492
734	Ga0496114_0059176	3300048917	Bacteria	3200
735	Ga0496114_0062956	3300048917	Bacteria	3105
736	Ga0496114_0094927	3300048917	Bacteria	2537
737	Ga0496115_0014331	3300048918	Bacteria	6001
738	Ga0496115_0066303	3300048918	Bacteria	2917
739	Ga0496116_0000038	3300048919	Bacteria	370217
740	Ga0496116_0000276	3300048919	Bacteria	89506
741	Ga0496116_0000586	3300048919	Bacteria	48755
742	Ga0496116_0089582	3300048919	Bacteria	1876
743	Ga0496117_0000003	3300048920	Bacteria	1881097
744	Ga0496117_0000333	3300048920	Bacteria	83336
745	Ga0496117_0006452	3300048920	Bacteria	11866
746	Ga0496117_0006709	3300048920	Bacteria	11501
747	Ga0496117_0023670	3300048920	Bacteria	4884
748	Ga0496118_0000001	3300048921	Bacteria	1881100
749	Ga0496118_0001153	3300048921	Bacteria	40820
750	Ga0496118_0001919	3300048921	Bacteria	29527
751	Ga0496118_0008236	3300048921	Bacteria	10815
752	Ga0496118_0009402	3300048921	Bacteria	9871
753	Ga0496118_0021971	3300048921	Bacteria	5595
754	Ga0496118_0087234	3300048921	Bacteria	2165
755	Ga0496118_0147198	3300048921	Bacteria	1481
756	Ga0496118_0193940	3300048921	Bacteria	1211
757	Ga0496119_0000781	3300048922	Bacteria	42580
758	Ga0496119_0002042	3300048922	Bacteria	22845
759	Ga0496119_0010748	3300048922	Bacteria	7670
760	Ga0496119_0016213	3300048922	Bacteria	5688
761	Ga0496119_0018569	3300048922	Bacteria	5168
762	Ga0496119_0022089	3300048922	Bacteria	4571
763	Ga0496119_0022884	3300048922	Bacteria	4453
764	Ga0496119_0030252	3300048922	Bacteria	3655
765	Ga0496119_0044547	3300048922	Bacteria	2792
766	Ga0496119_0076487	3300048922	Bacteria	1942
767	Ga0496119_0125982	3300048922	Bacteria	1401
768	Ga0496120_0000877	3300048923	Bacteria	42461
769	Ga0496120_0001440	3300048923	Bacteria	28596
770	Ga0496120_0004056	3300048923	Bacteria	12681
771	Ga0496120_0014085	3300048923	Bacteria	5342
772	Ga0496120_0023553	3300048923	Bacteria	3852
773	Ga0496120_0072588	3300048923	Bacteria	1885
774	Ga0496120_0144831	3300048923	Bacteria	1201
775	Ga0496121_0000338	3300048924	Bacteria	97703
776	Ga0496121_0001478	3300048924	Bacteria	39564
777	Ga0496121_0001828	3300048924	Bacteria	34313
778	Ga0496121_0003620	3300048924	Bacteria	21795
779	Ga0496121_0005225	3300048924	Bacteria	16807
780	Ga0496121_0009280	3300048924	Bacteria	11347
781	Ga0496121_0015644	3300048924	Bacteria	7916
782	Ga0496121_0017191	3300048924	Bacteria	7406
783	Ga0496121_0025102	3300048924	Bacteria	5671
784	Ga0496121_0028791	3300048924	Bacteria	5161
785	Ga0496122_0000411	3300048925	Bacteria	90936
786	Ga0496122_0000523	3300048925	Bacteria	79324
787	Ga0496122_0001291	3300048925	Bacteria	41585
788	Ga0496122_0001815	3300048925	Bacteria	32651
789	Ga0496122_0003593	3300048925	Bacteria	20201
790	Ga0496122_0008132	3300048925	Bacteria	11423
791	Ga0496122_0010818	3300048925	Bacteria	9345
792	Ga0496122_0011079	3300048925	Bacteria	9194
793	Ga0496122_0015742	3300048925	Bacteria	7208
794	Ga0496122_0031601	3300048925	Bacteria	4401
795	Ga0496122_0044961	3300048925	Bacteria	3438
796	Ga0496123_0000055	3300048926	Bacteria	233626
797	Ga0496123_0000404	3300048926	Bacteria	79326
798	Ga0496123_0000759	3300048926	Bacteria	52224
799	Ga0496123_0001109	3300048926	Bacteria	40387
800	Ga0496123_0001562	3300048926	Bacteria	31366
801	Ga0496123_0003092	3300048926	Bacteria	19117
802	Ga0496123_0004965	3300048926	Bacteria	13634
803	Ga0496123_0019267	3300048926	Bacteria	5385
804	Ga0496123_0067164	3300048926	Bacteria	2266
805	Ga0496123_0195677	3300048926	Bacteria	1041
806	Ga0496124_0001124	3300048927	Bacteria	42065
807	Ga0496124_0001298	3300048927	Bacteria	37829
808	Ga0496124_0001376	3300048927	Bacteria	36433
809	Ga0496124_0012658	3300048927	Bacteria	8299
810	Ga0496124_0034971	3300048927	Bacteria	4399
811	Ga0496124_0055577	3300048927	Bacteria	3345
812	Ga0496124_0113141	3300048927	Bacteria	2181
813	Ga0496125_0000355	3300048928	Bacteria	86577
814	Ga0496125_0002596	3300048928	Bacteria	23182
815	Ga0496125_0002643	3300048928	Bacteria	22910
816	Ga0496125_0006578	3300048928	Bacteria	12521
817	Ga0496125_0152690	3300048928	Bacteria	1583
818	Ga0496126_0000035	3300048929	Bacteria	361590
819	Ga0496126_0000551	3300048929	Bacteria	72093
820	Ga0496126_0002287	3300048929	Bacteria	26402
821	Ga0496126_0006107	3300048929	Bacteria	13507
822	Ga0496126_0073529	3300048929	Bacteria	3038
823	Ga0496126_0074529	3300048929	Bacteria	3013
824	Ga0496126_0082061	3300048929	Bacteria	2849
825	Ga0496126_0117717	3300048929	Bacteria	2307
826	Ga0496126_0164132	3300048929	Bacteria	1897
827	Ga0495678_000014	3300049459	Bacteria	313755
828	Ga0495678_002419	3300049459	Bacteria	12707
829	Ga0495682_0000025	3300049460	Bacteria	147931
830	Ga0501031_0079464	3300049568	Bacteria	2137
831	Ga0501032_0005221	3300049569	Bacteria	9666
832	Ga0501032_0016030	3300049569	Bacteria	5276
833	Ga0501033_0006927	3300049570	Bacteria	8853
834	Ga0501034_0000057	3300049571	Bacteria	202455
835	Ga0501034_0034741	3300049571	Bacteria	5111
836	Ga0501034_0140052	3300049571	Bacteria	2399
837	Ga0501037_0005857	3300049573	Bacteria	8977
838	Ga0501037_0016359	3300049573	Bacteria	5458
839	Ga0501037_0025809	3300049573	Bacteria	4340
840	Ga0501037_0040572	3300049573	Bacteria	3425
841	Ga0501037_0046384	3300049573	Bacteria	3187
842	Ga0501037_0137869	3300049573	Bacteria	1747
843	Ga0501038_0088498	3300049574	Bacteria	2599
844	Ga0501038_0091239	3300049574	Bacteria	2552
845	Ga0501039_0002487	3300049575	Bacteria	13717
846	Ga0501039_0088392	3300049575	Bacteria	2414
847	Ga0501039_0097925	3300049575	Bacteria	2288
848	Ga0501039_0241945	3300049575	Bacteria	1419
849	Ga0501043_0009700	3300049579	Bacteria	7545
850	Ga0501043_0053716	3300049579	Bacteria	3163
851	Ga0501046_0002219	3300049580	Bacteria	18324
852	Ga0501048_0002473	3300049582	Bacteria	14103
853	Ga0501068_0038162	3300049584	Bacteria	2877
854	Ga0501070_0015124	3300049586	Bacteria	6496
855	Ga0501070_0019297	3300049586	Bacteria	5718
856	Ga0501070_0188248	3300049586	Bacteria	1697
857	Ga0501071_0041783	3300049587	Bacteria	3284
858	Ga0501079_0189632	3300049741	Bacteria	1604
859	Ga0501081_0246092	3300049743	Bacteria	1304
860	Ga0501035_0120666	3300049822	Bacteria	2292
861	Ga0501044_0048208	3300049823	Bacteria	4402
862	Ga0501044_0192523	3300049823	Bacteria	2001
863	Ga0501045_0028074	3300049824	Bacteria	4058
864	nmdc:mga03683_15665_c1	3300050489	Bacteria	2833
865	nmdc:mga03n38_161083_c1	3300050490	Bacteria	1136
866	nmdc:mga03n38_22578_c1	3300050490	Bacteria	2549
867	nmdc:mga03n38_42867_c1	3300050490	Bacteria	1981
868	nmdc:mga03n38_5503_c1	3300050490	Bacteria	4318
869	nmdc:mga00v17_1631_c1	3300050491	Bacteria	11734
870	nmdc:mga00v17_22430_c1	3300050491	Bacteria	3642
871	nmdc:mga00v17_31566_c1	3300050491	Bacteria	3125
872	nmdc:mga00v17_45_c1	3300050491	Bacteria	78686
873	nmdc:mga0yw44_10036_c1	3300050492	Bacteria	4817
874	nmdc:mga0yw44_55918_c1	3300050492	Bacteria	2402
875	nmdc:mga0yw44_8915_c1	3300050492	Bacteria	5031
876	nmdc:mga06z11_9236_c1	3300050494	Bacteria	4148
877	nmdc:mga07m45_126470_c1	3300050496	Bacteria	1478
878	nmdc:mga07m45_5445_c1	3300050496	Bacteria	6337
879	nmdc:mga07m45_7733_c1	3300050496	Bacteria	5499
880	nmdc:mga05p37_4206_c1	3300050507	Bacteria	16816
881	nmdc:mga0qj67_54338_c1	3300050509	Bacteria	3171
882	nmdc:mga06r32_36600_c1	3300050510	Bacteria	4639
883	nmdc:mga0n895_225676_c1	3300050512	Bacteria	1901
884	nmdc:mga0rr50_91889_c1	3300050513	Bacteria	2365
885	nmdc:mga0sz30_1250_c1	3300050516	Bacteria	9091
886	nmdc:mga0sz30_26095_c1	3300050516	Bacteria	2392
887	Ga0495655_0000671	3300053083	Bacteria	5491
888	Ga0495595_0015285	3300053084	Bacteria	3272
889	Ga0495595_0100149	3300053084	Bacteria	1398
890	Ga0500643_000480	3300053087	Bacteria	29140
891	Ga0500643_002391	3300053087	Bacteria	9756
892	Ga0500559_0038445	3300053136	Bacteria	2078
893	Ga0500573_0000738	3300053140	Bacteria	14604
894	Ga0500616_0002052	3300053153	Bacteria	17695
895	2945923673	2945920336	Bacteria	4501603
896	2506864968	2506783011	Bacteria	5323186
897	2511137218	2510917022	Bacteria	6504556
898	2515494187	2515154088	Bacteria	5526283
899	2515722519	2515154129	Bacteria	5584369
900	2515758597	2515154137	Bacteria	5711575
901	2516085630	2515154202	Bacteria	5471270
902	2516090565	2515154203	Bacteria	5458536
903	2524461930	2524023209	Bacteria	6679728
904	2528204086	2527291627	Bacteria	5309833
905	2528214217	2527291629	Bacteria	5267418
906	2546949156	2546825537	Bacteria	5389291
907	2547696172	2547132181	Bacteria	4945084
908	2552106194	2551306166	Bacteria	9731570
909	2555260512	2554235234	Bacteria	5762085
910	2555670010	2554235341	Bacteria	6867980
911	2562464406	2561511199	Bacteria	5155034
912	2579748224	2576861822	Bacteria	5004595
913	2585273392	2582581307	Bacteria	6597605
914	2585283486	2582581308	Bacteria	7413247
915	2585328271	2582581315	Bacteria	7318924
916	2585330681	2582581316	Bacteria	7774528
917	2585535945	2585427527	Bacteria	7273426
918	2585556708	2585427530	Bacteria	7383882
919	2585564077	2585427531	Bacteria	6992870
920	2585900243	2585427608	Bacteria	6544331
921	2585909196	2585427609	Bacteria	6667127
922	2587984702	2585428125	Bacteria	6662905
923	2599333413	2599185156	Bacteria	5403036
924	2599352953	2599185160	Bacteria	6844013
925	2599378061	2599185164	Bacteria	6841688
926	2599384562	2599185165	Bacteria	6843250
927	2599411163	2599185169	Bacteria	5441380
928	2599459787	2599185181	Bacteria	6844519
929	2599488808	2599185186	Bacteria	6831633
930	2599970034	2599185307	Bacteria	6194719
931	2600212394	2599185356	Bacteria	6843884
932	2601523594	2600255254	Bacteria	5281859
933	2601528753	2600255255	Bacteria	5282785
934	2601534237	2600255256	Bacteria	5597742
935	2601538984	2600255257	Bacteria	5597196
936	2601615586	2600255280	Bacteria	5292309
937	2601620694	2600255281	Bacteria	5288753
938	2601643409	2600255287	Bacteria	5210468
939	2601649091	2600255288	Bacteria	5282738
940	2601653637	2600255289	Bacteria	5281907
941	2601659057	2600255290	Bacteria	5282218
942	2601663232	2600255291	Bacteria	5217298
943	2601696191	2600255298	Bacteria	5215185
944	2601700865	2600255299	Bacteria	5218662
945	2601707786	2600255300	Bacteria	5287774
946	2601712845	2600255301	Bacteria	5280532
947	2601716896	2600255302	Bacteria	5288235
948	2601721215	2600255303	Bacteria	5219315
949	2601724941	2600255304	Bacteria	5283973
950	2601732224	2600255305	Bacteria	5282329
951	2601737898	2600255306	Bacteria	5281613
952	2601744041	2600255307	Bacteria	5439064
953	2601753427	2600255309	Bacteria	5431045
954	2601757333	2600255310	Bacteria	5600903
955	2601762066	2600255311	Bacteria	5598766
956	2601772562	2600255313	Bacteria	6842543
957	2602022054	2600255392	Bacteria	5437392
958	2603639728	2602042046	Bacteria	5483348
959	2603643510	2602042047	Bacteria	4697674
960	2603660616	2602042052	Bacteria	5215873
961	2603665888	2602042053	Bacteria	5214361
962	2603704083	2602042067	Bacteria	4863713
963	2603839241	2602042103	Bacteria	5284714
964	2603844703	2602042104	Bacteria	5281639
965	2603849398	2602042105	Bacteria	5282303
966	2603854466	2602042106	Bacteria	5282744
967	2603870121	2602042110	Bacteria	5283285
968	2603875080	2602042111	Bacteria	5212080
969	2606047312	2603880178	Bacteria	5283018
970	2606070322	2603880184	Bacteria	5217896
971	2606146186	2603880202	Bacteria	5284684
972	2606177112	2603880211	Bacteria	5284226
973	2609913223	2609459761	Bacteria	5513740
974	2616312865	2615840626	Bacteria	7921970
975	2616556004	2615840698	Bacteria	7319877
976	2617386203	2617270742	Bacteria	6808054
977	2637226091	2636415599	Bacteria	5718434
978	2644032019	2643221604	Bacteria	5014917
979	2644486443	2643221687	Bacteria	6500351
980	2644607655	2643221711	Bacteria	4865335
981	2671102277	2667528172	Bacteria	5170840
982	2671115906	2667528174	Bacteria	6435400
983	2676407722	2675903046	Bacteria	5451247
984	2681995845	2681812866	Bacteria	4552357
985	2682008864	2681812869	Bacteria	5014465
986	2686538345	2684623035	Bacteria	8032739
987	2686540882	2684623036	Bacteria	5199090
988	2689959170	2687453737	Bacteria	11203906
989	2689994216	2687453743	Bacteria	8361025
990	2691512606	2690315906	Bacteria	4517044
991	2710603888	2710264753	Bacteria	5455564
992	2738673117	2738541265	Bacteria	6594665
993	2738751510	2738541282	Bacteria	6593925
994	2738860551	2738541303	Bacteria	6591772
995	2753854977	2751185917	Bacteria	4551186
996	2765587842	2765235842	Bacteria	4799256
997	2774393140	2773857762	Bacteria	5971770
998	2774398913	2773857763	Bacteria	4180068
999	2774863746	2773857924	Bacteria	5256821
1000	2774905850	2773857933	Bacteria	5818019
1001	2775541759	2775506706	Bacteria	4873073
1002	2775655593	2775506735	Bacteria	4556596
1003	2777020547	2775507074	Bacteria	5532402
1004	2778179428	2775507266	Bacteria	7392367
1005	2792312754	2791355010	Bacteria	4864581
1006	2808828326	2808606357	Bacteria	4466944
1007	2808849570	2808606360	Bacteria	4404006
1008	2808877833	2808606366	Bacteria	4415912
1009	2808894119	2808606370	Bacteria	4942454
1010	2808895358	2808606371	Bacteria	4251511
1011	2809196965	2808606439	Bacteria	5952208
1012	2809228196	2808606447	Bacteria	3572005
1013	2812319953	2811994871	Bacteria	4497550
1014	2812373628	2811994882	Bacteria	4688362
1015	2813726973	2811995292	Bacteria	5303342
1016	2814694386	2814123068	Bacteria	5687681
1017	2819427018	2818991318	Bacteria	5266538
1018	2819612487	2818991448	Bacteria	6772224
1019	2819643360	2818991453	Bacteria	7181617
1020	2819665232	2818991458	Bacteria	4794049
1021	2819691522	2818991462	Bacteria	4320267
1022	2821118757	2821118458	Bacteria	4714306
1023	2821450300	2821443989	Bacteria	7658172
1024	2823377042	2823373977	Bacteria	4779415
1025	2831908240	2831905167	Bacteria	3319172
1026	2831938054	2831935698	Bacteria	5963223
1027	2832007662	2832004796	Bacteria	6538017
1028	2837271111	2837268691	Bacteria	7850704
1029	2838033891	2838029111	Bacteria	6603031
1030	2839994904	2839993093	Bacteria	5512535
1031	2841913629	2841911363	Bacteria	6173697
1032	2841919376	2841917233	Bacteria	6173500
1033	2842138462	2842134933	Bacteria	5847019
1034	2842299998	2842298080	Bacteria	6123127
1035	2842362608	2842357229	Bacteria	6485165
1036	2842480637	2842475841	Bacteria	6603183
1037	2842487324	2842482326	Bacteria	7212537
1038	2842507320	2842502639	Bacteria	6604161
1039	2842514593	2842509118	Bacteria	6850950
1040	2842889387	2842888712	Bacteria	4279094
1041	2842925179	2842922631	Bacteria	5824079
1042	2844426531	2844425489	Bacteria	4854065
1043	2844670639	2844665904	Bacteria	6817974
1044	2844851691	2844849076	Bacteria	4091819
1045	2852387795	2852387548	Bacteria	8025568
1046	2857744605	2857740372	Bacteria	4782044
1047	2891673815	2891670763	Bacteria	4967099
1048	2891971533	2891968417	Bacteria	5821697
1049	2895890347	2895880812	Bacteria	11255272
1050	2902798431	2902792274	Bacteria	7270173
1051	2902840138	2902837492	Bacteria	6697721
1052	2904500675	2904497146	Bacteria	4731781
1053	2904517575	2904513164	Bacteria	5476410
1054	2904777385	2904776348	Bacteria	4658726
1055	2917073833	2917070673	Bacteria	6868303
1056	2919038105	2919034639	Bacteria	4763403
1057	2919053754	2919051321	Bacteria	4210889
1058	2919063210	2919059106	Bacteria	4991624
1059	2919112944	2919108558	Bacteria	5897419
1060	2919391770	2919391150	Bacteria	4884741
1061	2919408262	2919408235	Bacteria	6149349
1062	2919447008	2919446982	Bacteria	3994487
1063	2923638390	2923634449	Bacteria	4753480
1064	2927835108	2927833300	Bacteria	4923934
1065	2933421942	2933418574	Bacteria	4476724
1066	2937542956	2937539931	Bacteria	4639830
1067	2939600720	2939598168	Bacteria	4687164
1068	2939647246	2939647034	Bacteria	4681660
1069	2939662507	2939660829	Bacteria	3784848
1070	2939675074	2939674588	Bacteria	4844420
1071	2945879180	2945874760	Bacteria	5527237
1072	2945917702	2945916053	Bacteria	4555517
1073	2945944657	2945941187	Bacteria	4682474
1074	2945957142	2945956166	Bacteria	5110334
1075	2946025985	2946024296	Bacteria	3508095
1076	2946040600	2946037020	Bacteria	4900426
1077	2946061521	2946059875	Bacteria	4386623
1078	2969083104	2969079654	Bacteria	5439582
1079	2971824405	2971820967	Bacteria	5823634
1080	2974304146	2974302888	Bacteria	4369871
1081	2974313225	2974310843	Bacteria	4947816
1082	2984560124	2984559226	Bacteria	5683096
1083	2984598205	2984595703	Bacteria	5682994
1084	3005419705	3005416602	Bacteria	7064308
1085	637878927	637000116	Bacteria	5433628
1086	637320379	637000220	Bacteria	7074893
1087	8004022249	8004021418	Bacteria	4313954
1088	8004026532	8004025490	Bacteria	4327753
1089	8005317720	8005314921	Bacteria	7072929
1090	8005484397	8005484373	Bacteria	6297373
1091	8005647324	8005645114	Bacteria	6950293
1092	8005687532	8005682033	Bacteria	6726518
1093	8018405812	8018405270	Bacteria	4978981
1094	8024488646	8024486573	Bacteria	6540512
1095	8046768750	8046767195	Bacteria	7547379
1096	8054108180	8054107350	Bacteria	5022511
1097	8055412999	8055412473	Bacteria	6257500
1098	8057582535	8057575449	Bacteria	7367519
1099	SwRhRL2b_contig_518715
1100	LJQas_1000468
1101	LJQas_1002626
1102	JGI24746J21847_1001751
1103	JGI24747J21853_1000246
1104	JGI24740J21852_10005274
1105	JGI24745J21846_1003398
1106	JGI24749J21850_1007932
1107	JGI25155J39150_1000075
1108	JGI25156J39149_1000103
1109	JGI25162J39368_1000004
1110	JGI25162J39368_1000835
1111	JGI25162J39368_1001330
1112	JGI25154J39366_1000018
1113	JGI25157J39369_1000074
1114	JGI25163J39215_1000045
1115	JGI25164J39214_1000031
1116	JGI25159J45721_1000093
1117	JGI25151J46595_10010763
1118	JGI25165J46597_1000011
1119	JGI25165J46597_1000431
1120	JGI25165J46597_1001289
1121	rootH2_10002738
1122	rootL2_10009232
1123	rootH1_10051348
1124	JGI25160J50197_1000044
1125	JGI25161J50226_1000028
1126	Ga0055542_1002991
1127	Ga0055536_1007757
1128	Ga0055540_1002963
1129	Ga0058692_1000388
1130	Ga0058692_1004166
1131	Ga0055543_1000054
1132	Ga0065165_1000143
1133	Ga0065165_1002551
1134	Ga0065704_10000341
1135	Ga0070676_10002269
1136	Ga0070676_10011316
1137	Ga0070683_100082063
1138	Ga0070690_100001876
1139	Ga0070677_10032986
1140	Ga0068869_100072048
1141	Ga0068869_100122211
1142	Ga0070666_10129765
1143	Ga0070680_100166399
1144	Ga0070682_100002430
1145	Ga0070682_100166281
1146	Ga0068868_100000981
1147	Ga0068868_100057787
1148	Ga0070660_100026091
1149	Ga0070660_100062328
1150	Ga0070691_10004309
1151	Ga0070687_100090126
1152	Ga0070692_10015140
1153	Ga0070668_100007935
1154	Ga0070668_100119488
1155	Ga0070668_100180262
1156	Ga0070669_100010640
1157	Ga0070675_100053737
1158	Ga0070671_100006111
1159	Ga0070671_100178714
1160	Ga0070674_100000580
1161	Ga0070674_100083364
1162	Ga0070688_100007332
1163	Ga0070688_100027360
1164	Ga0070659_100014976
1165	Ga0070659_100051419
1166	Ga0070659_100305972
1167	Ga0070667_100003100
1168	Ga0070703_10037294
1169	Ga0070709_10059028
1170	Ga0070709_10124793
1171	Ga0070714_100230360
1172	Ga0070713_100162689
1173	Ga0070710_10006928
1174	Ga0070710_10051031
1175	Ga0070701_10006934
1176	Ga0070711_100000375
1177	Ga0070711_100005852
1178	Ga0070705_100003911
1179	Ga0070694_100014489
1180	Ga0070708_100006377
1181	Ga0070663_100321101
1182	Ga0070678_100001259
1183	Ga0070678_100025970
1184	Ga0070678_100117780
1185	Ga0070662_100011890
1186	Ga0070662_100040984
1187	Ga0070681_10091061
1188	Ga0068867_100008191
1189	Ga0068867_100176089
1190	Ga0070685_10027712
1191	Ga0070706_100002862
1192	Ga0070707_100019719
1193	Ga0070699_100001310
1194	Ga0070679_100261854
1195	Ga0070697_100000606
1196	Ga0068853_100006398
1197	Ga0070672_100140266
1198	Ga0070695_100035844
1199	Ga0070696_100001702
1200	Ga0070693_100002698
1201	Ga0070665_100000203
1202	Ga0070665_100017040
1203	Ga0070665_100021730
1204	Ga0070665_100025808
1205	Ga0070665_100055527
1206	Ga0070665_100111495
1207	Ga0070704_100001435
1208	Ga0070704_100101838
1209	Ga0068855_100015536
1210	Ga0068855_100089813
1211	Ga0068855_100101291
1212	Ga0068857_100000003
1213	Ga0068856_100038325
1214	Ga0068856_100077168
1215	Ga0070702_100000895
1216	Ga0070702_100005515
1217	Ga0068852_100255699
1218	Ga0068852_100289405
1219	Ga0068859_100000135
1220	Ga0068859_100006460
1221	Ga0068859_100279464
1222	Ga0068864_100051026
1223	Ga0068866_10000812
1224	Ga0068861_100002386
1225	Ga0068861_100196644
1226	Ga0068851_10045559
1227	Ga0068863_100083843
1228	Ga0068863_100097901
1229	Ga0068863_100292479
1230	Ga0068858_100001306
1231	Ga0068858_100111366
1232	Ga0068860_100005764
1233	Ga0068862_100000116
1234	Ga0068862_100008628
1235	Ga0081455_10035060
1236	Ga0081455_10119243
1237	Ga0081540_1011205
1238	Ga0070717_10004536
1239	Ga0075365_10013946
1240	Ga0075365_10277788
1241	Ga0075363_100001358
1242	Ga0075363_100010113
1243	Ga0075364_10000293
1244	Ga0075364_10001383
1245	Ga0075364_10003886
1246	Ga0075364_10006351
1247	Ga0075364_10008216
1248	Ga0075364_10194914
1249	Ga0075432_10000869
1250	Ga0075432_10008270
1251	Ga0070715_10017666
1252	Ga0070715_10036099
1253	Ga0070716_100008407
1254	Ga0070716_100019326
1255	Ga0070712_100009065
1256	Ga0070712_100011261
1257	Ga0070712_100083534
1258	Ga0070712_100339358
1259	Ga0075367_10014568
1260	Ga0075367_10027655
1261	Ga0075369_10005139
1262	Ga0075369_10056713
1263	Ga0097621_100009484
1264	Ga0097621_100104150
1265	Ga0075370_10001391
1266	Ga0075370_10011592
1267	Ga0075370_10012515
1268	Ga0068871_100063229
1269	Ga0075428_100004253
1270	Ga0075431_100025424
1271	Ga0068865_100003677
1272	Ga0068865_100094911
1273	Ga0068865_100155769
1274	Ga0097620_100000135
1275	Ga0097620_100006460
1276	Ga0097620_100279478
1277	Ga0079104_1000436
1278	Ga0079104_1000853
1279	Ga0079104_1000958
1280	Ga0075435_100078251
1281	Ga0105251_10000001
1282	Ga0105251_10000053
1283	Ga0105251_10000814
1284	Ga0105251_10011633
1285	Ga0105251_10013261
1286	Ga0105251_10061674
1287	Ga0105244_10000094
1288	Ga0105244_10000861
1289	Ga0105244_10015089
1290	Ga0105244_10028140
1291	Ga0105244_10087526
1292	Ga0105250_10000040
1293	Ga0105250_10002079
1294	Ga0105240_10000910
1295	Ga0111539_10305876
1296	Ga0105245_10001029
1297	Ga0105245_10097228
1298	Ga0105245_10203478
1299	Ga0105245_10288762
1300	Ga0105247_10006972
1301	Ga0105247_10038125
1302	Ga0105247_10067449
1303	Ga0114129_10002350
1304	Ga0114129_10213149
1305	Ga0105243_10001000
1306	Ga0105243_10009101
1307	Ga0105243_10012467
1308	Ga0105243_10154509
1309	Ga0105243_10159034
1310	Ga0105243_10331170
1311	Ga0105243_10375337
1312	Ga0105242_10000759
1313	Ga0105242_10100051
1314	Ga0105248_10003071
1315	Ga0105248_10022517
1316	Ga0105248_10026472
1317	Ga0105248_10164663
1318	Ga0105237_10001371
1319	Ga0105237_10016277
1320	Ga0105237_10047548
1321	Ga0105237_10262009
1322	Ga0105238_10119629
1323	Ga0105238_10184880
1324	Ga0105238_10387432
1325	Ga0105249_10001675
1326	Ga0105249_10005735
1327	Ga0105249_10054319
1328	Ga0105239_10016179
1329	Ga0105239_10018700
1330	Ga0105239_10336298
1331	Ga0105246_10001193
1332	Ga0105246_10010325
1333	Ga0105246_10158570
1334	Ga0105246_10168399
1335	Ga0157373_10024417
1336	Ga0157371_10000057
1337	Ga0157371_10000745
1338	Ga0157371_10058675
1339	Ga0157371_10104782
1340	Ga0157371_10136086
1341	Ga0157370_10000909
1342	Ga0157370_10003872
1343	Ga0157370_10028924
1344	Ga0157369_10046045
1345	Ga0157374_10028263
1346	Ga0157378_10001038
1347	Ga0157378_10028844
1348	Ga0163162_10047770
1349	Ga0163162_10087320
1350	Ga0163162_10155870
1351	Ga0157372_10022394
1352	Ga0157375_10000838
1353	Ga0157375_10048072
1354	Ga0157375_10325504
1355	Ga0163163_10003937
1356	Ga0163163_10013212
1357	Ga0157380_10011425
1358	Ga0182008_10000224
1359	Ga0157379_10135619
1360	Ga0182005_1018965
1361	Ga0183370_1001
1362	Ga0183369_1001
1363	Ga0183368_1001
1364	Ga0163161_10023518
1365	Ga0163161_10089319
1366	Ga0163161_10314696
1367	Ga0206353_10981172
1368	Ga0213873_10000139
1369	Ga0213876_10000158
1370	Ga0213875_10000778
1371	Ga0213875_10016436
1372	Ga0209435_100044
1373	Ga0209760_100032
1374	Ga0209436_104981
1375	Ga0209672_103766
1376	Ga0207427_100003
1377	Ga0209437_100002
1378	Ga0209437_100050
1379	Ga0209437_100205
1380	Ga0207425_1004615
1381	Ga0209646_1000151
1382	Ga0209026_1000170
1383	Ga0209148_1000288
1384	Ga0209148_1001608
1385	Ga0209759_1000186
1386	Ga0209129_1000109
1387	Ga0209233_1000004
1388	Ga0209233_1000037
1389	Ga0209233_1000187
1390	Ga0209233_1000232
1391	Ga0209455_1000806
1392	Ga0209455_1006594
1393	Ga0209130_1000093
1394	Ga0209130_1000342
1395	Ga0209676_1000547
1396	Ga0209025_1001288
1397	Ga0207426_1000012
1398	Ga0207426_1007080
1399	Ga0209051_1001831
1400	Ga0209051_1008709
1401	Ga0209051_1017046
1402	Ga0207697_10002763
1403	Ga0207696_1000077
1404	Ga0207696_1025499
1405	Ga0207655_1000032
1406	Ga0207655_1000102
1407	Ga0207655_1000820
1408	Ga0207655_1006340
1409	Ga0207655_1013285
1410	Ga0207655_1014743
1411	Ga0207713_1000021
1412	Ga0207713_1000040
1413	Ga0207713_1000117
1414	Ga0207713_1000147
1415	Ga0207713_1000440
1416	Ga0207713_1004808
1417	Ga0207713_1009101
1418	Ga0207682_10002817
1419	Ga0207642_10000117
1420	Ga0207710_10002181
1421	Ga0207710_10004229
1422	Ga0207688_10003291
1423	Ga0207688_10009637
1424	Ga0207680_10005559
1425	Ga0207647_10034165
1426	Ga0207647_10070355
1427	Ga0207685_10025209
1428	Ga0207699_10009138
1429	Ga0207645_10004199
1430	Ga0207645_10013384
1431	Ga0207645_10032885
1432	Ga0207705_10001355
1433	Ga0207695_10000427
1434	Ga0207671_10000288
1435	Ga0207671_10021085
1436	Ga0207671_10104728
1437	Ga0207671_10141135
1438	Ga0207693_10000930
1439	Ga0207693_10001479
1440	Ga0207663_10003213
1441	Ga0207663_10006894
1442	Ga0207662_10012772
1443	Ga0207657_10001803
1444	Ga0207652_10140680
1445	Ga0207646_10021446
1446	Ga0207646_10064645
1447	Ga0207694_10124257
1448	Ga0207650_10003161
1449	Ga0207659_10094802
1450	Ga0207687_10001128
1451	Ga0207700_10059658
1452	Ga0207644_10102110
1453	Ga0207690_10046209
1454	Ga0207690_10136756
1455	Ga0207690_10204331
1456	Ga0207706_10029347
1457	Ga0207706_10132171
1458	Ga0207686_10002045
1459	Ga0207686_10052665
1460	Ga0207709_10005909
1461	Ga0207709_10082893
1462	Ga0207709_10144235
1463	Ga0207709_10319197
1464	Ga0207669_10000297
1465	Ga0207669_10013054
1466	Ga0207669_10036227
1467	Ga0207669_10110220
1468	Ga0207704_10002558
1469	Ga0207704_10014878
1470	Ga0207665_10002468
1471	Ga0207665_10003248
1472	Ga0207665_10046974
1473	Ga0207691_10002149
1474	Ga0207691_10084487
1475	Ga0207711_10012376
1476	Ga0207689_10018892
1477	Ga0207689_10036523
1478	Ga0207661_10061731
1479	Ga0207667_10004039
1480	Ga0207667_10072679
1481	Ga0207667_10154905
1482	Ga0207712_10004913
1483	Ga0207712_10007450
1484	Ga0207668_10003771
1485	Ga0207668_10068589
1486	Ga0207640_10004996
1487	Ga0207658_10006512
1488	Ga0207658_10086660
1489	Ga0207658_10143475
1490	Ga0207677_10003489
1491	Ga0207703_10001189
1492	Ga0207703_10344814
1493	Ga0207639_10003053
1494	Ga0207639_10151392
1495	Ga0207678_10010201
1496	Ga0207678_10217964
1497	Ga0207708_10004036
1498	Ga0207708_10011449
1499	Ga0207702_10036608
1500	Ga0207702_10131074
1501	Ga0207641_10080909
1502	Ga0207648_10001361
1503	Ga0207648_10016998
1504	Ga0207676_10027519
1505	Ga0207674_10000043
1506	Ga0207674_10144672
1507	Ga0207675_100003845
1508	Ga0207675_100125954
1509	Ga0207675_100201901
1510	Ga0207683_10002759
1511	Ga0207683_10005268
1512	Ga0207683_10020625
1513	Ga0207683_10030503
1514	Ga0207683_10385420
1515	Ga0207698_10152272
1516	Ga0209281_1000122
1517	Ga0209281_1000275
1518	Ga0209281_1000622
1519	Ga0209371_1000001
1520	Ga0209371_1000101
1521	Ga0209371_1001497
1522	Ga0209371_1003766
1523	Ga0209371_1004132
1524	Ga0209371_1004225
1525	Ga0209371_1006488
1526	Ga0207428_10011029
1527	Ga0268266_10000084
1528	Ga0268266_10024890
1529	Ga0268266_10038058
1530	Ga0268266_10139572
1531	Ga0268265_10000126
1532	Ga0268265_10019493
1533	Ga0268265_10095928
1534	Ga0268264_10005225
1535	Ga0268264_10117195
1536	Ga0307515_10021556
1537	Ga0268256_1000001
1538	Ga0268256_1000029
1539	Ga0268256_1000759
1540	Ga0268256_1003707
1541	Ga0268256_1003737
1542	Ga0268256_1003894
1543	Ga0268256_1006523
1544	Ga0265340_10034077
1545	Ga0265339_10063055
1546	Ga0265331_10003074
1547	Ga0307513_10073842
1548	Ga0307408_100049434
1549	Ga0307408_100050755
1550	Ga0307408_100110335
1551	Ga0265313_10000079
1552	Ga0307514_10001732
1553	Ga0316579_10023923
1554	Ga0265342_10082214
1555	Ga0316576_10000482
1556	Ga0316578_10000931
1557	Ga0307405_10018647
1558	Ga0307405_10046575
1559	Ga0307405_10133770
1560	Ga0307413_10008128
1561	Ga0307413_10032302
1562	Ga0307413_10059073
1563	Ga0307413_10172243
1564	Ga0307413_10303852
1565	Ga0307410_10007580
1566	Ga0307410_10010666
1567	Ga0307410_10013492
1568	Ga0307410_10069505
1569	Ga0307410_10098960
1570	Ga0307406_10112098
1571	Ga0307407_10076451
1572	Ga0307407_10125563
1573	Ga0307407_10156281
1574	Ga0307412_10010649
1575	Ga0307412_10038907
1576	Ga0307412_10047066
1577	Ga0307412_10097866
1578	Ga0307412_10195167
1579	Ga0307409_100032242
1580	Ga0307409_100040099
1581	Ga0307409_100062345
1582	Ga0307409_100080254
1583	Ga0307409_100216382
1584	Ga0307409_100373919
1585	Ga0307416_100008364
1586	Ga0307416_100010587
1587	Ga0307416_100116667
1588	Ga0307416_100351555
1589	Ga0307416_100612883
1590	Ga0307414_10002021
1591	Ga0307414_10046012
1592	Ga0307414_10060995
1593	Ga0307411_10007352
1594	Ga0307415_100020862
1595	Ga0307415_100031575
1596	Ga0307415_100154332
1597	Ga0307415_100282642
1598	Ga0307510_10126901
1599	Ga0373944_0027125
1600	Ga0373951_0041382
1601	Ga0373932_0022393
1602	Ga0373935_0256795
1603	Ga0316582_0261160
1604	Ga0316584_0000134
1605	Ga0395899_0006752
1606	Ga0395900_0044111
1607	Ga0395900_0165621
1608	Ga0395898_0001462
1609	Ga0395898_0011125
1610	Ga0395898_0014457
1611	Ga0395898_0214002
1612	Ga0395905_0029185
1613	Ga0395905_0032545
1614	Ga0395905_0054066
1615	Ga0316581_0000541
1616	Ga0436364_0150041
1617	Ga0436364_0377973
1618	Ga0436364_0829841
1619	Ga0395901_0000132
1620	Ga0395901_0004658
1621	Ga0395901_0017119
1622	Ga0395901_0049057
1623	Ga0395901_0057384
1624	Ga0237819_07603
1625	Ga0436365_0098304
1626	Ga0436365_0571044
1627	Ga0436362_0900593
1628	Ga0439436_0005199
1629	Ga0439436_0019485
1630	Ga0439439_0013842
1631	Ga0439466_0012980
1632	Ga0439465_0000501
1633	Ga0451789_0815329
1634	Ga0451853_0144711
1635	Ga0439433_0001377
1636	Ga0439442_000063
1637	Ga0439442_000196
1638	Ga0439442_004871
1639	Ga0439442_010005
1640	Ga0439442_013312
1641	Ga0439442_023646
1642	Ga0439432_016304
1643	Ga0439449_0000390
1644	Ga0439449_0017159
1645	Ga0439457_003299
1646	Ga0439462_0006218
1647	Ga0450920_000276
1648	Ga0450920_006233
1649	Ga0450907_000361
1650	Ga0439434_0001874
1651	Ga0439464_0001914
1652	Ga0450918_003585
1653	Ga0466981_0000006
1654	Ga0466968_0009658
1655	Ga0466968_0085872
1656	Ga0466970_0000150
1657	Ga0466967_0123441
1658	Ga0466967_0132650
1659	Ga0495617_020005
1660	Ga0495627_007536
1661	Ga0495627_026276
1662	Ga0495592_0040260
1663	Ga0495591_000172
1664	Ga0495591_002491
1665	Ga0495591_026011
1666	Ga0495638_0124157
1667	Ga0495651_0031426
1668	Ga0495653_0001814
1669	Ga0495653_0035166
1670	Ga0495650_0000175
1671	Ga0495650_0008099
1672	Ga0495650_0011486
1673	Ga0495650_0013733
1674	Ga0495580_0009044
1675	Ga0495582_0019384
1676	Ga0495605_0000007
1677	Ga0495605_0000054
1678	Ga0495639_0002530
1679	Ga0495639_0060843
1680	Ga0495584_0001887
1681	Ga0495585_0004929
1682	Ga0495594_0003947
1683	Ga0495594_0110452
1684	Ga0495607_0000036
1685	Ga0495607_0015562
1686	Ga0495583_0000007
1687	Ga0495583_0001768
1688	Ga0495606_0000079
1689	Ga0495606_0100337
1690	Ga0495610_0012966
1691	Ga0495616_0005880
1692	Ga0495616_0033445
1693	Ga0495620_0000014
1694	Ga0495620_0000152
1695	Ga0495620_0008332
1696	Ga0495620_0039931
1697	Ga0495628_0005701
1698	Ga0495630_0108243
1699	Ga0495631_0005933
1700	Ga0495631_0012019
1701	Ga0495632_0062825
1702	Ga0495637_0000075
1703	Ga0495643_0010108
1704	Ga0495644_0002009
1705	Ga0495648_0006335
1706	Ga0495648_0064957
1707	Ga0495648_0111416
1708	Ga0495642_0012477
1709	Ga0495652_0124494
1710	Ga0495654_0003042
1711	Ga0495654_0003868
1712	Ga0495654_0010915
1713	Ga0495665_0004101
1714	Ga0495665_0030854
1715	Ga0495640_0052585
1716	Ga0495586_0001078
1717	Ga0495586_0008289
1718	Ga0495587_0002655
1719	Ga0495609_0000004
1720	Ga0495609_0000016
1721	Ga0495597_0000800
1722	Ga0495645_0045287
1723	Ga0495633_0000051
1724	Ga0495667_0007819
1725	Ga0495667_0055290
1726	Ga0495668_0057643
1727	Ga0495611_0001208
1728	Ga0495659_0023417
1729	Ga0495661_0000035
1730	Ga0495661_0000106
1731	Ga0495661_0029575
1732	Ga0495588_0001553
1733	Ga0495588_0017284
1734	Ga0495657_0028038
1735	Ga0495599_0002087
1736	Ga0495624_0045702
1737	Ga0495670_0025112
1738	Ga0495670_0071999
1739	Ga0495671_0047513
1740	Ga0495589_0002672
1741	Ga0495600_0005355
1742	Ga0495600_0031255
1743	Ga0495660_0015289
1744	Ga0495581_0000128
1745	Ga0495581_0002168
1746	Ga0495581_0031812
1747	Ga0495581_0036997
1748	Ga0495604_0005987
1749	Ga0495674_0084789
1750	Ga0495680_0075548
1751	Ga0495680_0081709
1752	Ga0495683_0000004
1753	Ga0495675_0004789
1754	Ga0495675_0039050
1755	Ga0495679_000086
1756	Ga0495679_000137
1757	Ga0495673_0000256
1758	Ga0495673_0001945
1759	Ga0495673_0021875
1760	Ga0495681_0006754
1761	Ga0495684_0003049
1762	Ga0495686_0002724
1763	Ga0495686_0002735
1764	Ga0495686_0031493
1765	Ga0495686_0127976
1766	Ga0496100_0000857
1767	Ga0496100_0001043
1768	Ga0496100_0002285
1769	Ga0496100_0005295
1770	Ga0496100_0010231
1771	Ga0496100_0023675
1772	Ga0496100_0065333
1773	Ga0496100_0109330
1774	Ga0496100_0153812
1775	Ga0496101_0000102
1776	Ga0496101_0000931
1777	Ga0496101_0003929
1778	Ga0496101_0005707
1779	Ga0496101_0018956
1780	Ga0496101_0038028
1781	Ga0496102_0000037
1782	Ga0496102_0002961
1783	Ga0496102_0006017
1784	Ga0496102_0020916
1785	Ga0496102_0024935
1786	Ga0496102_0032031
1787	Ga0496102_0103954
1788	Ga0496103_0000004
1789	Ga0496103_0000538
1790	Ga0496103_0001429
1791	Ga0496103_0043704
1792	Ga0496103_0144750
1793	Ga0496104_0000163
1794	Ga0496104_0015071
1795	Ga0496104_0056529
1796	Ga0496104_0158146
1797	Ga0496105_0020937
1798	Ga0496105_0037363
1799	Ga0496105_0045899
1800	Ga0496105_0047180
1801	Ga0496105_0084791
1802	Ga0496106_0002893
1803	Ga0496106_0021101
1804	Ga0496106_0022568
1805	Ga0496106_0073410
1806	Ga0496106_0082954
1807	Ga0496106_0321630
1808	Ga0496107_0001948
1809	Ga0496107_0002085
1810	Ga0496107_0002652
1811	Ga0496107_0028542
1812	Ga0496107_0079489
1813	Ga0496107_0120532
1814	Ga0496108_0003170
1815	Ga0496108_0174853
1816	Ga0496109_0001781
1817	Ga0496109_0055755
1818	Ga0496109_0445166
1819	Ga0496110_0030152
1820	Ga0496111_0210876
1821	Ga0496112_0011406
1822	Ga0496112_0064956
1823	Ga0496112_0110581
1824	Ga0496112_0343368
1825	Ga0496113_0007659
1826	Ga0496113_0021432
1827	Ga0496113_0082126
1828	Ga0496114_0000183
1829	Ga0496114_0010345
1830	Ga0496114_0037902
1831	Ga0496114_0049614
1832	Ga0496114_0059176
1833	Ga0496114_0062956
1834	Ga0496114_0094927
1835	Ga0496115_0014331
1836	Ga0496115_0066303
1837	Ga0496116_0000038
1838	Ga0496116_0000276
1839	Ga0496116_0000586
1840	Ga0496116_0089582
1841	Ga0496117_0000003
1842	Ga0496117_0000333
1843	Ga0496117_0006452
1844	Ga0496117_0006709
1845	Ga0496117_0023670
1846	Ga0496118_0000001
1847	Ga0496118_0001153
1848	Ga0496118_0001919
1849	Ga0496118_0008236
1850	Ga0496118_0009402
1851	Ga0496118_0021971
1852	Ga0496118_0087234
1853	Ga0496118_0147198
1854	Ga0496118_0193940
1855	Ga0496119_0000781
1856	Ga0496119_0002042
1857	Ga0496119_0010748
1858	Ga0496119_0016213
1859	Ga0496119_0018569
1860	Ga0496119_0022089
1861	Ga0496119_0022884
1862	Ga0496119_0030252
1863	Ga0496119_0044547
1864	Ga0496119_0076487
1865	Ga0496119_0125982
1866	Ga0496120_0000877
1867	Ga0496120_0001440
1868	Ga0496120_0004056
1869	Ga0496120_0014085
1870	Ga0496120_0023553
1871	Ga0496120_0072588
1872	Ga0496120_0144831
1873	Ga0496121_0000338
1874	Ga0496121_0001478
1875	Ga0496121_0001828
1876	Ga0496121_0003620
1877	Ga0496121_0005225
1878	Ga0496121_0009280
1879	Ga0496121_0015644
1880	Ga0496121_0017191
1881	Ga0496121_0025102
1882	Ga0496121_0028791
1883	Ga0496122_0000411
1884	Ga0496122_0000523
1885	Ga0496122_0001291
1886	Ga0496122_0001815
1887	Ga0496122_0003593
1888	Ga0496122_0008132
1889	Ga0496122_0010818
1890	Ga0496122_0011079
1891	Ga0496122_0015742
1892	Ga0496122_0031601
1893	Ga0496122_0044961
1894	Ga0496123_0000055
1895	Ga0496123_0000404
1896	Ga0496123_0000759
1897	Ga0496123_0001109
1898	Ga0496123_0001562
1899	Ga0496123_0003092
1900	Ga0496123_0004965
1901	Ga0496123_0019267
1902	Ga0496123_0067164
1903	Ga0496123_0195677
1904	Ga0496124_0001124
1905	Ga0496124_0001298
1906	Ga0496124_0001376
1907	Ga0496124_0012658
1908	Ga0496124_0034971
1909	Ga0496124_0055577
1910	Ga0496124_0113141
1911	Ga0496125_0000355
1912	Ga0496125_0002596
1913	Ga0496125_0002643
1914	Ga0496125_0006578
1915	Ga0496125_0152690
1916	Ga0496126_0000035
1917	Ga0496126_0000551
1918	Ga0496126_0002287
1919	Ga0496126_0006107
1920	Ga0496126_0073529
1921	Ga0496126_0074529
1922	Ga0496126_0082061
1923	Ga0496126_0117717
1924	Ga0496126_0164132
1925	Ga0495678_000014
1926	Ga0495678_002419
1927	Ga0495682_0000025
1928	Ga0501031_0079464
1929	Ga0501032_0005221
1930	Ga0501032_0016030
1931	Ga0501033_0006927
1932	Ga0501034_0000057
1933	Ga0501034_0034741
1934	Ga0501034_0140052
1935	Ga0501037_0005857
1936	Ga0501037_0016359
1937	Ga0501037_0025809
1938	Ga0501037_0040572
1939	Ga0501037_0046384
1940	Ga0501037_0137869
1941	Ga0501038_0088498
1942	Ga0501038_0091239
1943	Ga0501039_0002487
1944	Ga0501039_0088392
1945	Ga0501039_0097925
1946	Ga0501039_0241945
1947	Ga0501043_0009700
1948	Ga0501043_0053716
1949	Ga0501046_0002219
1950	Ga0501048_0002473
1951	Ga0501068_0038162
1952	Ga0501070_0015124
1953	Ga0501070_0019297
1954	Ga0501070_0188248
1955	Ga0501071_0041783
1956	Ga0501079_0189632
1957	Ga0501081_0246092
1958	Ga0501035_0120666
1959	Ga0501044_0048208
1960	Ga0501044_0192523
1961	Ga0501045_0028074
1962	nmdc:mga03683_15665_c1
1963	nmdc:mga03n38_161083_c1
1964	nmdc:mga03n38_22578_c1
1965	nmdc:mga03n38_42867_c1
1966	nmdc:mga03n38_5503_c1
1967	nmdc:mga00v17_1631_c1
1968	nmdc:mga00v17_22430_c1
1969	nmdc:mga00v17_31566_c1
1970	nmdc:mga00v17_45_c1
1971	nmdc:mga0yw44_10036_c1
1972	nmdc:mga0yw44_55918_c1
1973	nmdc:mga0yw44_8915_c1
1974	nmdc:mga06z11_9236_c1
1975	nmdc:mga07m45_126470_c1
1976	nmdc:mga07m45_5445_c1
1977	nmdc:mga07m45_7733_c1
1978	nmdc:mga05p37_4206_c1
1979	nmdc:mga0qj67_54338_c1
1980	nmdc:mga06r32_36600_c1
1981	nmdc:mga0n895_225676_c1
1982	nmdc:mga0rr50_91889_c1
1983	nmdc:mga0sz30_1250_c1
1984	nmdc:mga0sz30_26095_c1
1985	Ga0495655_0000671
1986	Ga0495595_0015285
1987	Ga0495595_0100149
1988	Ga0500643_000480
1989	Ga0500643_002391
1990	Ga0500559_0038445
1991	Ga0500573_0000738
1992	Ga0500616_0002052
1993	2945923673
1994	2506864968
1995	2511137218
1996	2515494187
1997	2515722519
1998	2515758597
1999	2516085630
2000	2516090565
2001	2524461930
2002	2528204086
2003	2528214217
2004	2546949156
2005	2547696172
2006	2552106194
2007	2555260512
2008	2555670010
2009	2562464406
2010	2579748224
2011	2585273392
2012	2585283486
2013	2585328271
2014	2585330681
2015	2585535945
2016	2585556708
2017	2585564077
2018	2585900243
2019	2585909196
2020	2587984702
2021	2599333413
2022	2599352953
2023	2599378061
2024	2599384562
2025	2599411163
2026	2599459787
2027	2599488808
2028	2599970034
2029	2600212394
2030	2601523594
2031	2601528753
2032	2601534237
2033	2601538984
2034	2601615586
2035	2601620694
2036	2601643409
2037	2601649091
2038	2601653637
2039	2601659057
2040	2601663232
2041	2601696191
2042	2601700865
2043	2601707786
2044	2601712845
2045	2601716896
2046	2601721215
2047	2601724941
2048	2601732224
2049	2601737898
2050	2601744041
2051	2601753427
2052	2601757333
2053	2601762066
2054	2601772562
2055	2602022054
2056	2603639728
2057	2603643510
2058	2603660616
2059	2603665888
2060	2603704083
2061	2603839241
2062	2603844703
2063	2603849398
2064	2603854466
2065	2603870121
2066	2603875080
2067	2606047312
2068	2606070322
2069	2606146186
2070	2606177112
2071	2609913223
2072	2616312865
2073	2616556004
2074	2617386203
2075	2637226091
2076	2644032019
2077	2644486443
2078	2644607655
2079	2671102277
2080	2671115906
2081	2676407722
2082	2681995845
2083	2682008864
2084	2686538345
2085	2686540882
2086	2689959170
2087	2689994216
2088	2691512606
2089	2710603888
2090	2738673117
2091	2738751510
2092	2738860551
2093	2753854977
2094	2765587842
2095	2774393140
2096	2774398913
2097	2774863746
2098	2774905850
2099	2775541759
2100	2775655593
2101	2777020547
2102	2778179428
2103	2792312754
2104	2808828326
2105	2808849570
2106	2808877833
2107	2808894119
2108	2808895358
2109	2809196965
2110	2809228196
2111	2812319953
2112	2812373628
2113	2813726973
2114	2814694386
2115	2819427018
2116	2819612487
2117	2819643360
2118	2819665232
2119	2819691522
2120	2821118757
2121	2821450300
2122	2823377042
2123	2831908240
2124	2831938054
2125	2832007662
2126	2837271111
2127	2838033891
2128	2839994904
2129	2841913629
2130	2841919376
2131	2842138462
2132	2842299998
2133	2842362608
2134	2842480637
2135	2842487324
2136	2842507320
2137	2842514593
2138	2842889387
2139	2842925179
2140	2844426531
2141	2844670639
2142	2844851691
2143	2852387795
2144	2857744605
2145	2891673815
2146	2891971533
2147	2895890347
2148	2902798431
2149	2902840138
2150	2904500675
2151	2904517575
2152	2904777385
2153	2917073833
2154	2919038105
2155	2919053754
2156	2919063210
2157	2919112944
2158	2919391770
2159	2919408262
2160	2919447008
2161	2923638390
2162	2927835108
2163	2933421942
2164	2937542956
2165	2939600720
2166	2939647246
2167	2939662507
2168	2939675074
2169	2945879180
2170	2945917702
2171	2945944657
2172	2945957142
2173	2946025985
2174	2946040600
2175	2946061521
2176	2969083104
2177	2971824405
2178	2974304146
2179	2974313225
2180	2984560124
2181	2984598205
2182	3005419705
2183	637878927
2184	637320379
2185	8004022249
2186	8004026532
2187	8005317720
2188	8005484397
2189	8005647324
2190	8005687532
2191	8018405812
2192	8024488646
2193	8046768750
2194	8054108180
2195	8055412999
2196	8057582535

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

72

222

0.94 PF08402

TOBE_2

TOBE domain

329

403

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2onk-assembly1.cif.gz_B	abc transporter modbc in complex with its binding protein moda	0.928	2	234
1f3o-assembly1.cif.gz_A-2	crystal structure of mj0796 atp-binding cassette	0.9248	1	217
3c41-assembly1.cif.gz_K	abc protein artp in complex with amp-pnp/mg2+	0.9182	1	234
4wbs-assembly1.cif.gz_A	crystal structure of an abc transporter related protein from burkholderia phymatum	0.9111	2	225
7z17-assembly1.cif.gz_J	e. coli c-p lyase bound to a phnk abc dimer in an open conformation	0.9097	2	234

ID	Description	Score	Start	End	Superfamily
af_P77795_1_218_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9658	2	217	3.40.50.300
2awoD01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9642	2	216	3.40.50.300
1oxuA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9519	2	236	3.40.50.300
af_Q47538_1_237_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9479	1	217	3.40.50.300
2awoD01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9444	2	216	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A257XML9-F1-model_v4	Iron ABC transporter ATP-binding protein	0.9687	2	191	GO:0005524 GO:0016887
AF-A0A2N5A791-F1-model_v4	Fe3+/spermidine/putrescine ABC transporter ATP-binding protein	0.9641	2	212	GO:0005524 GO:0005886 GO:0015408 GO:0016887
AF-A0A4P6EN98-F1-model_v4	ATP-binding cassette domain-containing protein	0.9601	2	218	GO:0005524 GO:0016887
AF-A0A382ZAC4-F1-model_v4	ABC transporter domain-containing protein	0.9593	2	210	GO:0005524 GO:0005886 GO:0015408 GO:0016887
AF-A0A357JJL3-F1-model_v4	ABC transporter domain-containing protein	0.9586	1	192	GO:0005524 GO:0005886 GO:0015408 GO:0016887

F490031

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00005

ABC_tran

ABC transporter

72

222

0.94

PF08402

TOBE_2

TOBE domain

329

403

0.9

Structural Annotation

Top 5 Hits

Map