F489999

General Info

Members Datasets Scaffolds Average Seq Length
1097 347 2194 113

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_101413534|Ga0075428_1014135341
Length 122
Sequence LKPEGSDQLPPTTPDILRGTLDLLILKALSWGPAHGYAVARWIQQATDDALAVGEGSLYPALHRLEERDWITARWGTSENNRQAKYYALTRRGRAQLKIETTNWRRYAVAVFAALDAPALQE

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
224 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
236 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
237 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
238 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
239 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
240 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
241 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
242 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
243 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
258 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
259 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
273 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
293 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
294 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
315 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
316 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
317 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
318 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
319 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
320 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
321 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
325 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
326 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
333 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
334 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
335 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
336 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
337 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
338 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
339 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
340 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
341 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
342 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
343 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
344 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
345 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
346 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
347 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 1.28
Rhizosphere 98.27
Stem 0
Stem Tuber 0
Unclassified 18.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_101413534 3300006844 Bacteria 730
2 JGI24750J21931_1071927 3300002070 Bacteria 566
3 Ga0065712_10207806 3300005290 Bacteria 1083
4 Ga0065712_10460842 3300005290 Bacteria 678
5 Ga0065715_10031719 3300005293 Unclassified 1754
6 Ga0065715_10148693 3300005293 Bacteria 1755
7 Ga0065715_10149918 3300005293 Unclassified 1741
8 Ga0065715_10550346 3300005293 Bacteria 741
9 Ga0065707_10042451 3300005295 Bacteria 995
10 Ga0065707_10084700 3300005295 Bacteria 6870
11 Ga0065707_10404930 3300005295 Unclassified 848
12 Ga0070676_10041369 3300005328 Bacteria 2672
13 Ga0070676_10483915 3300005328 Unclassified 876
14 Ga0070683_100002086 3300005329 Bacteria 15785
15 Ga0070683_100046487 3300005329 Bacteria 4010
16 Ga0070683_100066183 3300005329 Bacteria 3366
17 Ga0070683_100339086 3300005329 Bacteria 1431
18 Ga0070683_100549862 3300005329 Bacteria 1104
19 Ga0070683_100786922 3300005329 Bacteria 912
20 Ga0070683_100846785 3300005329 Bacteria 877
21 Ga0070690_100084527 3300005330 Bacteria 2080
22 Ga0070690_100167273 3300005330 Bacteria 1511
23 Ga0070690_100310975 3300005330 Bacteria 1132
24 Ga0070690_100421583 3300005330 Bacteria 984
25 Ga0070670_100012997 3300005331 Bacteria 7130
26 Ga0070670_100063917 3300005331 Bacteria 3158
27 Ga0070670_100802918 3300005331 Bacteria 850
28 Ga0070677_10123616 3300005333 Unclassified 1172
29 Ga0070677_10226139 3300005333 Bacteria 917
30 Ga0070677_10407804 3300005333 Unclassified 718
31 Ga0068869_100066536 3300005334 Bacteria 2655
32 Ga0068869_100214378 3300005334 Bacteria 1523
33 Ga0068869_100279930 3300005334 Bacteria 1341
34 Ga0068869_100374996 3300005334 Bacteria 1165
35 Ga0068869_100444555 3300005334 Unclassified 1074
36 Ga0068869_100681237 3300005334 Bacteria 875
37 Ga0068869_100784520 3300005334 Bacteria 818
38 Ga0070666_10221512 3300005335 Bacteria 1335
39 Ga0070666_10474004 3300005335 Bacteria 906
40 Ga0070680_100002241 3300005336 Bacteria 14263
41 Ga0070680_100004937 3300005336 Bacteria 10042
42 Ga0070680_100007133 3300005336 Bacteria 8515
43 Ga0070680_100044158 3300005336 Bacteria 3621
44 Ga0070680_100044415 3300005336 Bacteria 3611
45 Ga0070680_100361003 3300005336 Bacteria 1236
46 Ga0070680_101229158 3300005336 Unclassified 648
47 Ga0070680_101781736 3300005336 Bacteria 534
48 Ga0070682_100987647 3300005337 Bacteria 698
49 Ga0068868_100020990 3300005338 Bacteria 4917
50 Ga0068868_100399637 3300005338 Unclassified 1186
51 Ga0068868_102049559 3300005338 Bacteria 544
52 Ga0070660_100800577 3300005339 Bacteria 793
53 Ga0070660_101212736 3300005339 Bacteria 640
54 Ga0070689_100060698 3300005340 Bacteria 2940
55 Ga0070689_100071555 3300005340 Bacteria 2709
56 Ga0070689_100093021 3300005340 Bacteria 2379
57 Ga0070689_100106303 3300005340 Bacteria 2226
58 Ga0070689_100113726 3300005340 Bacteria 2155
59 Ga0070689_100320109 3300005340 Bacteria 1295
60 Ga0070689_100342238 3300005340 Bacteria 1253
61 Ga0070689_100433794 3300005340 Unclassified 1115
62 Ga0070691_10020238 3300005341 Bacteria 3074
63 Ga0070691_10043247 3300005341 Bacteria 2134
64 Ga0070687_100062272 3300005343 Bacteria 1975
65 Ga0070687_100150404 3300005343 Bacteria 1366
66 Ga0070661_100008191 3300005344 Bacteria 7210
67 Ga0070661_100069046 3300005344 Bacteria 2598
68 Ga0070661_100101198 3300005344 Bacteria 2143
69 Ga0070661_100112612 3300005344 Bacteria 2033
70 Ga0070692_10214392 3300005345 Bacteria 1135
71 Ga0070692_10466249 3300005345 Bacteria 812
72 Ga0070668_100029427 3300005347 Bacteria 4172
73 Ga0070668_100035546 3300005347 Bacteria 3799
74 Ga0070668_100126558 3300005347 Bacteria 2047
75 Ga0070668_100476860 3300005347 Bacteria 1077
76 Ga0070668_101072926 3300005347 Bacteria 726
77 Ga0070668_101309346 3300005347 Bacteria 659
78 Ga0070669_100002529 3300005353 Bacteria 13220
79 Ga0070669_100018592 3300005353 Bacteria 4967
80 Ga0070669_100027616 3300005353 Bacteria 4085
81 Ga0070669_100113389 3300005353 Bacteria 2059
82 Ga0070669_100189934 3300005353 Bacteria 1611
83 Ga0070675_100025332 3300005354 Bacteria 4756
84 Ga0070675_100047910 3300005354 Unclassified 3503
85 Ga0070675_100102666 3300005354 Bacteria 2409
86 Ga0070675_100416648 3300005354 Bacteria 1201
87 Ga0070675_100602711 3300005354 Bacteria 996
88 Ga0070675_100733816 3300005354 Unclassified 901
89 Ga0070675_100936278 3300005354 Unclassified 794
90 Ga0070675_101082218 3300005354 Bacteria 737
91 Ga0070675_101241096 3300005354 Unclassified 686
92 Ga0070675_102249599 3300005354 Bacteria 502
93 Ga0070671_100032506 3300005355 Bacteria 4313
94 Ga0070671_100213679 3300005355 Bacteria 1636
95 Ga0070671_100299636 3300005355 Unclassified 1369
96 Ga0070671_100589272 3300005355 Bacteria 960
97 Ga0070671_100783330 3300005355 Bacteria 830
98 Ga0070671_101096522 3300005355 Unclassified 699
99 Ga0070671_101265171 3300005355 Bacteria 650
100 Ga0070674_100001417 3300005356 Bacteria 12718
101 Ga0070674_100125889 3300005356 Bacteria 1903
102 Ga0070674_100172191 3300005356 Bacteria 1652
103 Ga0070674_100254364 3300005356 Bacteria 1381
104 Ga0070674_100320912 3300005356 Bacteria 1242
105 Ga0070674_100351377 3300005356 Unclassified 1191
106 Ga0070673_100003041 3300005364 Bacteria 10372
107 Ga0070673_100064212 3300005364 Bacteria 2924
108 Ga0070673_100092869 3300005364 Bacteria 2470
109 Ga0070673_100298929 3300005364 Bacteria 1417
110 Ga0070673_100725821 3300005364 Unclassified 914
111 Ga0070673_101033233 3300005364 Unclassified 766
112 Ga0070688_100056715 3300005365 Bacteria 2460
113 Ga0070688_100113170 3300005365 Bacteria 1808
114 Ga0070688_100418806 3300005365 Bacteria 995
115 Ga0070688_100599506 3300005365 Bacteria 843
116 Ga0070688_100620257 3300005365 Bacteria 830
117 Ga0070659_100030011 3300005366 Bacteria 4205
118 Ga0070659_100065538 3300005366 Bacteria 2877
119 Ga0070659_101339756 3300005366 Bacteria 635
120 Ga0070659_101530121 3300005366 Unclassified 595
121 Ga0070667_100372077 3300005367 Unclassified 1297
122 Ga0070667_101037455 3300005367 Unclassified 765
123 Ga0070703_10069968 3300005406 Bacteria 1170
124 Ga0070709_10080313 3300005434 Bacteria 2126
125 Ga0070714_100000710 3300005435 Bacteria 23579
126 Ga0070714_100004748 3300005435 Bacteria 10287
127 Ga0070714_100050961 3300005435 Bacteria 3529
128 Ga0070714_100379378 3300005435 Bacteria 1332
129 Ga0070714_100493958 3300005435 Bacteria 1166
130 Ga0070713_100106515 3300005436 Bacteria 2437
131 Ga0070713_100218906 3300005436 Bacteria 1726
132 Ga0070710_10116749 3300005437 Bacteria 1610
133 Ga0070701_10083457 3300005438 Bacteria 1735
134 Ga0070701_10234220 3300005438 Bacteria 1101
135 Ga0070701_10418983 3300005438 Bacteria 853
136 Ga0070701_10528744 3300005438 Unclassified 770
137 Ga0070701_11065431 3300005438 Bacteria 567
138 Ga0070711_100150582 3300005439 Bacteria 1754
139 Ga0070705_100524346 3300005440 Bacteria 903
140 Ga0070700_100063293 3300005441 Bacteria 2340
141 Ga0070700_100083624 3300005441 Bacteria 2067
142 Ga0070700_100168231 3300005441 Bacteria 1516
143 Ga0070700_100379738 3300005441 Bacteria 1056
144 Ga0070700_100835321 3300005441 Unclassified 745
145 Ga0070700_101402987 3300005441 Bacteria 590
146 Ga0070694_100109395 3300005444 Bacteria 1967
147 Ga0070694_100150414 3300005444 Bacteria 1700
148 Ga0070694_100588737 3300005444 Bacteria 895
149 Ga0070694_101011880 3300005444 Unclassified 690
150 Ga0070708_100212874 3300005445 Bacteria 1811
151 Ga0070663_100096438 3300005455 Bacteria 2200
152 Ga0070663_100344670 3300005455 Bacteria 1205
153 Ga0070678_100115533 3300005456 Bacteria 2107
154 Ga0070678_100536864 3300005456 Bacteria 1037
155 Ga0070678_100976215 3300005456 Bacteria 778
156 Ga0070678_101217444 3300005456 Unclassified 699
157 Ga0070662_100011662 3300005457 Bacteria 5801
158 Ga0070662_100350668 3300005457 Unclassified 1209
159 Ga0070662_100692344 3300005457 Bacteria 862
160 Ga0070662_100741458 3300005457 Bacteria 833
161 Ga0070681_10000342 3300005458 Bacteria 37579
162 Ga0070681_10011023 3300005458 Bacteria 8935
163 Ga0070681_10103920 3300005458 Bacteria 2784
164 Ga0070681_10105551 3300005458 Bacteria 2759
165 Ga0070681_10113051 3300005458 Bacteria 2655
166 Ga0070681_10210284 3300005458 Bacteria 1861
167 Ga0070681_10237995 3300005458 Bacteria 1734
168 Ga0070681_11031710 3300005458 Unclassified 743
169 Ga0070681_11725407 3300005458 Bacteria 552
170 Ga0068867_100021225 3300005459 Bacteria 4633
171 Ga0068867_100066064 3300005459 Bacteria 2693
172 Ga0068867_100089077 3300005459 Bacteria 2340
173 Ga0068867_100109009 3300005459 Bacteria 2125
174 Ga0068867_100527888 3300005459 Unclassified 1019
175 Ga0068867_100771992 3300005459 Unclassified 855
176 Ga0070685_10038931 3300005466 Bacteria 2698
177 Ga0070685_11052117 3300005466 Bacteria 613
178 Ga0070685_11355104 3300005466 Bacteria 545
179 Ga0070706_101184401 3300005467 Unclassified 702
180 Ga0070706_101231951 3300005467 Bacteria 687
181 Ga0070707_100000847 3300005468 Bacteria 30350
182 Ga0070698_100034959 3300005471 Bacteria 5198
183 Ga0070698_100113784 3300005471 Bacteria 2671
184 Ga0070698_100192933 3300005471 Unclassified 1974
185 Ga0070698_100466415 3300005471 Unclassified 1199
186 Ga0070699_100548583 3300005518 Bacteria 1052
187 Ga0070699_101542076 3300005518 Bacteria 609
188 Ga0070679_100000592 3300005530 Bacteria 30736
189 Ga0070679_100001118 3300005530 Bacteria 23399
190 Ga0070679_100058766 3300005530 Bacteria 3832
191 Ga0070679_100214910 3300005530 Bacteria 1885
192 Ga0070679_100275634 3300005530 Bacteria 1635
193 Ga0070679_101067207 3300005530 Bacteria 752
194 Ga0070684_100029898 3300005535 Bacteria 4623
195 Ga0070684_100130751 3300005535 Unclassified 2264
196 Ga0070684_100342419 3300005535 Bacteria 1375
197 Ga0070684_100557591 3300005535 Unclassified 1064
198 Ga0070684_100919682 3300005535 Unclassified 820
199 Ga0068853_100292641 3300005539 Bacteria 1503
200 Ga0068853_100477617 3300005539 Bacteria 1175
201 Ga0068853_100523238 3300005539 Unclassified 1121
202 Ga0068853_100723839 3300005539 Unclassified 950
203 Ga0070672_100008778 3300005543 Bacteria 6939
204 Ga0070672_100090254 3300005543 Bacteria 2471
205 Ga0070672_100103623 3300005543 Unclassified 2311
206 Ga0070672_100203331 3300005543 Bacteria 1657
207 Ga0070672_101568295 3300005543 Unclassified 590
208 Ga0070686_100200104 3300005544 Bacteria 1431
209 Ga0070686_100220594 3300005544 Bacteria 1370
210 Ga0070686_100863905 3300005544 Unclassified 733
211 Ga0070686_100908098 3300005544 Unclassified 717
212 Ga0070686_101316202 3300005544 Bacteria 604
213 Ga0070695_100117186 3300005545 Unclassified 1817
214 Ga0070695_100202863 3300005545 Bacteria 1418
215 Ga0070695_100635315 3300005545 Bacteria 841
216 Ga0070695_101622887 3300005545 Unclassified 540
217 Ga0070696_100219881 3300005546 Bacteria 1425
218 Ga0070696_100241048 3300005546 Bacteria 1364
219 Ga0070696_100373846 3300005546 Bacteria 1109
220 Ga0070696_100826381 3300005546 Bacteria 764
221 Ga0070696_100895233 3300005546 Unclassified 736
222 Ga0070696_101436232 3300005546 Bacteria 589
223 Ga0070693_100027787 3300005547 Bacteria 3070
224 Ga0070693_100080972 3300005547 Bacteria 1935
225 Ga0070665_100669810 3300005548 Bacteria 1051
226 Ga0070665_101264087 3300005548 Bacteria 748
227 Ga0070665_101355074 3300005548 Bacteria 721
228 Ga0070704_100000322 3300005549 Bacteria 21587
229 Ga0070704_100200497 3300005549 Bacteria 1610
230 Ga0070704_100487438 3300005549 Bacteria 1068
231 Ga0070704_100529686 3300005549 Bacteria 1027
232 Ga0068855_100027285 3300005563 Bacteria 6833
233 Ga0068855_100130722 3300005563 Bacteria 2868
234 Ga0068855_100170964 3300005563 Bacteria 2461
235 Ga0068855_100205759 3300005563 Bacteria 2214
236 Ga0068855_100259252 3300005563 Bacteria 1937
237 Ga0068855_100358161 3300005563 Bacteria 1606
238 Ga0068855_100816213 3300005563 Bacteria 990
239 Ga0068855_102227016 3300005563 Bacteria 550
240 Ga0070664_100002183 3300005564 Bacteria 15715
241 Ga0070664_100033249 3300005564 Bacteria 4318
242 Ga0070664_100048698 3300005564 Unclassified 3581
243 Ga0070664_100197174 3300005564 Bacteria 1795
244 Ga0070664_100224902 3300005564 Bacteria 1680
245 Ga0070664_100329573 3300005564 Bacteria 1385
246 Ga0070664_100390388 3300005564 Bacteria 1272
247 Ga0070664_100669164 3300005564 Unclassified 965
248 Ga0070664_100889539 3300005564 Bacteria 835
249 Ga0068857_100002781 3300005577 Bacteria 14384
250 Ga0068857_100114558 3300005577 Bacteria 2425
251 Ga0068857_100182775 3300005577 Bacteria 1908
252 Ga0068854_100095922 3300005578 Bacteria 2215
253 Ga0068854_100153677 3300005578 Bacteria 1776
254 Ga0068854_100407108 3300005578 Bacteria 1127
255 Ga0068854_100702582 3300005578 Bacteria 873
256 Ga0068854_100849174 3300005578 Bacteria 799
257 Ga0068856_100500424 3300005614 Bacteria 1236
258 Ga0068856_102049809 3300005614 Unclassified 582
259 Ga0068856_102052519 3300005614 Bacteria 582
260 Ga0070702_100014361 3300005615 Bacteria 4017
261 Ga0070702_100226042 3300005615 Bacteria 1254
262 Ga0070702_100459936 3300005615 Bacteria 925
263 Ga0068852_100029515 3300005616 Bacteria 4507
264 Ga0068852_100110078 3300005616 Bacteria 2502
265 Ga0068852_100253314 3300005616 Bacteria 1687
266 Ga0068852_100489871 3300005616 Bacteria 1223
267 Ga0068852_100759577 3300005616 Bacteria 982
268 Ga0068852_100945520 3300005616 Bacteria 880
269 Ga0068852_102391699 3300005616 Unclassified 549
270 Ga0068859_100029089 3300005617 Bacteria 5545
271 Ga0068859_100136554 3300005617 Bacteria 2525
272 Ga0068859_100165336 3300005617 Unclassified 2292
273 Ga0068859_100732076 3300005617 Bacteria 1079
274 Ga0068859_100918713 3300005617 Bacteria 959
275 Ga0068859_101112044 3300005617 Unclassified 869
276 Ga0068859_101574771 3300005617 Unclassified 725
277 Ga0068864_100203494 3300005618 Unclassified 1820
278 Ga0068866_10352367 3300005718 Bacteria 936
279 Ga0068866_10454837 3300005718 Unclassified 838
280 Ga0068866_10624442 3300005718 Unclassified 730
281 Ga0068866_10627093 3300005718 Bacteria 729
282 Ga0068861_100000927 3300005719 Bacteria 17824
283 Ga0068861_100241076 3300005719 Unclassified 1538
284 Ga0068861_100373365 3300005719 Bacteria 1258
285 Ga0068861_101236700 3300005719 Unclassified 724
286 Ga0068861_101592895 3300005719 Bacteria 643
287 Ga0068851_10015005 3300005834 Bacteria 3686
288 Ga0068851_10611950 3300005834 Unclassified 664
289 Ga0068870_11132698 3300005840 Bacteria 564
290 Ga0068863_100006098 3300005841 Bacteria 11823
291 Ga0068863_100027035 3300005841 Bacteria 5472
292 Ga0068863_100129568 3300005841 Bacteria 2408
293 Ga0068863_100150122 3300005841 Unclassified 2229
294 Ga0068863_100949741 3300005841 Bacteria 861
295 Ga0068858_100140634 3300005842 Unclassified 2266
296 Ga0068858_100141487 3300005842 Bacteria 2259
297 Ga0068858_100222378 3300005842 Bacteria 1788
298 Ga0068858_100395335 3300005842 Bacteria 1328
299 Ga0068858_101904571 3300005842 Bacteria 587
300 Ga0068860_100202344 3300005843 Bacteria 1925
301 Ga0068860_100222106 3300005843 Unclassified 1835
302 Ga0068860_100585280 3300005843 Bacteria 1120
303 Ga0068860_100643566 3300005843 Unclassified 1068
304 Ga0068860_101041100 3300005843 Bacteria 837
305 Ga0068862_100015543 3300005844 Bacteria 6322
306 Ga0068862_100016152 3300005844 Bacteria 6209
307 Ga0068862_100039998 3300005844 Bacteria 3984
308 Ga0068862_100252259 3300005844 Unclassified 1608
309 Ga0068862_100268524 3300005844 Bacteria 1559
310 Ga0068862_100293663 3300005844 Bacteria 1493
311 Ga0070717_10043334 3300006028 Bacteria 3673
312 Ga0070716_100032905 3300006173 Bacteria 2832
313 Ga0070712_100065137 3300006175 Bacteria 2585
314 Ga0070712_100860294 3300006175 Bacteria 780
315 Ga0097621_100319091 3300006237 Bacteria 1376
316 Ga0068871_101194731 3300006358 Unclassified 713
317 Ga0075428_100038452 3300006844 Bacteria 5265
318 Ga0075428_100048210 3300006844 Bacteria 4676
319 Ga0075428_100097034 3300006844 Bacteria 3213
320 Ga0075428_100114502 3300006844 Bacteria 2938
321 Ga0075428_100646604 3300006844 Bacteria 1128
322 Ga0075430_100000594 3300006846 Bacteria 27485
323 Ga0075430_100019500 3300006846 Bacteria 5767
324 Ga0075430_100111634 3300006846 Unclassified 2280
325 Ga0075430_100165779 3300006846 Bacteria 1838
326 Ga0075430_100244070 3300006846 Bacteria 1488
327 Ga0075430_100546939 3300006846 Bacteria 955
328 Ga0075431_100032277 3300006847 Bacteria 5396
329 Ga0075431_100063668 3300006847 Bacteria 3806
330 Ga0075431_100064715 3300006847 Bacteria 3776
331 Ga0075431_100077660 3300006847 Bacteria 3427
332 Ga0075431_100917341 3300006847 Bacteria 845
333 Ga0075433_10062472 3300006852 Bacteria 3262
334 Ga0075433_10091182 3300006852 Bacteria 2694
335 Ga0075433_10474650 3300006852 Bacteria 1102
336 Ga0075434_100037433 3300006871 Bacteria 4803
337 Ga0075434_100098308 3300006871 Bacteria 2932
338 Ga0075434_100105715 3300006871 Unclassified 2825
339 Ga0075434_100124865 3300006871 Bacteria 2591
340 Ga0075434_100235190 3300006871 Bacteria 1852
341 Ga0075434_101297603 3300006871 Bacteria 739
342 Ga0075429_100173676 3300006880 Bacteria 1888
343 Ga0075429_100642554 3300006880 Bacteria 930
344 Ga0075429_100899584 3300006880 Archaea 775
345 Ga0075429_101905810 3300006880 Bacteria 515
346 Ga0068865_100110044 3300006881 Unclassified 2031
347 Ga0068865_100133777 3300006881 Unclassified 1860
348 Ga0068865_100320414 3300006881 Unclassified 1247
349 Ga0068865_100603501 3300006881 Bacteria 928
350 Ga0068865_101169871 3300006881 Bacteria 680
351 Ga0075436_100001520 3300006914 Bacteria 15834
352 Ga0075436_100021677 3300006914 Bacteria 4409
353 Ga0075436_100083802 3300006914 Bacteria 2212
354 Ga0075436_100115888 3300006914 Bacteria 1872
355 Ga0075436_100117389 3300006914 Bacteria 1860
356 Ga0075436_100847292 3300006914 Bacteria 682
357 Ga0075436_101488418 3300006914 Bacteria 514
358 Ga0097620_100029090 3300006931 Bacteria 5545
359 Ga0097620_100136557 3300006931 Bacteria 2525
360 Ga0097620_100165323 3300006931 Unclassified 2292
361 Ga0097620_100732041 3300006931 Bacteria 1079
362 Ga0097620_100918705 3300006931 Bacteria 959
363 Ga0097620_101112013 3300006931 Unclassified 869
364 Ga0097620_101574791 3300006931 Unclassified 725
365 Ga0075435_100002075 3300007076 Bacteria 13145
366 Ga0075435_100280985 3300007076 Bacteria 1421
367 Ga0075435_100290957 3300007076 Bacteria 1396
368 Ga0075435_100933311 3300007076 Bacteria 757
369 Ga0105240_10025295 3300009093 Bacteria 7805
370 Ga0105240_10046001 3300009093 Bacteria 5533
371 Ga0105240_10052246 3300009093 Bacteria 5138
372 Ga0105240_10312827 3300009093 Bacteria 1793
373 Ga0105240_10775442 3300009093 Bacteria 1040
374 Ga0105240_11246417 3300009093 Bacteria 786
375 Ga0105240_11353283 3300009093 Bacteria 749
376 Ga0105240_11386489 3300009093 Bacteria 739
377 Ga0111539_10011043 3300009094 Bacteria 11362
378 Ga0111539_10014759 3300009094 Bacteria 9745
379 Ga0111539_10058539 3300009094 Bacteria 4571
380 Ga0111539_10066641 3300009094 Bacteria 4253
381 Ga0111539_10085927 3300009094 Bacteria 3697
382 Ga0111539_10171481 3300009094 Bacteria 2535
383 Ga0111539_10174533 3300009094 Bacteria 2511
384 Ga0111539_10325848 3300009094 Bacteria 1788
385 Ga0111539_10395232 3300009094 Bacteria 1610
386 Ga0111539_10573181 3300009094 Bacteria 1315
387 Ga0111539_11383741 3300009094 Unclassified 816
388 Ga0111539_11496300 3300009094 Bacteria 783
389 Ga0111539_12007438 3300009094 Bacteria 671
390 Ga0111539_12755336 3300009094 Unclassified 570
391 Ga0105245_10245447 3300009098 Bacteria 1738
392 Ga0105245_10314354 3300009098 Bacteria 1541
393 Ga0105245_11596279 3300009098 Bacteria 704
394 Ga0105245_11782600 3300009098 Unclassified 668
395 Ga0105247_10211533 3300009101 Bacteria 1308
396 Ga0114129_10013420 3300009147 Bacteria 11674
397 Ga0114129_10039221 3300009147 Bacteria 6677
398 Ga0114129_10054878 3300009147 Bacteria 5585
399 Ga0114129_10130190 3300009147 Bacteria 3457
400 Ga0114129_10487053 3300009147 Bacteria 1613
401 Ga0114129_10876435 3300009147 Bacteria 1139
402 Ga0114129_13108249 3300009147 Unclassified 542
403 Ga0105243_10389537 3300009148 Bacteria 1291
404 Ga0105243_10999418 3300009148 Bacteria 839
405 Ga0105243_11532342 3300009148 Unclassified 691
406 Ga0105243_13091397 3300009148 Bacteria 504
407 Ga0105241_10112663 3300009174 Bacteria 2180
408 Ga0105241_10114120 3300009174 Bacteria 2167
409 Ga0105241_10162164 3300009174 Bacteria 1839
410 Ga0105241_10405415 3300009174 Bacteria 1197
411 Ga0105241_11189078 3300009174 Bacteria 722
412 Ga0105241_11878954 3300009174 Bacteria 586
413 Ga0105241_12024551 3300009174 Bacteria 567
414 Ga0105242_10049439 3300009176 Bacteria 3422
415 Ga0105242_10086700 3300009176 Bacteria 2628
416 Ga0105242_10257883 3300009176 Bacteria 1574
417 Ga0105242_11294935 3300009176 Bacteria 752
418 Ga0105248_10014029 3300009177 Bacteria 8816
419 Ga0105248_10017537 3300009177 Bacteria 7895
420 Ga0105248_10028015 3300009177 Bacteria 6275
421 Ga0105248_10106301 3300009177 Bacteria 3164
422 Ga0105248_10169849 3300009177 Bacteria 2458
423 Ga0105248_10379966 3300009177 Bacteria 1590
424 Ga0105248_10646426 3300009177 Bacteria 1193
425 Ga0105237_10098281 3300009545 Bacteria 2918
426 Ga0105237_10190029 3300009545 Bacteria 2054
427 Ga0105237_10241944 3300009545 Bacteria 1806
428 Ga0105237_10685513 3300009545 Bacteria 1031
429 Ga0105237_11039174 3300009545 Bacteria 826
430 Ga0105237_11792226 3300009545 Bacteria 621
431 Ga0105238_10013673 3300009551 Bacteria 8197
432 Ga0105238_10080479 3300009551 Bacteria 3247
433 Ga0105238_10109276 3300009551 Unclassified 2746
434 Ga0105238_10179770 3300009551 Bacteria 2092
435 Ga0105238_10187858 3300009551 Unclassified 2042
436 Ga0105238_10697907 3300009551 Bacteria 1027
437 Ga0105238_10704502 3300009551 Unclassified 1022
438 Ga0105249_10001916 3300009553 Bacteria 18047
439 Ga0105249_10004595 3300009553 Bacteria 11927
440 Ga0105249_10298944 3300009553 Bacteria 1614
441 Ga0105249_10558189 3300009553 Bacteria 1196
442 Ga0105249_10865883 3300009553 Bacteria 969
443 Ga0105239_10038551 3300010375 Bacteria 5237
444 Ga0105239_10531833 3300010375 Bacteria 1338
445 Ga0105239_10662931 3300010375 Bacteria 1192
446 Ga0105239_13086201 3300010375 Bacteria 543
447 Ga0105246_10042561 3300011119 Unclassified 3076
448 Ga0105246_10169454 3300011119 Unclassified 1671
449 Ga0157373_10020314 3300013100 Bacteria 4830
450 Ga0157373_10071356 3300013100 Bacteria 2453
451 Ga0157373_10109507 3300013100 Bacteria 1942
452 Ga0157373_10144338 3300013100 Bacteria 1674
453 Ga0157373_10382440 3300013100 Bacteria 1007
454 Ga0157373_10615455 3300013100 Unclassified 791
455 Ga0157373_10632653 3300013100 Unclassified 780
456 Ga0157371_10033591 3300013102 Bacteria 3685
457 Ga0157370_10023970 3300013104 Bacteria 6050
458 Ga0157370_10192346 3300013104 Bacteria 1894
459 Ga0157370_10196636 3300013104 Unclassified 1871
460 Ga0157370_10256155 3300013104 Bacteria 1618
461 Ga0157370_10344651 3300013104 Unclassified 1373
462 Ga0157370_11159579 3300013104 Bacteria 698
463 Ga0157370_11295153 3300013104 Bacteria 657
464 Ga0157369_10012326 3300013105 Bacteria 9710
465 Ga0157369_10013320 3300013105 Bacteria 9299
466 Ga0157369_10039653 3300013105 Bacteria 5147
467 Ga0157369_10190071 3300013105 Unclassified 2158
468 Ga0157369_10237234 3300013105 Unclassified 1905
469 Ga0157369_10563381 3300013105 Bacteria 1177
470 Ga0157369_10780515 3300013105 Bacteria 982
471 Ga0157369_10848745 3300013105 Bacteria 937
472 Ga0157369_11502340 3300013105 Unclassified 685
473 Ga0157374_10068700 3300013296 Bacteria 3334
474 Ga0157374_10484945 3300013296 Bacteria 1240
475 Ga0157378_10129268 3300013297 Bacteria 2336
476 Ga0157378_10245520 3300013297 Unclassified 1712
477 Ga0157378_10263337 3300013297 Unclassified 1655
478 Ga0157378_10307291 3300013297 Bacteria 1537
479 Ga0157378_11688115 3300013297 Unclassified 680
480 Ga0163162_10002204 3300013306 Bacteria 18301
481 Ga0163162_10364132 3300013306 Bacteria 1579
482 Ga0157372_10006667 3300013307 Bacteria 12284
483 Ga0157372_10013842 3300013307 Bacteria 8614
484 Ga0157372_10075519 3300013307 Bacteria 3803
485 Ga0157372_10108200 3300013307 Bacteria 3181
486 Ga0157372_10475011 3300013307 Bacteria 1457
487 Ga0157372_10517742 3300013307 Unclassified 1391
488 Ga0157372_10536642 3300013307 Unclassified 1364
489 Ga0157372_10738379 3300013307 Bacteria 1145
490 Ga0157372_10913753 3300013307 Unclassified 1018
491 Ga0157372_11036464 3300013307 Bacteria 950
492 Ga0157372_11189350 3300013307 Bacteria 881
493 Ga0157372_12752584 3300013307 Bacteria 564
494 Ga0157375_10226902 3300013308 Unclassified 2026
495 Ga0157375_10811086 3300013308 Bacteria 1084
496 Ga0157375_11649452 3300013308 Bacteria 759
497 Ga0163163_10000009 3300014325 Bacteria 268331
498 Ga0163163_10205909 3300014325 Unclassified 2015
499 Ga0157380_10028765 3300014326 Bacteria 4242
500 Ga0157380_10137043 3300014326 Bacteria 2097
501 Ga0157380_10159336 3300014326 Bacteria 1960
502 Ga0157380_10391460 3300014326 Bacteria 1315
503 Ga0157380_11125239 3300014326 Bacteria 825
504 Ga0157380_11546273 3300014326 Bacteria 718
505 Ga0157380_13396535 3300014326 Bacteria 509
506 Ga0157377_10016947 3300014745 Bacteria 3759
507 Ga0157377_10056842 3300014745 Bacteria 2223
508 Ga0157377_10171727 3300014745 Bacteria 1357
509 Ga0157377_10385667 3300014745 Bacteria 950
510 Ga0157377_10738986 3300014745 Bacteria 719
511 Ga0157377_10772605 3300014745 Bacteria 705
512 Ga0157377_10846610 3300014745 Unclassified 679
513 Ga0157379_11033880 3300014968 Unclassified 784
514 Ga0157376_10412754 3300014969 Bacteria 1308
515 Ga0182007_10236618 3300015262 Bacteria 650
516 Ga0163161_10035975 3300017792 Bacteria 3545
517 Ga0163161_10782100 3300017792 Unclassified 801
518 Ga0206356_10073776 3300020070 Bacteria 2178
519 Ga0206356_10999864 3300020070 Bacteria 858
520 Ga0206349_1327194 3300020075 Bacteria 533
521 Ga0206350_11173530 3300020080 Bacteria 635
522 Ga0206354_10340077 3300020081 Bacteria 769
523 Ga0206354_10696304 3300020081 Bacteria 1569
524 Ga0206353_10504984 3300020082 Bacteria 1226
525 Ga0206353_10730584 3300020082 Bacteria 1101
526 Ga0206353_10767563 3300020082 Bacteria 1472
527 Ga0224712_10105643 3300022467 Bacteria 1201
528 Ga0207697_10002021 3300025315 Bacteria 10733
529 Ga0207697_10056512 3300025315 Bacteria 1628
530 Ga0207697_10510540 3300025315 Bacteria 530
531 Ga0207656_10104637 3300025321 Unclassified 1301
532 Ga0207656_10401876 3300025321 Unclassified 689
533 Ga0207653_10231590 3300025885 Unclassified 704
534 Ga0207682_10257099 3300025893 Bacteria 814
535 Ga0207642_10327462 3300025899 Unclassified 897
536 Ga0207710_10441315 3300025900 Bacteria 671
537 Ga0207688_10395657 3300025901 Unclassified 856
538 Ga0207688_10395749 3300025901 Bacteria 856
539 Ga0207688_11044140 3300025901 Archaea 516
540 Ga0207680_10057026 3300025903 Bacteria 2362
541 Ga0207680_10083457 3300025903 Bacteria 2014
542 Ga0207680_10133574 3300025903 Bacteria 1638
543 Ga0207680_10336377 3300025903 Unclassified 1058
544 Ga0207647_10629931 3300025904 Bacteria 589
545 Ga0207647_10739251 3300025904 Unclassified 533
546 Ga0207699_10490679 3300025906 Bacteria 886
547 Ga0207645_10001905 3300025907 Bacteria 16838
548 Ga0207645_10014161 3300025907 Bacteria 5343
549 Ga0207645_10029920 3300025907 Bacteria 3510
550 Ga0207645_10109279 3300025907 Bacteria 1789
551 Ga0207645_10601571 3300025907 Bacteria 746
552 Ga0207643_10008747 3300025908 Bacteria 5433
553 Ga0207643_10331018 3300025908 Bacteria 953
554 Ga0207643_10578907 3300025908 Bacteria 722
555 Ga0207684_10855446 3300025910 Unclassified 766
556 Ga0207654_10245785 3300025911 Bacteria 1197
557 Ga0207654_11184639 3300025911 Bacteria 557
558 Ga0207707_10003438 3300025912 Bacteria 14045
559 Ga0207707_10005650 3300025912 Bacteria 10944
560 Ga0207707_10010086 3300025912 Bacteria 8197
561 Ga0207707_10018855 3300025912 Bacteria 6017
562 Ga0207707_10040421 3300025912 Bacteria 4073
563 Ga0207707_10131322 3300025912 Bacteria 2190
564 Ga0207707_10281135 3300025912 Bacteria 1442
565 Ga0207707_10312658 3300025912 Bacteria 1357
566 Ga0207707_10388781 3300025912 Bacteria 1198
567 Ga0207707_10574889 3300025912 Bacteria 956
568 Ga0207695_10012421 3300025913 Bacteria 10226
569 Ga0207695_10013678 3300025913 Bacteria 9662
570 Ga0207695_10031661 3300025913 Bacteria 5797
571 Ga0207695_10190596 3300025913 Bacteria 1968
572 Ga0207695_10191149 3300025913 Bacteria 1965
573 Ga0207695_10276492 3300025913 Bacteria 1574
574 Ga0207695_10321107 3300025913 Bacteria 1438
575 Ga0207695_10912248 3300025913 Bacteria 758
576 Ga0207695_11633560 3300025913 Unclassified 525
577 Ga0207671_10261188 3300025914 Bacteria 1363
578 Ga0207693_10162820 3300025915 Bacteria 1755
579 Ga0207663_10183838 3300025916 Bacteria 1495
580 Ga0207663_10620638 3300025916 Bacteria 851
581 Ga0207663_11003000 3300025916 Unclassified 670
582 Ga0207660_10000703 3300025917 Bacteria 22314
583 Ga0207660_10018188 3300025917 Bacteria 4680
584 Ga0207660_10037347 3300025917 Bacteria 3384
585 Ga0207660_10099588 3300025917 Bacteria 2169
586 Ga0207660_10333951 3300025917 Bacteria 1212
587 Ga0207660_10560043 3300025917 Bacteria 930
588 Ga0207660_10633902 3300025917 Bacteria 871
589 Ga0207660_10809413 3300025917 Unclassified 765
590 Ga0207660_10991325 3300025917 Bacteria 685
591 Ga0207662_10006257 3300025918 Bacteria 6412
592 Ga0207662_10134665 3300025918 Bacteria 1561
593 Ga0207662_10150334 3300025918 Unclassified 1480
594 Ga0207662_10782780 3300025918 Unclassified 672
595 Ga0207657_10184080 3300025919 Bacteria 1688
596 Ga0207657_10690302 3300025919 Bacteria 793
597 Ga0207649_10014495 3300025920 Bacteria 4416
598 Ga0207649_10048714 3300025920 Bacteria 2614
599 Ga0207649_10090644 3300025920 Bacteria 2001
600 Ga0207649_10258452 3300025920 Bacteria 1257
601 Ga0207649_11358093 3300025920 Unclassified 562
602 Ga0207652_10010931 3300025921 Bacteria 7317
603 Ga0207652_10014885 3300025921 Bacteria 6307
604 Ga0207652_10090101 3300025921 Bacteria 2694
605 Ga0207652_10099980 3300025921 Bacteria 2560
606 Ga0207652_10273977 3300025921 Bacteria 1522
607 Ga0207652_10433014 3300025921 Bacteria 1186
608 Ga0207646_10064781 3300025922 Bacteria 3262
609 Ga0207681_10007214 3300025923 Bacteria 6815
610 Ga0207681_10008916 3300025923 Bacteria 6123
611 Ga0207681_10332686 3300025923 Bacteria 1211
612 Ga0207694_10024692 3300025924 Bacteria 4566
613 Ga0207694_10068903 3300025924 Bacteria 2763
614 Ga0207694_10100861 3300025924 Bacteria 2287
615 Ga0207650_10062578 3300025925 Unclassified 2781
616 Ga0207650_10226584 3300025925 Unclassified 1506
617 Ga0207650_10338977 3300025925 Bacteria 1234
618 Ga0207650_10643389 3300025925 Unclassified 893
619 Ga0207650_10811688 3300025925 Bacteria 793
620 Ga0207650_10985697 3300025925 Unclassified 717
621 Ga0207650_11059396 3300025925 Bacteria 690
622 Ga0207650_11775526 3300025925 Bacteria 522
623 Ga0207659_10097638 3300025926 Bacteria 2207
624 Ga0207659_11006585 3300025926 Bacteria 717
625 Ga0207659_11092376 3300025926 Unclassified 686
626 Ga0207659_11571544 3300025926 Bacteria 562
627 Ga0207687_10224465 3300025927 Bacteria 1481
628 Ga0207687_10245158 3300025927 Unclassified 1422
629 Ga0207700_10621579 3300025928 Unclassified 962
630 Ga0207700_11118009 3300025928 Bacteria 704
631 Ga0207664_10088592 3300025929 Bacteria 2533
632 Ga0207664_10431217 3300025929 Bacteria 1175
633 Ga0207664_10859536 3300025929 Unclassified 815
634 Ga0207664_11231088 3300025929 Bacteria 667
635 Ga0207664_12000526 3300025929 Bacteria 502
636 Ga0207644_10046513 3300025931 Bacteria 3092
637 Ga0207644_10181094 3300025931 Bacteria 1651
638 Ga0207644_11007338 3300025931 Bacteria 699
639 Ga0207644_11007618 3300025931 Unclassified 699
640 Ga0207690_10265003 3300025932 Bacteria 1332
641 Ga0207690_10321014 3300025932 Bacteria 1217
642 Ga0207690_10378788 3300025932 Bacteria 1124
643 Ga0207690_11136586 3300025932 Bacteria 651
644 Ga0207706_10000408 3300025933 Bacteria 46179
645 Ga0207706_10039012 3300025933 Bacteria 4212
646 Ga0207706_10124453 3300025933 Bacteria 2268
647 Ga0207706_11061707 3300025933 Unclassified 678
648 Ga0207686_10103973 3300025934 Unclassified 1901
649 Ga0207686_10106134 3300025934 Bacteria 1885
650 Ga0207686_10116316 3300025934 Bacteria 1812
651 Ga0207686_10325239 3300025934 Bacteria 1150
652 Ga0207686_10740038 3300025934 Bacteria 784
653 Ga0207709_10358021 3300025935 Bacteria 1104
654 Ga0207670_10075672 3300025936 Bacteria 2341
655 Ga0207670_10310497 3300025936 Bacteria 1238
656 Ga0207670_10315149 3300025936 Bacteria 1229
657 Ga0207670_10493507 3300025936 Bacteria 993
658 Ga0207670_10991395 3300025936 Bacteria 707
659 Ga0207669_10001837 3300025937 Bacteria 8994
660 Ga0207669_10127797 3300025937 Bacteria 1740
661 Ga0207669_10211768 3300025937 Unclassified 1415
662 Ga0207669_10223893 3300025937 Bacteria 1383
663 Ga0207669_10281055 3300025937 Unclassified 1255
664 Ga0207669_10437760 3300025937 Unclassified 1033
665 Ga0207669_10740043 3300025937 Bacteria 811
666 Ga0207669_10800058 3300025937 Bacteria 782
667 Ga0207704_10015385 3300025938 Bacteria 3898
668 Ga0207704_10179540 3300025938 Bacteria 1528
669 Ga0207704_11006809 3300025938 Bacteria 705
670 Ga0207691_10004629 3300025940 Bacteria 13319
671 Ga0207691_10031368 3300025940 Bacteria 4961
672 Ga0207691_10176449 3300025940 Unclassified 1869
673 Ga0207711_10110327 3300025941 Unclassified 2446
674 Ga0207711_10176623 3300025941 Bacteria 1940
675 Ga0207711_10188634 3300025941 Bacteria 1878
676 Ga0207711_10533597 3300025941 Bacteria 1094
677 Ga0207689_10003861 3300025942 Bacteria 13658
678 Ga0207689_10124705 3300025942 Unclassified 2119
679 Ga0207661_10003879 3300025944 Bacteria 10425
680 Ga0207661_10088512 3300025944 Bacteria 2574
681 Ga0207661_10218177 3300025944 Bacteria 1685
682 Ga0207661_10953348 3300025944 Bacteria 790
683 Ga0207679_10021972 3300025945 Bacteria 4337
684 Ga0207679_10039129 3300025945 Bacteria 3384
685 Ga0207679_10118476 3300025945 Bacteria 2103
686 Ga0207679_10157202 3300025945 Bacteria 1858
687 Ga0207679_10233404 3300025945 Bacteria 1555
688 Ga0207679_10244338 3300025945 Bacteria 1523
689 Ga0207679_10294898 3300025945 Bacteria 1395
690 Ga0207679_10388042 3300025945 Unclassified 1226
691 Ga0207667_10064668 3300025949 Bacteria 3817
692 Ga0207667_10066030 3300025949 Bacteria 3772
693 Ga0207667_10074535 3300025949 Bacteria 3525
694 Ga0207667_10368470 3300025949 Bacteria 1464
695 Ga0207667_10382710 3300025949 Bacteria 1433
696 Ga0207651_10034116 3300025960 Bacteria 3291
697 Ga0207651_10125077 3300025960 Bacteria 1958
698 Ga0207712_10029190 3300025961 Bacteria 3697
699 Ga0207712_10043828 3300025961 Bacteria 3089
700 Ga0207712_10578037 3300025961 Bacteria 969
701 Ga0207668_10068922 3300025972 Bacteria 2517
702 Ga0207668_10098143 3300025972 Bacteria 2170
703 Ga0207668_10585397 3300025972 Bacteria 970
704 Ga0207668_11220240 3300025972 Bacteria 676
705 Ga0207640_10079882 3300025981 Unclassified 2231
706 Ga0207640_10088282 3300025981 Bacteria 2140
707 Ga0207640_11743476 3300025981 Bacteria 562
708 Ga0207640_12047612 3300025981 Unclassified 519
709 Ga0207640_12075820 3300025981 Bacteria 515
710 Ga0207658_10127988 3300025986 Bacteria 2035
711 Ga0207658_10726221 3300025986 Bacteria 899
712 Ga0207677_10197249 3300026023 Bacteria 1597
713 Ga0207703_10112001 3300026035 Unclassified 2330
714 Ga0207703_10245145 3300026035 Bacteria 1612
715 Ga0207703_10329451 3300026035 Bacteria 1400
716 Ga0207639_10238438 3300026041 Bacteria 1580
717 Ga0207639_10653040 3300026041 Bacteria 973
718 Ga0207639_11303831 3300026041 Unclassified 681
719 Ga0207639_11597593 3300026041 Unclassified 612
720 Ga0207639_11689678 3300026041 Bacteria 593
721 Ga0207678_10286481 3300026067 Bacteria 1414
722 Ga0207678_10976224 3300026067 Unclassified 750
723 Ga0207678_11052892 3300026067 Bacteria 720
724 Ga0207678_11091947 3300026067 Bacteria 706
725 Ga0207678_11300867 3300026067 Bacteria 643
726 Ga0207708_10003989 3300026075 Bacteria 10862
727 Ga0207708_10025055 3300026075 Bacteria 4512
728 Ga0207708_10151037 3300026075 Bacteria 1828
729 Ga0207708_10217341 3300026075 Bacteria 1530
730 Ga0207708_10467713 3300026075 Bacteria 1052
731 Ga0207708_10720570 3300026075 Bacteria 854
732 Ga0207708_11267497 3300026075 Bacteria 645
733 Ga0207708_11520013 3300026075 Bacteria 588
734 Ga0207708_11521449 3300026075 Bacteria 588
735 Ga0207702_10002203 3300026078 Bacteria 18674
736 Ga0207702_10142743 3300026078 Bacteria 2169
737 Ga0207702_10429884 3300026078 Unclassified 1278
738 Ga0207702_10455085 3300026078 Bacteria 1242
739 Ga0207702_10484179 3300026078 Bacteria 1204
740 Ga0207702_11965232 3300026078 Bacteria 576
741 Ga0207641_10021682 3300026088 Bacteria 5279
742 Ga0207641_10092642 3300026088 Unclassified 2647
743 Ga0207641_10481872 3300026088 Bacteria 1202
744 Ga0207641_12208798 3300026088 Bacteria 550
745 Ga0207648_10007449 3300026089 Bacteria 10759
746 Ga0207648_10014257 3300026089 Bacteria 7348
747 Ga0207648_10023633 3300026089 Bacteria 5503
748 Ga0207648_10200547 3300026089 Unclassified 1769
749 Ga0207648_10382988 3300026089 Unclassified 1272
750 Ga0207676_10084260 3300026095 Unclassified 2591
751 Ga0207676_10084495 3300026095 Bacteria 2588
752 Ga0207676_11713165 3300026095 Unclassified 627
753 Ga0207674_10000409 3300026116 Bacteria 55809
754 Ga0207674_10229908 3300026116 Unclassified 1802
755 Ga0207674_10916773 3300026116 Bacteria 844
756 Ga0207674_11293328 3300026116 Bacteria 699
757 Ga0207675_100000465 3300026118 Bacteria 39473
758 Ga0207675_100140224 3300026118 Unclassified 2296
759 Ga0207675_100249263 3300026118 Bacteria 1718
760 Ga0207675_101340517 3300026118 Bacteria 736
761 Ga0207683_10063220 3300026121 Bacteria 3261
762 Ga0207683_10161213 3300026121 Bacteria 2027
763 Ga0207683_10208750 3300026121 Bacteria 1777
764 Ga0207683_10255428 3300026121 Unclassified 1600
765 Ga0207698_10289462 3300026142 Bacteria 1519
766 Ga0207698_10563882 3300026142 Bacteria 1118
767 Ga0207698_10799244 3300026142 Bacteria 945
768 Ga0207698_10980488 3300026142 Bacteria 855
769 Ga0207698_11071632 3300026142 Bacteria 818
770 Ga0207698_12314653 3300026142 Bacteria 549
771 Ga0209179_1023452 3300027512 Bacteria 1218
772 Ga0209999_1024916 3300027543 Bacteria 1104
773 Ga0209983_1019372 3300027665 Unclassified 1415
774 Ga0209971_1028072 3300027682 Bacteria 1346
775 Ga0209971_1154954 3300027682 Bacteria 565
776 Ga0209974_10175170 3300027876 Unclassified 783
777 Ga0207428_10006774 3300027907 Bacteria 10512
778 Ga0207428_10284666 3300027907 Bacteria 1226
779 Ga0207428_10450171 3300027907 Bacteria 939
780 Ga0207428_10637876 3300027907 Bacteria 765
781 Ga0207428_11274836 3300027907 Unclassified 510
782 Ga0268266_10080349 3300028379 Bacteria 2841
783 Ga0268266_10356792 3300028379 Unclassified 1375
784 Ga0268266_10545305 3300028379 Bacteria 1111
785 Ga0268265_10031919 3300028380 Bacteria 3809
786 Ga0268265_10036489 3300028380 Bacteria 3601
787 Ga0268265_10076847 3300028380 Bacteria 2621
788 Ga0268265_10096964 3300028380 Bacteria 2371
789 Ga0268265_11935295 3300028380 Bacteria 597
790 Ga0268264_10176461 3300028381 Bacteria 1937
791 Ga0268264_10265122 3300028381 Bacteria 1602
792 Ga0268264_10291916 3300028381 Bacteria 1532
793 Ga0268264_10920260 3300028381 Bacteria 878
794 Ga0268264_11005360 3300028381 Bacteria 840
795 Ga0268264_11127087 3300028381 Bacteria 793
796 Ga0268264_11492914 3300028381 Bacteria 687
797 Ga0307408_100009421 3300031548 Bacteria 6439
798 Ga0307408_100180160 3300031548 Bacteria 1694
799 Ga0307408_100407952 3300031548 Bacteria 1168
800 Ga0307408_100526797 3300031548 Bacteria 1039
801 Ga0307408_100724947 3300031548 Bacteria 896
802 Ga0307408_101199299 3300031548 Unclassified 708
803 Ga0307405_10026754 3300031731 Bacteria 3334
804 Ga0307405_10092204 3300031731 Bacteria 2009
805 Ga0307405_10249347 3300031731 Bacteria 1320
806 Ga0307405_11481459 3300031731 Bacteria 596
807 Ga0307413_10061206 3300031824 Bacteria 2322
808 Ga0307413_10632315 3300031824 Bacteria 880
809 Ga0307410_10045668 3300031852 Bacteria 2918
810 Ga0307410_10073912 3300031852 Bacteria 2372
811 Ga0307410_11001556 3300031852 Bacteria 720
812 Ga0307406_10006900 3300031901 Bacteria 6290
813 Ga0307406_10008381 3300031901 Bacteria 5764
814 Ga0307406_10173244 3300031901 Bacteria 1564
815 Ga0307406_10443531 3300031901 Bacteria 1039
816 Ga0307406_10846516 3300031901 Bacteria 775
817 Ga0307406_11915035 3300031901 Unclassified 529
818 Ga0307407_10070294 3300031903 Bacteria 2080
819 Ga0307407_10206686 3300031903 Bacteria 1319
820 Ga0307407_10213747 3300031903 Bacteria 1300
821 Ga0307412_10046788 3300031911 Bacteria 2837
822 Ga0307412_10084974 3300031911 Bacteria 2198
823 Ga0307412_12142669 3300031911 Bacteria 520
824 Ga0307409_100230484 3300031995 Bacteria 1678
825 Ga0307409_100280033 3300031995 Bacteria 1541
826 Ga0307409_100426993 3300031995 Bacteria 1273
827 Ga0307409_100522734 3300031995 Unclassified 1160
828 Ga0307409_100589576 3300031995 Bacteria 1097
829 Ga0307409_100968499 3300031995 Bacteria 867
830 Ga0307409_101316064 3300031995 Bacteria 748
831 Ga0307409_102316058 3300031995 Unclassified 566
832 Ga0307416_100033626 3300032002 Bacteria 3890
833 Ga0307416_100039250 3300032002 Bacteria 3663
834 Ga0307416_100085451 3300032002 Bacteria 2685
835 Ga0307416_100220117 3300032002 Unclassified 1820
836 Ga0307416_100383488 3300032002 Bacteria 1436
837 Ga0307416_100729168 3300032002 Unclassified 1082
838 Ga0307414_10017383 3300032004 Bacteria 4399
839 Ga0307414_11811054 3300032004 Unclassified 570
840 Ga0307411_10061921 3300032005 Bacteria 2493
841 Ga0307411_10155094 3300032005 Bacteria 1707
842 Ga0307411_10200336 3300032005 Bacteria 1532
843 Ga0307411_10309900 3300032005 Bacteria 1270
844 Ga0307411_10400691 3300032005 Bacteria 1134
845 Ga0307411_10518440 3300032005 Bacteria 1011
846 Ga0307411_10601076 3300032005 Unclassified 946
847 Ga0307415_100091783 3300032126 Bacteria 2200
848 Ga0307415_100233256 3300032126 Bacteria 1483
849 Ga0307415_100785190 3300032126 Unclassified 868
850 Ga0307415_100797020 3300032126 Bacteria 862
851 Ga0307415_101771926 3300032126 Bacteria 597
852 Ga0307415_101848478 3300032126 Bacteria 585
853 Ga0373934_0000316 3300035086 Bacteria 16956
854 Ga0373934_0005008 3300035086 Bacteria 4912
855 Ga0373923_0037582 3300035111 Bacteria 1981
856 Ga0373941_0017239 3300035115 Bacteria 1976
857 Ga0373941_0159510 3300035115 Bacteria 833
858 Ga0373953_0010281 3300035117 Bacteria 3251
859 Ga0373954_0041165 3300035118 Bacteria 2154
860 Ga0373954_0249666 3300035118 Bacteria 873
861 Ga0373956_0003435 3300035119 Bacteria 6378
862 Ga0373957_0001241 3300035120 Bacteria 6817
863 Ga0373957_0006304 3300035120 Bacteria 3729
864 Ga0373957_0040056 3300035120 Bacteria 1760
865 Ga0373946_0504315 3300035171 Unclassified 621
866 Ga0373955_0013484 3300035172 Bacteria 3955
867 Ga0373955_0039466 3300035172 Bacteria 2520
868 Ga0373961_0012144 3300035241 Bacteria 2151
869 Ga0373962_0066673 3300035242 Bacteria 1068
870 Ga0373962_0136474 3300035242 Bacteria 794
871 Ga0373924_0036629 3300035410 Bacteria 1995
872 Ga0373924_0216256 3300035410 Bacteria 846
873 Ga0373935_0038006 3300035692 Bacteria 3013
874 Ga0373935_1180480 3300035692 Unclassified 570
875 Ga0373933_0001497 3300035724 Bacteria 13670
876 Ga0373933_0007270 3300035724 Bacteria 6039
877 Ga0373933_0009562 3300035724 Bacteria 5293
878 Ga0373947_0453805 3300035725 Bacteria 868
879 Ga0373947_0477084 3300035725 Bacteria 846
880 Ga0373937_0000180 3300036401 Bacteria 61995
881 Ga0373937_0007779 3300036401 Bacteria 9293
882 Ga0373937_0013647 3300036401 Bacteria 7158
883 Ga0373925_0743862 3300037068 Bacteria 808
884 Ga0436365_0622275 3300039437 Bacteria 1159
885 Ga0436363_1492189 3300039450 Unclassified 737
886 Ga0451797_0717853 3300041453 Unclassified 623
887 Ga0451853_2205769 3300041512 Unclassified 788
888 Ga0450923_075760 3300042125 Bacteria 751
889 Ga0450923_146026 3300042125 Unclassified 570
890 Ga0450894_001860 3300042131 Bacteria 2929
891 Ga0450895_000873 3300042132 Bacteria 1932
892 Ga0450896_006195 3300042133 Bacteria 1638
893 Ga0450898_038252 3300042134 Bacteria 900
894 Ga0450905_026648 3300042142 Bacteria 875
895 Ga0450905_063944 3300042142 Bacteria 619
896 Ga0439464_0219741 3300042439 Unclassified 609
897 Ga0439460_0004748 3300042461 Unclassified 3315
898 Ga0439460_0245601 3300042461 Bacteria 618
899 Ga0450918_005238 3300042531 Bacteria 2338
900 Ga0466957_0075125 3300044842 Bacteria 2097
901 Ga0451576_0008719 3300045051 Bacteria 11866
902 Ga0451576_0414185 3300045051 Bacteria 1414
903 Ga0451576_2551448 3300045051 Unclassified 522
904 Ga0466967_0302193 3300045976 Unclassified 1540
905 Ga0495592_0019205 3300046454 Bacteria 5199
906 Ga0495629_0052255 3300046459 Bacteria 2859
907 Ga0495629_0473931 3300046459 Bacteria 846
908 Ga0495629_0632395 3300046459 Unclassified 714
909 Ga0495629_0939889 3300046459 Unclassified 565
910 Ga0495651_0043480 3300046462 Bacteria 3485
911 Ga0495651_0050780 3300046462 Bacteria 3199
912 Ga0495651_0290938 3300046462 Bacteria 1099
913 Ga0495653_0003277 3300046463 Bacteria 12993
914 Ga0495580_0015600 3300046472 Bacteria 5725
915 Ga0495580_0679522 3300046472 Bacteria 675
916 Ga0495582_0611822 3300046473 Unclassified 630
917 Ga0495639_0003950 3300046475 Bacteria 6369
918 Ga0495639_0742944 3300046475 Bacteria 508
919 Ga0495664_0019565 3300046477 Bacteria 3895
920 Ga0495594_0003213 3300046499 Bacteria 8467
921 Ga0495594_0030960 3300046499 Bacteria 2898
922 Ga0495594_0066409 3300046499 Bacteria 2001
923 Ga0495608_0038178 3300046511 Bacteria 3226
924 Ga0495618_0039093 3300046514 Bacteria 2983
925 Ga0495618_0044023 3300046514 Bacteria 2816
926 Ga0495628_0002358 3300046516 Bacteria 17044
927 Ga0495628_0106768 3300046516 Bacteria 2156
928 Ga0495630_0008905 3300046517 Bacteria 7206
929 Ga0495630_0240067 3300046517 Unclassified 1385
930 Ga0495630_0596412 3300046517 Unclassified 847
931 Ga0495652_0031427 3300046529 Bacteria 4650
932 Ga0495652_0044036 3300046529 Bacteria 3844
933 Ga0495665_0125388 3300046531 Bacteria 1345
934 Ga0495665_0252404 3300046531 Bacteria 908
935 Ga0495665_0425999 3300046531 Unclassified 672
936 Ga0495640_0038451 3300046533 Bacteria 3366
937 Ga0495640_0137148 3300046533 Bacteria 1579
938 Ga0495586_0019104 3300046535 Bacteria 3646
939 Ga0495586_0229509 3300046535 Bacteria 1056
940 Ga0495587_0004359 3300046536 Bacteria 9340
941 Ga0495587_0102019 3300046536 Bacteria 1652
942 Ga0495645_0002536 3300046543 Bacteria 12393
943 Ga0495645_0025945 3300046543 Bacteria 4254
944 Ga0495633_0355175 3300046558 Bacteria 664
945 Ga0495667_0016420 3300046559 Bacteria 5003
946 Ga0495634_0129104 3300046642 Bacteria 1613
947 Ga0495634_0465861 3300046642 Unclassified 744
948 Ga0495635_0000657 3300046663 Bacteria 22156
949 Ga0495657_0008266 3300046675 Bacteria 7973
950 Ga0495599_0007165 3300046678 Bacteria 6750
951 Ga0495599_0046119 3300046678 Bacteria 2733
952 Ga0495599_0460552 3300046678 Bacteria 752
953 Ga0495623_0027731 3300046679 Unclassified 3646
954 Ga0495623_0033795 3300046679 Bacteria 3281
955 Ga0495646_0017361 3300046680 Bacteria 4565
956 Ga0495613_1082349 3300046689 Bacteria 512
957 Ga0495600_0018360 3300046809 Bacteria 4456
958 Ga0495600_0193468 3300046809 Bacteria 1307
959 Ga0495581_0398222 3300047315 Bacteria 803
960 Ga0495604_0024742 3300047317 Bacteria 4790
961 Ga0495674_0020462 3300047319 Bacteria 6124
962 Ga0495674_0900810 3300047319 Unclassified 683
963 Ga0495680_0031480 3300047322 Bacteria 4317
964 Ga0495680_0291277 3300047322 Bacteria 1148
965 Ga0495675_0022305 3300047444 Bacteria 4035
966 Ga0495675_0023848 3300047444 Bacteria 3899
967 Ga0495684_0001927 3300047471 Bacteria 16636
968 Ga0495593_0012603 3300047673 Bacteria 4828
969 Ga0495602_0018922 3300048088 Bacteria 6856
970 Ga0495602_0499306 3300048088 Bacteria 851
971 Ga0496101_1233573 3300048904 Unclassified 585
972 Ga0496102_0301299 3300048905 Unclassified 1511
973 Ga0496102_0593183 3300048905 Unclassified 1031
974 Ga0496102_1515932 3300048905 Unclassified 589
975 Ga0496103_0469817 3300048906 Unclassified 806
976 Ga0496103_0965399 3300048906 Bacteria 532
977 Ga0496106_0435179 3300048909 Unclassified 1054
978 Ga0496107_0513411 3300048910 Bacteria 889
979 Ga0496107_0819219 3300048910 Unclassified 681
980 Ga0496109_1147471 3300048912 Bacteria 714
981 Ga0496109_1905317 3300048912 Bacteria 527
982 Ga0496113_0854843 3300048916 Bacteria 721
983 Ga0496114_0593195 3300048917 Bacteria 977
984 Ga0501291_051500 3300049514 Unclassified 751
985 Ga0501298_096637 3300049521 Bacteria 669
986 Ga0501299_010437 3300049522 Unclassified 1551
987 Ga0501031_0177196 3300049568 Bacteria 1393
988 Ga0501032_0144718 3300049569 Bacteria 1565
989 Ga0501033_0063765 3300049570 Bacteria 2712
990 Ga0501033_0146073 3300049570 Bacteria 1708
991 Ga0501034_0065584 3300049571 Bacteria 3644
992 Ga0501036_0672735 3300049572 Bacteria 856
993 Ga0501037_0108048 3300049573 Bacteria 2005
994 Ga0501038_1179318 3300049574 Unclassified 557
995 Ga0501042_1136829 3300049578 Bacteria 569
996 Ga0501043_0279762 3300049579 Bacteria 1279
997 Ga0501043_0293776 3300049579 Bacteria 1243
998 Ga0501046_0343285 3300049580 Unclassified 1085
999 Ga0501047_0000486 3300049581 Bacteria 43236
1000 Ga0501048_0195447 3300049582 Bacteria 1434
1001 Ga0501068_0058776 3300049584 Bacteria 2334
1002 Ga0501068_0805735 3300049584 Bacteria 616
1003 Ga0501070_0813390 3300049586 Unclassified 733
1004 Ga0501070_0861615 3300049586 Bacteria 708
1005 Ga0501071_0862557 3300049587 Unclassified 698
1006 Ga0501071_1225852 3300049587 Bacteria 580
1007 Ga0501073_0012846 3300049589 Bacteria 6104
1008 Ga0501073_0137986 3300049589 Bacteria 1690
1009 Ga0501074_0217479 3300049590 Bacteria 1361
1010 Ga0501075_0868627 3300049591 Unclassified 686
1011 Ga0501076_0355473 3300049592 Bacteria 1203
1012 Ga0501202_173957 3300049652 Bacteria 577
1013 Ga0501209_061704 3300049656 Unclassified 1048
1014 Ga0501217_073324 3300049661 Unclassified 935
1015 Ga0501223_010396 3300049663 Bacteria 1874
1016 Ga0501235_028220 3300049669 Bacteria 1261
1017 Ga0501235_097943 3300049669 Bacteria 714
1018 Ga0501243_006631 3300049675 Bacteria 1758
1019 Ga0501249_024424 3300049679 Unclassified 1332
1020 Ga0501225_0141373 3300049705 Unclassified 728
1021 Ga0501080_0027094 3300049742 Bacteria 5329
1022 Ga0501081_0430220 3300049743 Bacteria 979
1023 Ga0501081_1501229 3300049743 Unclassified 512
1024 Ga0501266_097190 3300049763 Unclassified 518
1025 Ga0501268_111874 3300049765 Bacteria 597
1026 Ga0501271_035448 3300049768 Unclassified 632
1027 Ga0501035_0003479 3300049822 Bacteria 15065
1028 Ga0501044_0007425 3300049823 Bacteria 12058
1029 Ga0501212_019523 3300049851 Bacteria 1039
1030 nmdc:mga05p37_382511_c1 3300050507 Bacteria 1649
1031 nmdc:mga05p37_5272_c1 3300050507 Bacteria 11971
1032 nmdc:mga05p37_52828_c1 3300050507 Bacteria 4997
1033 nmdc:mga05p37_544801_c1 3300050507 Bacteria 1322
1034 nmdc:mga09592_1010477_c1 3300050508 Unclassified 695
1035 nmdc:mga09592_1185702_c1 3300050508 Archaea 632
1036 nmdc:mga09592_1237513_c1 3300050508 Bacteria 616
1037 nmdc:mga09592_164360_c1 3300050508 Bacteria 1918
1038 nmdc:mga09592_168714_c1 3300050508 Viruses 1892
1039 nmdc:mga09592_482249_c1 3300050508 Bacteria 1068
1040 nmdc:mga09592_75505_c1 3300050508 Bacteria 2865
1041 nmdc:mga09592_84071_c1 3300050508 Bacteria 2713
1042 nmdc:mga0qj67_104142_c1 3300050509 Bacteria 2289
1043 nmdc:mga0qj67_109062_c1 3300050509 Unclassified 2234
1044 nmdc:mga0qj67_173014_c1 3300050509 Bacteria 1754
1045 nmdc:mga0qj67_275996_c1 3300050509 Bacteria 1363
1046 nmdc:mga0qj67_380037_c1 3300050509 Unclassified 1141
1047 nmdc:mga0qj67_432240_c1 3300050509 Bacteria 1061
1048 nmdc:mga06r32_1100513_c1 3300050510 Bacteria 744
1049 nmdc:mga06r32_68417_c1 3300050510 Bacteria 3430
1050 nmdc:mga06r32_718970_c1 3300050510 Viruses 963
1051 nmdc:mga06r32_782103_c1 3300050510 Bacteria 916
1052 nmdc:mga08y16_10166_c1 3300050511 Bacteria 9878
1053 nmdc:mga08y16_140131_c1 3300050511 Bacteria 2514
1054 nmdc:mga08y16_1533807_c1 3300050511 Bacteria 626
1055 nmdc:mga08y16_156096_c1 3300050511 Bacteria 2371
1056 nmdc:mga08y16_1718529_c1 3300050511 Unclassified 582
1057 nmdc:mga08y16_177993_c1 3300050511 Bacteria 2209
1058 nmdc:mga08y16_235379_c1 3300050511 Bacteria 1894
1059 nmdc:mga08y16_2481_c1 3300050511 Bacteria 18950
1060 nmdc:mga08y16_516029_c1 3300050511 Bacteria 1212
1061 nmdc:mga08y16_7482_c2 3300050511 Bacteria 8665
1062 nmdc:mga08y16_819980_c1 3300050511 Bacteria 922
1063 nmdc:mga08y16_921435_c1 3300050511 Bacteria 859
1064 nmdc:mga0n895_1044976_c1 3300050512 Bacteria 796
1065 nmdc:mga0n895_11937_c1 3300050512 Bacteria 7774
1066 nmdc:mga0n895_30730_c1 3300050512 Bacteria 5136
1067 nmdc:mga0n895_36051_c1 3300050512 Bacteria 4773
1068 nmdc:mga0n895_372560_c1 3300050512 Bacteria 1445
1069 nmdc:mga0n895_461471_c1 3300050512 Bacteria 1282
1070 nmdc:mga0n895_93559_c1 3300050512 Bacteria 3009
1071 nmdc:mga0n895_97132_c1 3300050512 Bacteria 2951
1072 nmdc:mga0rr50_10939_c1 3300050513 Bacteria 5788
1073 nmdc:mga0rr50_258090_c1 3300050513 Unclassified 1449
1074 nmdc:mga0rr50_33512_c1 3300050513 Bacteria 3670
1075 nmdc:mga08x19_115614_c1 3300050514 Bacteria 1793
1076 nmdc:mga08x19_28934_c1 3300050514 Bacteria 3474
1077 nmdc:mga08x19_29578_c1 3300050514 Bacteria 3436
1078 nmdc:mga08x19_62965_c1 3300050514 Bacteria 2406
1079 nmdc:mga08x19_706_c1 3300050514 Bacteria 21354
1080 nmdc:mga0a205_167649_c1 3300050515 Bacteria 2092
1081 nmdc:mga0a205_454406_c1 3300050515 Bacteria 1141
1082 nmdc:mga0a205_57588_c1 3300050515 Bacteria 3752
1083 Ga0495601_0011930 3300053077 Bacteria 5209
1084 Ga0495612_0005711 3300053078 Bacteria 5139
1085 Ga0495612_0545197 3300053078 Unclassified 534
1086 Ga0495595_0014535 3300053084 Bacteria 3343
1087 Ga0495595_0063483 3300053084 Unclassified 1734
1088 Ga0495595_0099304 3300053084 Bacteria 1404
1089 Ga0495619_0024748 3300053085 Bacteria 3851
1090 Ga0495619_0088790 3300053085 Bacteria 2091
1091 Ga0500646_0007640 3300053090 Bacteria 2763
1092 Ga0500555_034285 3300053103 Bacteria 1429
1093 Ga0501084_0434564 3300054114 Unclassified 1110
1094 Ga0501084_1430897 3300054114 Bacteria 579
1095 Ga0590071_189703 3300059421 Bacteria 540
1096 Ga0501082_0664916 3300060353 Bacteria 912
1097 Ga0501082_0710177 3300060353 Bacteria 880
1098 Ga0075428_101413534
1099 JGI24750J21931_1071927
1100 Ga0065712_10207806
1101 Ga0065712_10460842
1102 Ga0065715_10031719
1103 Ga0065715_10148693
1104 Ga0065715_10149918
1105 Ga0065715_10550346
1106 Ga0065707_10042451
1107 Ga0065707_10084700
1108 Ga0065707_10404930
1109 Ga0070676_10041369
1110 Ga0070676_10483915
1111 Ga0070683_100002086
1112 Ga0070683_100046487
1113 Ga0070683_100066183
1114 Ga0070683_100339086
1115 Ga0070683_100549862
1116 Ga0070683_100786922
1117 Ga0070683_100846785
1118 Ga0070690_100084527
1119 Ga0070690_100167273
1120 Ga0070690_100310975
1121 Ga0070690_100421583
1122 Ga0070670_100012997
1123 Ga0070670_100063917
1124 Ga0070670_100802918
1125 Ga0070677_10123616
1126 Ga0070677_10226139
1127 Ga0070677_10407804
1128 Ga0068869_100066536
1129 Ga0068869_100214378
1130 Ga0068869_100279930
1131 Ga0068869_100374996
1132 Ga0068869_100444555
1133 Ga0068869_100681237
1134 Ga0068869_100784520
1135 Ga0070666_10221512
1136 Ga0070666_10474004
1137 Ga0070680_100002241
1138 Ga0070680_100004937
1139 Ga0070680_100007133
1140 Ga0070680_100044158
1141 Ga0070680_100044415
1142 Ga0070680_100361003
1143 Ga0070680_101229158
1144 Ga0070680_101781736
1145 Ga0070682_100987647
1146 Ga0068868_100020990
1147 Ga0068868_100399637
1148 Ga0068868_102049559
1149 Ga0070660_100800577
1150 Ga0070660_101212736
1151 Ga0070689_100060698
1152 Ga0070689_100071555
1153 Ga0070689_100093021
1154 Ga0070689_100106303
1155 Ga0070689_100113726
1156 Ga0070689_100320109
1157 Ga0070689_100342238
1158 Ga0070689_100433794
1159 Ga0070691_10020238
1160 Ga0070691_10043247
1161 Ga0070687_100062272
1162 Ga0070687_100150404
1163 Ga0070661_100008191
1164 Ga0070661_100069046
1165 Ga0070661_100101198
1166 Ga0070661_100112612
1167 Ga0070692_10214392
1168 Ga0070692_10466249
1169 Ga0070668_100029427
1170 Ga0070668_100035546
1171 Ga0070668_100126558
1172 Ga0070668_100476860
1173 Ga0070668_101072926
1174 Ga0070668_101309346
1175 Ga0070669_100002529
1176 Ga0070669_100018592
1177 Ga0070669_100027616
1178 Ga0070669_100113389
1179 Ga0070669_100189934
1180 Ga0070675_100025332
1181 Ga0070675_100047910
1182 Ga0070675_100102666
1183 Ga0070675_100416648
1184 Ga0070675_100602711
1185 Ga0070675_100733816
1186 Ga0070675_100936278
1187 Ga0070675_101082218
1188 Ga0070675_101241096
1189 Ga0070675_102249599
1190 Ga0070671_100032506
1191 Ga0070671_100213679
1192 Ga0070671_100299636
1193 Ga0070671_100589272
1194 Ga0070671_100783330
1195 Ga0070671_101096522
1196 Ga0070671_101265171
1197 Ga0070674_100001417
1198 Ga0070674_100125889
1199 Ga0070674_100172191
1200 Ga0070674_100254364
1201 Ga0070674_100320912
1202 Ga0070674_100351377
1203 Ga0070673_100003041
1204 Ga0070673_100064212
1205 Ga0070673_100092869
1206 Ga0070673_100298929
1207 Ga0070673_100725821
1208 Ga0070673_101033233
1209 Ga0070688_100056715
1210 Ga0070688_100113170
1211 Ga0070688_100418806
1212 Ga0070688_100599506
1213 Ga0070688_100620257
1214 Ga0070659_100030011
1215 Ga0070659_100065538
1216 Ga0070659_101339756
1217 Ga0070659_101530121
1218 Ga0070667_100372077
1219 Ga0070667_101037455
1220 Ga0070703_10069968
1221 Ga0070709_10080313
1222 Ga0070714_100000710
1223 Ga0070714_100004748
1224 Ga0070714_100050961
1225 Ga0070714_100379378
1226 Ga0070714_100493958
1227 Ga0070713_100106515
1228 Ga0070713_100218906
1229 Ga0070710_10116749
1230 Ga0070701_10083457
1231 Ga0070701_10234220
1232 Ga0070701_10418983
1233 Ga0070701_10528744
1234 Ga0070701_11065431
1235 Ga0070711_100150582
1236 Ga0070705_100524346
1237 Ga0070700_100063293
1238 Ga0070700_100083624
1239 Ga0070700_100168231
1240 Ga0070700_100379738
1241 Ga0070700_100835321
1242 Ga0070700_101402987
1243 Ga0070694_100109395
1244 Ga0070694_100150414
1245 Ga0070694_100588737
1246 Ga0070694_101011880
1247 Ga0070708_100212874
1248 Ga0070663_100096438
1249 Ga0070663_100344670
1250 Ga0070678_100115533
1251 Ga0070678_100536864
1252 Ga0070678_100976215
1253 Ga0070678_101217444
1254 Ga0070662_100011662
1255 Ga0070662_100350668
1256 Ga0070662_100692344
1257 Ga0070662_100741458
1258 Ga0070681_10000342
1259 Ga0070681_10011023
1260 Ga0070681_10103920
1261 Ga0070681_10105551
1262 Ga0070681_10113051
1263 Ga0070681_10210284
1264 Ga0070681_10237995
1265 Ga0070681_11031710
1266 Ga0070681_11725407
1267 Ga0068867_100021225
1268 Ga0068867_100066064
1269 Ga0068867_100089077
1270 Ga0068867_100109009
1271 Ga0068867_100527888
1272 Ga0068867_100771992
1273 Ga0070685_10038931
1274 Ga0070685_11052117
1275 Ga0070685_11355104
1276 Ga0070706_101184401
1277 Ga0070706_101231951
1278 Ga0070707_100000847
1279 Ga0070698_100034959
1280 Ga0070698_100113784
1281 Ga0070698_100192933
1282 Ga0070698_100466415
1283 Ga0070699_100548583
1284 Ga0070699_101542076
1285 Ga0070679_100000592
1286 Ga0070679_100001118
1287 Ga0070679_100058766
1288 Ga0070679_100214910
1289 Ga0070679_100275634
1290 Ga0070679_101067207
1291 Ga0070684_100029898
1292 Ga0070684_100130751
1293 Ga0070684_100342419
1294 Ga0070684_100557591
1295 Ga0070684_100919682
1296 Ga0068853_100292641
1297 Ga0068853_100477617
1298 Ga0068853_100523238
1299 Ga0068853_100723839
1300 Ga0070672_100008778
1301 Ga0070672_100090254
1302 Ga0070672_100103623
1303 Ga0070672_100203331
1304 Ga0070672_101568295
1305 Ga0070686_100200104
1306 Ga0070686_100220594
1307 Ga0070686_100863905
1308 Ga0070686_100908098
1309 Ga0070686_101316202
1310 Ga0070695_100117186
1311 Ga0070695_100202863
1312 Ga0070695_100635315
1313 Ga0070695_101622887
1314 Ga0070696_100219881
1315 Ga0070696_100241048
1316 Ga0070696_100373846
1317 Ga0070696_100826381
1318 Ga0070696_100895233
1319 Ga0070696_101436232
1320 Ga0070693_100027787
1321 Ga0070693_100080972
1322 Ga0070665_100669810
1323 Ga0070665_101264087
1324 Ga0070665_101355074
1325 Ga0070704_100000322
1326 Ga0070704_100200497
1327 Ga0070704_100487438
1328 Ga0070704_100529686
1329 Ga0068855_100027285
1330 Ga0068855_100130722
1331 Ga0068855_100170964
1332 Ga0068855_100205759
1333 Ga0068855_100259252
1334 Ga0068855_100358161
1335 Ga0068855_100816213
1336 Ga0068855_102227016
1337 Ga0070664_100002183
1338 Ga0070664_100033249
1339 Ga0070664_100048698
1340 Ga0070664_100197174
1341 Ga0070664_100224902
1342 Ga0070664_100329573
1343 Ga0070664_100390388
1344 Ga0070664_100669164
1345 Ga0070664_100889539
1346 Ga0068857_100002781
1347 Ga0068857_100114558
1348 Ga0068857_100182775
1349 Ga0068854_100095922
1350 Ga0068854_100153677
1351 Ga0068854_100407108
1352 Ga0068854_100702582
1353 Ga0068854_100849174
1354 Ga0068856_100500424
1355 Ga0068856_102049809
1356 Ga0068856_102052519
1357 Ga0070702_100014361
1358 Ga0070702_100226042
1359 Ga0070702_100459936
1360 Ga0068852_100029515
1361 Ga0068852_100110078
1362 Ga0068852_100253314
1363 Ga0068852_100489871
1364 Ga0068852_100759577
1365 Ga0068852_100945520
1366 Ga0068852_102391699
1367 Ga0068859_100029089
1368 Ga0068859_100136554
1369 Ga0068859_100165336
1370 Ga0068859_100732076
1371 Ga0068859_100918713
1372 Ga0068859_101112044
1373 Ga0068859_101574771
1374 Ga0068864_100203494
1375 Ga0068866_10352367
1376 Ga0068866_10454837
1377 Ga0068866_10624442
1378 Ga0068866_10627093
1379 Ga0068861_100000927
1380 Ga0068861_100241076
1381 Ga0068861_100373365
1382 Ga0068861_101236700
1383 Ga0068861_101592895
1384 Ga0068851_10015005
1385 Ga0068851_10611950
1386 Ga0068870_11132698
1387 Ga0068863_100006098
1388 Ga0068863_100027035
1389 Ga0068863_100129568
1390 Ga0068863_100150122
1391 Ga0068863_100949741
1392 Ga0068858_100140634
1393 Ga0068858_100141487
1394 Ga0068858_100222378
1395 Ga0068858_100395335
1396 Ga0068858_101904571
1397 Ga0068860_100202344
1398 Ga0068860_100222106
1399 Ga0068860_100585280
1400 Ga0068860_100643566
1401 Ga0068860_101041100
1402 Ga0068862_100015543
1403 Ga0068862_100016152
1404 Ga0068862_100039998
1405 Ga0068862_100252259
1406 Ga0068862_100268524
1407 Ga0068862_100293663
1408 Ga0070717_10043334
1409 Ga0070716_100032905
1410 Ga0070712_100065137
1411 Ga0070712_100860294
1412 Ga0097621_100319091
1413 Ga0068871_101194731
1414 Ga0075428_100038452
1415 Ga0075428_100048210
1416 Ga0075428_100097034
1417 Ga0075428_100114502
1418 Ga0075428_100646604
1419 Ga0075430_100000594
1420 Ga0075430_100019500
1421 Ga0075430_100111634
1422 Ga0075430_100165779
1423 Ga0075430_100244070
1424 Ga0075430_100546939
1425 Ga0075431_100032277
1426 Ga0075431_100063668
1427 Ga0075431_100064715
1428 Ga0075431_100077660
1429 Ga0075431_100917341
1430 Ga0075433_10062472
1431 Ga0075433_10091182
1432 Ga0075433_10474650
1433 Ga0075434_100037433
1434 Ga0075434_100098308
1435 Ga0075434_100105715
1436 Ga0075434_100124865
1437 Ga0075434_100235190
1438 Ga0075434_101297603
1439 Ga0075429_100173676
1440 Ga0075429_100642554
1441 Ga0075429_100899584
1442 Ga0075429_101905810
1443 Ga0068865_100110044
1444 Ga0068865_100133777
1445 Ga0068865_100320414
1446 Ga0068865_100603501
1447 Ga0068865_101169871
1448 Ga0075436_100001520
1449 Ga0075436_100021677
1450 Ga0075436_100083802
1451 Ga0075436_100115888
1452 Ga0075436_100117389
1453 Ga0075436_100847292
1454 Ga0075436_101488418
1455 Ga0097620_100029090
1456 Ga0097620_100136557
1457 Ga0097620_100165323
1458 Ga0097620_100732041
1459 Ga0097620_100918705
1460 Ga0097620_101112013
1461 Ga0097620_101574791
1462 Ga0075435_100002075
1463 Ga0075435_100280985
1464 Ga0075435_100290957
1465 Ga0075435_100933311
1466 Ga0105240_10025295
1467 Ga0105240_10046001
1468 Ga0105240_10052246
1469 Ga0105240_10312827
1470 Ga0105240_10775442
1471 Ga0105240_11246417
1472 Ga0105240_11353283
1473 Ga0105240_11386489
1474 Ga0111539_10011043
1475 Ga0111539_10014759
1476 Ga0111539_10058539
1477 Ga0111539_10066641
1478 Ga0111539_10085927
1479 Ga0111539_10171481
1480 Ga0111539_10174533
1481 Ga0111539_10325848
1482 Ga0111539_10395232
1483 Ga0111539_10573181
1484 Ga0111539_11383741
1485 Ga0111539_11496300
1486 Ga0111539_12007438
1487 Ga0111539_12755336
1488 Ga0105245_10245447
1489 Ga0105245_10314354
1490 Ga0105245_11596279
1491 Ga0105245_11782600
1492 Ga0105247_10211533
1493 Ga0114129_10013420
1494 Ga0114129_10039221
1495 Ga0114129_10054878
1496 Ga0114129_10130190
1497 Ga0114129_10487053
1498 Ga0114129_10876435
1499 Ga0114129_13108249
1500 Ga0105243_10389537
1501 Ga0105243_10999418
1502 Ga0105243_11532342
1503 Ga0105243_13091397
1504 Ga0105241_10112663
1505 Ga0105241_10114120
1506 Ga0105241_10162164
1507 Ga0105241_10405415
1508 Ga0105241_11189078
1509 Ga0105241_11878954
1510 Ga0105241_12024551
1511 Ga0105242_10049439
1512 Ga0105242_10086700
1513 Ga0105242_10257883
1514 Ga0105242_11294935
1515 Ga0105248_10014029
1516 Ga0105248_10017537
1517 Ga0105248_10028015
1518 Ga0105248_10106301
1519 Ga0105248_10169849
1520 Ga0105248_10379966
1521 Ga0105248_10646426
1522 Ga0105237_10098281
1523 Ga0105237_10190029
1524 Ga0105237_10241944
1525 Ga0105237_10685513
1526 Ga0105237_11039174
1527 Ga0105237_11792226
1528 Ga0105238_10013673
1529 Ga0105238_10080479
1530 Ga0105238_10109276
1531 Ga0105238_10179770
1532 Ga0105238_10187858
1533 Ga0105238_10697907
1534 Ga0105238_10704502
1535 Ga0105249_10001916
1536 Ga0105249_10004595
1537 Ga0105249_10298944
1538 Ga0105249_10558189
1539 Ga0105249_10865883
1540 Ga0105239_10038551
1541 Ga0105239_10531833
1542 Ga0105239_10662931
1543 Ga0105239_13086201
1544 Ga0105246_10042561
1545 Ga0105246_10169454
1546 Ga0157373_10020314
1547 Ga0157373_10071356
1548 Ga0157373_10109507
1549 Ga0157373_10144338
1550 Ga0157373_10382440
1551 Ga0157373_10615455
1552 Ga0157373_10632653
1553 Ga0157371_10033591
1554 Ga0157370_10023970
1555 Ga0157370_10192346
1556 Ga0157370_10196636
1557 Ga0157370_10256155
1558 Ga0157370_10344651
1559 Ga0157370_11159579
1560 Ga0157370_11295153
1561 Ga0157369_10012326
1562 Ga0157369_10013320
1563 Ga0157369_10039653
1564 Ga0157369_10190071
1565 Ga0157369_10237234
1566 Ga0157369_10563381
1567 Ga0157369_10780515
1568 Ga0157369_10848745
1569 Ga0157369_11502340
1570 Ga0157374_10068700
1571 Ga0157374_10484945
1572 Ga0157378_10129268
1573 Ga0157378_10245520
1574 Ga0157378_10263337
1575 Ga0157378_10307291
1576 Ga0157378_11688115
1577 Ga0163162_10002204
1578 Ga0163162_10364132
1579 Ga0157372_10006667
1580 Ga0157372_10013842
1581 Ga0157372_10075519
1582 Ga0157372_10108200
1583 Ga0157372_10475011
1584 Ga0157372_10517742
1585 Ga0157372_10536642
1586 Ga0157372_10738379
1587 Ga0157372_10913753
1588 Ga0157372_11036464
1589 Ga0157372_11189350
1590 Ga0157372_12752584
1591 Ga0157375_10226902
1592 Ga0157375_10811086
1593 Ga0157375_11649452
1594 Ga0163163_10000009
1595 Ga0163163_10205909
1596 Ga0157380_10028765
1597 Ga0157380_10137043
1598 Ga0157380_10159336
1599 Ga0157380_10391460
1600 Ga0157380_11125239
1601 Ga0157380_11546273
1602 Ga0157380_13396535
1603 Ga0157377_10016947
1604 Ga0157377_10056842
1605 Ga0157377_10171727
1606 Ga0157377_10385667
1607 Ga0157377_10738986
1608 Ga0157377_10772605
1609 Ga0157377_10846610
1610 Ga0157379_11033880
1611 Ga0157376_10412754
1612 Ga0182007_10236618
1613 Ga0163161_10035975
1614 Ga0163161_10782100
1615 Ga0206356_10073776
1616 Ga0206356_10999864
1617 Ga0206349_1327194
1618 Ga0206350_11173530
1619 Ga0206354_10340077
1620 Ga0206354_10696304
1621 Ga0206353_10504984
1622 Ga0206353_10730584
1623 Ga0206353_10767563
1624 Ga0224712_10105643
1625 Ga0207697_10002021
1626 Ga0207697_10056512
1627 Ga0207697_10510540
1628 Ga0207656_10104637
1629 Ga0207656_10401876
1630 Ga0207653_10231590
1631 Ga0207682_10257099
1632 Ga0207642_10327462
1633 Ga0207710_10441315
1634 Ga0207688_10395657
1635 Ga0207688_10395749
1636 Ga0207688_11044140
1637 Ga0207680_10057026
1638 Ga0207680_10083457
1639 Ga0207680_10133574
1640 Ga0207680_10336377
1641 Ga0207647_10629931
1642 Ga0207647_10739251
1643 Ga0207699_10490679
1644 Ga0207645_10001905
1645 Ga0207645_10014161
1646 Ga0207645_10029920
1647 Ga0207645_10109279
1648 Ga0207645_10601571
1649 Ga0207643_10008747
1650 Ga0207643_10331018
1651 Ga0207643_10578907
1652 Ga0207684_10855446
1653 Ga0207654_10245785
1654 Ga0207654_11184639
1655 Ga0207707_10003438
1656 Ga0207707_10005650
1657 Ga0207707_10010086
1658 Ga0207707_10018855
1659 Ga0207707_10040421
1660 Ga0207707_10131322
1661 Ga0207707_10281135
1662 Ga0207707_10312658
1663 Ga0207707_10388781
1664 Ga0207707_10574889
1665 Ga0207695_10012421
1666 Ga0207695_10013678
1667 Ga0207695_10031661
1668 Ga0207695_10190596
1669 Ga0207695_10191149
1670 Ga0207695_10276492
1671 Ga0207695_10321107
1672 Ga0207695_10912248
1673 Ga0207695_11633560
1674 Ga0207671_10261188
1675 Ga0207693_10162820
1676 Ga0207663_10183838
1677 Ga0207663_10620638
1678 Ga0207663_11003000
1679 Ga0207660_10000703
1680 Ga0207660_10018188
1681 Ga0207660_10037347
1682 Ga0207660_10099588
1683 Ga0207660_10333951
1684 Ga0207660_10560043
1685 Ga0207660_10633902
1686 Ga0207660_10809413
1687 Ga0207660_10991325
1688 Ga0207662_10006257
1689 Ga0207662_10134665
1690 Ga0207662_10150334
1691 Ga0207662_10782780
1692 Ga0207657_10184080
1693 Ga0207657_10690302
1694 Ga0207649_10014495
1695 Ga0207649_10048714
1696 Ga0207649_10090644
1697 Ga0207649_10258452
1698 Ga0207649_11358093
1699 Ga0207652_10010931
1700 Ga0207652_10014885
1701 Ga0207652_10090101
1702 Ga0207652_10099980
1703 Ga0207652_10273977
1704 Ga0207652_10433014
1705 Ga0207646_10064781
1706 Ga0207681_10007214
1707 Ga0207681_10008916
1708 Ga0207681_10332686
1709 Ga0207694_10024692
1710 Ga0207694_10068903
1711 Ga0207694_10100861
1712 Ga0207650_10062578
1713 Ga0207650_10226584
1714 Ga0207650_10338977
1715 Ga0207650_10643389
1716 Ga0207650_10811688
1717 Ga0207650_10985697
1718 Ga0207650_11059396
1719 Ga0207650_11775526
1720 Ga0207659_10097638
1721 Ga0207659_11006585
1722 Ga0207659_11092376
1723 Ga0207659_11571544
1724 Ga0207687_10224465
1725 Ga0207687_10245158
1726 Ga0207700_10621579
1727 Ga0207700_11118009
1728 Ga0207664_10088592
1729 Ga0207664_10431217
1730 Ga0207664_10859536
1731 Ga0207664_11231088
1732 Ga0207664_12000526
1733 Ga0207644_10046513
1734 Ga0207644_10181094
1735 Ga0207644_11007338
1736 Ga0207644_11007618
1737 Ga0207690_10265003
1738 Ga0207690_10321014
1739 Ga0207690_10378788
1740 Ga0207690_11136586
1741 Ga0207706_10000408
1742 Ga0207706_10039012
1743 Ga0207706_10124453
1744 Ga0207706_11061707
1745 Ga0207686_10103973
1746 Ga0207686_10106134
1747 Ga0207686_10116316
1748 Ga0207686_10325239
1749 Ga0207686_10740038
1750 Ga0207709_10358021
1751 Ga0207670_10075672
1752 Ga0207670_10310497
1753 Ga0207670_10315149
1754 Ga0207670_10493507
1755 Ga0207670_10991395
1756 Ga0207669_10001837
1757 Ga0207669_10127797
1758 Ga0207669_10211768
1759 Ga0207669_10223893
1760 Ga0207669_10281055
1761 Ga0207669_10437760
1762 Ga0207669_10740043
1763 Ga0207669_10800058
1764 Ga0207704_10015385
1765 Ga0207704_10179540
1766 Ga0207704_11006809
1767 Ga0207691_10004629
1768 Ga0207691_10031368
1769 Ga0207691_10176449
1770 Ga0207711_10110327
1771 Ga0207711_10176623
1772 Ga0207711_10188634
1773 Ga0207711_10533597
1774 Ga0207689_10003861
1775 Ga0207689_10124705
1776 Ga0207661_10003879
1777 Ga0207661_10088512
1778 Ga0207661_10218177
1779 Ga0207661_10953348
1780 Ga0207679_10021972
1781 Ga0207679_10039129
1782 Ga0207679_10118476
1783 Ga0207679_10157202
1784 Ga0207679_10233404
1785 Ga0207679_10244338
1786 Ga0207679_10294898
1787 Ga0207679_10388042
1788 Ga0207667_10064668
1789 Ga0207667_10066030
1790 Ga0207667_10074535
1791 Ga0207667_10368470
1792 Ga0207667_10382710
1793 Ga0207651_10034116
1794 Ga0207651_10125077
1795 Ga0207712_10029190
1796 Ga0207712_10043828
1797 Ga0207712_10578037
1798 Ga0207668_10068922
1799 Ga0207668_10098143
1800 Ga0207668_10585397
1801 Ga0207668_11220240
1802 Ga0207640_10079882
1803 Ga0207640_10088282
1804 Ga0207640_11743476
1805 Ga0207640_12047612
1806 Ga0207640_12075820
1807 Ga0207658_10127988
1808 Ga0207658_10726221
1809 Ga0207677_10197249
1810 Ga0207703_10112001
1811 Ga0207703_10245145
1812 Ga0207703_10329451
1813 Ga0207639_10238438
1814 Ga0207639_10653040
1815 Ga0207639_11303831
1816 Ga0207639_11597593
1817 Ga0207639_11689678
1818 Ga0207678_10286481
1819 Ga0207678_10976224
1820 Ga0207678_11052892
1821 Ga0207678_11091947
1822 Ga0207678_11300867
1823 Ga0207708_10003989
1824 Ga0207708_10025055
1825 Ga0207708_10151037
1826 Ga0207708_10217341
1827 Ga0207708_10467713
1828 Ga0207708_10720570
1829 Ga0207708_11267497
1830 Ga0207708_11520013
1831 Ga0207708_11521449
1832 Ga0207702_10002203
1833 Ga0207702_10142743
1834 Ga0207702_10429884
1835 Ga0207702_10455085
1836 Ga0207702_10484179
1837 Ga0207702_11965232
1838 Ga0207641_10021682
1839 Ga0207641_10092642
1840 Ga0207641_10481872
1841 Ga0207641_12208798
1842 Ga0207648_10007449
1843 Ga0207648_10014257
1844 Ga0207648_10023633
1845 Ga0207648_10200547
1846 Ga0207648_10382988
1847 Ga0207676_10084260
1848 Ga0207676_10084495
1849 Ga0207676_11713165
1850 Ga0207674_10000409
1851 Ga0207674_10229908
1852 Ga0207674_10916773
1853 Ga0207674_11293328
1854 Ga0207675_100000465
1855 Ga0207675_100140224
1856 Ga0207675_100249263
1857 Ga0207675_101340517
1858 Ga0207683_10063220
1859 Ga0207683_10161213
1860 Ga0207683_10208750
1861 Ga0207683_10255428
1862 Ga0207698_10289462
1863 Ga0207698_10563882
1864 Ga0207698_10799244
1865 Ga0207698_10980488
1866 Ga0207698_11071632
1867 Ga0207698_12314653
1868 Ga0209179_1023452
1869 Ga0209999_1024916
1870 Ga0209983_1019372
1871 Ga0209971_1028072
1872 Ga0209971_1154954
1873 Ga0209974_10175170
1874 Ga0207428_10006774
1875 Ga0207428_10284666
1876 Ga0207428_10450171
1877 Ga0207428_10637876
1878 Ga0207428_11274836
1879 Ga0268266_10080349
1880 Ga0268266_10356792
1881 Ga0268266_10545305
1882 Ga0268265_10031919
1883 Ga0268265_10036489
1884 Ga0268265_10076847
1885 Ga0268265_10096964
1886 Ga0268265_11935295
1887 Ga0268264_10176461
1888 Ga0268264_10265122
1889 Ga0268264_10291916
1890 Ga0268264_10920260
1891 Ga0268264_11005360
1892 Ga0268264_11127087
1893 Ga0268264_11492914
1894 Ga0307408_100009421
1895 Ga0307408_100180160
1896 Ga0307408_100407952
1897 Ga0307408_100526797
1898 Ga0307408_100724947
1899 Ga0307408_101199299
1900 Ga0307405_10026754
1901 Ga0307405_10092204
1902 Ga0307405_10249347
1903 Ga0307405_11481459
1904 Ga0307413_10061206
1905 Ga0307413_10632315
1906 Ga0307410_10045668
1907 Ga0307410_10073912
1908 Ga0307410_11001556
1909 Ga0307406_10006900
1910 Ga0307406_10008381
1911 Ga0307406_10173244
1912 Ga0307406_10443531
1913 Ga0307406_10846516
1914 Ga0307406_11915035
1915 Ga0307407_10070294
1916 Ga0307407_10206686
1917 Ga0307407_10213747
1918 Ga0307412_10046788
1919 Ga0307412_10084974
1920 Ga0307412_12142669
1921 Ga0307409_100230484
1922 Ga0307409_100280033
1923 Ga0307409_100426993
1924 Ga0307409_100522734
1925 Ga0307409_100589576
1926 Ga0307409_100968499
1927 Ga0307409_101316064
1928 Ga0307409_102316058
1929 Ga0307416_100033626
1930 Ga0307416_100039250
1931 Ga0307416_100085451
1932 Ga0307416_100220117
1933 Ga0307416_100383488
1934 Ga0307416_100729168
1935 Ga0307414_10017383
1936 Ga0307414_11811054
1937 Ga0307411_10061921
1938 Ga0307411_10155094
1939 Ga0307411_10200336
1940 Ga0307411_10309900
1941 Ga0307411_10400691
1942 Ga0307411_10518440
1943 Ga0307411_10601076
1944 Ga0307415_100091783
1945 Ga0307415_100233256
1946 Ga0307415_100785190
1947 Ga0307415_100797020
1948 Ga0307415_101771926
1949 Ga0307415_101848478
1950 Ga0373934_0000316
1951 Ga0373934_0005008
1952 Ga0373923_0037582
1953 Ga0373941_0017239
1954 Ga0373941_0159510
1955 Ga0373953_0010281
1956 Ga0373954_0041165
1957 Ga0373954_0249666
1958 Ga0373956_0003435
1959 Ga0373957_0001241
1960 Ga0373957_0006304
1961 Ga0373957_0040056
1962 Ga0373946_0504315
1963 Ga0373955_0013484
1964 Ga0373955_0039466
1965 Ga0373961_0012144
1966 Ga0373962_0066673
1967 Ga0373962_0136474
1968 Ga0373924_0036629
1969 Ga0373924_0216256
1970 Ga0373935_0038006
1971 Ga0373935_1180480
1972 Ga0373933_0001497
1973 Ga0373933_0007270
1974 Ga0373933_0009562
1975 Ga0373947_0453805
1976 Ga0373947_0477084
1977 Ga0373937_0000180
1978 Ga0373937_0007779
1979 Ga0373937_0013647
1980 Ga0373925_0743862
1981 Ga0436365_0622275
1982 Ga0436363_1492189
1983 Ga0451797_0717853
1984 Ga0451853_2205769
1985 Ga0450923_075760
1986 Ga0450923_146026
1987 Ga0450894_001860
1988 Ga0450895_000873
1989 Ga0450896_006195
1990 Ga0450898_038252
1991 Ga0450905_026648
1992 Ga0450905_063944
1993 Ga0439464_0219741
1994 Ga0439460_0004748
1995 Ga0439460_0245601
1996 Ga0450918_005238
1997 Ga0466957_0075125
1998 Ga0451576_0008719
1999 Ga0451576_0414185
2000 Ga0451576_2551448
2001 Ga0466967_0302193
2002 Ga0495592_0019205
2003 Ga0495629_0052255
2004 Ga0495629_0473931
2005 Ga0495629_0632395
2006 Ga0495629_0939889
2007 Ga0495651_0043480
2008 Ga0495651_0050780
2009 Ga0495651_0290938
2010 Ga0495653_0003277
2011 Ga0495580_0015600
2012 Ga0495580_0679522
2013 Ga0495582_0611822
2014 Ga0495639_0003950
2015 Ga0495639_0742944
2016 Ga0495664_0019565
2017 Ga0495594_0003213
2018 Ga0495594_0030960
2019 Ga0495594_0066409
2020 Ga0495608_0038178
2021 Ga0495618_0039093
2022 Ga0495618_0044023
2023 Ga0495628_0002358
2024 Ga0495628_0106768
2025 Ga0495630_0008905
2026 Ga0495630_0240067
2027 Ga0495630_0596412
2028 Ga0495652_0031427
2029 Ga0495652_0044036
2030 Ga0495665_0125388
2031 Ga0495665_0252404
2032 Ga0495665_0425999
2033 Ga0495640_0038451
2034 Ga0495640_0137148
2035 Ga0495586_0019104
2036 Ga0495586_0229509
2037 Ga0495587_0004359
2038 Ga0495587_0102019
2039 Ga0495645_0002536
2040 Ga0495645_0025945
2041 Ga0495633_0355175
2042 Ga0495667_0016420
2043 Ga0495634_0129104
2044 Ga0495634_0465861
2045 Ga0495635_0000657
2046 Ga0495657_0008266
2047 Ga0495599_0007165
2048 Ga0495599_0046119
2049 Ga0495599_0460552
2050 Ga0495623_0027731
2051 Ga0495623_0033795
2052 Ga0495646_0017361
2053 Ga0495613_1082349
2054 Ga0495600_0018360
2055 Ga0495600_0193468
2056 Ga0495581_0398222
2057 Ga0495604_0024742
2058 Ga0495674_0020462
2059 Ga0495674_0900810
2060 Ga0495680_0031480
2061 Ga0495680_0291277
2062 Ga0495675_0022305
2063 Ga0495675_0023848
2064 Ga0495684_0001927
2065 Ga0495593_0012603
2066 Ga0495602_0018922
2067 Ga0495602_0499306
2068 Ga0496101_1233573
2069 Ga0496102_0301299
2070 Ga0496102_0593183
2071 Ga0496102_1515932
2072 Ga0496103_0469817
2073 Ga0496103_0965399
2074 Ga0496106_0435179
2075 Ga0496107_0513411
2076 Ga0496107_0819219
2077 Ga0496109_1147471
2078 Ga0496109_1905317
2079 Ga0496113_0854843
2080 Ga0496114_0593195
2081 Ga0501291_051500
2082 Ga0501298_096637
2083 Ga0501299_010437
2084 Ga0501031_0177196
2085 Ga0501032_0144718
2086 Ga0501033_0063765
2087 Ga0501033_0146073
2088 Ga0501034_0065584
2089 Ga0501036_0672735
2090 Ga0501037_0108048
2091 Ga0501038_1179318
2092 Ga0501042_1136829
2093 Ga0501043_0279762
2094 Ga0501043_0293776
2095 Ga0501046_0343285
2096 Ga0501047_0000486
2097 Ga0501048_0195447
2098 Ga0501068_0058776
2099 Ga0501068_0805735
2100 Ga0501070_0813390
2101 Ga0501070_0861615
2102 Ga0501071_0862557
2103 Ga0501071_1225852
2104 Ga0501073_0012846
2105 Ga0501073_0137986
2106 Ga0501074_0217479
2107 Ga0501075_0868627
2108 Ga0501076_0355473
2109 Ga0501202_173957
2110 Ga0501209_061704
2111 Ga0501217_073324
2112 Ga0501223_010396
2113 Ga0501235_028220
2114 Ga0501235_097943
2115 Ga0501243_006631
2116 Ga0501249_024424
2117 Ga0501225_0141373
2118 Ga0501080_0027094
2119 Ga0501081_0430220
2120 Ga0501081_1501229
2121 Ga0501266_097190
2122 Ga0501268_111874
2123 Ga0501271_035448
2124 Ga0501035_0003479
2125 Ga0501044_0007425
2126 Ga0501212_019523
2127 nmdc:mga05p37_382511_c1
2128 nmdc:mga05p37_5272_c1
2129 nmdc:mga05p37_52828_c1
2130 nmdc:mga05p37_544801_c1
2131 nmdc:mga09592_1010477_c1
2132 nmdc:mga09592_1185702_c1
2133 nmdc:mga09592_1237513_c1
2134 nmdc:mga09592_164360_c1
2135 nmdc:mga09592_168714_c1
2136 nmdc:mga09592_482249_c1
2137 nmdc:mga09592_75505_c1
2138 nmdc:mga09592_84071_c1
2139 nmdc:mga0qj67_104142_c1
2140 nmdc:mga0qj67_109062_c1
2141 nmdc:mga0qj67_173014_c1
2142 nmdc:mga0qj67_275996_c1
2143 nmdc:mga0qj67_380037_c1
2144 nmdc:mga0qj67_432240_c1
2145 nmdc:mga06r32_1100513_c1
2146 nmdc:mga06r32_68417_c1
2147 nmdc:mga06r32_718970_c1
2148 nmdc:mga06r32_782103_c1
2149 nmdc:mga08y16_10166_c1
2150 nmdc:mga08y16_140131_c1
2151 nmdc:mga08y16_1533807_c1
2152 nmdc:mga08y16_156096_c1
2153 nmdc:mga08y16_1718529_c1
2154 nmdc:mga08y16_177993_c1
2155 nmdc:mga08y16_235379_c1
2156 nmdc:mga08y16_2481_c1
2157 nmdc:mga08y16_516029_c1
2158 nmdc:mga08y16_7482_c2
2159 nmdc:mga08y16_819980_c1
2160 nmdc:mga08y16_921435_c1
2161 nmdc:mga0n895_1044976_c1
2162 nmdc:mga0n895_11937_c1
2163 nmdc:mga0n895_30730_c1
2164 nmdc:mga0n895_36051_c1
2165 nmdc:mga0n895_372560_c1
2166 nmdc:mga0n895_461471_c1
2167 nmdc:mga0n895_93559_c1
2168 nmdc:mga0n895_97132_c1
2169 nmdc:mga0rr50_10939_c1
2170 nmdc:mga0rr50_258090_c1
2171 nmdc:mga0rr50_33512_c1
2172 nmdc:mga08x19_115614_c1
2173 nmdc:mga08x19_28934_c1
2174 nmdc:mga08x19_29578_c1
2175 nmdc:mga08x19_62965_c1
2176 nmdc:mga08x19_706_c1
2177 nmdc:mga0a205_167649_c1
2178 nmdc:mga0a205_454406_c1
2179 nmdc:mga0a205_57588_c1
2180 Ga0495601_0011930
2181 Ga0495612_0005711
2182 Ga0495612_0545197
2183 Ga0495595_0014535
2184 Ga0495595_0063483
2185 Ga0495595_0099304
2186 Ga0495619_0024748
2187 Ga0495619_0088790
2188 Ga0500646_0007640
2189 Ga0500555_034285
2190 Ga0501084_0434564
2191 Ga0501084_1430897
2192 Ga0590071_189703
2193 Ga0501082_0664916
2194 Ga0501082_0710177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

25

99

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.921 13 106
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9082 6 104
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8976 9 108
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.8972 10 107
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8963 5 104
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9082 6 104 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9022 10 103 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8948 8 108 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8856 13 94 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8796 17 82 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V8ZGY6-F1-model_v4 PadR family transcriptional regulator 0.993 10 107
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9929 10 88
AF-A0A3N5LHC2-F1-model_v4 PadR family transcriptional regulator 0.9839 12 107
AF-A0A7S7SQC6-F1-model_v4 PadR family transcriptional regulator 0.9797 8 107
AF-A0A6A7L9E2-F1-model_v4 PadR family transcriptional regulator 0.9794 8 107

Map