F489943

General Info

Members Datasets Scaffolds Average Seq Length
1094 383 2188 318

Family's Representative Sequence

Representative Sequence 3300035091|Ga0373951_0028347|Ga0373951_0028347_22_1011
Length 329
Sequence MTRAEADDSRVKRIRFWGTRGSLPVALTAPAVRAKIIAALRGGAGRTFESDAEIERYIDVLPFAVSGTFGGHTACVEIENGSSEYVICDLGSGLRPFGQAAIARHGPANPQTYHLFVSHVHWDHIMGLPFFGPAYIPGNRLFFYGAHRELEAALRRQMEPPSFPVNFSVFNADIKFVYLEPGRTHDVAGMRVTVKRQHHAGDSYGYRFERDGRTVVYSTDSEHTFEDPNESASFAKFFRKADVVVFDAMYSLAEAISVKADWGHSSNIVGVELCQLAEARHLCLFHHEPALDDAALSTMLEETQRYEEITRTGEPLRVTAAYDGLELTL

Samples

Sample ID Description Type Environment
1 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
211 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
214 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
217 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
229 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
230 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
231 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
232 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
233 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
234 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
235 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
236 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
237 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
238 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
239 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
240 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
244 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
245 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
246 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
247 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
248 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
249 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
250 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
258 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
265 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
266 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
267 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
268 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
269 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
284 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
285 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
286 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
287 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
293 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
294 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
299 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
302 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
303 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
306 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
309 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
344 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
347 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
348 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
349 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
350 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
351 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
352 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
373 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
374 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
375 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
376 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
377 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
378 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
379 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
380 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 1.83
Rhizosphere 96.16
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373951_0028347 3300035091 Bacteria 1312
2 JGI24752J21851_1001828 3300001976 Bacteria 2846
3 JGI24743J22301_10004588 3300001991 Bacteria 2261
4 JGI24749J21850_1001400 3300002076 Bacteria 3421
5 JGI25154J39366_1002207 3300002738 Bacteria 5383
6 JGI25150J39212_1006616 3300002774 Bacteria 2379
7 Ga0065712_10086265 3300005290 Bacteria 2646
8 Ga0065707_10109310 3300005295 Bacteria 2474
9 Ga0070658_10010376 3300005327 Bacteria 7473
10 Ga0070658_10013504 3300005327 Bacteria 6554
11 Ga0070658_10095702 3300005327 Bacteria 2451
12 Ga0070658_10391652 3300005327 Bacteria 1193
13 Ga0070676_10001388 3300005328 Bacteria 12225
14 Ga0070676_10019388 3300005328 Bacteria 3784
15 Ga0070683_100002418 3300005329 Bacteria 14840
16 Ga0070683_100006182 3300005329 Bacteria 10042
17 Ga0070683_100009279 3300005329 Bacteria 8406
18 Ga0070690_100007731 3300005330 Bacteria 6162
19 Ga0070690_100009216 3300005330 Bacteria 5711
20 Ga0070690_100237908 3300005330 Bacteria 1283
21 Ga0070670_100009078 3300005331 Bacteria 8497
22 Ga0070670_100012760 3300005331 Bacteria 7191
23 Ga0070670_100015475 3300005331 Bacteria 6552
24 Ga0070670_100025236 3300005331 Bacteria 5115
25 Ga0070670_100039128 3300005331 Unclassified 4078
26 Ga0070670_100116828 3300005331 Bacteria 2300
27 Ga0070670_100157137 3300005331 Bacteria 1970
28 Ga0070670_100216436 3300005331 Bacteria 1666
29 Ga0070677_10000867 3300005333 Bacteria 9957
30 Ga0070677_10014895 3300005333 Bacteria 2746
31 Ga0070677_10018540 3300005333 Bacteria 2507
32 Ga0070677_10119925 3300005333 Bacteria 1186
33 Ga0068869_100001734 3300005334 Bacteria 13025
34 Ga0070666_10015635 3300005335 Bacteria 4842
35 Ga0070666_10028648 3300005335 Bacteria 3656
36 Ga0070666_10043965 3300005335 Bacteria 2992
37 Ga0070666_10099967 3300005335 Bacteria 1998
38 Ga0070680_100019114 3300005336 Bacteria 5426
39 Ga0070680_100023092 3300005336 Bacteria 4958
40 Ga0070680_100061902 3300005336 Bacteria 3064
41 Ga0070680_100079008 3300005336 Bacteria 2711
42 Ga0068868_100081600 3300005338 Bacteria 2593
43 Ga0068868_100116805 3300005338 Bacteria 2173
44 Ga0068868_100204551 3300005338 Bacteria 1647
45 Ga0070660_100002562 3300005339 Bacteria 12460
46 Ga0070660_100009931 3300005339 Bacteria 6715
47 Ga0070660_100010559 3300005339 Bacteria 6526
48 Ga0070660_100044127 3300005339 Bacteria 3409
49 Ga0070689_100004065 3300005340 Bacteria 9848
50 Ga0070689_100005370 3300005340 Bacteria 8735
51 Ga0070689_100259641 3300005340 Bacteria 1435
52 Ga0070691_10004121 3300005341 Bacteria 6599
53 Ga0070687_100008129 3300005343 Bacteria 4422
54 Ga0070661_100001712 3300005344 Bacteria 15207
55 Ga0070661_100009588 3300005344 Bacteria 6706
56 Ga0070661_100010701 3300005344 Bacteria 6383
57 Ga0070661_100024075 3300005344 Bacteria 4368
58 Ga0070661_100203165 3300005344 Bacteria 1515
59 Ga0070692_10021734 3300005345 Bacteria 3124
60 Ga0070668_100011897 3300005347 Bacteria 6478
61 Ga0070668_100036191 3300005347 Unclassified 3766
62 Ga0070669_100005194 3300005353 Bacteria 9420
63 Ga0070669_100053463 3300005353 Bacteria 2956
64 Ga0070669_100126544 3300005353 Bacteria 1956
65 Ga0070675_100000137 3300005354 Bacteria 44007
66 Ga0070675_100014748 3300005354 Bacteria 6165
67 Ga0070675_100027761 3300005354 Bacteria 4551
68 Ga0070675_100032635 3300005354 Bacteria 4215
69 Ga0070675_100100625 3300005354 Bacteria 2434
70 Ga0070675_100148191 3300005354 Bacteria 2010
71 Ga0070675_100187480 3300005354 Bacteria 1791
72 Ga0070671_100004005 3300005355 Bacteria 11605
73 Ga0070671_100007543 3300005355 Bacteria 8698
74 Ga0070671_100050483 3300005355 Bacteria 3460
75 Ga0070671_100074609 3300005355 Bacteria 2834
76 Ga0070671_100085101 3300005355 Bacteria 2645
77 Ga0070671_100110716 3300005355 Bacteria 2307
78 Ga0070671_100135279 3300005355 Bacteria 2078
79 Ga0070671_100154474 3300005355 Unclassified 1938
80 Ga0070671_100167859 3300005355 Bacteria 1856
81 Ga0070671_100370927 3300005355 Bacteria 1222
82 Ga0070674_100001534 3300005356 Bacteria 12333
83 Ga0070674_100002896 3300005356 Bacteria 9500
84 Ga0070674_100026684 3300005356 Bacteria 3776
85 Ga0070673_100003040 3300005364 Bacteria 10377
86 Ga0070673_100009306 3300005364 Bacteria 6592
87 Ga0070673_100041672 3300005364 Bacteria 3534
88 Ga0070673_100070427 3300005364 Bacteria 2806
89 Ga0070673_100175443 3300005364 Bacteria 1832
90 Ga0070688_100029562 3300005365 Bacteria 3282
91 Ga0070688_100051301 3300005365 Bacteria 2573
92 Ga0070659_100000175 3300005366 Bacteria 49114
93 Ga0070659_100008063 3300005366 Bacteria 7678
94 Ga0070659_100012176 3300005366 Bacteria 6375
95 Ga0070659_100076020 3300005366 Bacteria 2678
96 Ga0070659_100150389 3300005366 Bacteria 1899
97 Ga0070659_100161438 3300005366 Bacteria 1832
98 Ga0070659_100194025 3300005366 Bacteria 1670
99 Ga0070667_100005523 3300005367 Bacteria 10557
100 Ga0070667_100006609 3300005367 Bacteria 9639
101 Ga0070667_100387262 3300005367 Bacteria 1271
102 Ga0070714_100010622 3300005435 Bacteria 7286
103 Ga0070714_100028647 3300005435 Bacteria 4623
104 Ga0070714_100270204 3300005435 Bacteria 1576
105 Ga0070713_100008964 3300005436 Bacteria 7129
106 Ga0070713_100034284 3300005436 Bacteria 4076
107 Ga0070713_100047610 3300005436 Bacteria 3525
108 Ga0070701_10005142 3300005438 Bacteria 5374
109 Ga0070711_100049035 3300005439 Bacteria 2891
110 Ga0070711_100056819 3300005439 Bacteria 2708
111 Ga0070711_100237758 3300005439 Bacteria 1423
112 Ga0070705_100010412 3300005440 Bacteria 4654
113 Ga0070705_100017274 3300005440 Bacteria 3765
114 Ga0070705_100089782 3300005440 Bacteria 1911
115 Ga0070705_100095371 3300005440 Bacteria 1865
116 Ga0070700_100021030 3300005441 Bacteria 3789
117 Ga0070700_100022954 3300005441 Bacteria 3646
118 Ga0070700_100043324 3300005441 Bacteria 2768
119 Ga0070700_100088664 3300005441 Bacteria 2014
120 Ga0070694_100000470 3300005444 Bacteria 22074
121 Ga0070694_100024015 3300005444 Bacteria 3930
122 Ga0070694_100097306 3300005444 Bacteria 2076
123 Ga0070663_100001849 3300005455 Bacteria 11790
124 Ga0070663_100042138 3300005455 Bacteria 3207
125 Ga0070678_100008396 3300005456 Bacteria 6184
126 Ga0070678_100015553 3300005456 Bacteria 4840
127 Ga0070678_100079036 3300005456 Bacteria 2486
128 Ga0070678_100348577 3300005456 Bacteria 1272
129 Ga0070662_100001403 3300005457 Bacteria 14851
130 Ga0070662_100008803 3300005457 Bacteria 6581
131 Ga0070662_100015970 3300005457 Bacteria 5037
132 Ga0070662_100081613 3300005457 Bacteria 2409
133 Ga0070662_100251898 3300005457 Bacteria 1420
134 Ga0070681_10001270 3300005458 Bacteria 22011
135 Ga0070681_10001638 3300005458 Bacteria 19972
136 Ga0070681_10009996 3300005458 Bacteria 9355
137 Ga0070681_10021230 3300005458 Bacteria 6507
138 Ga0070681_10193276 3300005458 Bacteria 1954
139 Ga0070681_10213669 3300005458 Bacteria 1845
140 Ga0070681_10220266 3300005458 Unclassified 1813
141 Ga0068867_100005191 3300005459 Bacteria 9189
142 Ga0068867_100008773 3300005459 Bacteria 7139
143 Ga0068867_100011689 3300005459 Bacteria 6200
144 Ga0068867_100067208 3300005459 Bacteria 2672
145 Ga0068867_100233574 3300005459 Bacteria 1488
146 Ga0070685_10028377 3300005466 Bacteria 3100
147 Ga0070685_10041440 3300005466 Bacteria 2623
148 Ga0070706_100187242 3300005467 Bacteria 1934
149 Ga0070707_100021569 3300005468 Bacteria 6090
150 Ga0070698_100203184 3300005471 Bacteria 1917
151 Ga0070679_100003978 3300005530 Bacteria 13611
152 Ga0070679_100015982 3300005530 Bacteria 7228
153 Ga0070679_100037372 3300005530 Bacteria 4823
154 Ga0070679_100040925 3300005530 Bacteria 4612
155 Ga0070679_100193281 3300005530 Bacteria 2003
156 Ga0070679_100236402 3300005530 Bacteria 1786
157 Ga0070684_100001319 3300005535 Bacteria 17769
158 Ga0070684_100158290 3300005535 Bacteria 2054
159 Ga0070684_100247808 3300005535 Bacteria 1628
160 Ga0070684_100295543 3300005535 Bacteria 1486
161 Ga0070697_100006559 3300005536 Bacteria 9015
162 Ga0070697_100039686 3300005536 Bacteria 3807
163 Ga0070697_100238020 3300005536 Bacteria 1554
164 Ga0068853_100011678 3300005539 Bacteria 7138
165 Ga0068853_100043863 3300005539 Bacteria 3826
166 Ga0068853_100056381 3300005539 Bacteria 3388
167 Ga0068853_100059050 3300005539 Bacteria 3313
168 Ga0068853_100214185 3300005539 Bacteria 1757
169 Ga0070672_100001388 3300005543 Bacteria 14937
170 Ga0070672_100004432 3300005543 Bacteria 9187
171 Ga0070672_100005016 3300005543 Bacteria 8727
172 Ga0070672_100005192 3300005543 Bacteria 8612
173 Ga0070672_100032147 3300005543 Bacteria 3958
174 Ga0070672_100043571 3300005543 Unclassified 3461
175 Ga0070686_100042266 3300005544 Bacteria 2854
176 Ga0070686_100088511 3300005544 Bacteria 2066
177 Ga0070695_100004401 3300005545 Bacteria 8270
178 Ga0070695_100008602 3300005545 Bacteria 6061
179 Ga0070695_100065312 3300005545 Bacteria 2369
180 Ga0070695_100357386 3300005545 Bacteria 1096
181 Ga0070696_100004905 3300005546 Bacteria 8933
182 Ga0070696_100007898 3300005546 Bacteria 7102
183 Ga0070696_100011125 3300005546 Bacteria 6022
184 Ga0070696_100040120 3300005546 Bacteria 3232
185 Ga0070696_100042766 3300005546 Bacteria 3132
186 Ga0070696_100120854 3300005546 Bacteria 1896
187 Ga0070696_100171370 3300005546 Bacteria 1605
188 Ga0070693_100001197 3300005547 Bacteria 11683
189 Ga0070693_100005482 3300005547 Bacteria 6102
190 Ga0070693_100008979 3300005547 Bacteria 4960
191 Ga0070665_100011288 3300005548 Bacteria 9035
192 Ga0070665_100045347 3300005548 Bacteria 4415
193 Ga0070665_100143675 3300005548 Bacteria 2389
194 Ga0070704_100125512 3300005549 Bacteria 1979
195 Ga0068855_100001963 3300005563 Bacteria 25546
196 Ga0068855_100005684 3300005563 Bacteria 15235
197 Ga0068855_100008743 3300005563 Bacteria 12245
198 Ga0068855_100010458 3300005563 Bacteria 11195
199 Ga0068855_100039890 3300005563 Bacteria 5574
200 Ga0068855_100049165 3300005563 Bacteria 4975
201 Ga0068855_100124604 3300005563 Bacteria 2947
202 Ga0068855_100148182 3300005563 Bacteria 2670
203 Ga0070664_100000114 3300005564 Bacteria 53137
204 Ga0070664_100004571 3300005564 Bacteria 11106
205 Ga0070664_100022146 3300005564 Bacteria 5242
206 Ga0070664_100025184 3300005564 Bacteria 4929
207 Ga0070664_100040614 3300005564 Bacteria 3923
208 Ga0068857_100013587 3300005577 Bacteria 7093
209 Ga0068857_100047186 3300005577 Bacteria 3824
210 Ga0068857_100086774 3300005577 Bacteria 2799
211 Ga0068854_100002976 3300005578 Bacteria 10510
212 Ga0068854_100003984 3300005578 Bacteria 9263
213 Ga0068854_100007446 3300005578 Bacteria 6995
214 Ga0068854_100009227 3300005578 Bacteria 6366
215 Ga0068854_100016739 3300005578 Bacteria 4892
216 Ga0068854_100024159 3300005578 Bacteria 4159
217 Ga0068856_100002277 3300005614 Bacteria 19801
218 Ga0068856_100007240 3300005614 Bacteria 10827
219 Ga0068856_100036238 3300005614 Bacteria 4837
220 Ga0068856_100111925 3300005614 Bacteria 2727
221 Ga0068856_100114693 3300005614 Bacteria 2694
222 Ga0068856_100175510 3300005614 Bacteria 2155
223 Ga0070702_100000217 3300005615 Bacteria 19225
224 Ga0068852_100000686 3300005616 Bacteria 22174
225 Ga0068852_100005124 3300005616 Bacteria 9338
226 Ga0068852_100018526 3300005616 Bacteria 5487
227 Ga0068852_100020075 3300005616 Bacteria 5307
228 Ga0068852_100020181 3300005616 Bacteria 5294
229 Ga0068852_100038214 3300005616 Bacteria 4033
230 Ga0068852_100047775 3300005616 Bacteria 3654
231 Ga0068852_100099752 3300005616 Bacteria 2618
232 Ga0068852_100121786 3300005616 Bacteria 2390
233 Ga0068852_100318417 3300005616 Bacteria 1510
234 Ga0068859_100006540 3300005617 Bacteria 11835
235 Ga0068859_100055744 3300005617 Bacteria 3977
236 Ga0068859_100078535 3300005617 Bacteria 3341
237 Ga0068859_100078674 3300005617 Bacteria 3338
238 Ga0068859_100102240 3300005617 Bacteria 2923
239 Ga0068859_100112812 3300005617 Bacteria 2782
240 Ga0068859_100120369 3300005617 Bacteria 2692
241 Ga0068859_100150433 3300005617 Bacteria 2403
242 Ga0068859_100270264 3300005617 Bacteria 1792
243 Ga0068859_100429744 3300005617 Bacteria 1417
244 Ga0068864_100010266 3300005618 Bacteria 7732
245 Ga0068864_100073383 3300005618 Bacteria 2983
246 Ga0068864_100167952 3300005618 Bacteria 1999
247 Ga0068864_100278358 3300005618 Bacteria 1561
248 Ga0068864_100309211 3300005618 Unclassified 1481
249 Ga0068866_10002778 3300005718 Bacteria 7221
250 Ga0068861_100006831 3300005719 Bacteria 7791
251 Ga0068861_100039775 3300005719 Bacteria 3512
252 Ga0068861_100199197 3300005719 Bacteria 1680
253 Ga0068851_10004802 3300005834 Bacteria 6117
254 Ga0068851_10013420 3300005834 Bacteria 3877
255 Ga0068851_10014579 3300005834 Bacteria 3734
256 Ga0068851_10034364 3300005834 Bacteria 2530
257 Ga0068851_10079406 3300005834 Bacteria 1711
258 Ga0068851_10080423 3300005834 Bacteria 1701
259 Ga0068870_10007971 3300005840 Bacteria 4742
260 Ga0068863_100006537 3300005841 Bacteria 11438
261 Ga0068863_100082340 3300005841 Bacteria 3049
262 Ga0068863_100123185 3300005841 Bacteria 2473
263 Ga0068863_100175758 3300005841 Bacteria 2055
264 Ga0068858_100002592 3300005842 Bacteria 18197
265 Ga0068858_100004509 3300005842 Bacteria 13652
266 Ga0068858_100032816 3300005842 Bacteria 4822
267 Ga0068858_100090670 3300005842 Bacteria 2845
268 Ga0068858_100396629 3300005842 Bacteria 1325
269 Ga0068860_100001281 3300005843 Bacteria 27297
270 Ga0068860_100017705 3300005843 Bacteria 6940
271 Ga0068860_100028330 3300005843 Bacteria 5391
272 Ga0068860_100076675 3300005843 Bacteria 3179
273 Ga0068860_100116174 3300005843 Bacteria 2560
274 Ga0068860_100283786 3300005843 Bacteria 1619
275 Ga0068862_100029306 3300005844 Bacteria 4637
276 Ga0068862_100118706 3300005844 Bacteria 2329
277 Ga0081539_10000556 3300005985 Bacteria 77121
278 Ga0070717_10178146 3300006028 Bacteria 1852
279 Ga0075364_10021367 3300006051 Bacteria 4078
280 Ga0075432_10068970 3300006058 Bacteria 1268
281 Ga0070715_10025093 3300006163 Bacteria 2357
282 Ga0070715_10053842 3300006163 Bacteria 1740
283 Ga0075369_10011266 3300006186 Bacteria 3516
284 Ga0075366_10010951 3300006195 Bacteria 5105
285 Ga0075366_10049662 3300006195 Bacteria 2489
286 Ga0097621_100004498 3300006237 Bacteria 9722
287 Ga0097621_100023024 3300006237 Bacteria 4844
288 Ga0097621_100024138 3300006237 Bacteria 4744
289 Ga0097621_100041796 3300006237 Bacteria 3692
290 Ga0097621_100058629 3300006237 Bacteria 3150
291 Ga0097621_100145333 3300006237 Bacteria 2030
292 Ga0097621_100290270 3300006237 Bacteria 1442
293 Ga0097621_100382953 3300006237 Bacteria 1257
294 Ga0068871_100006783 3300006358 Bacteria 8136
295 Ga0068871_100008768 3300006358 Bacteria 7282
296 Ga0068871_100019357 3300006358 Bacteria 5196
297 Ga0068871_100020562 3300006358 Bacteria 5059
298 Ga0068871_100047633 3300006358 Bacteria 3458
299 Ga0068871_100073500 3300006358 Bacteria 2819
300 Ga0068871_100098215 3300006358 Bacteria 2449
301 Ga0075428_100001613 3300006844 Bacteria 24108
302 Ga0075428_100005808 3300006844 Bacteria 13706
303 Ga0075428_100006194 3300006844 Bacteria 13307
304 Ga0075428_100006591 3300006844 Bacteria 12915
305 Ga0075428_100027683 3300006844 Bacteria 6271
306 Ga0075430_100000656 3300006846 Bacteria 26394
307 Ga0075430_100006045 3300006846 Bacteria 10209
308 Ga0075430_100020605 3300006846 Bacteria 5609
309 Ga0075430_100024126 3300006846 Bacteria 5178
310 Ga0075431_100071904 3300006847 Bacteria 3569
311 Ga0075431_100318915 3300006847 Bacteria 1567
312 Ga0075433_10052115 3300006852 Bacteria 3565
313 Ga0075433_10177711 3300006852 Bacteria 1894
314 Ga0075433_10313142 3300006852 Bacteria 1389
315 Ga0075434_100000732 3300006871 Bacteria 25783
316 Ga0075434_100004372 3300006871 Bacteria 12725
317 Ga0075434_100093764 3300006871 Bacteria 3006
318 Ga0075434_100113341 3300006871 Bacteria 2724
319 Ga0075434_100525050 3300006871 Unclassified 1204
320 Ga0075434_100527598 3300006871 Bacteria 1201
321 Ga0075429_100000412 3300006880 Bacteria 31781
322 Ga0075429_100055794 3300006880 Bacteria 3438
323 Ga0075429_100062473 3300006880 Bacteria 3245
324 Ga0075429_100254463 3300006880 Bacteria 1538
325 Ga0068865_100007504 3300006881 Bacteria 6708
326 Ga0068865_100031209 3300006881 Bacteria 3552
327 Ga0068865_100031976 3300006881 Bacteria 3512
328 Ga0068865_100036842 3300006881 Bacteria 3300
329 Ga0068865_100132792 3300006881 Bacteria 1867
330 Ga0075436_100000500 3300006914 Bacteria 25332
331 Ga0075436_100003442 3300006914 Bacteria 10849
332 Ga0075436_100005957 3300006914 Bacteria 8374
333 Ga0075436_100024467 3300006914 Bacteria 4151
334 Ga0075436_100036088 3300006914 Bacteria 3411
335 Ga0075436_100076355 3300006914 Bacteria 2320
336 Ga0075436_100079467 3300006914 Bacteria 2272
337 Ga0097620_100006539 3300006931 Bacteria 11835
338 Ga0097620_100055743 3300006931 Bacteria 3977
339 Ga0097620_100078535 3300006931 Bacteria 3341
340 Ga0097620_100078677 3300006931 Bacteria 3338
341 Ga0097620_100102250 3300006931 Bacteria 2923
342 Ga0097620_100112816 3300006931 Bacteria 2782
343 Ga0097620_100120368 3300006931 Bacteria 2692
344 Ga0097620_100150431 3300006931 Bacteria 2403
345 Ga0097620_100270244 3300006931 Bacteria 1792
346 Ga0097620_100429723 3300006931 Bacteria 1417
347 Ga0075435_100002000 3300007076 Bacteria 13341
348 Ga0075435_100065216 3300007076 Bacteria 2960
349 Ga0075435_100375625 3300007076 Bacteria 1221
350 Ga0075435_100431955 3300007076 Unclassified 1135
351 Ga0099794_10002061 3300007265 Bacteria 7291
352 Ga0105240_10008339 3300009093 Bacteria 14828
353 Ga0105240_10029860 3300009093 Bacteria 7095
354 Ga0105240_10076438 3300009093 Bacteria 4128
355 Ga0105240_10115588 3300009093 Bacteria 3239
356 Ga0105240_10198834 3300009093 Bacteria 2351
357 Ga0105240_10226422 3300009093 Bacteria 2175
358 Ga0111539_10000774 3300009094 Bacteria 41587
359 Ga0111539_10001599 3300009094 Bacteria 30206
360 Ga0111539_10036691 3300009094 Bacteria 5924
361 Ga0111539_10085639 3300009094 Bacteria 3704
362 Ga0111539_10480340 3300009094 Bacteria 1447
363 Ga0111539_10501259 3300009094 Bacteria 1414
364 Ga0105245_10015101 3300009098 Bacteria 6727
365 Ga0105245_10053450 3300009098 Bacteria 3625
366 Ga0114129_10001648 3300009147 Bacteria 30350
367 Ga0114129_10041809 3300009147 Bacteria 6454
368 Ga0114129_10047169 3300009147 Bacteria 6055
369 Ga0114129_10078122 3300009147 Bacteria 4604
370 Ga0114129_10188876 3300009147 Bacteria 2799
371 Ga0105243_10013368 3300009148 Bacteria 6208
372 Ga0105243_10043196 3300009148 Bacteria 3532
373 Ga0105243_10071301 3300009148 Bacteria 2809
374 Ga0105243_10105802 3300009148 Bacteria 2344
375 Ga0105243_10340669 3300009148 Bacteria 1373
376 Ga0105243_10354386 3300009148 Bacteria 1349
377 Ga0105241_10000793 3300009174 Bacteria 24022
378 Ga0105241_10010605 3300009174 Bacteria 6758
379 Ga0105241_10032487 3300009174 Bacteria 3913
380 Ga0105241_10080099 3300009174 Bacteria 2555
381 Ga0105241_10104110 3300009174 Bacteria 2261
382 Ga0105241_10371059 3300009174 Bacteria 1248
383 Ga0105242_10001017 3300009176 Bacteria 22032
384 Ga0105242_10007971 3300009176 Bacteria 8158
385 Ga0105242_10065185 3300009176 Bacteria 3005
386 Ga0105248_10001350 3300009177 Bacteria 27352
387 Ga0105248_10006705 3300009177 Bacteria 12630
388 Ga0105248_10030011 3300009177 Bacteria 6069
389 Ga0105248_10037365 3300009177 Bacteria 5433
390 Ga0105248_10080575 3300009177 Bacteria 3659
391 Ga0105248_10159504 3300009177 Bacteria 2545
392 Ga0105248_10240435 3300009177 Bacteria 2038
393 Ga0105248_10311268 3300009177 Bacteria 1773
394 Ga0105237_10020839 3300009545 Bacteria 6751
395 Ga0105237_10035610 3300009545 Bacteria 5036
396 Ga0105237_10174101 3300009545 Unclassified 2152
397 Ga0105238_10001520 3300009551 Bacteria 23233
398 Ga0105238_10045880 3300009551 Bacteria 4414
399 Ga0105238_10096720 3300009551 Bacteria 2938
400 Ga0105238_10139350 3300009551 Bacteria 2403
401 Ga0105249_10071642 3300009553 Bacteria 3202
402 Ga0099796_10054953 3300010159 Bacteria 1393
403 Ga0105239_10059640 3300010375 Bacteria 4188
404 Ga0105239_10160355 3300010375 Bacteria 2512
405 Ga0105239_10315749 3300010375 Bacteria 1762
406 Ga0105246_10236272 3300011119 Bacteria 1442
407 Ga0157373_10000792 3300013100 Bacteria 24394
408 Ga0157373_10004951 3300013100 Bacteria 10010
409 Ga0157373_10013069 3300013100 Bacteria 6092
410 Ga0157371_10000498 3300013102 Bacteria 47567
411 Ga0157371_10007316 3300013102 Bacteria 8963
412 Ga0157370_10008522 3300013104 Bacteria 11051
413 Ga0157370_10012125 3300013104 Bacteria 8965
414 Ga0157370_10026167 3300013104 Bacteria 5763
415 Ga0157370_10094856 3300013104 Bacteria 2799
416 Ga0157370_10195379 3300013104 Bacteria 1878
417 Ga0157370_10288821 3300013104 Unclassified 1515
418 Ga0157370_10523229 3300013104 Bacteria 1088
419 Ga0157369_10009905 3300013105 Bacteria 10891
420 Ga0157369_10015273 3300013105 Bacteria 8659
421 Ga0157369_10060070 3300013105 Bacteria 4100
422 Ga0157369_10250681 3300013105 Unclassified 1848
423 Ga0157369_10359357 3300013105 Bacteria 1512
424 Ga0157374_10004692 3300013296 Bacteria 11472
425 Ga0157374_10040493 3300013296 Bacteria 4291
426 Ga0157374_10159436 3300013296 Bacteria 2197
427 Ga0157374_10269539 3300013296 Unclassified 1678
428 Ga0157374_10532110 3300013296 Bacteria 1182
429 Ga0157378_10016123 3300013297 Bacteria 6543
430 Ga0157378_10047311 3300013297 Bacteria 3824
431 Ga0157378_10050329 3300013297 Bacteria 3708
432 Ga0157378_10227172 3300013297 Bacteria 1777
433 Ga0157378_10347690 3300013297 Bacteria 1448
434 Ga0157378_10407884 3300013297 Bacteria 1340
435 Ga0157378_10462007 3300013297 Bacteria 1262
436 Ga0163162_10021677 3300013306 Bacteria 6329
437 Ga0163162_10043178 3300013306 Bacteria 4514
438 Ga0163162_10207207 3300013306 Bacteria 2090
439 Ga0163162_10256461 3300013306 Bacteria 1881
440 Ga0163162_10503460 3300013306 Bacteria 1341
441 Ga0163162_10546317 3300013306 Bacteria 1287
442 Ga0157372_10005513 3300013307 Bacteria 13454
443 Ga0157372_10006902 3300013307 Bacteria 12084
444 Ga0157372_10019239 3300013307 Bacteria 7353
445 Ga0157372_10031050 3300013307 Bacteria 5848
446 Ga0157372_10035070 3300013307 Bacteria 5520
447 Ga0157372_10058676 3300013307 Bacteria 4303
448 Ga0157372_10154300 3300013307 Bacteria 2652
449 Ga0157372_10209896 3300013307 Bacteria 2256
450 Ga0157372_10238578 3300013307 Bacteria 2109
451 Ga0157372_10310938 3300013307 Bacteria 1834
452 Ga0157372_10320301 3300013307 Bacteria 1805
453 Ga0157375_10002449 3300013308 Bacteria 16057
454 Ga0157375_10014787 3300013308 Bacteria 6972
455 Ga0157375_10070717 3300013308 Bacteria 3500
456 Ga0157375_10079156 3300013308 Bacteria 3321
457 Ga0157375_10081266 3300013308 Bacteria 3281
458 Ga0157375_10091687 3300013308 Bacteria 3101
459 Ga0157375_10112298 3300013308 Bacteria 2825
460 Ga0157375_10330935 3300013308 Bacteria 1688
461 Ga0163163_10050470 3300014325 Bacteria 4097
462 Ga0163163_10139494 3300014325 Bacteria 2466
463 Ga0163163_10228277 3300014325 Bacteria 1911
464 Ga0163163_10482585 3300014325 Bacteria 1301
465 Ga0157380_10006083 3300014326 Bacteria 8460
466 Ga0157380_10010510 3300014326 Bacteria 6659
467 Ga0157380_10010974 3300014326 Bacteria 6533
468 Ga0157380_10024855 3300014326 Bacteria 4537
469 Ga0157380_10224272 3300014326 Bacteria 1683
470 Ga0182008_10033922 3300014497 Bacteria 2560
471 Ga0157377_10000549 3300014745 Bacteria 15789
472 Ga0157379_10001431 3300014968 Bacteria 19596
473 Ga0157379_10022403 3300014968 Bacteria 5596
474 Ga0157379_10062297 3300014968 Bacteria 3336
475 Ga0157379_10307038 3300014968 Bacteria 1447
476 Ga0157379_10457784 3300014968 Unclassified 1179
477 Ga0157376_10110807 3300014969 Bacteria 2416
478 Ga0157376_10211041 3300014969 Bacteria 1792
479 Ga0163161_10005760 3300017792 Bacteria 8588
480 Ga0163161_10009336 3300017792 Bacteria 6788
481 Ga0163161_10058311 3300017792 Bacteria 2807
482 Ga0163161_10092466 3300017792 Bacteria 2240
483 Ga0163161_10115685 3300017792 Bacteria 2010
484 Ga0163161_10164663 3300017792 Bacteria 1692
485 Ga0209233_1000006 3300025261 Bacteria 1473685
486 Ga0207697_10000216 3300025315 Bacteria 30924
487 Ga0207697_10037319 3300025315 Bacteria 1990
488 Ga0207697_10107937 3300025315 Bacteria 1191
489 Ga0207656_10004877 3300025321 Bacteria 4709
490 Ga0207656_10006456 3300025321 Bacteria 4217
491 Ga0207656_10048950 3300025321 Bacteria 1821
492 Ga0207656_10056489 3300025321 Bacteria 1711
493 Ga0207682_10000562 3300025893 Bacteria 17168
494 Ga0207682_10011048 3300025893 Bacteria 3534
495 Ga0207682_10059829 3300025893 Bacteria 1592
496 Ga0207692_10031899 3300025898 Bacteria 2527
497 Ga0207642_10009070 3300025899 Bacteria 3445
498 Ga0207642_10093563 3300025899 Bacteria 1491
499 Ga0207688_10003213 3300025901 Bacteria 8922
500 Ga0207688_10073106 3300025901 Bacteria 1948
501 Ga0207680_10034296 3300025903 Bacteria 2903
502 Ga0207680_10038066 3300025903 Bacteria 2782
503 Ga0207647_10081070 3300025904 Bacteria 1945
504 Ga0207685_10016678 3300025905 Bacteria 2356
505 Ga0207685_10064624 3300025905 Bacteria 1462
506 Ga0207699_10021772 3300025906 Bacteria 3462
507 Ga0207645_10002486 3300025907 Bacteria 14465
508 Ga0207645_10008487 3300025907 Bacteria 7164
509 Ga0207645_10011260 3300025907 Bacteria 6114
510 Ga0207645_10091967 3300025907 Bacteria 1951
511 Ga0207645_10096320 3300025907 Bacteria 1906
512 Ga0207643_10000644 3300025908 Bacteria 21805
513 Ga0207643_10066982 3300025908 Bacteria 2060
514 Ga0207705_10020558 3300025909 Bacteria 4714
515 Ga0207705_10035534 3300025909 Bacteria 3565
516 Ga0207705_10124684 3300025909 Bacteria 1913
517 Ga0207684_10144691 3300025910 Bacteria 2044
518 Ga0207654_10011806 3300025911 Bacteria 4461
519 Ga0207654_10053110 3300025911 Bacteria 2338
520 Ga0207654_10063604 3300025911 Bacteria 2166
521 Ga0207707_10000488 3300025912 Bacteria 40995
522 Ga0207707_10001835 3300025912 Bacteria 19461
523 Ga0207707_10010732 3300025912 Bacteria 7960
524 Ga0207707_10012332 3300025912 Bacteria 7428
525 Ga0207707_10013729 3300025912 Bacteria 7063
526 Ga0207707_10056533 3300025912 Bacteria 3414
527 Ga0207707_10175400 3300025912 Bacteria 1873
528 Ga0207695_10018422 3300025913 Bacteria 8075
529 Ga0207695_10048690 3300025913 Bacteria 4474
530 Ga0207695_10052705 3300025913 Bacteria 4260
531 Ga0207695_10222137 3300025913 Bacteria 1796
532 Ga0207695_10287376 3300025913 Bacteria 1537
533 Ga0207695_10363728 3300025913 Bacteria 1333
534 Ga0207695_10386028 3300025913 Bacteria 1285
535 Ga0207671_10033505 3300025914 Bacteria 3820
536 Ga0207671_10103813 3300025914 Bacteria 2156
537 Ga0207663_10137336 3300025916 Bacteria 1698
538 Ga0207663_10196658 3300025916 Bacteria 1451
539 Ga0207660_10003306 3300025917 Bacteria 10546
540 Ga0207662_10001612 3300025918 Bacteria 11044
541 Ga0207662_10004513 3300025918 Bacteria 7333
542 Ga0207657_10000597 3300025919 Bacteria 38289
543 Ga0207657_10008264 3300025919 Bacteria 10593
544 Ga0207657_10009051 3300025919 Bacteria 10053
545 Ga0207657_10017593 3300025919 Bacteria 6848
546 Ga0207657_10110352 3300025919 Bacteria 2272
547 Ga0207657_10132940 3300025919 Bacteria 2038
548 Ga0207649_10006758 3300025920 Bacteria 6231
549 Ga0207649_10014503 3300025920 Bacteria 4415
550 Ga0207649_10017735 3300025920 Bacteria 4036
551 Ga0207649_10027905 3300025920 Bacteria 3318
552 Ga0207649_10061996 3300025920 Bacteria 2356
553 Ga0207652_10002959 3300025921 Bacteria 14201
554 Ga0207652_10003559 3300025921 Bacteria 12853
555 Ga0207652_10013696 3300025921 Bacteria 6558
556 Ga0207652_10028821 3300025921 Bacteria 4635
557 Ga0207652_10057982 3300025921 Bacteria 3336
558 Ga0207652_10288848 3300025921 Bacteria 1480
559 Ga0207652_10342178 3300025921 Bacteria 1350
560 Ga0207646_10033893 3300025922 Unclassified 4615
561 Ga0207681_10000628 3300025923 Bacteria 23614
562 Ga0207681_10011423 3300025923 Bacteria 5456
563 Ga0207694_10000689 3300025924 Bacteria 30335
564 Ga0207694_10017919 3300025924 Bacteria 5354
565 Ga0207694_10018225 3300025924 Bacteria 5306
566 Ga0207694_10040626 3300025924 Bacteria 3582
567 Ga0207694_10106288 3300025924 Bacteria 2229
568 Ga0207650_10004273 3300025925 Bacteria 9750
569 Ga0207650_10008575 3300025925 Bacteria 6981
570 Ga0207650_10016110 3300025925 Bacteria 5219
571 Ga0207650_10020114 3300025925 Bacteria 4702
572 Ga0207650_10072926 3300025925 Unclassified 2585
573 Ga0207650_10073305 3300025925 Bacteria 2578
574 Ga0207650_10095448 3300025925 Bacteria 2280
575 Ga0207659_10011585 3300025926 Bacteria 5576
576 Ga0207659_10014247 3300025926 Bacteria 5119
577 Ga0207659_10014701 3300025926 Bacteria 5055
578 Ga0207659_10015263 3300025926 Bacteria 4972
579 Ga0207659_10046137 3300025926 Bacteria 3076
580 Ga0207659_10059278 3300025926 Bacteria 2751
581 Ga0207687_10049887 3300025927 Bacteria 2912
582 Ga0207687_10065323 3300025927 Bacteria 2583
583 Ga0207687_10203459 3300025927 Bacteria 1549
584 Ga0207700_10001479 3300025928 Bacteria 13324
585 Ga0207700_10018411 3300025928 Bacteria 4691
586 Ga0207700_10060966 3300025928 Bacteria 2859
587 Ga0207664_10146006 3300025929 Unclassified 2006
588 Ga0207664_10221127 3300025929 Bacteria 1642
589 Ga0207664_10238941 3300025929 Bacteria 1581
590 Ga0207664_10290266 3300025929 Bacteria 1437
591 Ga0207644_10005464 3300025931 Bacteria 8275
592 Ga0207644_10006258 3300025931 Bacteria 7755
593 Ga0207644_10065375 3300025931 Bacteria 2645
594 Ga0207644_10112764 3300025931 Bacteria 2058
595 Ga0207644_10165523 3300025931 Bacteria 1722
596 Ga0207644_10202480 3300025931 Bacteria 1566
597 Ga0207644_10251436 3300025931 Bacteria 1410
598 Ga0207690_10002519 3300025932 Bacteria 11074
599 Ga0207690_10024447 3300025932 Bacteria 3784
600 Ga0207690_10096338 3300025932 Bacteria 2104
601 Ga0207690_10142608 3300025932 Bacteria 1767
602 Ga0207690_10228794 3300025932 Bacteria 1426
603 Ga0207690_10339488 3300025932 Bacteria 1185
604 Ga0207706_10000219 3300025933 Bacteria 62762
605 Ga0207706_10003487 3300025933 Bacteria 15017
606 Ga0207706_10035369 3300025933 Bacteria 4442
607 Ga0207706_10075071 3300025933 Bacteria 2973
608 Ga0207706_10103515 3300025933 Bacteria 2504
609 Ga0207706_10161633 3300025933 Bacteria 1969
610 Ga0207706_10210836 3300025933 Bacteria 1703
611 Ga0207706_10231594 3300025933 Bacteria 1616
612 Ga0207686_10002293 3300025934 Bacteria 10484
613 Ga0207686_10032917 3300025934 Bacteria 3089
614 Ga0207686_10052662 3300025934 Bacteria 2541
615 Ga0207686_10261813 3300025934 Bacteria 1268
616 Ga0207709_10009875 3300025935 Bacteria 5255
617 Ga0207709_10020133 3300025935 Bacteria 3760
618 Ga0207709_10123174 3300025935 Bacteria 1754
619 Ga0207709_10361711 3300025935 Bacteria 1099
620 Ga0207670_10005516 3300025936 Bacteria 6952
621 Ga0207670_10104124 3300025936 Bacteria 2032
622 Ga0207670_10118502 3300025936 Bacteria 1920
623 Ga0207669_10002317 3300025937 Bacteria 8103
624 Ga0207669_10003416 3300025937 Bacteria 6869
625 Ga0207704_10046683 3300025938 Bacteria 2583
626 Ga0207704_10061122 3300025938 Bacteria 2335
627 Ga0207704_10108066 3300025938 Bacteria 1873
628 Ga0207665_10083588 3300025939 Bacteria 2202
629 Ga0207691_10001582 3300025940 Bacteria 22601
630 Ga0207691_10002087 3300025940 Bacteria 19514
631 Ga0207691_10003398 3300025940 Bacteria 15481
632 Ga0207691_10007816 3300025940 Bacteria 10298
633 Ga0207691_10011044 3300025940 Bacteria 8666
634 Ga0207691_10015515 3300025940 Bacteria 7242
635 Ga0207691_10061013 3300025940 Bacteria 3425
636 Ga0207691_10180852 3300025940 Bacteria 1843
637 Ga0207711_10040500 3300025941 Bacteria 3964
638 Ga0207711_10048738 3300025941 Bacteria 3624
639 Ga0207711_10059292 3300025941 Bacteria 3295
640 Ga0207711_10063752 3300025941 Unclassified 3182
641 Ga0207689_10002749 3300025942 Bacteria 16265
642 Ga0207689_10005026 3300025942 Bacteria 11918
643 Ga0207689_10006102 3300025942 Bacteria 10657
644 Ga0207689_10158012 3300025942 Bacteria 1869
645 Ga0207661_10031643 3300025944 Bacteria 4090
646 Ga0207661_10042897 3300025944 Bacteria 3568
647 Ga0207661_10142399 3300025944 Bacteria 2064
648 Ga0207679_10003739 3300025945 Bacteria 9436
649 Ga0207679_10012906 3300025945 Bacteria 5465
650 Ga0207679_10014845 3300025945 Bacteria 5132
651 Ga0207679_10028224 3300025945 Bacteria 3891
652 Ga0207679_10065327 3300025945 Bacteria 2722
653 Ga0207679_10291587 3300025945 Bacteria 1403
654 Ga0207667_10001002 3300025949 Bacteria 36041
655 Ga0207667_10002417 3300025949 Bacteria 23394
656 Ga0207667_10009664 3300025949 Bacteria 11344
657 Ga0207667_10033016 3300025949 Bacteria 5570
658 Ga0207667_10059052 3300025949 Bacteria 4020
659 Ga0207667_10159927 3300025949 Bacteria 2317
660 Ga0207667_10186398 3300025949 Bacteria 2130
661 Ga0207667_10194568 3300025949 Bacteria 2080
662 Ga0207667_10416310 3300025949 Bacteria 1367
663 Ga0207651_10003551 3300025960 Bacteria 7665
664 Ga0207651_10004311 3300025960 Bacteria 7143
665 Ga0207651_10032494 3300025960 Bacteria 3352
666 Ga0207651_10285501 3300025960 Bacteria 1366
667 Ga0207712_10080945 3300025961 Bacteria 2364
668 Ga0207668_10059070 3300025972 Bacteria 2684
669 Ga0207640_10023035 3300025981 Bacteria 3738
670 Ga0207640_10023678 3300025981 Bacteria 3694
671 Ga0207640_10081646 3300025981 Bacteria 2211
672 Ga0207640_10159679 3300025981 Bacteria 1666
673 Ga0207640_10166189 3300025981 Bacteria 1639
674 Ga0207658_10010303 3300025986 Bacteria 6353
675 Ga0207658_10108833 3300025986 Bacteria 2187
676 Ga0207658_10116187 3300025986 Unclassified 2125
677 Ga0207658_10331516 3300025986 Bacteria 1320
678 Ga0207677_10007514 3300026023 Bacteria 6038
679 Ga0207677_10011648 3300026023 Bacteria 5019
680 Ga0207677_10034343 3300026023 Bacteria 3283
681 Ga0207677_10036565 3300026023 Bacteria 3202
682 Ga0207677_10052681 3300026023 Bacteria 2766
683 Ga0207677_10095286 3300026023 Bacteria 2175
684 Ga0207677_10098474 3300026023 Bacteria 2145
685 Ga0207677_10220689 3300026023 Bacteria 1520
686 Ga0207703_10002627 3300026035 Bacteria 15507
687 Ga0207703_10004833 3300026035 Bacteria 10965
688 Ga0207703_10014803 3300026035 Bacteria 6086
689 Ga0207703_10020388 3300026035 Bacteria 5184
690 Ga0207703_10020487 3300026035 Bacteria 5171
691 Ga0207703_10041958 3300026035 Bacteria 3668
692 Ga0207639_10004058 3300026041 Bacteria 9878
693 Ga0207639_10007080 3300026041 Bacteria 7649
694 Ga0207639_10038652 3300026041 Bacteria 3551
695 Ga0207639_10039023 3300026041 Bacteria 3536
696 Ga0207639_10211197 3300026041 Bacteria 1671
697 Ga0207639_10222754 3300026041 Bacteria 1630
698 Ga0207678_10003590 3300026067 Bacteria 13943
699 Ga0207678_10005641 3300026067 Bacteria 11188
700 Ga0207678_10010641 3300026067 Bacteria 8082
701 Ga0207678_10028171 3300026067 Bacteria 4905
702 Ga0207708_10001426 3300026075 Bacteria 17937
703 Ga0207708_10026793 3300026075 Bacteria 4364
704 Ga0207708_10056430 3300026075 Bacteria 2996
705 Ga0207708_10121968 3300026075 Bacteria 2031
706 Ga0207708_10137761 3300026075 Bacteria 1912
707 Ga0207702_10002800 3300026078 Bacteria 16335
708 Ga0207702_10024502 3300026078 Bacteria 5007
709 Ga0207702_10039420 3300026078 Bacteria 3957
710 Ga0207702_10049543 3300026078 Bacteria 3545
711 Ga0207702_10144585 3300026078 Bacteria 2156
712 Ga0207702_10160811 3300026078 Bacteria 2051
713 Ga0207702_10180515 3300026078 Bacteria 1943
714 Ga0207641_10004097 3300026088 Bacteria 12706
715 Ga0207641_10024578 3300026088 Bacteria 4965
716 Ga0207641_10073858 3300026088 Bacteria 2940
717 Ga0207641_10172024 3300026088 Bacteria 1978
718 Ga0207641_10189365 3300026088 Bacteria 1890
719 Ga0207648_10002639 3300026089 Bacteria 19155
720 Ga0207648_10004813 3300026089 Bacteria 13776
721 Ga0207648_10005629 3300026089 Bacteria 12588
722 Ga0207648_10008791 3300026089 Bacteria 9729
723 Ga0207648_10078581 3300026089 Bacteria 2878
724 Ga0207648_10103986 3300026089 Bacteria 2490
725 Ga0207676_10031227 3300026095 Bacteria 4005
726 Ga0207676_10046477 3300026095 Bacteria 3359
727 Ga0207676_10140106 3300026095 Bacteria 2069
728 Ga0207676_10279814 3300026095 Bacteria 1514
729 Ga0207674_10000902 3300026116 Bacteria 38847
730 Ga0207674_10001525 3300026116 Bacteria 29849
731 Ga0207674_10009798 3300026116 Bacteria 10911
732 Ga0207674_10021100 3300026116 Bacteria 7023
733 Ga0207674_10060201 3300026116 Bacteria 3840
734 Ga0207675_100002605 3300026118 Bacteria 17862
735 Ga0207675_100004408 3300026118 Bacteria 13592
736 Ga0207675_100004974 3300026118 Bacteria 12804
737 Ga0207675_100022053 3300026118 Bacteria 5928
738 Ga0207675_100031808 3300026118 Bacteria 4916
739 Ga0207675_100132224 3300026118 Bacteria 2366
740 Ga0207675_100204080 3300026118 Bacteria 1899
741 Ga0207683_10016957 3300026121 Bacteria 6199
742 Ga0207683_10019632 3300026121 Bacteria 5776
743 Ga0207683_10034724 3300026121 Bacteria 4384
744 Ga0207683_10111765 3300026121 Bacteria 2446
745 Ga0207683_10223041 3300026121 Bacteria 1718
746 Ga0207698_10002721 3300026142 Bacteria 10525
747 Ga0207698_10018975 3300026142 Bacteria 4696
748 Ga0207698_10027637 3300026142 Bacteria 4031
749 Ga0207698_10029443 3300026142 Bacteria 3933
750 Ga0207698_10033043 3300026142 Bacteria 3755
751 Ga0207698_10057570 3300026142 Bacteria 3008
752 Ga0207698_10147748 3300026142 Bacteria 2035
753 Ga0207698_10185553 3300026142 Bacteria 1847
754 Ga0207698_10387527 3300026142 Bacteria 1331
755 Ga0209969_1006154 3300027360 Bacteria 1688
756 Ga0209967_1000891 3300027364 Bacteria 3825
757 Ga0209996_1007691 3300027395 Bacteria 1406
758 Ga0210000_1003624 3300027462 Bacteria 2229
759 Ga0209995_1004941 3300027471 Bacteria 2138
760 Ga0209999_1003499 3300027543 Bacteria 2813
761 Ga0209970_1014801 3300027614 Bacteria 1297
762 Ga0209983_1020214 3300027665 Bacteria 1386
763 Ga0209588_1010880 3300027671 Bacteria 2741
764 Ga0209588_1022699 3300027671 Unclassified 1975
765 Ga0209588_1023592 3300027671 Bacteria 1940
766 Ga0209588_1053368 3300027671 Bacteria 1307
767 Ga0209971_1002265 3300027682 Bacteria 4652
768 Ga0209966_1010981 3300027695 Bacteria 1643
769 Ga0209974_10010667 3300027876 Bacteria 3100
770 Ga0209974_10018429 3300027876 Bacteria 2316
771 Ga0207428_10001635 3300027907 Bacteria 23301
772 Ga0207428_10003216 3300027907 Bacteria 15962
773 Ga0207428_10006405 3300027907 Bacteria 10877
774 Ga0268266_10003598 3300028379 Bacteria 15330
775 Ga0268266_10233017 3300028379 Bacteria 1696
776 Ga0268265_10085610 3300028380 Bacteria 2502
777 Ga0268264_10005765 3300028381 Bacteria 10501
778 Ga0268264_10046514 3300028381 Bacteria 3604
779 Ga0268264_10050783 3300028381 Bacteria 3454
780 Ga0307511_10000014 3300030521 Bacteria 127602
781 Ga0265327_10020487 3300031251 Bacteria 4026
782 Ga0307408_100088380 3300031548 Bacteria 2334
783 Ga0307408_100132452 3300031548 Unclassified 1946
784 Ga0307408_100142806 3300031548 Bacteria 1881
785 Ga0307408_100178274 3300031548 Bacteria 1702
786 Ga0307408_100289744 3300031548 Bacteria 1367
787 Ga0316575_10012984 3300031665 Unclassified 3108
788 Ga0316579_10003762 3300031691 Bacteria 5972
789 Ga0265314_10085785 3300031711 Bacteria 2063
790 Ga0316576_10052103 3300031727 Bacteria 2980
791 Ga0316578_10082046 3300031728 Bacteria 1919
792 Ga0307405_10016127 3300031731 Bacteria 4066
793 Ga0307405_10105571 3300031731 Bacteria 1898
794 Ga0307413_10005609 3300031824 Bacteria 5625
795 Ga0307410_10020492 3300031852 Bacteria 4045
796 Ga0307406_10019162 3300031901 Bacteria 4013
797 Ga0307407_10014669 3300031903 Bacteria 3846
798 Ga0307412_10015586 3300031911 Bacteria 4511
799 Ga0307412_10185295 3300031911 Bacteria 1569
800 Ga0307409_100029550 3300031995 Bacteria 3923
801 Ga0307409_100231366 3300031995 Bacteria 1676
802 Ga0307416_100108580 3300032002 Bacteria 2438
803 Ga0307416_100201636 3300032002 Bacteria 1888
804 Ga0307416_100261121 3300032002 Bacteria 1693
805 Ga0307411_10007310 3300032005 Bacteria 5611
806 Ga0307415_100040854 3300032126 Bacteria 3076
807 Ga0316583_10007901 3300032133 Bacteria 3835
808 Ga0373930_0003199 3300034816 Bacteria 2587
809 Ga0373948_0008077 3300034817 Bacteria 1785
810 Ga0373950_0001718 3300034818 Bacteria 2901
811 Ga0373958_0006012 3300034819 Bacteria 1872
812 Ga0373938_0025469 3300034957 Bacteria 1231
813 Ga0373926_0000691 3300035083 Bacteria 9307
814 Ga0373929_0009119 3300035085 Bacteria 1835
815 Ga0373934_0000289 3300035086 Bacteria 18055
816 Ga0373940_0000565 3300035088 Bacteria 5857
817 Ga0373944_0005865 3300035089 Bacteria 3250
818 Ga0373949_0018448 3300035090 Bacteria 1581
819 Ga0373936_0019373 3300035113 Bacteria 2636
820 Ga0373939_0033645 3300035114 Bacteria 1498
821 Ga0373941_0009408 3300035115 Bacteria 2461
822 Ga0373954_0000484 3300035118 Bacteria 14925
823 Ga0373956_0001718 3300035119 Bacteria 9025
824 Ga0373957_0001264 3300035120 Bacteria 6769
825 Ga0373960_0045780 3300035121 Bacteria 1282
826 Ga0373946_0013068 3300035171 Bacteria 3115
827 Ga0373955_0010749 3300035172 Bacteria 4336
828 Ga0373955_0023788 3300035172 Bacteria 3125
829 Ga0373955_0039688 3300035172 Bacteria 2514
830 Ga0373955_0067605 3300035172 Bacteria 1990
831 Ga0316574_0002262 3300035398 Bacteria 9595
832 Ga0373924_0000582 3300035410 Bacteria 11242
833 Ga0373931_0017335 3300035691 Bacteria 3560
834 Ga0373931_0035082 3300035691 Bacteria 2606
835 Ga0373935_0003902 3300035692 Bacteria 8700
836 Ga0373935_0070124 3300035692 Bacteria 2259
837 Ga0373927_0019789 3300035695 Bacteria 4414
838 Ga0373933_0002023 3300035724 Bacteria 11666
839 Ga0373933_0021909 3300035724 Bacteria 3634
840 Ga0373933_0102242 3300035724 Bacteria 1779
841 Ga0373947_0080390 3300035725 Bacteria 2016
842 Ga0373937_0003830 3300036401 Bacteria 12710
843 Ga0373937_0022043 3300036401 Bacteria 5721
844 Ga0373937_0026093 3300036401 Bacteria 5279
845 Ga0373937_0111776 3300036401 Bacteria 2541
846 Ga0373937_0392011 3300036401 Bacteria 1317
847 Ga0316582_0140386 3300036647 Bacteria 1628
848 Ga0316584_0228114 3300036712 Bacteria 1366
849 Ga0373925_0049631 3300037068 Bacteria 3128
850 Ga0373925_0061702 3300037068 Bacteria 2816
851 Ga0373925_0181992 3300037068 Bacteria 1664
852 Ga0373925_0188269 3300037068 Bacteria 1637
853 Ga0395899_0045749 3300037312 Bacteria 3261
854 Ga0395899_0083691 3300037312 Bacteria 2320
855 Ga0395899_0108161 3300037312 Bacteria 2001
856 Ga0395900_0238572 3300037418 Bacteria 1825
857 Ga0395898_0180237 3300037466 Bacteria 2019
858 Ga0395905_0015984 3300037471 Bacteria 7134
859 Ga0395905_0071506 3300037471 Bacteria 3252
860 Ga0395901_0000729 3300038443 Bacteria 37396
861 Ga0395901_0045640 3300038443 Bacteria 4549
862 Ga0395901_0093598 3300038443 Bacteria 3147
863 Ga0436360_0952238 3300039438 Bacteria 2111
864 Ga0451853_0942648 3300041512 Bacteria 2708
865 Ga0451577_0043517 3300042876 Bacteria 4022
866 Ga0451577_0088937 3300042876 Bacteria 2756
867 Ga0451577_0113786 3300042876 Bacteria 2422
868 Ga0451577_0491035 3300042876 Bacteria 1115
869 Ga0466965_0113183 3300044683 Bacteria 1396
870 Ga0466966_0014661 3300044684 Bacteria 5189
871 Ga0453684_0031061 3300044712 Bacteria 7522
872 Ga0453684_0315055 3300044712 Bacteria 1774
873 Ga0466957_0028139 3300044842 Bacteria 3345
874 Ga0466959_0125903 3300045049 Bacteria 1819
875 Ga0451576_0002498 3300045051 Bacteria 27301
876 Ga0451576_0078608 3300045051 Bacteria 3433
877 Ga0451576_0137444 3300045051 Unclassified 2549
878 Ga0451576_0559934 3300045051 Bacteria 1201
879 Ga0466958_0085784 3300045836 Bacteria 1942
880 Ga0466967_0275697 3300045976 Bacteria 1613
881 Ga0495592_0006058 3300046454 Bacteria 8993
882 Ga0495592_0009699 3300046454 Bacteria 7247
883 Ga0495592_0044376 3300046454 Bacteria 3322
884 Ga0495592_0049642 3300046454 Unclassified 3118
885 Ga0495603_0007518 3300046455 Bacteria 6552
886 Ga0495590_0000034 3300046457 Bacteria 129910
887 Ga0495629_0049696 3300046459 Bacteria 2939
888 Ga0495641_0004760 3300046461 Bacteria 9451
889 Ga0495651_0000574 3300046462 Bacteria 28532
890 Ga0495651_0016494 3300046462 Bacteria 5722
891 Ga0495653_0020912 3300046463 Bacteria 5301
892 Ga0495580_0025733 3300046472 Bacteria 4299
893 Ga0495582_0149338 3300046473 Bacteria 1326
894 Ga0495639_0005479 3300046475 Bacteria 5465
895 Ga0495662_0011180 3300046476 Bacteria 4386
896 Ga0495662_0033282 3300046476 Bacteria 2490
897 Ga0495585_0120384 3300046492 Bacteria 1389
898 Ga0495606_0001824 3300046507 Bacteria 26988
899 Ga0495608_0013523 3300046511 Bacteria 5660
900 Ga0495608_0034400 3300046511 Bacteria 3421
901 Ga0495608_0042922 3300046511 Bacteria 3023
902 Ga0495628_0000543 3300046516 Bacteria 34700
903 Ga0495628_0005452 3300046516 Bacteria 11146
904 Ga0495630_0007503 3300046517 Bacteria 7795
905 Ga0495666_0008789 3300046526 Bacteria 5061
906 Ga0495642_0009600 3300046528 Bacteria 3702
907 Ga0495652_0003566 3300046529 Bacteria 15278
908 Ga0495652_0023115 3300046529 Bacteria 5512
909 Ga0495652_0134146 3300046529 Bacteria 1955
910 Ga0495640_0010290 3300046533 Bacteria 7234
911 Ga0495586_0006461 3300046535 Bacteria 6260
912 Ga0495586_0158137 3300046535 Bacteria 1277
913 Ga0495587_0007005 3300046536 Bacteria 7320
914 Ga0495587_0031005 3300046536 Bacteria 3240
915 Ga0495598_0012301 3300046537 Bacteria 2097
916 Ga0495621_0004562 3300046539 Bacteria 3909
917 Ga0495621_0006661 3300046539 Bacteria 3383
918 Ga0495645_0000148 3300046543 Bacteria 48244
919 Ga0495645_0013622 3300046543 Bacteria 5758
920 Ga0495622_0021130 3300046557 Bacteria 3033
921 Ga0495633_0000258 3300046558 Bacteria 62715
922 Ga0495667_0039142 3300046559 Bacteria 3154
923 Ga0495667_0063864 3300046559 Bacteria 2409
924 Ga0495634_0015391 3300046642 Bacteria 5498
925 Ga0495634_0083214 3300046642 Bacteria 2089
926 Ga0495635_0117467 3300046663 Bacteria 1815
927 Ga0495657_0063121 3300046675 Unclassified 2445
928 Ga0495599_0000218 3300046678 Bacteria 36747
929 Ga0495599_0002735 3300046678 Bacteria 10291
930 Ga0495599_0008382 3300046678 Bacteria 6283
931 Ga0495599_0038764 3300046678 Bacteria 2994
932 Ga0495623_0054211 3300046679 Bacteria 2530
933 Ga0495647_0000869 3300046681 Bacteria 9030
934 Ga0495647_0001858 3300046681 Bacteria 6547
935 Ga0495658_0073081 3300046683 Bacteria 1995
936 Ga0495669_0003249 3300046684 Bacteria 6687
937 Ga0495669_0010940 3300046684 Bacteria 3841
938 Ga0495600_0005651 3300046809 Bacteria 7555
939 Ga0495600_0071528 3300046809 Bacteria 2266
940 Ga0495600_0171604 3300046809 Bacteria 1400
941 Ga0495581_0044285 3300047315 Bacteria 2574
942 Ga0495604_0226883 3300047317 Bacteria 1283
943 Ga0495636_0014648 3300047318 Bacteria 3120
944 Ga0495636_0047233 3300047318 Bacteria 1797
945 Ga0495636_0097484 3300047318 Bacteria 1282
946 Ga0495674_0017611 3300047319 Bacteria 6651
947 Ga0495680_0010727 3300047322 Bacteria 8166
948 Ga0495680_0051021 3300047322 Bacteria 3232
949 Ga0495675_0003535 3300047444 Bacteria 9417
950 Ga0495684_0029980 3300047471 Bacteria 4177
951 Ga0495684_0115486 3300047471 Bacteria 2024
952 Ga0495602_0159436 3300048088 Bacteria 1763
953 Ga0496101_0519903 3300048904 Bacteria 940
954 Ga0496102_0004063 3300048905 Bacteria 12408
955 Ga0496102_0176385 3300048905 Bacteria 2012
956 Ga0496103_0040264 3300048906 Bacteria 2872
957 Ga0496103_0222120 3300048906 Bacteria 1215
958 Ga0496104_0008652 3300048907 Bacteria 9056
959 Ga0496104_0088958 3300048907 Bacteria 2950
960 Ga0496105_0019871 3300048908 Bacteria 5420
961 Ga0496106_0002141 3300048909 Bacteria 14750
962 Ga0496106_0012832 3300048909 Bacteria 6185
963 Ga0496107_0065003 3300048910 Bacteria 2644
964 Ga0496108_0006744 3300048911 Bacteria 9297
965 Ga0496108_0105199 3300048911 Bacteria 2409
966 Ga0496109_0150649 3300048912 Bacteria 2178
967 Ga0496110_0022571 3300048913 Bacteria 5345
968 Ga0496110_0060891 3300048913 Bacteria 3330
969 Ga0496110_0139021 3300048913 Bacteria 2195
970 Ga0496112_0078101 3300048915 Bacteria 3274
971 Ga0496114_0031187 3300048917 Bacteria 4385
972 Ga0496114_0059531 3300048917 Bacteria 3191
973 Ga0501034_0497557 3300049571 Bacteria 1133
974 Ga0501036_0016082 3300049572 Bacteria 6252
975 Ga0501036_0108018 3300049572 Bacteria 2353
976 Ga0501038_0114355 3300049574 Bacteria 2232
977 Ga0501039_0025506 3300049575 Bacteria 4542
978 Ga0501039_0060310 3300049575 Bacteria 2938
979 Ga0501039_0098219 3300049575 Bacteria 2284
980 Ga0501040_0062757 3300049576 Bacteria 2556
981 Ga0501040_0360426 3300049576 Bacteria 1042
982 Ga0501041_0002130 3300049577 Bacteria 11154
983 Ga0501041_0019643 3300049577 Bacteria 4036
984 Ga0501041_0025804 3300049577 Bacteria 3533
985 Ga0501041_0074368 3300049577 Bacteria 2088
986 Ga0501042_0039291 3300049578 Bacteria 3362
987 Ga0501042_0147368 3300049578 Bacteria 1697
988 Ga0501046_0019195 3300049580 Bacteria 5671
989 Ga0501046_0092676 3300049580 Bacteria 2323
990 Ga0501047_0252653 3300049581 Bacteria 1611
991 Ga0501048_0020853 3300049582 Bacteria 4801
992 Ga0501048_0040258 3300049582 Bacteria 3350
993 Ga0501048_0087877 3300049582 Bacteria 2193
994 Ga0501048_0105699 3300049582 Bacteria 1987
995 Ga0501068_0166016 3300049584 Bacteria 1392
996 Ga0501069_0001254 3300049585 Bacteria 12424
997 Ga0501070_0002109 3300049586 Bacteria 17450
998 Ga0501071_0012588 3300049587 Bacteria 5744
999 Ga0501071_0015383 3300049587 Bacteria 5252
1000 Ga0501072_0037675 3300049588 Bacteria 3793
1001 Ga0501072_0051237 3300049588 Bacteria 3251
1002 Ga0501072_0062080 3300049588 Bacteria 2948
1003 Ga0501072_0064281 3300049588 Bacteria 2894
1004 Ga0501072_0065070 3300049588 Bacteria 2875
1005 Ga0501072_0112879 3300049588 Bacteria 2163
1006 Ga0501072_0264167 3300049588 Bacteria 1370
1007 Ga0501073_0002431 3300049589 Bacteria 13929
1008 Ga0501074_0000424 3300049590 Bacteria 25196
1009 Ga0501074_0094931 3300049590 Bacteria 2136
1010 Ga0501075_0000562 3300049591 Bacteria 22528
1011 Ga0501075_0145397 3300049591 Bacteria 1807
1012 Ga0501076_0000938 3300049592 Bacteria 19012
1013 Ga0501076_0020142 3300049592 Bacteria 5105
1014 Ga0501076_0067243 3300049592 Bacteria 2861
1015 Ga0501076_0081069 3300049592 Bacteria 2605
1016 Ga0501077_0017942 3300049593 Bacteria 4473
1017 Ga0501079_0012223 3300049741 Bacteria 6556
1018 Ga0501079_0068166 3300049741 Bacteria 2746
1019 Ga0501079_0280205 3300049741 Bacteria 1304
1020 Ga0501080_0002585 3300049742 Bacteria 15855
1021 Ga0501080_0010496 3300049742 Bacteria 8480
1022 Ga0501080_0016743 3300049742 Bacteria 6770
1023 Ga0501080_0338791 3300049742 Bacteria 1359
1024 Ga0501080_0432557 3300049742 Bacteria 1181
1025 Ga0501081_0011121 3300049743 Bacteria 5885
1026 Ga0501081_0119073 3300049743 Bacteria 1879
1027 Ga0501081_0129667 3300049743 Bacteria 1801
1028 Ga0501083_0000417 3300049744 Bacteria 27243
1029 Ga0501044_0069941 3300049823 Bacteria 3572
1030 Ga0501044_0172302 3300049823 Bacteria 2135
1031 Ga0501045_0015365 3300049824 Bacteria 5435
1032 Ga0501045_0171556 3300049824 Bacteria 1615
1033 Ga0501045_0385938 3300049824 Bacteria 1043
1034 nmdc:mga00v17_261523_c1 3300050491 Bacteria 1123
1035 nmdc:mga0k408_37001_c1 3300050493 Bacteria 2801
1036 nmdc:mga0k408_75544_c1 3300050493 Bacteria 1969
1037 nmdc:mga0k408_96188_c1 3300050493 Bacteria 1743
1038 nmdc:mga05p37_28361_c1 3300050507 Bacteria 6827
1039 nmdc:mga05p37_812205_c1 3300050507 Bacteria 1021
1040 nmdc:mga05p37_92563_c1 3300050507 Bacteria 3725
1041 nmdc:mga09592_26209_c1 3300050508 Bacteria 4829
1042 nmdc:mga09592_31819_c1 3300050508 Bacteria 4397
1043 nmdc:mga09592_322176_c1 3300050508 Bacteria 1339
1044 nmdc:mga09592_8149_c1 3300050508 Bacteria 8521
1045 nmdc:mga0qj67_14885_c1 3300050509 Bacteria 5884
1046 nmdc:mga0qj67_1737_c1 3300050509 Bacteria 15393
1047 nmdc:mga0qj67_208617_c1 3300050509 Bacteria 1587
1048 nmdc:mga0qj67_2113_c1 3300050509 Bacteria 14163
1049 nmdc:mga06r32_630_c1 3300050510 Bacteria 30687
1050 nmdc:mga06r32_9842_c1 3300050510 Bacteria 8626
1051 nmdc:mga08y16_114142_c1 3300050511 Bacteria 2812
1052 nmdc:mga08y16_147_c1 3300050511 Bacteria 61021
1053 nmdc:mga08y16_1975_c1 3300050511 Bacteria 20910
1054 nmdc:mga08y16_2374_c1 3300050511 Bacteria 19329
1055 nmdc:mga08y16_733134_c1 3300050511 Bacteria 985
1056 nmdc:mga0n895_254471_c1 3300050512 Bacteria 1782
1057 nmdc:mga0n895_474041_c1 3300050512 Bacteria 1263
1058 nmdc:mga0n895_4929_c1 3300050512 Bacteria 11074
1059 nmdc:mga0n895_515851_c1 3300050512 Bacteria 1203
1060 nmdc:mga0rr50_2399_c1 3300050513 Bacteria 10544
1061 nmdc:mga0rr50_74688_c1 3300050513 Bacteria 2596
1062 nmdc:mga08x19_100010_c1 3300050514 Bacteria 1923
1063 nmdc:mga08x19_1812_c1 3300050514 Bacteria 13131
1064 nmdc:mga08x19_34299_c1 3300050514 Bacteria 3206
1065 nmdc:mga08x19_36660_c1 3300050514 Bacteria 3107
1066 nmdc:mga08x19_51899_c1 3300050514 Bacteria 2636
1067 nmdc:mga08x19_66616_c1 3300050514 Bacteria 2341
1068 nmdc:mga08x19_95370_c1 3300050514 Bacteria 1968
1069 nmdc:mga0a205_251341_c1 3300050515 Bacteria 1647
1070 nmdc:mga0a205_327551_c1 3300050515 Bacteria 1402
1071 nmdc:mga0a205_3625_c1 3300050515 Bacteria 13823
1072 nmdc:mga0a205_45395_c1 3300050515 Bacteria 4236
1073 Ga0495601_0000966 3300053077 Bacteria 15693
1074 Ga0495601_0008118 3300053077 Bacteria 6190
1075 Ga0495601_0075562 3300053077 Bacteria 2156
1076 Ga0495595_0006819 3300053084 Bacteria 4660
1077 Ga0495595_0021797 3300053084 Bacteria 2803
1078 Ga0500646_0004985 3300053090 Bacteria 3369
1079 Ga0500647_0004257 3300053091 Bacteria 5735
1080 Ga0500583_0048699 3300053092 Bacteria 1957
1081 Ga0500641_0014072 3300053096 Bacteria 2948
1082 Ga0500555_007936 3300053103 Bacteria 3020
1083 Ga0500642_0150229 3300053130 Bacteria 1093
1084 Ga0500655_006266 3300053133 Bacteria 2142
1085 Ga0500568_0044109 3300053139 Bacteria 1780
1086 Ga0500604_0003491 3300053151 Bacteria 4234
1087 Ga0501084_0021415 3300054114 Bacteria 5387
1088 Ga0501084_0051495 3300054114 Bacteria 3446
1089 Ga0501084_0123151 3300054114 Bacteria 2181
1090 Ga0501084_0129845 3300054114 Bacteria 2121
1091 Ga0501084_0184335 3300054114 Bacteria 1762
1092 Ga0501082_0007339 3300060353 Bacteria 9514
1093 Ga0501082_0029507 3300060353 Bacteria 4725
1094 Ga0530510_0017372 3300061734 Bacteria 5099
1095 Ga0373951_0028347
1096 JGI24752J21851_1001828
1097 JGI24743J22301_10004588
1098 JGI24749J21850_1001400
1099 JGI25154J39366_1002207
1100 JGI25150J39212_1006616
1101 Ga0065712_10086265
1102 Ga0065707_10109310
1103 Ga0070658_10010376
1104 Ga0070658_10013504
1105 Ga0070658_10095702
1106 Ga0070658_10391652
1107 Ga0070676_10001388
1108 Ga0070676_10019388
1109 Ga0070683_100002418
1110 Ga0070683_100006182
1111 Ga0070683_100009279
1112 Ga0070690_100007731
1113 Ga0070690_100009216
1114 Ga0070690_100237908
1115 Ga0070670_100009078
1116 Ga0070670_100012760
1117 Ga0070670_100015475
1118 Ga0070670_100025236
1119 Ga0070670_100039128
1120 Ga0070670_100116828
1121 Ga0070670_100157137
1122 Ga0070670_100216436
1123 Ga0070677_10000867
1124 Ga0070677_10014895
1125 Ga0070677_10018540
1126 Ga0070677_10119925
1127 Ga0068869_100001734
1128 Ga0070666_10015635
1129 Ga0070666_10028648
1130 Ga0070666_10043965
1131 Ga0070666_10099967
1132 Ga0070680_100019114
1133 Ga0070680_100023092
1134 Ga0070680_100061902
1135 Ga0070680_100079008
1136 Ga0068868_100081600
1137 Ga0068868_100116805
1138 Ga0068868_100204551
1139 Ga0070660_100002562
1140 Ga0070660_100009931
1141 Ga0070660_100010559
1142 Ga0070660_100044127
1143 Ga0070689_100004065
1144 Ga0070689_100005370
1145 Ga0070689_100259641
1146 Ga0070691_10004121
1147 Ga0070687_100008129
1148 Ga0070661_100001712
1149 Ga0070661_100009588
1150 Ga0070661_100010701
1151 Ga0070661_100024075
1152 Ga0070661_100203165
1153 Ga0070692_10021734
1154 Ga0070668_100011897
1155 Ga0070668_100036191
1156 Ga0070669_100005194
1157 Ga0070669_100053463
1158 Ga0070669_100126544
1159 Ga0070675_100000137
1160 Ga0070675_100014748
1161 Ga0070675_100027761
1162 Ga0070675_100032635
1163 Ga0070675_100100625
1164 Ga0070675_100148191
1165 Ga0070675_100187480
1166 Ga0070671_100004005
1167 Ga0070671_100007543
1168 Ga0070671_100050483
1169 Ga0070671_100074609
1170 Ga0070671_100085101
1171 Ga0070671_100110716
1172 Ga0070671_100135279
1173 Ga0070671_100154474
1174 Ga0070671_100167859
1175 Ga0070671_100370927
1176 Ga0070674_100001534
1177 Ga0070674_100002896
1178 Ga0070674_100026684
1179 Ga0070673_100003040
1180 Ga0070673_100009306
1181 Ga0070673_100041672
1182 Ga0070673_100070427
1183 Ga0070673_100175443
1184 Ga0070688_100029562
1185 Ga0070688_100051301
1186 Ga0070659_100000175
1187 Ga0070659_100008063
1188 Ga0070659_100012176
1189 Ga0070659_100076020
1190 Ga0070659_100150389
1191 Ga0070659_100161438
1192 Ga0070659_100194025
1193 Ga0070667_100005523
1194 Ga0070667_100006609
1195 Ga0070667_100387262
1196 Ga0070714_100010622
1197 Ga0070714_100028647
1198 Ga0070714_100270204
1199 Ga0070713_100008964
1200 Ga0070713_100034284
1201 Ga0070713_100047610
1202 Ga0070701_10005142
1203 Ga0070711_100049035
1204 Ga0070711_100056819
1205 Ga0070711_100237758
1206 Ga0070705_100010412
1207 Ga0070705_100017274
1208 Ga0070705_100089782
1209 Ga0070705_100095371
1210 Ga0070700_100021030
1211 Ga0070700_100022954
1212 Ga0070700_100043324
1213 Ga0070700_100088664
1214 Ga0070694_100000470
1215 Ga0070694_100024015
1216 Ga0070694_100097306
1217 Ga0070663_100001849
1218 Ga0070663_100042138
1219 Ga0070678_100008396
1220 Ga0070678_100015553
1221 Ga0070678_100079036
1222 Ga0070678_100348577
1223 Ga0070662_100001403
1224 Ga0070662_100008803
1225 Ga0070662_100015970
1226 Ga0070662_100081613
1227 Ga0070662_100251898
1228 Ga0070681_10001270
1229 Ga0070681_10001638
1230 Ga0070681_10009996
1231 Ga0070681_10021230
1232 Ga0070681_10193276
1233 Ga0070681_10213669
1234 Ga0070681_10220266
1235 Ga0068867_100005191
1236 Ga0068867_100008773
1237 Ga0068867_100011689
1238 Ga0068867_100067208
1239 Ga0068867_100233574
1240 Ga0070685_10028377
1241 Ga0070685_10041440
1242 Ga0070706_100187242
1243 Ga0070707_100021569
1244 Ga0070698_100203184
1245 Ga0070679_100003978
1246 Ga0070679_100015982
1247 Ga0070679_100037372
1248 Ga0070679_100040925
1249 Ga0070679_100193281
1250 Ga0070679_100236402
1251 Ga0070684_100001319
1252 Ga0070684_100158290
1253 Ga0070684_100247808
1254 Ga0070684_100295543
1255 Ga0070697_100006559
1256 Ga0070697_100039686
1257 Ga0070697_100238020
1258 Ga0068853_100011678
1259 Ga0068853_100043863
1260 Ga0068853_100056381
1261 Ga0068853_100059050
1262 Ga0068853_100214185
1263 Ga0070672_100001388
1264 Ga0070672_100004432
1265 Ga0070672_100005016
1266 Ga0070672_100005192
1267 Ga0070672_100032147
1268 Ga0070672_100043571
1269 Ga0070686_100042266
1270 Ga0070686_100088511
1271 Ga0070695_100004401
1272 Ga0070695_100008602
1273 Ga0070695_100065312
1274 Ga0070695_100357386
1275 Ga0070696_100004905
1276 Ga0070696_100007898
1277 Ga0070696_100011125
1278 Ga0070696_100040120
1279 Ga0070696_100042766
1280 Ga0070696_100120854
1281 Ga0070696_100171370
1282 Ga0070693_100001197
1283 Ga0070693_100005482
1284 Ga0070693_100008979
1285 Ga0070665_100011288
1286 Ga0070665_100045347
1287 Ga0070665_100143675
1288 Ga0070704_100125512
1289 Ga0068855_100001963
1290 Ga0068855_100005684
1291 Ga0068855_100008743
1292 Ga0068855_100010458
1293 Ga0068855_100039890
1294 Ga0068855_100049165
1295 Ga0068855_100124604
1296 Ga0068855_100148182
1297 Ga0070664_100000114
1298 Ga0070664_100004571
1299 Ga0070664_100022146
1300 Ga0070664_100025184
1301 Ga0070664_100040614
1302 Ga0068857_100013587
1303 Ga0068857_100047186
1304 Ga0068857_100086774
1305 Ga0068854_100002976
1306 Ga0068854_100003984
1307 Ga0068854_100007446
1308 Ga0068854_100009227
1309 Ga0068854_100016739
1310 Ga0068854_100024159
1311 Ga0068856_100002277
1312 Ga0068856_100007240
1313 Ga0068856_100036238
1314 Ga0068856_100111925
1315 Ga0068856_100114693
1316 Ga0068856_100175510
1317 Ga0070702_100000217
1318 Ga0068852_100000686
1319 Ga0068852_100005124
1320 Ga0068852_100018526
1321 Ga0068852_100020075
1322 Ga0068852_100020181
1323 Ga0068852_100038214
1324 Ga0068852_100047775
1325 Ga0068852_100099752
1326 Ga0068852_100121786
1327 Ga0068852_100318417
1328 Ga0068859_100006540
1329 Ga0068859_100055744
1330 Ga0068859_100078535
1331 Ga0068859_100078674
1332 Ga0068859_100102240
1333 Ga0068859_100112812
1334 Ga0068859_100120369
1335 Ga0068859_100150433
1336 Ga0068859_100270264
1337 Ga0068859_100429744
1338 Ga0068864_100010266
1339 Ga0068864_100073383
1340 Ga0068864_100167952
1341 Ga0068864_100278358
1342 Ga0068864_100309211
1343 Ga0068866_10002778
1344 Ga0068861_100006831
1345 Ga0068861_100039775
1346 Ga0068861_100199197
1347 Ga0068851_10004802
1348 Ga0068851_10013420
1349 Ga0068851_10014579
1350 Ga0068851_10034364
1351 Ga0068851_10079406
1352 Ga0068851_10080423
1353 Ga0068870_10007971
1354 Ga0068863_100006537
1355 Ga0068863_100082340
1356 Ga0068863_100123185
1357 Ga0068863_100175758
1358 Ga0068858_100002592
1359 Ga0068858_100004509
1360 Ga0068858_100032816
1361 Ga0068858_100090670
1362 Ga0068858_100396629
1363 Ga0068860_100001281
1364 Ga0068860_100017705
1365 Ga0068860_100028330
1366 Ga0068860_100076675
1367 Ga0068860_100116174
1368 Ga0068860_100283786
1369 Ga0068862_100029306
1370 Ga0068862_100118706
1371 Ga0081539_10000556
1372 Ga0070717_10178146
1373 Ga0075364_10021367
1374 Ga0075432_10068970
1375 Ga0070715_10025093
1376 Ga0070715_10053842
1377 Ga0075369_10011266
1378 Ga0075366_10010951
1379 Ga0075366_10049662
1380 Ga0097621_100004498
1381 Ga0097621_100023024
1382 Ga0097621_100024138
1383 Ga0097621_100041796
1384 Ga0097621_100058629
1385 Ga0097621_100145333
1386 Ga0097621_100290270
1387 Ga0097621_100382953
1388 Ga0068871_100006783
1389 Ga0068871_100008768
1390 Ga0068871_100019357
1391 Ga0068871_100020562
1392 Ga0068871_100047633
1393 Ga0068871_100073500
1394 Ga0068871_100098215
1395 Ga0075428_100001613
1396 Ga0075428_100005808
1397 Ga0075428_100006194
1398 Ga0075428_100006591
1399 Ga0075428_100027683
1400 Ga0075430_100000656
1401 Ga0075430_100006045
1402 Ga0075430_100020605
1403 Ga0075430_100024126
1404 Ga0075431_100071904
1405 Ga0075431_100318915
1406 Ga0075433_10052115
1407 Ga0075433_10177711
1408 Ga0075433_10313142
1409 Ga0075434_100000732
1410 Ga0075434_100004372
1411 Ga0075434_100093764
1412 Ga0075434_100113341
1413 Ga0075434_100525050
1414 Ga0075434_100527598
1415 Ga0075429_100000412
1416 Ga0075429_100055794
1417 Ga0075429_100062473
1418 Ga0075429_100254463
1419 Ga0068865_100007504
1420 Ga0068865_100031209
1421 Ga0068865_100031976
1422 Ga0068865_100036842
1423 Ga0068865_100132792
1424 Ga0075436_100000500
1425 Ga0075436_100003442
1426 Ga0075436_100005957
1427 Ga0075436_100024467
1428 Ga0075436_100036088
1429 Ga0075436_100076355
1430 Ga0075436_100079467
1431 Ga0097620_100006539
1432 Ga0097620_100055743
1433 Ga0097620_100078535
1434 Ga0097620_100078677
1435 Ga0097620_100102250
1436 Ga0097620_100112816
1437 Ga0097620_100120368
1438 Ga0097620_100150431
1439 Ga0097620_100270244
1440 Ga0097620_100429723
1441 Ga0075435_100002000
1442 Ga0075435_100065216
1443 Ga0075435_100375625
1444 Ga0075435_100431955
1445 Ga0099794_10002061
1446 Ga0105240_10008339
1447 Ga0105240_10029860
1448 Ga0105240_10076438
1449 Ga0105240_10115588
1450 Ga0105240_10198834
1451 Ga0105240_10226422
1452 Ga0111539_10000774
1453 Ga0111539_10001599
1454 Ga0111539_10036691
1455 Ga0111539_10085639
1456 Ga0111539_10480340
1457 Ga0111539_10501259
1458 Ga0105245_10015101
1459 Ga0105245_10053450
1460 Ga0114129_10001648
1461 Ga0114129_10041809
1462 Ga0114129_10047169
1463 Ga0114129_10078122
1464 Ga0114129_10188876
1465 Ga0105243_10013368
1466 Ga0105243_10043196
1467 Ga0105243_10071301
1468 Ga0105243_10105802
1469 Ga0105243_10340669
1470 Ga0105243_10354386
1471 Ga0105241_10000793
1472 Ga0105241_10010605
1473 Ga0105241_10032487
1474 Ga0105241_10080099
1475 Ga0105241_10104110
1476 Ga0105241_10371059
1477 Ga0105242_10001017
1478 Ga0105242_10007971
1479 Ga0105242_10065185
1480 Ga0105248_10001350
1481 Ga0105248_10006705
1482 Ga0105248_10030011
1483 Ga0105248_10037365
1484 Ga0105248_10080575
1485 Ga0105248_10159504
1486 Ga0105248_10240435
1487 Ga0105248_10311268
1488 Ga0105237_10020839
1489 Ga0105237_10035610
1490 Ga0105237_10174101
1491 Ga0105238_10001520
1492 Ga0105238_10045880
1493 Ga0105238_10096720
1494 Ga0105238_10139350
1495 Ga0105249_10071642
1496 Ga0099796_10054953
1497 Ga0105239_10059640
1498 Ga0105239_10160355
1499 Ga0105239_10315749
1500 Ga0105246_10236272
1501 Ga0157373_10000792
1502 Ga0157373_10004951
1503 Ga0157373_10013069
1504 Ga0157371_10000498
1505 Ga0157371_10007316
1506 Ga0157370_10008522
1507 Ga0157370_10012125
1508 Ga0157370_10026167
1509 Ga0157370_10094856
1510 Ga0157370_10195379
1511 Ga0157370_10288821
1512 Ga0157370_10523229
1513 Ga0157369_10009905
1514 Ga0157369_10015273
1515 Ga0157369_10060070
1516 Ga0157369_10250681
1517 Ga0157369_10359357
1518 Ga0157374_10004692
1519 Ga0157374_10040493
1520 Ga0157374_10159436
1521 Ga0157374_10269539
1522 Ga0157374_10532110
1523 Ga0157378_10016123
1524 Ga0157378_10047311
1525 Ga0157378_10050329
1526 Ga0157378_10227172
1527 Ga0157378_10347690
1528 Ga0157378_10407884
1529 Ga0157378_10462007
1530 Ga0163162_10021677
1531 Ga0163162_10043178
1532 Ga0163162_10207207
1533 Ga0163162_10256461
1534 Ga0163162_10503460
1535 Ga0163162_10546317
1536 Ga0157372_10005513
1537 Ga0157372_10006902
1538 Ga0157372_10019239
1539 Ga0157372_10031050
1540 Ga0157372_10035070
1541 Ga0157372_10058676
1542 Ga0157372_10154300
1543 Ga0157372_10209896
1544 Ga0157372_10238578
1545 Ga0157372_10310938
1546 Ga0157372_10320301
1547 Ga0157375_10002449
1548 Ga0157375_10014787
1549 Ga0157375_10070717
1550 Ga0157375_10079156
1551 Ga0157375_10081266
1552 Ga0157375_10091687
1553 Ga0157375_10112298
1554 Ga0157375_10330935
1555 Ga0163163_10050470
1556 Ga0163163_10139494
1557 Ga0163163_10228277
1558 Ga0163163_10482585
1559 Ga0157380_10006083
1560 Ga0157380_10010510
1561 Ga0157380_10010974
1562 Ga0157380_10024855
1563 Ga0157380_10224272
1564 Ga0182008_10033922
1565 Ga0157377_10000549
1566 Ga0157379_10001431
1567 Ga0157379_10022403
1568 Ga0157379_10062297
1569 Ga0157379_10307038
1570 Ga0157379_10457784
1571 Ga0157376_10110807
1572 Ga0157376_10211041
1573 Ga0163161_10005760
1574 Ga0163161_10009336
1575 Ga0163161_10058311
1576 Ga0163161_10092466
1577 Ga0163161_10115685
1578 Ga0163161_10164663
1579 Ga0209233_1000006
1580 Ga0207697_10000216
1581 Ga0207697_10037319
1582 Ga0207697_10107937
1583 Ga0207656_10004877
1584 Ga0207656_10006456
1585 Ga0207656_10048950
1586 Ga0207656_10056489
1587 Ga0207682_10000562
1588 Ga0207682_10011048
1589 Ga0207682_10059829
1590 Ga0207692_10031899
1591 Ga0207642_10009070
1592 Ga0207642_10093563
1593 Ga0207688_10003213
1594 Ga0207688_10073106
1595 Ga0207680_10034296
1596 Ga0207680_10038066
1597 Ga0207647_10081070
1598 Ga0207685_10016678
1599 Ga0207685_10064624
1600 Ga0207699_10021772
1601 Ga0207645_10002486
1602 Ga0207645_10008487
1603 Ga0207645_10011260
1604 Ga0207645_10091967
1605 Ga0207645_10096320
1606 Ga0207643_10000644
1607 Ga0207643_10066982
1608 Ga0207705_10020558
1609 Ga0207705_10035534
1610 Ga0207705_10124684
1611 Ga0207684_10144691
1612 Ga0207654_10011806
1613 Ga0207654_10053110
1614 Ga0207654_10063604
1615 Ga0207707_10000488
1616 Ga0207707_10001835
1617 Ga0207707_10010732
1618 Ga0207707_10012332
1619 Ga0207707_10013729
1620 Ga0207707_10056533
1621 Ga0207707_10175400
1622 Ga0207695_10018422
1623 Ga0207695_10048690
1624 Ga0207695_10052705
1625 Ga0207695_10222137
1626 Ga0207695_10287376
1627 Ga0207695_10363728
1628 Ga0207695_10386028
1629 Ga0207671_10033505
1630 Ga0207671_10103813
1631 Ga0207663_10137336
1632 Ga0207663_10196658
1633 Ga0207660_10003306
1634 Ga0207662_10001612
1635 Ga0207662_10004513
1636 Ga0207657_10000597
1637 Ga0207657_10008264
1638 Ga0207657_10009051
1639 Ga0207657_10017593
1640 Ga0207657_10110352
1641 Ga0207657_10132940
1642 Ga0207649_10006758
1643 Ga0207649_10014503
1644 Ga0207649_10017735
1645 Ga0207649_10027905
1646 Ga0207649_10061996
1647 Ga0207652_10002959
1648 Ga0207652_10003559
1649 Ga0207652_10013696
1650 Ga0207652_10028821
1651 Ga0207652_10057982
1652 Ga0207652_10288848
1653 Ga0207652_10342178
1654 Ga0207646_10033893
1655 Ga0207681_10000628
1656 Ga0207681_10011423
1657 Ga0207694_10000689
1658 Ga0207694_10017919
1659 Ga0207694_10018225
1660 Ga0207694_10040626
1661 Ga0207694_10106288
1662 Ga0207650_10004273
1663 Ga0207650_10008575
1664 Ga0207650_10016110
1665 Ga0207650_10020114
1666 Ga0207650_10072926
1667 Ga0207650_10073305
1668 Ga0207650_10095448
1669 Ga0207659_10011585
1670 Ga0207659_10014247
1671 Ga0207659_10014701
1672 Ga0207659_10015263
1673 Ga0207659_10046137
1674 Ga0207659_10059278
1675 Ga0207687_10049887
1676 Ga0207687_10065323
1677 Ga0207687_10203459
1678 Ga0207700_10001479
1679 Ga0207700_10018411
1680 Ga0207700_10060966
1681 Ga0207664_10146006
1682 Ga0207664_10221127
1683 Ga0207664_10238941
1684 Ga0207664_10290266
1685 Ga0207644_10005464
1686 Ga0207644_10006258
1687 Ga0207644_10065375
1688 Ga0207644_10112764
1689 Ga0207644_10165523
1690 Ga0207644_10202480
1691 Ga0207644_10251436
1692 Ga0207690_10002519
1693 Ga0207690_10024447
1694 Ga0207690_10096338
1695 Ga0207690_10142608
1696 Ga0207690_10228794
1697 Ga0207690_10339488
1698 Ga0207706_10000219
1699 Ga0207706_10003487
1700 Ga0207706_10035369
1701 Ga0207706_10075071
1702 Ga0207706_10103515
1703 Ga0207706_10161633
1704 Ga0207706_10210836
1705 Ga0207706_10231594
1706 Ga0207686_10002293
1707 Ga0207686_10032917
1708 Ga0207686_10052662
1709 Ga0207686_10261813
1710 Ga0207709_10009875
1711 Ga0207709_10020133
1712 Ga0207709_10123174
1713 Ga0207709_10361711
1714 Ga0207670_10005516
1715 Ga0207670_10104124
1716 Ga0207670_10118502
1717 Ga0207669_10002317
1718 Ga0207669_10003416
1719 Ga0207704_10046683
1720 Ga0207704_10061122
1721 Ga0207704_10108066
1722 Ga0207665_10083588
1723 Ga0207691_10001582
1724 Ga0207691_10002087
1725 Ga0207691_10003398
1726 Ga0207691_10007816
1727 Ga0207691_10011044
1728 Ga0207691_10015515
1729 Ga0207691_10061013
1730 Ga0207691_10180852
1731 Ga0207711_10040500
1732 Ga0207711_10048738
1733 Ga0207711_10059292
1734 Ga0207711_10063752
1735 Ga0207689_10002749
1736 Ga0207689_10005026
1737 Ga0207689_10006102
1738 Ga0207689_10158012
1739 Ga0207661_10031643
1740 Ga0207661_10042897
1741 Ga0207661_10142399
1742 Ga0207679_10003739
1743 Ga0207679_10012906
1744 Ga0207679_10014845
1745 Ga0207679_10028224
1746 Ga0207679_10065327
1747 Ga0207679_10291587
1748 Ga0207667_10001002
1749 Ga0207667_10002417
1750 Ga0207667_10009664
1751 Ga0207667_10033016
1752 Ga0207667_10059052
1753 Ga0207667_10159927
1754 Ga0207667_10186398
1755 Ga0207667_10194568
1756 Ga0207667_10416310
1757 Ga0207651_10003551
1758 Ga0207651_10004311
1759 Ga0207651_10032494
1760 Ga0207651_10285501
1761 Ga0207712_10080945
1762 Ga0207668_10059070
1763 Ga0207640_10023035
1764 Ga0207640_10023678
1765 Ga0207640_10081646
1766 Ga0207640_10159679
1767 Ga0207640_10166189
1768 Ga0207658_10010303
1769 Ga0207658_10108833
1770 Ga0207658_10116187
1771 Ga0207658_10331516
1772 Ga0207677_10007514
1773 Ga0207677_10011648
1774 Ga0207677_10034343
1775 Ga0207677_10036565
1776 Ga0207677_10052681
1777 Ga0207677_10095286
1778 Ga0207677_10098474
1779 Ga0207677_10220689
1780 Ga0207703_10002627
1781 Ga0207703_10004833
1782 Ga0207703_10014803
1783 Ga0207703_10020388
1784 Ga0207703_10020487
1785 Ga0207703_10041958
1786 Ga0207639_10004058
1787 Ga0207639_10007080
1788 Ga0207639_10038652
1789 Ga0207639_10039023
1790 Ga0207639_10211197
1791 Ga0207639_10222754
1792 Ga0207678_10003590
1793 Ga0207678_10005641
1794 Ga0207678_10010641
1795 Ga0207678_10028171
1796 Ga0207708_10001426
1797 Ga0207708_10026793
1798 Ga0207708_10056430
1799 Ga0207708_10121968
1800 Ga0207708_10137761
1801 Ga0207702_10002800
1802 Ga0207702_10024502
1803 Ga0207702_10039420
1804 Ga0207702_10049543
1805 Ga0207702_10144585
1806 Ga0207702_10160811
1807 Ga0207702_10180515
1808 Ga0207641_10004097
1809 Ga0207641_10024578
1810 Ga0207641_10073858
1811 Ga0207641_10172024
1812 Ga0207641_10189365
1813 Ga0207648_10002639
1814 Ga0207648_10004813
1815 Ga0207648_10005629
1816 Ga0207648_10008791
1817 Ga0207648_10078581
1818 Ga0207648_10103986
1819 Ga0207676_10031227
1820 Ga0207676_10046477
1821 Ga0207676_10140106
1822 Ga0207676_10279814
1823 Ga0207674_10000902
1824 Ga0207674_10001525
1825 Ga0207674_10009798
1826 Ga0207674_10021100
1827 Ga0207674_10060201
1828 Ga0207675_100002605
1829 Ga0207675_100004408
1830 Ga0207675_100004974
1831 Ga0207675_100022053
1832 Ga0207675_100031808
1833 Ga0207675_100132224
1834 Ga0207675_100204080
1835 Ga0207683_10016957
1836 Ga0207683_10019632
1837 Ga0207683_10034724
1838 Ga0207683_10111765
1839 Ga0207683_10223041
1840 Ga0207698_10002721
1841 Ga0207698_10018975
1842 Ga0207698_10027637
1843 Ga0207698_10029443
1844 Ga0207698_10033043
1845 Ga0207698_10057570
1846 Ga0207698_10147748
1847 Ga0207698_10185553
1848 Ga0207698_10387527
1849 Ga0209969_1006154
1850 Ga0209967_1000891
1851 Ga0209996_1007691
1852 Ga0210000_1003624
1853 Ga0209995_1004941
1854 Ga0209999_1003499
1855 Ga0209970_1014801
1856 Ga0209983_1020214
1857 Ga0209588_1010880
1858 Ga0209588_1022699
1859 Ga0209588_1023592
1860 Ga0209588_1053368
1861 Ga0209971_1002265
1862 Ga0209966_1010981
1863 Ga0209974_10010667
1864 Ga0209974_10018429
1865 Ga0207428_10001635
1866 Ga0207428_10003216
1867 Ga0207428_10006405
1868 Ga0268266_10003598
1869 Ga0268266_10233017
1870 Ga0268265_10085610
1871 Ga0268264_10005765
1872 Ga0268264_10046514
1873 Ga0268264_10050783
1874 Ga0307511_10000014
1875 Ga0265327_10020487
1876 Ga0307408_100088380
1877 Ga0307408_100132452
1878 Ga0307408_100142806
1879 Ga0307408_100178274
1880 Ga0307408_100289744
1881 Ga0316575_10012984
1882 Ga0316579_10003762
1883 Ga0265314_10085785
1884 Ga0316576_10052103
1885 Ga0316578_10082046
1886 Ga0307405_10016127
1887 Ga0307405_10105571
1888 Ga0307413_10005609
1889 Ga0307410_10020492
1890 Ga0307406_10019162
1891 Ga0307407_10014669
1892 Ga0307412_10015586
1893 Ga0307412_10185295
1894 Ga0307409_100029550
1895 Ga0307409_100231366
1896 Ga0307416_100108580
1897 Ga0307416_100201636
1898 Ga0307416_100261121
1899 Ga0307411_10007310
1900 Ga0307415_100040854
1901 Ga0316583_10007901
1902 Ga0373930_0003199
1903 Ga0373948_0008077
1904 Ga0373950_0001718
1905 Ga0373958_0006012
1906 Ga0373938_0025469
1907 Ga0373926_0000691
1908 Ga0373929_0009119
1909 Ga0373934_0000289
1910 Ga0373940_0000565
1911 Ga0373944_0005865
1912 Ga0373949_0018448
1913 Ga0373936_0019373
1914 Ga0373939_0033645
1915 Ga0373941_0009408
1916 Ga0373954_0000484
1917 Ga0373956_0001718
1918 Ga0373957_0001264
1919 Ga0373960_0045780
1920 Ga0373946_0013068
1921 Ga0373955_0010749
1922 Ga0373955_0023788
1923 Ga0373955_0039688
1924 Ga0373955_0067605
1925 Ga0316574_0002262
1926 Ga0373924_0000582
1927 Ga0373931_0017335
1928 Ga0373931_0035082
1929 Ga0373935_0003902
1930 Ga0373935_0070124
1931 Ga0373927_0019789
1932 Ga0373933_0002023
1933 Ga0373933_0021909
1934 Ga0373933_0102242
1935 Ga0373947_0080390
1936 Ga0373937_0003830
1937 Ga0373937_0022043
1938 Ga0373937_0026093
1939 Ga0373937_0111776
1940 Ga0373937_0392011
1941 Ga0316582_0140386
1942 Ga0316584_0228114
1943 Ga0373925_0049631
1944 Ga0373925_0061702
1945 Ga0373925_0181992
1946 Ga0373925_0188269
1947 Ga0395899_0045749
1948 Ga0395899_0083691
1949 Ga0395899_0108161
1950 Ga0395900_0238572
1951 Ga0395898_0180237
1952 Ga0395905_0015984
1953 Ga0395905_0071506
1954 Ga0395901_0000729
1955 Ga0395901_0045640
1956 Ga0395901_0093598
1957 Ga0436360_0952238
1958 Ga0451853_0942648
1959 Ga0451577_0043517
1960 Ga0451577_0088937
1961 Ga0451577_0113786
1962 Ga0451577_0491035
1963 Ga0466965_0113183
1964 Ga0466966_0014661
1965 Ga0453684_0031061
1966 Ga0453684_0315055
1967 Ga0466957_0028139
1968 Ga0466959_0125903
1969 Ga0451576_0002498
1970 Ga0451576_0078608
1971 Ga0451576_0137444
1972 Ga0451576_0559934
1973 Ga0466958_0085784
1974 Ga0466967_0275697
1975 Ga0495592_0006058
1976 Ga0495592_0009699
1977 Ga0495592_0044376
1978 Ga0495592_0049642
1979 Ga0495603_0007518
1980 Ga0495590_0000034
1981 Ga0495629_0049696
1982 Ga0495641_0004760
1983 Ga0495651_0000574
1984 Ga0495651_0016494
1985 Ga0495653_0020912
1986 Ga0495580_0025733
1987 Ga0495582_0149338
1988 Ga0495639_0005479
1989 Ga0495662_0011180
1990 Ga0495662_0033282
1991 Ga0495585_0120384
1992 Ga0495606_0001824
1993 Ga0495608_0013523
1994 Ga0495608_0034400
1995 Ga0495608_0042922
1996 Ga0495628_0000543
1997 Ga0495628_0005452
1998 Ga0495630_0007503
1999 Ga0495666_0008789
2000 Ga0495642_0009600
2001 Ga0495652_0003566
2002 Ga0495652_0023115
2003 Ga0495652_0134146
2004 Ga0495640_0010290
2005 Ga0495586_0006461
2006 Ga0495586_0158137
2007 Ga0495587_0007005
2008 Ga0495587_0031005
2009 Ga0495598_0012301
2010 Ga0495621_0004562
2011 Ga0495621_0006661
2012 Ga0495645_0000148
2013 Ga0495645_0013622
2014 Ga0495622_0021130
2015 Ga0495633_0000258
2016 Ga0495667_0039142
2017 Ga0495667_0063864
2018 Ga0495634_0015391
2019 Ga0495634_0083214
2020 Ga0495635_0117467
2021 Ga0495657_0063121
2022 Ga0495599_0000218
2023 Ga0495599_0002735
2024 Ga0495599_0008382
2025 Ga0495599_0038764
2026 Ga0495623_0054211
2027 Ga0495647_0000869
2028 Ga0495647_0001858
2029 Ga0495658_0073081
2030 Ga0495669_0003249
2031 Ga0495669_0010940
2032 Ga0495600_0005651
2033 Ga0495600_0071528
2034 Ga0495600_0171604
2035 Ga0495581_0044285
2036 Ga0495604_0226883
2037 Ga0495636_0014648
2038 Ga0495636_0047233
2039 Ga0495636_0097484
2040 Ga0495674_0017611
2041 Ga0495680_0010727
2042 Ga0495680_0051021
2043 Ga0495675_0003535
2044 Ga0495684_0029980
2045 Ga0495684_0115486
2046 Ga0495602_0159436
2047 Ga0496101_0519903
2048 Ga0496102_0004063
2049 Ga0496102_0176385
2050 Ga0496103_0040264
2051 Ga0496103_0222120
2052 Ga0496104_0008652
2053 Ga0496104_0088958
2054 Ga0496105_0019871
2055 Ga0496106_0002141
2056 Ga0496106_0012832
2057 Ga0496107_0065003
2058 Ga0496108_0006744
2059 Ga0496108_0105199
2060 Ga0496109_0150649
2061 Ga0496110_0022571
2062 Ga0496110_0060891
2063 Ga0496110_0139021
2064 Ga0496112_0078101
2065 Ga0496114_0031187
2066 Ga0496114_0059531
2067 Ga0501034_0497557
2068 Ga0501036_0016082
2069 Ga0501036_0108018
2070 Ga0501038_0114355
2071 Ga0501039_0025506
2072 Ga0501039_0060310
2073 Ga0501039_0098219
2074 Ga0501040_0062757
2075 Ga0501040_0360426
2076 Ga0501041_0002130
2077 Ga0501041_0019643
2078 Ga0501041_0025804
2079 Ga0501041_0074368
2080 Ga0501042_0039291
2081 Ga0501042_0147368
2082 Ga0501046_0019195
2083 Ga0501046_0092676
2084 Ga0501047_0252653
2085 Ga0501048_0020853
2086 Ga0501048_0040258
2087 Ga0501048_0087877
2088 Ga0501048_0105699
2089 Ga0501068_0166016
2090 Ga0501069_0001254
2091 Ga0501070_0002109
2092 Ga0501071_0012588
2093 Ga0501071_0015383
2094 Ga0501072_0037675
2095 Ga0501072_0051237
2096 Ga0501072_0062080
2097 Ga0501072_0064281
2098 Ga0501072_0065070
2099 Ga0501072_0112879
2100 Ga0501072_0264167
2101 Ga0501073_0002431
2102 Ga0501074_0000424
2103 Ga0501074_0094931
2104 Ga0501075_0000562
2105 Ga0501075_0145397
2106 Ga0501076_0000938
2107 Ga0501076_0020142
2108 Ga0501076_0067243
2109 Ga0501076_0081069
2110 Ga0501077_0017942
2111 Ga0501079_0012223
2112 Ga0501079_0068166
2113 Ga0501079_0280205
2114 Ga0501080_0002585
2115 Ga0501080_0010496
2116 Ga0501080_0016743
2117 Ga0501080_0338791
2118 Ga0501080_0432557
2119 Ga0501081_0011121
2120 Ga0501081_0119073
2121 Ga0501081_0129667
2122 Ga0501083_0000417
2123 Ga0501044_0069941
2124 Ga0501044_0172302
2125 Ga0501045_0015365
2126 Ga0501045_0171556
2127 Ga0501045_0385938
2128 nmdc:mga00v17_261523_c1
2129 nmdc:mga0k408_37001_c1
2130 nmdc:mga0k408_75544_c1
2131 nmdc:mga0k408_96188_c1
2132 nmdc:mga05p37_28361_c1
2133 nmdc:mga05p37_812205_c1
2134 nmdc:mga05p37_92563_c1
2135 nmdc:mga09592_26209_c1
2136 nmdc:mga09592_31819_c1
2137 nmdc:mga09592_322176_c1
2138 nmdc:mga09592_8149_c1
2139 nmdc:mga0qj67_14885_c1
2140 nmdc:mga0qj67_1737_c1
2141 nmdc:mga0qj67_208617_c1
2142 nmdc:mga0qj67_2113_c1
2143 nmdc:mga06r32_630_c1
2144 nmdc:mga06r32_9842_c1
2145 nmdc:mga08y16_114142_c1
2146 nmdc:mga08y16_147_c1
2147 nmdc:mga08y16_1975_c1
2148 nmdc:mga08y16_2374_c1
2149 nmdc:mga08y16_733134_c1
2150 nmdc:mga0n895_254471_c1
2151 nmdc:mga0n895_474041_c1
2152 nmdc:mga0n895_4929_c1
2153 nmdc:mga0n895_515851_c1
2154 nmdc:mga0rr50_2399_c1
2155 nmdc:mga0rr50_74688_c1
2156 nmdc:mga08x19_100010_c1
2157 nmdc:mga08x19_1812_c1
2158 nmdc:mga08x19_34299_c1
2159 nmdc:mga08x19_36660_c1
2160 nmdc:mga08x19_51899_c1
2161 nmdc:mga08x19_66616_c1
2162 nmdc:mga08x19_95370_c1
2163 nmdc:mga0a205_251341_c1
2164 nmdc:mga0a205_327551_c1
2165 nmdc:mga0a205_3625_c1
2166 nmdc:mga0a205_45395_c1
2167 Ga0495601_0000966
2168 Ga0495601_0008118
2169 Ga0495601_0075562
2170 Ga0495595_0006819
2171 Ga0495595_0021797
2172 Ga0500646_0004985
2173 Ga0500647_0004257
2174 Ga0500583_0048699
2175 Ga0500641_0014072
2176 Ga0500555_007936
2177 Ga0500642_0150229
2178 Ga0500655_006266
2179 Ga0500568_0044109
2180 Ga0500604_0003491
2181 Ga0501084_0021415
2182 Ga0501084_0051495
2183 Ga0501084_0123151
2184 Ga0501084_0129845
2185 Ga0501084_0184335
2186 Ga0501082_0007339
2187 Ga0501082_0029507
2188 Ga0530510_0017372

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

68

259

0.84

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

86

287

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kns-assembly4.cif.gz_D-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.838 1 317
6kns-assembly2.cif.gz_B-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8321 2 319
6kns-assembly3.cif.gz_C-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8313 2 319
6kns-assembly4.cif.gz_D-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8283 1 317
6kns-assembly2.cif.gz_B-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8226 2 319
ID Description Score Start End Superfamily
af_Q4DTW2_23_113_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8686 167 214 3.60.15.10
af_P9WGC1_17_267_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8228 1 317 3.60.15.10
af_P9WGC1_17_267_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8198 1 317 3.60.15.10
1zkpC00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8019 57 317 3.60.15.10
1zkpC00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.759 57 317 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A536ZCG5-F1-model_v4 MBL fold metallo-hydrolase 0.9821 59 319 GO:0016787
AF-A0A2N2RT20-F1-model_v4 PPM-type phosphatase domain-containing protein 0.9816 4 284 GO:0016020
GO:0016791
AF-A0A1P8FHN2-F1-model_v4 MBL fold metallo-hydrolase 0.9795 3 319 GO:0016787
AF-A0A536ZCG5-F1-model_v4 MBL fold metallo-hydrolase 0.9784 59 319 GO:0016787
AF-A0A1P8FHN2-F1-model_v4 MBL fold metallo-hydrolase 0.9735 3 319 GO:0016787

Map