F489941
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1094 | 314 | 1094 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300025961|Ga0207712_10992159|Ga0207712_109921592 |
| Length | 99 |
| Sequence | MTSPTREDVIEALRQVEDPELGMDIVDLGLLYDVEVAGAKVKVTHSLTSMGCPAGPMIQEDIHRVVADLGVDDVEIDLTWDPPWTPDRMSEDAKFILGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 101 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 144 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 156 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 167 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 168 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 172 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 180 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 190 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 191 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 194 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 195 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 196 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 197 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 198 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 202 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 203 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 204 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 205 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 206 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 207 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 208 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 209 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 210 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 295 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 307 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 314 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.17 |
| Metatranscriptomes | 1.83 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.27 |
| Nodule | 0 |
| Rhizoplane | 10.51 |
| Rhizosphere | 88.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10182417 | 3300003323 | Bacteria | 2601 |
| 2 | Ga0070658_10054511 | 3300005327 | Bacteria | 3247 |
| 3 | Ga0070658_10182619 | 3300005327 | Bacteria | 1765 |
| 4 | Ga0070683_100021983 | 3300005329 | Bacteria | 5695 |
| 5 | Ga0070683_100037771 | 3300005329 | Bacteria | 4422 |
| 6 | Ga0070683_100058070 | 3300005329 | Bacteria | 3595 |
| 7 | Ga0070683_100158239 | 3300005329 | Bacteria | 2149 |
| 8 | Ga0070683_100176387 | 3300005329 | Bacteria | 2029 |
| 9 | Ga0070683_100332332 | 3300005329 | Bacteria | 1447 |
| 10 | Ga0070690_100394324 | 3300005330 | Bacteria | 1015 |
| 11 | Ga0068869_100749878 | 3300005334 | Unclassified | 836 |
| 12 | Ga0070680_100100044 | 3300005336 | Bacteria | 2406 |
| 13 | Ga0070682_100031764 | 3300005337 | Unclassified | 3196 |
| 14 | Ga0070682_100057409 | 3300005337 | Bacteria | 2452 |
| 15 | Ga0070682_100212174 | 3300005337 | Unclassified | 1373 |
| 16 | Ga0068868_100125953 | 3300005338 | Bacteria | 2093 |
| 17 | Ga0068868_101420324 | 3300005338 | Unclassified | 648 |
| 18 | Ga0070660_100004655 | 3300005339 | Bacteria | 9496 |
| 19 | Ga0070660_100011588 | 3300005339 | Bacteria | 6273 |
| 20 | Ga0070660_100054116 | 3300005339 | Bacteria | 3098 |
| 21 | Ga0070660_100268286 | 3300005339 | Bacteria | 1394 |
| 22 | Ga0070689_100386077 | 3300005340 | Bacteria | 1181 |
| 23 | Ga0070661_100148351 | 3300005344 | Bacteria | 1772 |
| 24 | Ga0070661_100179146 | 3300005344 | Bacteria | 1612 |
| 25 | Ga0070661_100988022 | 3300005344 | Unclassified | 698 |
| 26 | Ga0070675_101408318 | 3300005354 | Bacteria | 643 |
| 27 | Ga0070671_100008449 | 3300005355 | Bacteria | 8253 |
| 28 | Ga0070671_100279396 | 3300005355 | Bacteria | 1420 |
| 29 | Ga0070673_100623936 | 3300005364 | Bacteria | 985 |
| 30 | Ga0070659_100352978 | 3300005366 | Bacteria | 1234 |
| 31 | Ga0070659_100562720 | 3300005366 | Unclassified | 977 |
| 32 | Ga0070659_100663549 | 3300005366 | Bacteria | 900 |
| 33 | Ga0070659_101746678 | 3300005366 | Unclassified | 557 |
| 34 | Ga0070709_10015673 | 3300005434 | Bacteria | 4316 |
| 35 | Ga0070709_10044135 | 3300005434 | Bacteria | 2759 |
| 36 | Ga0070709_10227194 | 3300005434 | Unclassified | 1334 |
| 37 | Ga0070709_11030388 | 3300005434 | Unclassified | 656 |
| 38 | Ga0070714_100038691 | 3300005435 | Bacteria | 4011 |
| 39 | Ga0070714_100042803 | 3300005435 | Bacteria | 3827 |
| 40 | Ga0070714_100058761 | 3300005435 | Bacteria | 3296 |
| 41 | Ga0070714_100104028 | 3300005435 | Unclassified | 2505 |
| 42 | Ga0070714_100363670 | 3300005435 | Bacteria | 1361 |
| 43 | Ga0070714_100380543 | 3300005435 | Bacteria | 1331 |
| 44 | Ga0070714_100445438 | 3300005435 | Bacteria | 1229 |
| 45 | Ga0070714_100514422 | 3300005435 | Bacteria | 1143 |
| 46 | Ga0070714_100652924 | 3300005435 | Bacteria | 1013 |
| 47 | Ga0070714_100655966 | 3300005435 | Bacteria | 1010 |
| 48 | Ga0070714_102504515 | 3300005435 | Unclassified | 501 |
| 49 | Ga0070713_100001203 | 3300005436 | Bacteria | 16520 |
| 50 | Ga0070713_100002241 | 3300005436 | Bacteria | 12548 |
| 51 | Ga0070713_100108459 | 3300005436 | Bacteria | 2417 |
| 52 | Ga0070713_100333447 | 3300005436 | Bacteria | 1404 |
| 53 | Ga0070713_100820882 | 3300005436 | Unclassified | 892 |
| 54 | Ga0070713_101034041 | 3300005436 | Bacteria | 793 |
| 55 | Ga0070710_10029016 | 3300005437 | Bacteria | 2964 |
| 56 | Ga0070701_10286859 | 3300005438 | Bacteria | 1007 |
| 57 | Ga0070711_100626229 | 3300005439 | Bacteria | 900 |
| 58 | Ga0070711_100903416 | 3300005439 | Unclassified | 754 |
| 59 | Ga0070711_101280849 | 3300005439 | Bacteria | 636 |
| 60 | Ga0070705_100182751 | 3300005440 | Unclassified | 1422 |
| 61 | Ga0070705_101597235 | 3300005440 | Bacteria | 549 |
| 62 | Ga0070705_101850306 | 3300005440 | Unclassified | 513 |
| 63 | Ga0070708_100413026 | 3300005445 | Bacteria | 1273 |
| 64 | Ga0070663_100536657 | 3300005455 | Bacteria | 976 |
| 65 | Ga0070678_100113271 | 3300005456 | Bacteria | 2126 |
| 66 | Ga0070678_100694726 | 3300005456 | Unclassified | 916 |
| 67 | Ga0070678_101271716 | 3300005456 | Bacteria | 684 |
| 68 | Ga0070681_10076535 | 3300005458 | Bacteria | 3304 |
| 69 | Ga0070681_10170989 | 3300005458 | Bacteria | 2095 |
| 70 | Ga0070681_10215813 | 3300005458 | Unclassified | 1834 |
| 71 | Ga0070681_10295237 | 3300005458 | Bacteria | 1530 |
| 72 | Ga0070681_10464904 | 3300005458 | Bacteria | 1178 |
| 73 | Ga0070681_10716761 | 3300005458 | Unclassified | 916 |
| 74 | Ga0068867_100110603 | 3300005459 | Bacteria | 2111 |
| 75 | Ga0070706_100575867 | 3300005467 | Bacteria | 1047 |
| 76 | Ga0070706_101437744 | 3300005467 | Bacteria | 631 |
| 77 | Ga0070707_100030113 | 3300005468 | Bacteria | 5164 |
| 78 | Ga0070707_100207249 | 3300005468 | Bacteria | 1911 |
| 79 | Ga0070707_100270671 | 3300005468 | Unclassified | 1651 |
| 80 | Ga0070707_100279985 | 3300005468 | Bacteria | 1621 |
| 81 | Ga0070698_100093650 | 3300005471 | Bacteria | 2984 |
| 82 | Ga0070698_100099098 | 3300005471 | Bacteria | 2888 |
| 83 | Ga0070698_100186057 | 3300005471 | Bacteria | 2015 |
| 84 | Ga0070699_100120520 | 3300005518 | Bacteria | 2306 |
| 85 | Ga0070699_100490186 | 3300005518 | Bacteria | 1116 |
| 86 | Ga0070699_101147556 | 3300005518 | Unclassified | 713 |
| 87 | Ga0070679_100077669 | 3300005530 | Bacteria | 3310 |
| 88 | Ga0070679_100165280 | 3300005530 | Bacteria | 2186 |
| 89 | Ga0070679_100363496 | 3300005530 | Bacteria | 1394 |
| 90 | Ga0070679_100647073 | 3300005530 | Unclassified | 1000 |
| 91 | Ga0070684_100201362 | 3300005535 | Bacteria | 1813 |
| 92 | Ga0070684_100228248 | 3300005535 | Bacteria | 1700 |
| 93 | Ga0070684_100282112 | 3300005535 | Unclassified | 1522 |
| 94 | Ga0070684_100563308 | 3300005535 | Bacteria | 1058 |
| 95 | Ga0070684_100884080 | 3300005535 | Unclassified | 837 |
| 96 | Ga0070697_100648554 | 3300005536 | Bacteria | 930 |
| 97 | Ga0070697_101751406 | 3300005536 | Bacteria | 556 |
| 98 | Ga0070695_100002173 | 3300005545 | Bacteria | 11236 |
| 99 | Ga0070695_100367759 | 3300005545 | Bacteria | 1082 |
| 100 | Ga0070696_100276356 | 3300005546 | Bacteria | 1279 |
| 101 | Ga0070693_100255798 | 3300005547 | Bacteria | 1163 |
| 102 | Ga0070693_100277951 | 3300005547 | Bacteria | 1120 |
| 103 | Ga0070704_100023732 | 3300005549 | Bacteria | 4013 |
| 104 | Ga0070704_100700987 | 3300005549 | Unclassified | 898 |
| 105 | Ga0070704_100843591 | 3300005549 | Unclassified | 821 |
| 106 | Ga0070704_101737097 | 3300005549 | Bacteria | 577 |
| 107 | Ga0068855_100040522 | 3300005563 | Bacteria | 5528 |
| 108 | Ga0068855_100406343 | 3300005563 | Bacteria | 1491 |
| 109 | Ga0070664_100486334 | 3300005564 | Bacteria | 1136 |
| 110 | Ga0068857_100599808 | 3300005577 | Bacteria | 1041 |
| 111 | Ga0068857_102189640 | 3300005577 | Bacteria | 543 |
| 112 | Ga0068854_100564760 | 3300005578 | Bacteria | 967 |
| 113 | Ga0068856_100027109 | 3300005614 | Bacteria | 5589 |
| 114 | Ga0068856_100398044 | 3300005614 | Bacteria | 1397 |
| 115 | Ga0068856_100614668 | 3300005614 | Bacteria | 1108 |
| 116 | Ga0068856_101153891 | 3300005614 | Unclassified | 791 |
| 117 | Ga0070702_100197513 | 3300005615 | Bacteria | 1329 |
| 118 | Ga0068852_100376413 | 3300005616 | Bacteria | 1392 |
| 119 | Ga0068852_102150848 | 3300005616 | Bacteria | 580 |
| 120 | Ga0068859_101892550 | 3300005617 | Unclassified | 659 |
| 121 | Ga0068864_101400398 | 3300005618 | Unclassified | 701 |
| 122 | Ga0068851_10588691 | 3300005834 | Unclassified | 676 |
| 123 | Ga0068870_10146188 | 3300005840 | Bacteria | 1388 |
| 124 | Ga0068863_100523911 | 3300005841 | Bacteria | 1169 |
| 125 | Ga0068863_100871309 | 3300005841 | Bacteria | 900 |
| 126 | Ga0081455_10012981 | 3300005937 | Bacteria | 8262 |
| 127 | Ga0081538_10016286 | 3300005981 | Bacteria | 5708 |
| 128 | Ga0081539_10002873 | 3300005985 | Bacteria | 22878 |
| 129 | Ga0081539_10192609 | 3300005985 | Bacteria | 948 |
| 130 | Ga0070717_10012964 | 3300006028 | Bacteria | 6367 |
| 131 | Ga0070717_10020908 | 3300006028 | Bacteria | 5152 |
| 132 | Ga0070717_10023774 | 3300006028 | Bacteria | 4860 |
| 133 | Ga0070717_10105783 | 3300006028 | Bacteria | 2395 |
| 134 | Ga0070717_10306021 | 3300006028 | Bacteria | 1413 |
| 135 | Ga0070717_11573191 | 3300006028 | Bacteria | 596 |
| 136 | Ga0075363_100352105 | 3300006048 | Unclassified | 860 |
| 137 | Ga0070715_10014573 | 3300006163 | Bacteria | 2914 |
| 138 | Ga0070716_100020680 | 3300006173 | Bacteria | 3457 |
| 139 | Ga0070716_100047188 | 3300006173 | Bacteria | 2428 |
| 140 | Ga0070712_100174603 | 3300006175 | Bacteria | 1670 |
| 141 | Ga0070712_100225115 | 3300006175 | Unclassified | 1487 |
| 142 | Ga0070712_100313291 | 3300006175 | Unclassified | 1274 |
| 143 | Ga0070712_100332211 | 3300006175 | Bacteria | 1239 |
| 144 | Ga0097621_101272763 | 3300006237 | Bacteria | 694 |
| 145 | Ga0068871_100211151 | 3300006358 | Bacteria | 1679 |
| 146 | Ga0068871_100317163 | 3300006358 | Unclassified | 1372 |
| 147 | Ga0075428_100523095 | 3300006844 | Bacteria | 1269 |
| 148 | Ga0075434_100008073 | 3300006871 | Bacteria | 9761 |
| 149 | Ga0075434_100112032 | 3300006871 | Bacteria | 2740 |
| 150 | Ga0075436_100000414 | 3300006914 | Bacteria | 27543 |
| 151 | Ga0075436_100506705 | 3300006914 | Unclassified | 883 |
| 152 | Ga0097620_101892718 | 3300006931 | Unclassified | 659 |
| 153 | Ga0075435_100024379 | 3300007076 | Bacteria | 4694 |
| 154 | Ga0105240_10007770 | 3300009093 | Bacteria | 15505 |
| 155 | Ga0105240_10095737 | 3300009093 | Bacteria | 3619 |
| 156 | Ga0105240_10299716 | 3300009093 | Bacteria | 1839 |
| 157 | Ga0105240_10985015 | 3300009093 | Bacteria | 902 |
| 158 | Ga0105240_11518419 | 3300009093 | Bacteria | 702 |
| 159 | Ga0111539_10025766 | 3300009094 | Bacteria | 7203 |
| 160 | Ga0111539_10444558 | 3300009094 | Unclassified | 1510 |
| 161 | Ga0105245_10056221 | 3300009098 | Bacteria | 3536 |
| 162 | Ga0105245_10125540 | 3300009098 | Bacteria | 2402 |
| 163 | Ga0105245_10586584 | 3300009098 | Bacteria | 1140 |
| 164 | Ga0105245_10601252 | 3300009098 | Unclassified | 1126 |
| 165 | Ga0105245_11146643 | 3300009098 | Bacteria | 824 |
| 166 | Ga0105247_10049827 | 3300009101 | Bacteria | 2576 |
| 167 | Ga0105247_10565844 | 3300009101 | Unclassified | 838 |
| 168 | Ga0114129_10387450 | 3300009147 | Bacteria | 1844 |
| 169 | Ga0105241_10232854 | 3300009174 | Bacteria | 1553 |
| 170 | Ga0105241_11898426 | 3300009174 | Bacteria | 584 |
| 171 | Ga0105242_11225859 | 3300009176 | Unclassified | 771 |
| 172 | Ga0105242_12792636 | 3300009176 | Unclassified | 539 |
| 173 | Ga0105248_10066829 | 3300009177 | Bacteria | 4036 |
| 174 | Ga0105248_11246020 | 3300009177 | Unclassified | 841 |
| 175 | Ga0105248_12173912 | 3300009177 | Unclassified | 631 |
| 176 | Ga0105248_12731449 | 3300009177 | Unclassified | 563 |
| 177 | Ga0105237_10032857 | 3300009545 | Bacteria | 5253 |
| 178 | Ga0105237_10359809 | 3300009545 | Unclassified | 1459 |
| 179 | Ga0105237_11657521 | 3300009545 | Bacteria | 647 |
| 180 | Ga0105238_10041072 | 3300009551 | Bacteria | 4686 |
| 181 | Ga0105238_10149087 | 3300009551 | Bacteria | 2315 |
| 182 | Ga0105238_10936829 | 3300009551 | Unclassified | 885 |
| 183 | Ga0105238_11215201 | 3300009551 | Bacteria | 778 |
| 184 | Ga0105238_11264766 | 3300009551 | Bacteria | 763 |
| 185 | Ga0105249_10566523 | 3300009553 | Bacteria | 1188 |
| 186 | Ga0105239_10338305 | 3300010375 | Bacteria | 1698 |
| 187 | Ga0105239_11257004 | 3300010375 | Unclassified | 854 |
| 188 | Ga0105246_10498170 | 3300011119 | Bacteria | 1034 |
| 189 | Ga0105246_10638103 | 3300011119 | Bacteria | 925 |
| 190 | Ga0157326_1085520 | 3300012513 | Bacteria | 523 |
| 191 | Ga0157373_10213475 | 3300013100 | Bacteria | 1361 |
| 192 | Ga0157373_10323680 | 3300013100 | Bacteria | 1097 |
| 193 | Ga0157371_10233720 | 3300013102 | Bacteria | 1322 |
| 194 | Ga0157371_10337998 | 3300013102 | Bacteria | 1095 |
| 195 | Ga0157371_10610075 | 3300013102 | Bacteria | 812 |
| 196 | Ga0157370_10012477 | 3300013104 | Bacteria | 8807 |
| 197 | Ga0157370_10249700 | 3300013104 | Bacteria | 1641 |
| 198 | Ga0157370_10578765 | 3300013104 | Bacteria | 1029 |
| 199 | Ga0157369_10044290 | 3300013105 | Bacteria | 4844 |
| 200 | Ga0157369_10077272 | 3300013105 | Bacteria | 3568 |
| 201 | Ga0157369_10138744 | 3300013105 | Bacteria | 2573 |
| 202 | Ga0157369_10267936 | 3300013105 | Unclassified | 1780 |
| 203 | Ga0157369_10707896 | 3300013105 | Unclassified | 1037 |
| 204 | Ga0157369_11171718 | 3300013105 | Bacteria | 785 |
| 205 | Ga0157374_10032819 | 3300013296 | Bacteria | 4731 |
| 206 | Ga0157374_10111411 | 3300013296 | Bacteria | 2633 |
| 207 | Ga0157374_11447452 | 3300013296 | Unclassified | 710 |
| 208 | Ga0157374_12277291 | 3300013296 | Bacteria | 569 |
| 209 | Ga0163162_10213266 | 3300013306 | Bacteria | 2061 |
| 210 | Ga0157372_10174552 | 3300013307 | Bacteria | 2487 |
| 211 | Ga0157372_10250043 | 3300013307 | Bacteria | 2058 |
| 212 | Ga0157372_10290131 | 3300013307 | Bacteria | 1903 |
| 213 | Ga0157372_10401669 | 3300013307 | Bacteria | 1597 |
| 214 | Ga0157372_10633548 | 3300013307 | Bacteria | 1245 |
| 215 | Ga0157372_11173770 | 3300013307 | Bacteria | 887 |
| 216 | Ga0157372_11282877 | 3300013307 | Bacteria | 845 |
| 217 | Ga0157372_12861775 | 3300013307 | Bacteria | 553 |
| 218 | Ga0157375_11403085 | 3300013308 | Unclassified | 823 |
| 219 | Ga0182008_10002395 | 3300014497 | Bacteria | 11786 |
| 220 | Ga0182008_10067351 | 3300014497 | Bacteria | 1762 |
| 221 | Ga0182008_10233466 | 3300014497 | Bacteria | 944 |
| 222 | Ga0182008_10241219 | 3300014497 | Unclassified | 930 |
| 223 | Ga0157377_10183641 | 3300014745 | Bacteria | 1317 |
| 224 | Ga0157377_10398077 | 3300014745 | Unclassified | 937 |
| 225 | Ga0157379_11880679 | 3300014968 | Unclassified | 589 |
| 226 | Ga0157379_12206874 | 3300014968 | Unclassified | 547 |
| 227 | Ga0157376_10018483 | 3300014969 | Bacteria | 5346 |
| 228 | Ga0157376_11443710 | 3300014969 | Unclassified | 720 |
| 229 | Ga0182006_1007014 | 3300015261 | Bacteria | 5187 |
| 230 | Ga0182006_1300790 | 3300015261 | Bacteria | 527 |
| 231 | Ga0182007_10012095 | 3300015262 | Bacteria | 3332 |
| 232 | Ga0182007_10310654 | 3300015262 | Bacteria | 581 |
| 233 | Ga0163161_10112500 | 3300017792 | Bacteria | 2037 |
| 234 | Ga0197907_10283293 | 3300020069 | Bacteria | 760 |
| 235 | Ga0197907_10461500 | 3300020069 | Unclassified | 726 |
| 236 | Ga0206356_10864395 | 3300020070 | Bacteria | 620 |
| 237 | Ga0206356_10933417 | 3300020070 | Unclassified | 535 |
| 238 | Ga0206356_11619042 | 3300020070 | Bacteria | 8693 |
| 239 | Ga0206356_11789295 | 3300020070 | Unclassified | 1629 |
| 240 | Ga0206354_11139136 | 3300020081 | Bacteria | 2169 |
| 241 | Ga0206354_11487989 | 3300020081 | Bacteria | 878 |
| 242 | Ga0206353_10752732 | 3300020082 | Bacteria | 9937 |
| 243 | Ga0206353_10914373 | 3300020082 | Bacteria | 1140 |
| 244 | Ga0206353_10953357 | 3300020082 | Bacteria | 8226 |
| 245 | Ga0154015_1573975 | 3300020610 | Bacteria | 902 |
| 246 | Ga0213871_10093261 | 3300021441 | Unclassified | 874 |
| 247 | Ga0224712_10003063 | 3300022467 | Bacteria | 4265 |
| 248 | Ga0224712_10071764 | 3300022467 | Unclassified | 1408 |
| 249 | Ga0207692_10015333 | 3300025898 | Bacteria | 3369 |
| 250 | Ga0207710_10471995 | 3300025900 | Unclassified | 649 |
| 251 | Ga0207685_10000585 | 3300025905 | Bacteria | 6339 |
| 252 | Ga0207699_10055108 | 3300025906 | Bacteria | 2364 |
| 253 | Ga0207699_10441744 | 3300025906 | Unclassified | 932 |
| 254 | Ga0207699_10477751 | 3300025906 | Bacteria | 897 |
| 255 | Ga0207643_10307168 | 3300025908 | Unclassified | 988 |
| 256 | Ga0207705_10026024 | 3300025909 | Bacteria | 4175 |
| 257 | Ga0207705_10037406 | 3300025909 | Bacteria | 3473 |
| 258 | Ga0207705_10039859 | 3300025909 | Bacteria | 3367 |
| 259 | Ga0207705_10109232 | 3300025909 | Bacteria | 2042 |
| 260 | Ga0207705_10206687 | 3300025909 | Bacteria | 1488 |
| 261 | Ga0207684_10485875 | 3300025910 | Bacteria | 1059 |
| 262 | Ga0207684_10958173 | 3300025910 | Bacteria | 717 |
| 263 | Ga0207654_10434537 | 3300025911 | Unclassified | 918 |
| 264 | Ga0207654_11291441 | 3300025911 | Unclassified | 532 |
| 265 | Ga0207707_10046974 | 3300025912 | Bacteria | 3760 |
| 266 | Ga0207707_10086041 | 3300025912 | Bacteria | 2747 |
| 267 | Ga0207707_10086836 | 3300025912 | Bacteria | 2733 |
| 268 | Ga0207707_10192791 | 3300025912 | Bacteria | 1777 |
| 269 | Ga0207707_11047522 | 3300025912 | Bacteria | 667 |
| 270 | Ga0207707_11387733 | 3300025912 | Unclassified | 561 |
| 271 | Ga0207695_10020007 | 3300025913 | Bacteria | 7682 |
| 272 | Ga0207695_10229159 | 3300025913 | Unclassified | 1763 |
| 273 | Ga0207693_10002991 | 3300025915 | Bacteria | 14628 |
| 274 | Ga0207693_10183195 | 3300025915 | Bacteria | 1648 |
| 275 | Ga0207693_10458463 | 3300025915 | Bacteria | 996 |
| 276 | Ga0207693_10655023 | 3300025915 | Bacteria | 815 |
| 277 | Ga0207693_10757545 | 3300025915 | Unclassified | 750 |
| 278 | Ga0207693_10921310 | 3300025915 | Unclassified | 670 |
| 279 | Ga0207663_10025210 | 3300025916 | Bacteria | 3434 |
| 280 | Ga0207663_10217378 | 3300025916 | Bacteria | 1389 |
| 281 | Ga0207663_11074144 | 3300025916 | Unclassified | 647 |
| 282 | Ga0207660_10011588 | 3300025917 | Bacteria | 5746 |
| 283 | Ga0207660_10065159 | 3300025917 | Bacteria | 2632 |
| 284 | Ga0207660_10209421 | 3300025917 | Bacteria | 1526 |
| 285 | Ga0207660_10315776 | 3300025917 | Bacteria | 1247 |
| 286 | Ga0207660_11699179 | 3300025917 | Unclassified | 508 |
| 287 | Ga0207657_10007972 | 3300025919 | Bacteria | 10797 |
| 288 | Ga0207657_10011057 | 3300025919 | Bacteria | 8972 |
| 289 | Ga0207657_10017187 | 3300025919 | Bacteria | 6949 |
| 290 | Ga0207657_10070513 | 3300025919 | Bacteria | 2962 |
| 291 | Ga0207657_10338694 | 3300025919 | Bacteria | 1187 |
| 292 | Ga0207649_10029273 | 3300025920 | Bacteria | 3252 |
| 293 | Ga0207649_10171989 | 3300025920 | Bacteria | 1510 |
| 294 | Ga0207652_10153809 | 3300025921 | Bacteria | 2060 |
| 295 | Ga0207652_10191058 | 3300025921 | Bacteria | 1842 |
| 296 | Ga0207652_10202188 | 3300025921 | Bacteria | 1788 |
| 297 | Ga0207652_10500455 | 3300025921 | Bacteria | 1094 |
| 298 | Ga0207652_10590565 | 3300025921 | Unclassified | 996 |
| 299 | Ga0207652_11169981 | 3300025921 | Bacteria | 670 |
| 300 | Ga0207646_10215625 | 3300025922 | Bacteria | 1734 |
| 301 | Ga0207646_10225468 | 3300025922 | Bacteria | 1693 |
| 302 | Ga0207646_10304218 | 3300025922 | Bacteria | 1441 |
| 303 | Ga0207646_10441760 | 3300025922 | Bacteria | 1174 |
| 304 | Ga0207646_10553132 | 3300025922 | Unclassified | 1035 |
| 305 | Ga0207646_10797825 | 3300025922 | Bacteria | 841 |
| 306 | Ga0207694_10083135 | 3300025924 | Bacteria | 2517 |
| 307 | Ga0207694_11460793 | 3300025924 | Bacteria | 577 |
| 308 | Ga0207687_10039659 | 3300025927 | Bacteria | 3225 |
| 309 | Ga0207687_10354716 | 3300025927 | Unclassified | 1196 |
| 310 | Ga0207687_10428304 | 3300025927 | Bacteria | 1093 |
| 311 | Ga0207687_10730028 | 3300025927 | Bacteria | 842 |
| 312 | Ga0207700_10000002 | 3300025928 | Bacteria | 775978 |
| 313 | Ga0207700_10047743 | 3300025928 | Bacteria | 3175 |
| 314 | Ga0207700_10302606 | 3300025928 | Unclassified | 1381 |
| 315 | Ga0207700_11206905 | 3300025928 | Bacteria | 675 |
| 316 | Ga0207700_11416250 | 3300025928 | Unclassified | 618 |
| 317 | Ga0207664_10006174 | 3300025929 | Bacteria | 8220 |
| 318 | Ga0207664_10032406 | 3300025929 | Bacteria | 4004 |
| 319 | Ga0207664_10039220 | 3300025929 | Bacteria | 3677 |
| 320 | Ga0207664_10039805 | 3300025929 | Bacteria | 3650 |
| 321 | Ga0207664_10048590 | 3300025929 | Bacteria | 3337 |
| 322 | Ga0207664_10106287 | 3300025929 | Bacteria | 2327 |
| 323 | Ga0207664_10113318 | 3300025929 | Unclassified | 2258 |
| 324 | Ga0207664_10127435 | 3300025929 | Bacteria | 2138 |
| 325 | Ga0207664_10190821 | 3300025929 | Bacteria | 1764 |
| 326 | Ga0207664_10273944 | 3300025929 | Bacteria | 1479 |
| 327 | Ga0207664_10293628 | 3300025929 | Bacteria | 1429 |
| 328 | Ga0207664_10749569 | 3300025929 | Bacteria | 878 |
| 329 | Ga0207664_11222614 | 3300025929 | Bacteria | 670 |
| 330 | Ga0207664_11818597 | 3300025929 | Bacteria | 532 |
| 331 | Ga0207664_11975302 | 3300025929 | Bacteria | 506 |
| 332 | Ga0207644_10072648 | 3300025931 | Bacteria | 2520 |
| 333 | Ga0207644_10511805 | 3300025931 | Unclassified | 991 |
| 334 | Ga0207690_10352695 | 3300025932 | Unclassified | 1164 |
| 335 | Ga0207686_10681625 | 3300025934 | Unclassified | 816 |
| 336 | Ga0207704_10947747 | 3300025938 | Unclassified | 726 |
| 337 | Ga0207665_10000336 | 3300025939 | Bacteria | 32436 |
| 338 | Ga0207665_10014097 | 3300025939 | Bacteria | 5259 |
| 339 | Ga0207665_10697408 | 3300025939 | Bacteria | 798 |
| 340 | Ga0207711_11931514 | 3300025941 | Unclassified | 533 |
| 341 | Ga0207661_10082972 | 3300025944 | Unclassified | 2651 |
| 342 | Ga0207661_10087031 | 3300025944 | Bacteria | 2594 |
| 343 | Ga0207661_10091855 | 3300025944 | Bacteria | 2530 |
| 344 | Ga0207661_10322409 | 3300025944 | Unclassified | 1389 |
| 345 | Ga0207661_10399644 | 3300025944 | Bacteria | 1246 |
| 346 | Ga0207661_10571805 | 3300025944 | Bacteria | 1036 |
| 347 | Ga0207661_10801812 | 3300025944 | Bacteria | 867 |
| 348 | Ga0207661_11885971 | 3300025944 | Unclassified | 543 |
| 349 | Ga0207667_10168616 | 3300025949 | Bacteria | 2250 |
| 350 | Ga0207667_10442639 | 3300025949 | Bacteria | 1321 |
| 351 | Ga0207667_11408199 | 3300025949 | Bacteria | 670 |
| 352 | Ga0207712_10820122 | 3300025961 | Unclassified | 819 |
| 353 | Ga0207712_10992159 | 3300025961 | Bacteria | 745 |
| 354 | Ga0207640_10638152 | 3300025981 | Bacteria | 906 |
| 355 | Ga0207677_11084247 | 3300026023 | Unclassified | 729 |
| 356 | Ga0207639_10539343 | 3300026041 | Bacteria | 1070 |
| 357 | Ga0207639_12032513 | 3300026041 | Bacteria | 536 |
| 358 | Ga0207678_10102549 | 3300026067 | Bacteria | 2442 |
| 359 | Ga0207678_11501939 | 3300026067 | Bacteria | 595 |
| 360 | Ga0207702_10165361 | 3300026078 | Bacteria | 2023 |
| 361 | Ga0207702_10279925 | 3300026078 | Bacteria | 1576 |
| 362 | Ga0207702_10398619 | 3300026078 | Unclassified | 1327 |
| 363 | Ga0207702_10448189 | 3300026078 | Bacteria | 1252 |
| 364 | Ga0207702_11085560 | 3300026078 | Unclassified | 794 |
| 365 | Ga0207702_11402579 | 3300026078 | Unclassified | 692 |
| 366 | Ga0207676_10158246 | 3300026095 | Bacteria | 1960 |
| 367 | Ga0207676_11576823 | 3300026095 | Unclassified | 654 |
| 368 | Ga0207674_10034379 | 3300026116 | Bacteria | 5299 |
| 369 | Ga0207674_10526597 | 3300026116 | Bacteria | 1142 |
| 370 | Ga0207674_11905607 | 3300026116 | Bacteria | 560 |
| 371 | Ga0207683_10252452 | 3300026121 | Bacteria | 1610 |
| 372 | Ga0207683_10427060 | 3300026121 | Bacteria | 1221 |
| 373 | Ga0207683_11617933 | 3300026121 | Bacteria | 597 |
| 374 | Ga0207683_11857800 | 3300026121 | Bacteria | 551 |
| 375 | Ga0207698_10066518 | 3300026142 | Bacteria | 2837 |
| 376 | Ga0207698_10075391 | 3300026142 | Bacteria | 2696 |
| 377 | Ga0207428_10029986 | 3300027907 | Bacteria | 4500 |
| 378 | Ga0265337_1068031 | 3300028556 | Bacteria | 981 |
| 379 | Ga0265319_1007014 | 3300028563 | Bacteria | 5123 |
| 380 | Ga0265319_1045523 | 3300028563 | Unclassified | 1466 |
| 381 | Ga0265319_1065316 | 3300028563 | Bacteria | 1173 |
| 382 | Ga0265319_1274886 | 3300028563 | Bacteria | 512 |
| 383 | Ga0265334_10002797 | 3300028573 | Bacteria | 8049 |
| 384 | Ga0265334_10032929 | 3300028573 | Bacteria | 2064 |
| 385 | Ga0265334_10205416 | 3300028573 | Bacteria | 683 |
| 386 | Ga0265334_10261808 | 3300028573 | Bacteria | 594 |
| 387 | Ga0265318_10000604 | 3300028577 | Bacteria | 25020 |
| 388 | Ga0265318_10000968 | 3300028577 | Bacteria | 18432 |
| 389 | Ga0265318_10065658 | 3300028577 | Bacteria | 1349 |
| 390 | Ga0265318_10129217 | 3300028577 | Bacteria | 929 |
| 391 | Ga0265323_10036409 | 3300028653 | Bacteria | 1809 |
| 392 | Ga0265322_10009234 | 3300028654 | Bacteria | 2863 |
| 393 | Ga0265322_10128455 | 3300028654 | Bacteria | 723 |
| 394 | Ga0265322_10158670 | 3300028654 | Unclassified | 647 |
| 395 | Ga0265322_10213306 | 3300028654 | Bacteria | 553 |
| 396 | Ga0265336_10018326 | 3300028666 | Bacteria | 2269 |
| 397 | Ga0265336_10076088 | 3300028666 | Bacteria | 1002 |
| 398 | Ga0265336_10115943 | 3300028666 | Bacteria | 798 |
| 399 | Ga0265336_10174194 | 3300028666 | Bacteria | 640 |
| 400 | Ga0265336_10205984 | 3300028666 | Bacteria | 584 |
| 401 | Ga0265338_10003462 | 3300028800 | Bacteria | 22216 |
| 402 | Ga0265338_10005686 | 3300028800 | Bacteria | 16138 |
| 403 | Ga0265338_10006184 | 3300028800 | Bacteria | 15349 |
| 404 | Ga0265338_10007091 | 3300028800 | Bacteria | 14041 |
| 405 | Ga0265338_10010810 | 3300028800 | Bacteria | 10641 |
| 406 | Ga0265338_10014548 | 3300028800 | Bacteria | 8742 |
| 407 | Ga0265338_10029352 | 3300028800 | Bacteria | 5453 |
| 408 | Ga0265338_10219615 | 3300028800 | Bacteria | 1420 |
| 409 | Ga0265338_10595353 | 3300028800 | Bacteria | 770 |
| 410 | Ga0265324_10080610 | 3300029957 | Bacteria | 1107 |
| 411 | Ga0265324_10128708 | 3300029957 | Bacteria | 859 |
| 412 | Ga0265330_10004102 | 3300031235 | Bacteria | 7466 |
| 413 | Ga0265330_10516806 | 3300031235 | Unclassified | 509 |
| 414 | Ga0265332_10003579 | 3300031238 | Bacteria | 7458 |
| 415 | Ga0265332_10389918 | 3300031238 | Bacteria | 575 |
| 416 | Ga0265328_10003809 | 3300031239 | Bacteria | 6627 |
| 417 | Ga0265320_10003921 | 3300031240 | Bacteria | 9831 |
| 418 | Ga0265320_10004476 | 3300031240 | Bacteria | 9158 |
| 419 | Ga0265320_10051042 | 3300031240 | Bacteria | 2009 |
| 420 | Ga0265325_10006354 | 3300031241 | Bacteria | 7183 |
| 421 | Ga0265325_10076428 | 3300031241 | Bacteria | 1671 |
| 422 | Ga0265325_10110880 | 3300031241 | Bacteria | 1333 |
| 423 | Ga0265329_10003633 | 3300031242 | Bacteria | 6660 |
| 424 | Ga0265329_10034868 | 3300031242 | Bacteria | 1625 |
| 425 | Ga0265340_10005417 | 3300031247 | Bacteria | 7091 |
| 426 | Ga0265339_10016814 | 3300031249 | Bacteria | 4350 |
| 427 | Ga0265339_10061903 | 3300031249 | Bacteria | 2012 |
| 428 | Ga0265339_10413030 | 3300031249 | Bacteria | 629 |
| 429 | Ga0265331_10007022 | 3300031250 | Bacteria | 6570 |
| 430 | Ga0265331_10018747 | 3300031250 | Bacteria | 3581 |
| 431 | Ga0265331_10108254 | 3300031250 | Bacteria | 1276 |
| 432 | Ga0265331_10129465 | 3300031250 | Bacteria | 1152 |
| 433 | Ga0265331_10327769 | 3300031250 | Bacteria | 686 |
| 434 | Ga0265327_10006564 | 3300031251 | Bacteria | 9254 |
| 435 | Ga0265327_10013358 | 3300031251 | Bacteria | 5458 |
| 436 | Ga0265327_10024976 | 3300031251 | Bacteria | 3494 |
| 437 | Ga0265327_10412796 | 3300031251 | Bacteria | 585 |
| 438 | Ga0265316_10002341 | 3300031344 | Bacteria | 19753 |
| 439 | Ga0265316_10107154 | 3300031344 | Bacteria | 2119 |
| 440 | Ga0265316_10329194 | 3300031344 | Bacteria | 1108 |
| 441 | Ga0265316_10971713 | 3300031344 | Bacteria | 591 |
| 442 | Ga0265313_10007877 | 3300031595 | Bacteria | 7181 |
| 443 | Ga0265313_10012894 | 3300031595 | Bacteria | 5069 |
| 444 | Ga0265313_10013344 | 3300031595 | Bacteria | 4937 |
| 445 | Ga0265313_10029304 | 3300031595 | Bacteria | 2849 |
| 446 | Ga0265314_10007984 | 3300031711 | Bacteria | 9128 |
| 447 | Ga0265314_10025861 | 3300031711 | Bacteria | 4419 |
| 448 | Ga0265314_10089993 | 3300031711 | Bacteria | 2000 |
| 449 | Ga0265314_10101987 | 3300031711 | Bacteria | 1842 |
| 450 | Ga0265342_10005023 | 3300031712 | Bacteria | 10204 |
| 451 | Ga0265342_10049105 | 3300031712 | Bacteria | 2527 |
| 452 | Ga0265342_10076530 | 3300031712 | Bacteria | 1939 |
| 453 | Ga0373950_0076174 | 3300034818 | Bacteria | 694 |
| 454 | Ga0373926_0378313 | 3300035083 | Archaea | 557 |
| 455 | Ga0373939_0009501 | 3300035114 | Bacteria | 2413 |
| 456 | Ga0373945_0104171 | 3300035116 | Bacteria | 1113 |
| 457 | Ga0373953_0125925 | 3300035117 | Bacteria | 1090 |
| 458 | Ga0373956_0071452 | 3300035119 | Bacteria | 1584 |
| 459 | Ga0373957_0092945 | 3300035120 | Bacteria | 1201 |
| 460 | Ga0373957_0319511 | 3300035120 | Bacteria | 660 |
| 461 | Ga0373957_0514371 | 3300035120 | Unclassified | 522 |
| 462 | Ga0373960_0022012 | 3300035121 | Bacteria | 1702 |
| 463 | Ga0373960_0040923 | 3300035121 | Bacteria | 1340 |
| 464 | Ga0373960_0196255 | 3300035121 | Bacteria | 712 |
| 465 | Ga0373943_0000829 | 3300035170 | Bacteria | 13619 |
| 466 | Ga0373943_0270295 | 3300035170 | Unclassified | 959 |
| 467 | Ga0373943_0293523 | 3300035170 | Bacteria | 922 |
| 468 | Ga0373955_0019481 | 3300035172 | Bacteria | 3393 |
| 469 | Ga0373955_0221916 | 3300035172 | Bacteria | 1129 |
| 470 | Ga0373955_0901872 | 3300035172 | Unclassified | 544 |
| 471 | Ga0373942_0071180 | 3300035207 | Bacteria | 1016 |
| 472 | Ga0373924_0435236 | 3300035410 | Bacteria | 587 |
| 473 | Ga0373931_0457403 | 3300035691 | Bacteria | 817 |
| 474 | Ga0373931_0458111 | 3300035691 | Bacteria | 817 |
| 475 | Ga0373935_0221248 | 3300035692 | Bacteria | 1315 |
| 476 | Ga0373927_0381012 | 3300035695 | Archaea | 930 |
| 477 | Ga0373933_0036055 | 3300035724 | Bacteria | 2893 |
| 478 | Ga0373933_0646094 | 3300035724 | Unclassified | 695 |
| 479 | Ga0373933_1062572 | 3300035724 | Bacteria | 533 |
| 480 | Ga0373947_0000984 | 3300035725 | Bacteria | 17384 |
| 481 | Ga0373947_0407910 | 3300035725 | Bacteria | 917 |
| 482 | Ga0373947_0496951 | 3300035725 | Bacteria | 829 |
| 483 | Ga0373947_1226988 | 3300035725 | Bacteria | 511 |
| 484 | Ga0373937_0004827 | 3300036401 | Bacteria | 11460 |
| 485 | Ga0373937_0015379 | 3300036401 | Bacteria | 6767 |
| 486 | Ga0373937_0132585 | 3300036401 | Unclassified | 2328 |
| 487 | Ga0373937_1418610 | 3300036401 | Bacteria | 642 |
| 488 | Ga0373925_0010018 | 3300037068 | Bacteria | 6883 |
| 489 | Ga0373925_1291588 | 3300037068 | Bacteria | 599 |
| 490 | Ga0395899_0016363 | 3300037312 | Bacteria | 5652 |
| 491 | Ga0395899_0047945 | 3300037312 | Bacteria | 3179 |
| 492 | Ga0395899_0161295 | 3300037312 | Bacteria | 1584 |
| 493 | Ga0395900_0095627 | 3300037418 | Bacteria | 3052 |
| 494 | Ga0395900_0147160 | 3300037418 | Bacteria | 2408 |
| 495 | Ga0395900_0300820 | 3300037418 | Bacteria | 1590 |
| 496 | Ga0395900_0441507 | 3300037418 | Bacteria | 1259 |
| 497 | Ga0395900_0948931 | 3300037418 | Bacteria | 782 |
| 498 | Ga0395900_1259629 | 3300037418 | Bacteria | 654 |
| 499 | Ga0395898_0029255 | 3300037466 | Bacteria | 5519 |
| 500 | Ga0395898_0089588 | 3300037466 | Bacteria | 2960 |
| 501 | Ga0395898_0105649 | 3300037466 | Bacteria | 2700 |
| 502 | Ga0395898_0136846 | 3300037466 | Bacteria | 2345 |
| 503 | Ga0395898_0303429 | 3300037466 | Bacteria | 1523 |
| 504 | Ga0395898_0365992 | 3300037466 | Bacteria | 1375 |
| 505 | Ga0395898_0726818 | 3300037466 | Bacteria | 934 |
| 506 | Ga0395898_0821786 | 3300037466 | Bacteria | 869 |
| 507 | Ga0395898_1596162 | 3300037466 | Bacteria | 577 |
| 508 | Ga0395898_1700882 | 3300037466 | Bacteria | 553 |
| 509 | Ga0395898_1729812 | 3300037466 | Bacteria | 548 |
| 510 | Ga0395905_0012643 | 3300037471 | Bacteria | 8120 |
| 511 | Ga0395905_0020541 | 3300037471 | Bacteria | 6254 |
| 512 | Ga0395905_0172811 | 3300037471 | Bacteria | 2029 |
| 513 | Ga0395905_1066785 | 3300037471 | Bacteria | 711 |
| 514 | Ga0395901_0085688 | 3300038443 | Bacteria | 3293 |
| 515 | Ga0395901_0104451 | 3300038443 | Bacteria | 2973 |
| 516 | Ga0395901_0206329 | 3300038443 | Bacteria | 2058 |
| 517 | Ga0395901_0210507 | 3300038443 | Bacteria | 2035 |
| 518 | Ga0395901_0311953 | 3300038443 | Bacteria | 1629 |
| 519 | Ga0395901_0395880 | 3300038443 | Bacteria | 1419 |
| 520 | Ga0395901_0815489 | 3300038443 | Unclassified | 921 |
| 521 | Ga0395901_1030888 | 3300038443 | Bacteria | 797 |
| 522 | Ga0395901_1050423 | 3300038443 | Bacteria | 788 |
| 523 | Ga0242420_092276 | 3300038996 | Bacteria | 637 |
| 524 | Ga0436365_0098300 | 3300039437 | Unclassified | 544 |
| 525 | Ga0436360_0759873 | 3300039438 | Bacteria | 3368 |
| 526 | Ga0436360_1273503 | 3300039438 | Bacteria | 3604 |
| 527 | Ga0436363_0525738 | 3300039450 | Bacteria | 1238 |
| 528 | Ga0436362_1298139 | 3300039453 | Bacteria | 506 |
| 529 | Ga0451802_1315935 | 3300041460 | Bacteria | 647 |
| 530 | Ga0439448_0339757 | 3300042005 | Bacteria | 535 |
| 531 | Ga0450907_089521 | 3300042146 | Bacteria | 535 |
| 532 | Ga0466969_0008320 | 3300044656 | Bacteria | 5502 |
| 533 | Ga0466969_0028314 | 3300044656 | Bacteria | 2864 |
| 534 | Ga0466969_0079059 | 3300044656 | Bacteria | 1572 |
| 535 | Ga0466969_0093558 | 3300044656 | Bacteria | 1422 |
| 536 | Ga0466969_0204172 | 3300044656 | Bacteria | 901 |
| 537 | Ga0466965_0006762 | 3300044683 | Bacteria | 5234 |
| 538 | Ga0466965_0047491 | 3300044683 | Unclassified | 2126 |
| 539 | Ga0466965_0582917 | 3300044683 | Unclassified | 634 |
| 540 | Ga0466965_0624773 | 3300044683 | Bacteria | 613 |
| 541 | Ga0466966_0010121 | 3300044684 | Bacteria | 6256 |
| 542 | Ga0466966_0027613 | 3300044684 | Bacteria | 3699 |
| 543 | Ga0466966_0332827 | 3300044684 | Bacteria | 912 |
| 544 | Ga0466966_0941860 | 3300044684 | Unclassified | 521 |
| 545 | Ga0466961_0002598 | 3300044693 | Bacteria | 11208 |
| 546 | Ga0466961_0009627 | 3300044693 | Bacteria | 6151 |
| 547 | Ga0466961_0011449 | 3300044693 | Bacteria | 5673 |
| 548 | Ga0466961_0029655 | 3300044693 | Bacteria | 3515 |
| 549 | Ga0466961_0305177 | 3300044693 | Bacteria | 972 |
| 550 | Ga0466961_0369298 | 3300044693 | Bacteria | 872 |
| 551 | Ga0466961_0373865 | 3300044693 | Unclassified | 866 |
| 552 | Ga0466961_0723268 | 3300044693 | Unclassified | 596 |
| 553 | Ga0466961_0739063 | 3300044693 | Bacteria | 588 |
| 554 | Ga0466963_0000638 | 3300044694 | Bacteria | 16848 |
| 555 | Ga0466963_0001960 | 3300044694 | Bacteria | 11294 |
| 556 | Ga0466963_0002419 | 3300044694 | Bacteria | 10446 |
| 557 | Ga0466963_0002874 | 3300044694 | Bacteria | 9728 |
| 558 | Ga0466963_0007500 | 3300044694 | Bacteria | 6509 |
| 559 | Ga0466963_0008277 | 3300044694 | Bacteria | 6230 |
| 560 | Ga0466963_0010088 | 3300044694 | Bacteria | 5711 |
| 561 | Ga0466963_0015895 | 3300044694 | Bacteria | 4672 |
| 562 | Ga0466963_0018310 | 3300044694 | Bacteria | 4376 |
| 563 | Ga0466963_0041043 | 3300044694 | Bacteria | 3033 |
| 564 | Ga0466963_0061838 | 3300044694 | Bacteria | 2504 |
| 565 | Ga0466963_0074842 | 3300044694 | Bacteria | 2284 |
| 566 | Ga0466963_0124604 | 3300044694 | Bacteria | 1775 |
| 567 | Ga0466963_0126152 | 3300044694 | Bacteria | 1765 |
| 568 | Ga0466963_0135344 | 3300044694 | Bacteria | 1704 |
| 569 | Ga0466963_0305487 | 3300044694 | Unclassified | 1119 |
| 570 | Ga0466963_0315279 | 3300044694 | Bacteria | 1100 |
| 571 | Ga0466963_0491748 | 3300044694 | Bacteria | 866 |
| 572 | Ga0466963_0702076 | 3300044694 | Bacteria | 714 |
| 573 | Ga0466963_0733865 | 3300044694 | Bacteria | 697 |
| 574 | Ga0466963_1263664 | 3300044694 | Bacteria | 518 |
| 575 | Ga0466963_1285127 | 3300044694 | Bacteria | 514 |
| 576 | Ga0466963_1290516 | 3300044694 | Bacteria | 512 |
| 577 | Ga0466964_0009667 | 3300044706 | Bacteria | 3633 |
| 578 | Ga0466964_0011996 | 3300044706 | Bacteria | 3277 |
| 579 | Ga0466964_0012986 | 3300044706 | Bacteria | 3155 |
| 580 | Ga0466964_0043632 | 3300044706 | Unclassified | 1819 |
| 581 | Ga0466964_0048436 | 3300044706 | Bacteria | 1737 |
| 582 | Ga0466964_0082260 | 3300044706 | Bacteria | 1384 |
| 583 | Ga0466964_0125995 | 3300044706 | Bacteria | 1160 |
| 584 | Ga0466964_0159160 | 3300044706 | Bacteria | 1054 |
| 585 | Ga0453684_0919400 | 3300044712 | Bacteria | 936 |
| 586 | Ga0466971_0003820 | 3300044719 | Bacteria | 6448 |
| 587 | Ga0466971_0006453 | 3300044719 | Bacteria | 5096 |
| 588 | Ga0466971_0009099 | 3300044719 | Bacteria | 4340 |
| 589 | Ga0466971_0051058 | 3300044719 | Bacteria | 1861 |
| 590 | Ga0466971_0106507 | 3300044719 | Bacteria | 1292 |
| 591 | Ga0466971_0197398 | 3300044719 | Unclassified | 949 |
| 592 | Ga0466971_0201894 | 3300044719 | Bacteria | 939 |
| 593 | Ga0466971_0300313 | 3300044719 | Unclassified | 771 |
| 594 | Ga0466971_0530280 | 3300044719 | Bacteria | 583 |
| 595 | Ga0466968_0007699 | 3300044735 | Unclassified | 4102 |
| 596 | Ga0466968_0007930 | 3300044735 | Bacteria | 4055 |
| 597 | Ga0466968_0104565 | 3300044735 | Bacteria | 1267 |
| 598 | Ga0466968_0110361 | 3300044735 | Bacteria | 1236 |
| 599 | Ga0466968_0138544 | 3300044735 | Bacteria | 1111 |
| 600 | Ga0466968_0235870 | 3300044735 | Unclassified | 865 |
| 601 | Ga0466968_0318970 | 3300044735 | Bacteria | 750 |
| 602 | Ga0466970_0031380 | 3300044765 | Bacteria | 2806 |
| 603 | Ga0466970_0127310 | 3300044765 | Bacteria | 1397 |
| 604 | Ga0466970_0432096 | 3300044765 | Bacteria | 754 |
| 605 | Ga0466970_0837061 | 3300044765 | Bacteria | 540 |
| 606 | Ga0466957_0004248 | 3300044842 | Bacteria | 7943 |
| 607 | Ga0466957_0016146 | 3300044842 | Bacteria | 4365 |
| 608 | Ga0466957_0045674 | 3300044842 | Bacteria | 2657 |
| 609 | Ga0466957_0046935 | 3300044842 | Bacteria | 2623 |
| 610 | Ga0466957_0056358 | 3300044842 | Bacteria | 2403 |
| 611 | Ga0466957_0065101 | 3300044842 | Bacteria | 2244 |
| 612 | Ga0466957_0069326 | 3300044842 | Bacteria | 2178 |
| 613 | Ga0466957_0083788 | 3300044842 | Bacteria | 1990 |
| 614 | Ga0466957_0090534 | 3300044842 | Bacteria | 1916 |
| 615 | Ga0466957_0130720 | 3300044842 | Bacteria | 1608 |
| 616 | Ga0466957_0173250 | 3300044842 | Bacteria | 1406 |
| 617 | Ga0466957_0226265 | 3300044842 | Bacteria | 1237 |
| 618 | Ga0466957_1314679 | 3300044842 | Bacteria | 525 |
| 619 | Ga0466960_0005505 | 3300044901 | Bacteria | 5020 |
| 620 | Ga0466960_0014667 | 3300044901 | Bacteria | 3362 |
| 621 | Ga0466960_0034473 | 3300044901 | Bacteria | 2359 |
| 622 | Ga0466960_0069363 | 3300044901 | Unclassified | 1751 |
| 623 | Ga0466960_0119577 | 3300044901 | Bacteria | 1378 |
| 624 | Ga0466960_0272081 | 3300044901 | Bacteria | 947 |
| 625 | Ga0466960_1007120 | 3300044901 | Bacteria | 512 |
| 626 | Ga0466959_0003027 | 3300045049 | Bacteria | 10865 |
| 627 | Ga0466959_0007099 | 3300045049 | Bacteria | 7837 |
| 628 | Ga0466959_0007785 | 3300045049 | Bacteria | 7537 |
| 629 | Ga0466959_0028569 | 3300045049 | Bacteria | 4135 |
| 630 | Ga0466959_0045281 | 3300045049 | Bacteria | 3240 |
| 631 | Ga0466959_0098643 | 3300045049 | Bacteria | 2093 |
| 632 | Ga0466959_0160810 | 3300045049 | Bacteria | 1579 |
| 633 | Ga0466958_0005189 | 3300045836 | Bacteria | 6975 |
| 634 | Ga0466958_0006933 | 3300045836 | Bacteria | 6200 |
| 635 | Ga0466958_0007722 | 3300045836 | Bacteria | 5934 |
| 636 | Ga0466958_0013137 | 3300045836 | Bacteria | 4708 |
| 637 | Ga0466958_0025514 | 3300045836 | Bacteria | 3485 |
| 638 | Ga0466958_0034967 | 3300045836 | Bacteria | 3000 |
| 639 | Ga0466958_0041133 | 3300045836 | Bacteria | 2779 |
| 640 | Ga0466958_0081052 | 3300045836 | Bacteria | 1997 |
| 641 | Ga0466958_0118993 | 3300045836 | Bacteria | 1652 |
| 642 | Ga0466958_0135384 | 3300045836 | Bacteria | 1549 |
| 643 | Ga0466958_0326158 | 3300045836 | Bacteria | 987 |
| 644 | Ga0466958_0930329 | 3300045836 | Bacteria | 567 |
| 645 | Ga0466967_0000179 | 3300045976 | Bacteria | 26199 |
| 646 | Ga0466967_0001152 | 3300045976 | Bacteria | 14777 |
| 647 | Ga0466967_0004521 | 3300045976 | Bacteria | 9404 |
| 648 | Ga0466967_0010503 | 3300045976 | Bacteria | 6951 |
| 649 | Ga0466967_0010586 | 3300045976 | Bacteria | 6929 |
| 650 | Ga0466967_0013317 | 3300045976 | Bacteria | 6349 |
| 651 | Ga0466967_0014204 | 3300045976 | Bacteria | 6192 |
| 652 | Ga0466967_0016513 | 3300045976 | Bacteria | 5825 |
| 653 | Ga0466967_0016668 | 3300045976 | Bacteria | 5802 |
| 654 | Ga0466967_0018352 | 3300045976 | Bacteria | 5588 |
| 655 | Ga0466967_0027751 | 3300045976 | Bacteria | 4713 |
| 656 | Ga0466967_0031328 | 3300045976 | Bacteria | 4476 |
| 657 | Ga0466967_0052497 | 3300045976 | Bacteria | 3578 |
| 658 | Ga0466967_0063760 | 3300045976 | Bacteria | 3275 |
| 659 | Ga0466967_0080521 | 3300045976 | Bacteria | 2939 |
| 660 | Ga0466967_0083995 | 3300045976 | Bacteria | 2880 |
| 661 | Ga0466967_0124820 | 3300045976 | Unclassified | 2383 |
| 662 | Ga0466967_0143030 | 3300045976 | Bacteria | 2229 |
| 663 | Ga0466967_0153511 | 3300045976 | Bacteria | 2154 |
| 664 | Ga0466967_0168690 | 3300045976 | Unclassified | 2058 |
| 665 | Ga0466967_0176788 | 3300045976 | Bacteria | 2011 |
| 666 | Ga0466967_0183394 | 3300045976 | Bacteria | 1975 |
| 667 | Ga0466967_0188349 | 3300045976 | Bacteria | 1949 |
| 668 | Ga0466967_0189269 | 3300045976 | Bacteria | 1944 |
| 669 | Ga0466967_0227190 | 3300045976 | Bacteria | 1776 |
| 670 | Ga0466967_0233298 | 3300045976 | Bacteria | 1753 |
| 671 | Ga0466967_0243407 | 3300045976 | Unclassified | 1716 |
| 672 | Ga0466967_0327057 | 3300045976 | Bacteria | 1480 |
| 673 | Ga0466967_0332887 | 3300045976 | Bacteria | 1466 |
| 674 | Ga0466967_0337537 | 3300045976 | Bacteria | 1456 |
| 675 | Ga0466967_0388249 | 3300045976 | Bacteria | 1356 |
| 676 | Ga0466967_0595710 | 3300045976 | Unclassified | 1091 |
| 677 | Ga0466967_0629454 | 3300045976 | Bacteria | 1060 |
| 678 | Ga0466967_0730565 | 3300045976 | Bacteria | 981 |
| 679 | Ga0466967_0789590 | 3300045976 | Bacteria | 942 |
| 680 | Ga0466967_1000869 | 3300045976 | Bacteria | 832 |
| 681 | Ga0466967_1062852 | 3300045976 | Bacteria | 806 |
| 682 | Ga0466967_1361528 | 3300045976 | Unclassified | 707 |
| 683 | Ga0466967_1439467 | 3300045976 | Bacteria | 686 |
| 684 | Ga0466967_1637288 | 3300045976 | Bacteria | 641 |
| 685 | Ga0466967_2037987 | 3300045976 | Bacteria | 570 |
| 686 | Ga0466967_2327300 | 3300045976 | Unclassified | 531 |
| 687 | Ga0495592_0000467 | 3300046454 | Bacteria | 29720 |
| 688 | Ga0495592_0004809 | 3300046454 | Bacteria | 9927 |
| 689 | Ga0495592_0038526 | 3300046454 | Bacteria | 3596 |
| 690 | Ga0495592_0524998 | 3300046454 | Bacteria | 731 |
| 691 | Ga0495592_0532538 | 3300046454 | Bacteria | 725 |
| 692 | Ga0495603_0122187 | 3300046455 | Bacteria | 1517 |
| 693 | Ga0495629_0024661 | 3300046459 | Bacteria | 4281 |
| 694 | Ga0495629_0042187 | 3300046459 | Bacteria | 3207 |
| 695 | Ga0495629_0051469 | 3300046459 | Bacteria | 2882 |
| 696 | Ga0495629_0246577 | 3300046459 | Unclassified | 1229 |
| 697 | Ga0495629_0794009 | 3300046459 | Unclassified | 625 |
| 698 | Ga0495641_0032675 | 3300046461 | Bacteria | 2475 |
| 699 | Ga0495641_0048267 | 3300046461 | Bacteria | 1952 |
| 700 | Ga0495641_0065685 | 3300046461 | Bacteria | 1633 |
| 701 | Ga0495641_0100956 | 3300046461 | Bacteria | 1287 |
| 702 | Ga0495641_0156768 | 3300046461 | Bacteria | 1018 |
| 703 | Ga0495641_0194596 | 3300046461 | Unclassified | 909 |
| 704 | Ga0495651_0000621 | 3300046462 | Bacteria | 27474 |
| 705 | Ga0495651_0065300 | 3300046462 | Bacteria | 2779 |
| 706 | Ga0495651_0218634 | 3300046462 | Bacteria | 1320 |
| 707 | Ga0495651_0284014 | 3300046462 | Bacteria | 1117 |
| 708 | Ga0495651_0475159 | 3300046462 | Bacteria | 804 |
| 709 | Ga0495651_0646106 | 3300046462 | Bacteria | 664 |
| 710 | Ga0495651_0791234 | 3300046462 | Archaea | 586 |
| 711 | Ga0495653_0071507 | 3300046463 | Bacteria | 2593 |
| 712 | Ga0495653_0088791 | 3300046463 | Bacteria | 2266 |
| 713 | Ga0495653_0148364 | 3300046463 | Bacteria | 1641 |
| 714 | Ga0495653_0161594 | 3300046463 | Bacteria | 1554 |
| 715 | Ga0495653_0226612 | 3300046463 | Bacteria | 1253 |
| 716 | Ga0495653_0321024 | 3300046463 | Bacteria | 1004 |
| 717 | Ga0495653_0337587 | 3300046463 | Unclassified | 972 |
| 718 | Ga0495653_0350983 | 3300046463 | Bacteria | 949 |
| 719 | Ga0495653_0759791 | 3300046463 | Bacteria | 585 |
| 720 | Ga0495580_0097510 | 3300046472 | Bacteria | 2044 |
| 721 | Ga0495582_0006911 | 3300046473 | Bacteria | 6308 |
| 722 | Ga0495582_0018061 | 3300046473 | Bacteria | 3858 |
| 723 | Ga0495582_0060129 | 3300046473 | Bacteria | 2096 |
| 724 | Ga0495582_0121278 | 3300046473 | Bacteria | 1473 |
| 725 | Ga0495582_0528744 | 3300046473 | Bacteria | 682 |
| 726 | Ga0495582_0737679 | 3300046473 | Bacteria | 570 |
| 727 | Ga0495639_0009136 | 3300046475 | Bacteria | 4247 |
| 728 | Ga0495662_0018780 | 3300046476 | Bacteria | 3346 |
| 729 | Ga0495662_0159618 | 3300046476 | Bacteria | 1111 |
| 730 | Ga0495662_0617719 | 3300046476 | Bacteria | 530 |
| 731 | Ga0495664_0089788 | 3300046477 | Bacteria | 1847 |
| 732 | Ga0495664_0159897 | 3300046477 | Bacteria | 1366 |
| 733 | Ga0495664_0234408 | 3300046477 | Bacteria | 1110 |
| 734 | Ga0495664_0735392 | 3300046477 | Unclassified | 582 |
| 735 | Ga0495584_0654457 | 3300046491 | Unclassified | 536 |
| 736 | Ga0495585_0057908 | 3300046492 | Bacteria | 2138 |
| 737 | Ga0495594_0258448 | 3300046499 | Bacteria | 992 |
| 738 | Ga0495608_0011270 | 3300046511 | Bacteria | 6225 |
| 739 | Ga0495608_0042449 | 3300046511 | Bacteria | 3042 |
| 740 | Ga0495608_0062849 | 3300046511 | Bacteria | 2438 |
| 741 | Ga0495608_0127149 | 3300046511 | Bacteria | 1632 |
| 742 | Ga0495608_0616873 | 3300046511 | Bacteria | 650 |
| 743 | Ga0495618_0000514 | 3300046514 | Bacteria | 27432 |
| 744 | Ga0495618_0025530 | 3300046514 | Bacteria | 3668 |
| 745 | Ga0495618_0036609 | 3300046514 | Bacteria | 3079 |
| 746 | Ga0495618_0046686 | 3300046514 | Bacteria | 2733 |
| 747 | Ga0495618_0110550 | 3300046514 | Bacteria | 1760 |
| 748 | Ga0495618_0482599 | 3300046514 | Bacteria | 749 |
| 749 | Ga0495628_0000209 | 3300046516 | Bacteria | 51173 |
| 750 | Ga0495628_0023732 | 3300046516 | Bacteria | 5029 |
| 751 | Ga0495628_0154623 | 3300046516 | Bacteria | 1746 |
| 752 | Ga0495628_0244842 | 3300046516 | Bacteria | 1340 |
| 753 | Ga0495628_0351723 | 3300046516 | Bacteria | 1083 |
| 754 | Ga0495628_0597604 | 3300046516 | Bacteria | 788 |
| 755 | Ga0495630_0029915 | 3300046517 | Bacteria | 4050 |
| 756 | Ga0495630_0032508 | 3300046517 | Bacteria | 3888 |
| 757 | Ga0495630_0077000 | 3300046517 | Bacteria | 2514 |
| 758 | Ga0495630_0113955 | 3300046517 | Bacteria | 2049 |
| 759 | Ga0495630_0153890 | 3300046517 | Bacteria | 1750 |
| 760 | Ga0495630_0187855 | 3300046517 | Bacteria | 1576 |
| 761 | Ga0495630_0449837 | 3300046517 | Bacteria | 987 |
| 762 | Ga0495630_0509571 | 3300046517 | Bacteria | 923 |
| 763 | Ga0495630_1143774 | 3300046517 | Bacteria | 589 |
| 764 | Ga0495644_0255444 | 3300046523 | Bacteria | 681 |
| 765 | Ga0495666_0000649 | 3300046526 | Bacteria | 15639 |
| 766 | Ga0495666_0312377 | 3300046526 | Bacteria | 710 |
| 767 | Ga0495652_0001901 | 3300046529 | Bacteria | 22205 |
| 768 | Ga0495652_0045105 | 3300046529 | Bacteria | 3793 |
| 769 | Ga0495652_0068779 | 3300046529 | Bacteria | 2966 |
| 770 | Ga0495652_0080097 | 3300046529 | Bacteria | 2699 |
| 771 | Ga0495652_0129406 | 3300046529 | Bacteria | 2000 |
| 772 | Ga0495652_0143141 | 3300046529 | Unclassified | 1878 |
| 773 | Ga0495652_0172940 | 3300046529 | Bacteria | 1665 |
| 774 | Ga0495652_0243299 | 3300046529 | Bacteria | 1337 |
| 775 | Ga0495652_0276313 | 3300046529 | Bacteria | 1232 |
| 776 | Ga0495652_0550187 | 3300046529 | Bacteria | 794 |
| 777 | Ga0495652_0620493 | 3300046529 | Archaea | 735 |
| 778 | Ga0495652_0732378 | 3300046529 | Bacteria | 663 |
| 779 | Ga0495665_0375708 | 3300046531 | Unclassified | 722 |
| 780 | Ga0495640_0024570 | 3300046533 | Bacteria | 4382 |
| 781 | Ga0495640_0074914 | 3300046533 | Unclassified | 2261 |
| 782 | Ga0495640_0256326 | 3300046533 | Bacteria | 1094 |
| 783 | Ga0495640_0257193 | 3300046533 | Bacteria | 1092 |
| 784 | Ga0495640_0883995 | 3300046533 | Bacteria | 530 |
| 785 | Ga0495586_0051724 | 3300046535 | Bacteria | 2223 |
| 786 | Ga0495586_0189050 | 3300046535 | Bacteria | 1166 |
| 787 | Ga0495586_0228486 | 3300046535 | Bacteria | 1058 |
| 788 | Ga0495586_0293847 | 3300046535 | Bacteria | 930 |
| 789 | Ga0495586_0523725 | 3300046535 | Bacteria | 684 |
| 790 | Ga0495586_0675005 | 3300046535 | Bacteria | 597 |
| 791 | Ga0495587_0000492 | 3300046536 | Bacteria | 27537 |
| 792 | Ga0495587_0034131 | 3300046536 | Bacteria | 3069 |
| 793 | Ga0495587_0038267 | 3300046536 | Bacteria | 2877 |
| 794 | Ga0495645_0000126 | 3300046543 | Bacteria | 51697 |
| 795 | Ga0495645_0047549 | 3300046543 | Bacteria | 3125 |
| 796 | Ga0495645_0078324 | 3300046543 | Bacteria | 2375 |
| 797 | Ga0495645_0246482 | 3300046543 | Bacteria | 1189 |
| 798 | Ga0495667_0025462 | 3300046559 | Bacteria | 3987 |
| 799 | Ga0495667_0058958 | 3300046559 | Bacteria | 2520 |
| 800 | Ga0495667_0069471 | 3300046559 | Bacteria | 2299 |
| 801 | Ga0495667_0073553 | 3300046559 | Bacteria | 2226 |
| 802 | Ga0495667_0077102 | 3300046559 | Bacteria | 2168 |
| 803 | Ga0495667_0398011 | 3300046559 | Bacteria | 868 |
| 804 | Ga0495667_0753862 | 3300046559 | Bacteria | 602 |
| 805 | Ga0495656_0006189 | 3300046615 | Bacteria | 4187 |
| 806 | Ga0495656_0319665 | 3300046615 | Bacteria | 799 |
| 807 | Ga0495634_0163911 | 3300046642 | Bacteria | 1400 |
| 808 | Ga0495634_0190572 | 3300046642 | Unclassified | 1279 |
| 809 | Ga0495634_0248988 | 3300046642 | Bacteria | 1087 |
| 810 | Ga0495634_0796533 | 3300046642 | Bacteria | 539 |
| 811 | Ga0495635_0010795 | 3300046663 | Bacteria | 6400 |
| 812 | Ga0495635_0052818 | 3300046663 | Bacteria | 2799 |
| 813 | Ga0495635_0054282 | 3300046663 | Bacteria | 2760 |
| 814 | Ga0495635_0059338 | 3300046663 | Bacteria | 2630 |
| 815 | Ga0495635_0081459 | 3300046663 | Bacteria | 2215 |
| 816 | Ga0495635_0131326 | 3300046663 | Unclassified | 1707 |
| 817 | Ga0495635_0137700 | 3300046663 | Bacteria | 1663 |
| 818 | Ga0495635_0156451 | 3300046663 | Bacteria | 1551 |
| 819 | Ga0495588_0558312 | 3300046674 | Bacteria | 600 |
| 820 | Ga0495657_0007470 | 3300046675 | Bacteria | 8447 |
| 821 | Ga0495657_0007590 | 3300046675 | Bacteria | 8367 |
| 822 | Ga0495657_0021368 | 3300046675 | Bacteria | 4644 |
| 823 | Ga0495657_0022121 | 3300046675 | Bacteria | 4559 |
| 824 | Ga0495599_0000130 | 3300046678 | Bacteria | 48631 |
| 825 | Ga0495599_0235459 | 3300046678 | Bacteria | 1117 |
| 826 | Ga0495599_0360090 | 3300046678 | Archaea | 871 |
| 827 | Ga0495623_0000041 | 3300046679 | Bacteria | 78481 |
| 828 | Ga0495623_0373170 | 3300046679 | Bacteria | 773 |
| 829 | Ga0495623_0424907 | 3300046679 | Bacteria | 711 |
| 830 | Ga0495646_0268246 | 3300046680 | Bacteria | 910 |
| 831 | Ga0495646_0332758 | 3300046680 | Bacteria | 798 |
| 832 | Ga0495647_0005935 | 3300046681 | Bacteria | 4021 |
| 833 | Ga0495647_0038165 | 3300046681 | Bacteria | 1815 |
| 834 | Ga0495647_0348646 | 3300046681 | Bacteria | 674 |
| 835 | Ga0495647_0541745 | 3300046681 | Unclassified | 544 |
| 836 | Ga0495658_0004962 | 3300046683 | Bacteria | 6527 |
| 837 | Ga0495658_0038832 | 3300046683 | Bacteria | 2638 |
| 838 | Ga0495658_0077855 | 3300046683 | Bacteria | 1940 |
| 839 | Ga0495658_0638210 | 3300046683 | Bacteria | 682 |
| 840 | Ga0495613_0004077 | 3300046689 | Bacteria | 10921 |
| 841 | Ga0495613_0065038 | 3300046689 | Bacteria | 2666 |
| 842 | Ga0495613_0075657 | 3300046689 | Bacteria | 2451 |
| 843 | Ga0495613_0077256 | 3300046689 | Bacteria | 2423 |
| 844 | Ga0495613_0083914 | 3300046689 | Bacteria | 2313 |
| 845 | Ga0495613_0117564 | 3300046689 | Bacteria | 1911 |
| 846 | Ga0495613_0395861 | 3300046689 | Bacteria | 943 |
| 847 | Ga0495613_0712973 | 3300046689 | Bacteria | 660 |
| 848 | Ga0495613_0789962 | 3300046689 | Bacteria | 620 |
| 849 | Ga0495613_0798449 | 3300046689 | Bacteria | 616 |
| 850 | Ga0495624_0003577 | 3300046690 | Bacteria | 11505 |
| 851 | Ga0495624_0032360 | 3300046690 | Unclassified | 3392 |
| 852 | Ga0495624_0050268 | 3300046690 | Bacteria | 2641 |
| 853 | Ga0495624_0394708 | 3300046690 | Unclassified | 831 |
| 854 | Ga0495624_0627360 | 3300046690 | Bacteria | 640 |
| 855 | Ga0495589_0419934 | 3300046794 | Bacteria | 613 |
| 856 | Ga0495600_0114072 | 3300046809 | Bacteria | 1760 |
| 857 | Ga0495600_0174744 | 3300046809 | Bacteria | 1385 |
| 858 | Ga0495600_0350087 | 3300046809 | Bacteria | 925 |
| 859 | Ga0495581_0007047 | 3300047315 | Bacteria | 6516 |
| 860 | Ga0495581_0045247 | 3300047315 | Bacteria | 2545 |
| 861 | Ga0495581_0612098 | 3300047315 | Unclassified | 631 |
| 862 | Ga0495604_0000167 | 3300047317 | Bacteria | 57533 |
| 863 | Ga0495604_0561258 | 3300047317 | Bacteria | 735 |
| 864 | Ga0495604_0740947 | 3300047317 | Bacteria | 622 |
| 865 | Ga0495674_0037111 | 3300047319 | Bacteria | 4380 |
| 866 | Ga0495674_0037491 | 3300047319 | Bacteria | 4356 |
| 867 | Ga0495674_0126018 | 3300047319 | Bacteria | 2161 |
| 868 | Ga0495674_0134915 | 3300047319 | Bacteria | 2077 |
| 869 | Ga0495674_0141468 | 3300047319 | Bacteria | 2022 |
| 870 | Ga0495674_0307582 | 3300047319 | Bacteria | 1294 |
| 871 | Ga0495674_0417003 | 3300047319 | Unclassified | 1082 |
| 872 | Ga0495674_0446413 | 3300047319 | Bacteria | 1040 |
| 873 | Ga0495674_0970014 | 3300047319 | Bacteria | 653 |
| 874 | Ga0495674_1082072 | 3300047319 | Bacteria | 611 |
| 875 | Ga0495674_1162632 | 3300047319 | Bacteria | 585 |
| 876 | Ga0495676_0002388 | 3300047321 | Bacteria | 16667 |
| 877 | Ga0495676_0229986 | 3300047321 | Bacteria | 1274 |
| 878 | Ga0495676_0416105 | 3300047321 | Bacteria | 890 |
| 879 | Ga0495676_0750082 | 3300047321 | Unclassified | 630 |
| 880 | Ga0495680_0003097 | 3300047322 | Bacteria | 16573 |
| 881 | Ga0495680_0023872 | 3300047322 | Bacteria | 5081 |
| 882 | Ga0495680_0027741 | 3300047322 | Bacteria | 4647 |
| 883 | Ga0495680_0027979 | 3300047322 | Bacteria | 4626 |
| 884 | Ga0495680_0033027 | 3300047322 | Bacteria | 4194 |
| 885 | Ga0495680_0079172 | 3300047322 | Bacteria | 2486 |
| 886 | Ga0495680_0272241 | 3300047322 | Bacteria | 1195 |
| 887 | Ga0495680_0357225 | 3300047322 | Bacteria | 1016 |
| 888 | Ga0495680_0454678 | 3300047322 | Bacteria | 876 |
| 889 | Ga0495680_0686863 | 3300047322 | Bacteria | 677 |
| 890 | Ga0495675_0000724 | 3300047444 | Bacteria | 20636 |
| 891 | Ga0495675_0356176 | 3300047444 | Bacteria | 860 |
| 892 | Ga0495684_0014897 | 3300047471 | Bacteria | 5988 |
| 893 | Ga0495684_0020918 | 3300047471 | Bacteria | 5041 |
| 894 | Ga0495684_0026533 | 3300047471 | Bacteria | 4452 |
| 895 | Ga0495684_0040798 | 3300047471 | Bacteria | 3557 |
| 896 | Ga0495684_0082568 | 3300047471 | Bacteria | 2438 |
| 897 | Ga0495684_0104324 | 3300047471 | Bacteria | 2142 |
| 898 | Ga0495684_0175847 | 3300047471 | Unclassified | 1589 |
| 899 | Ga0495684_1002535 | 3300047471 | Bacteria | 530 |
| 900 | Ga0495593_0006002 | 3300047673 | Bacteria | 7152 |
| 901 | Ga0495593_0337721 | 3300047673 | Bacteria | 753 |
| 902 | Ga0495602_0000147 | 3300048088 | Bacteria | 65372 |
| 903 | Ga0495602_0251666 | 3300048088 | Bacteria | 1316 |
| 904 | Ga0495614_0010756 | 3300048089 | Bacteria | 4029 |
| 905 | Ga0495614_0524370 | 3300048089 | Bacteria | 565 |
| 906 | Ga0496100_0001432 | 3300048903 | Bacteria | 11671 |
| 907 | Ga0496100_0007313 | 3300048903 | Bacteria | 6080 |
| 908 | Ga0496100_0014542 | 3300048903 | Bacteria | 4571 |
| 909 | Ga0496100_0194027 | 3300048903 | Unclassified | 1476 |
| 910 | Ga0496100_1034076 | 3300048903 | Unclassified | 647 |
| 911 | Ga0496100_1510666 | 3300048903 | Bacteria | 531 |
| 912 | Ga0496101_0004152 | 3300048904 | Bacteria | 9073 |
| 913 | Ga0496101_0007006 | 3300048904 | Bacteria | 7281 |
| 914 | Ga0496101_0015812 | 3300048904 | Bacteria | 5092 |
| 915 | Ga0496101_0158788 | 3300048904 | Bacteria | 1733 |
| 916 | Ga0496101_0630182 | 3300048904 | Unclassified | 847 |
| 917 | Ga0496101_0643906 | 3300048904 | Bacteria | 837 |
| 918 | Ga0496102_0002713 | 3300048905 | Bacteria | 15060 |
| 919 | Ga0496102_0011745 | 3300048905 | Bacteria | 7558 |
| 920 | Ga0496102_0014363 | 3300048905 | Bacteria | 6879 |
| 921 | Ga0496102_0116347 | 3300048905 | Bacteria | 2495 |
| 922 | Ga0496102_0349843 | 3300048905 | Bacteria | 1391 |
| 923 | Ga0496102_0485168 | 3300048905 | Unclassified | 1157 |
| 924 | Ga0496102_1703307 | 3300048905 | Unclassified | 548 |
| 925 | Ga0496103_0030216 | 3300048906 | Bacteria | 3296 |
| 926 | Ga0496103_0034710 | 3300048906 | Bacteria | 3086 |
| 927 | Ga0496103_0071000 | 3300048906 | Bacteria | 2179 |
| 928 | Ga0496103_0190315 | 3300048906 | Bacteria | 1319 |
| 929 | Ga0496103_0351687 | 3300048906 | Unclassified | 947 |
| 930 | Ga0496104_0020221 | 3300048907 | Bacteria | 6100 |
| 931 | Ga0496104_0078038 | 3300048907 | Bacteria | 3155 |
| 932 | Ga0496104_0104879 | 3300048907 | Bacteria | 2709 |
| 933 | Ga0496104_0113105 | 3300048907 | Bacteria | 2603 |
| 934 | Ga0496104_0157942 | 3300048907 | Bacteria | 2176 |
| 935 | Ga0496104_0161795 | 3300048907 | Bacteria | 2147 |
| 936 | Ga0496104_0169409 | 3300048907 | Bacteria | 2094 |
| 937 | Ga0496104_0184515 | 3300048907 | Bacteria | 1997 |
| 938 | Ga0496104_0325595 | 3300048907 | Bacteria | 1450 |
| 939 | Ga0496104_0468114 | 3300048907 | Bacteria | 1172 |
| 940 | Ga0496104_0520879 | 3300048907 | Bacteria | 1100 |
| 941 | Ga0496104_1122189 | 3300048907 | Unclassified | 690 |
| 942 | Ga0496104_1663280 | 3300048907 | Bacteria | 541 |
| 943 | Ga0496105_0020574 | 3300048908 | Bacteria | 5334 |
| 944 | Ga0496105_0032718 | 3300048908 | Bacteria | 4269 |
| 945 | Ga0496105_0087793 | 3300048908 | Bacteria | 2569 |
| 946 | Ga0496105_0255319 | 3300048908 | Bacteria | 1419 |
| 947 | Ga0496105_0393485 | 3300048908 | Unclassified | 1101 |
| 948 | Ga0496105_1040315 | 3300048908 | Unclassified | 610 |
| 949 | Ga0496105_1222188 | 3300048908 | Bacteria | 552 |
| 950 | Ga0496106_0000586 | 3300048909 | Bacteria | 26020 |
| 951 | Ga0496106_0005920 | 3300048909 | Bacteria | 9040 |
| 952 | Ga0496106_0018426 | 3300048909 | Bacteria | 5161 |
| 953 | Ga0496106_0392785 | 3300048909 | Bacteria | 1115 |
| 954 | Ga0496107_0000178 | 3300048910 | Bacteria | 32998 |
| 955 | Ga0496107_0001702 | 3300048910 | Bacteria | 13784 |
| 956 | Ga0496107_0015869 | 3300048910 | Bacteria | 5284 |
| 957 | Ga0496107_0022441 | 3300048910 | Bacteria | 4460 |
| 958 | Ga0496107_0033804 | 3300048910 | Bacteria | 3660 |
| 959 | Ga0496107_0454106 | 3300048910 | Unclassified | 952 |
| 960 | Ga0496108_0034028 | 3300048911 | Bacteria | 4233 |
| 961 | Ga0496108_0050199 | 3300048911 | Bacteria | 3492 |
| 962 | Ga0496108_0062684 | 3300048911 | Bacteria | 3130 |
| 963 | Ga0496108_0103999 | 3300048911 | Bacteria | 2423 |
| 964 | Ga0496108_0562960 | 3300048911 | Bacteria | 994 |
| 965 | Ga0496108_0728972 | 3300048911 | Unclassified | 858 |
| 966 | Ga0496108_0806035 | 3300048911 | Bacteria | 810 |
| 967 | Ga0496108_1041126 | 3300048911 | Unclassified | 698 |
| 968 | Ga0496108_1366947 | 3300048911 | Bacteria | 593 |
| 969 | Ga0496109_0023831 | 3300048912 | Bacteria | 5433 |
| 970 | Ga0496109_0034023 | 3300048912 | Bacteria | 4586 |
| 971 | Ga0496109_0060193 | 3300048912 | Bacteria | 3470 |
| 972 | Ga0496109_0067859 | 3300048912 | Bacteria | 3268 |
| 973 | Ga0496109_0071716 | 3300048912 | Bacteria | 3181 |
| 974 | Ga0496109_0101168 | 3300048912 | Unclassified | 2674 |
| 975 | Ga0496109_0414694 | 3300048912 | Bacteria | 1272 |
| 976 | Ga0496109_0992911 | 3300048912 | Bacteria | 777 |
| 977 | Ga0496109_1545898 | 3300048912 | Unclassified | 598 |
| 978 | Ga0496109_1689725 | 3300048912 | Bacteria | 567 |
| 979 | Ga0496110_0012051 | 3300048913 | Bacteria | 7102 |
| 980 | Ga0496110_0019384 | 3300048913 | Bacteria | 5723 |
| 981 | Ga0496110_0648594 | 3300048913 | Bacteria | 955 |
| 982 | Ga0496110_1566194 | 3300048913 | Bacteria | 569 |
| 983 | Ga0496111_0006770 | 3300048914 | Bacteria | 7468 |
| 984 | Ga0496111_0028995 | 3300048914 | Bacteria | 3927 |
| 985 | Ga0496111_0070656 | 3300048914 | Bacteria | 2540 |
| 986 | Ga0496111_0163351 | 3300048914 | Bacteria | 1654 |
| 987 | Ga0496111_0460116 | 3300048914 | Bacteria | 938 |
| 988 | Ga0496111_0765421 | 3300048914 | Bacteria | 700 |
| 989 | Ga0496112_0002974 | 3300048915 | Bacteria | 13822 |
| 990 | Ga0496112_0009862 | 3300048915 | Bacteria | 8631 |
| 991 | Ga0496112_0052767 | 3300048915 | Bacteria | 3991 |
| 992 | Ga0496112_0058651 | 3300048915 | Bacteria | 3791 |
| 993 | Ga0496112_0127224 | 3300048915 | Bacteria | 2518 |
| 994 | Ga0496112_0193892 | 3300048915 | Bacteria | 1993 |
| 995 | Ga0496112_0220626 | 3300048915 | Bacteria | 1852 |
| 996 | Ga0496112_0503077 | 3300048915 | Bacteria | 1147 |
| 997 | Ga0496112_0839333 | 3300048915 | Bacteria | 842 |
| 998 | Ga0496112_1313235 | 3300048915 | Unclassified | 639 |
| 999 | Ga0496112_1707767 | 3300048915 | Archaea | 542 |
| 1000 | Ga0496113_0177054 | 3300048916 | Bacteria | 1690 |
| 1001 | Ga0496113_0230776 | 3300048916 | Bacteria | 1476 |
| 1002 | Ga0496113_0231059 | 3300048916 | Bacteria | 1475 |
| 1003 | Ga0496113_0242879 | 3300048916 | Bacteria | 1437 |
| 1004 | Ga0496113_0324821 | 3300048916 | Unclassified | 1234 |
| 1005 | Ga0496113_0386151 | 3300048916 | Bacteria | 1124 |
| 1006 | Ga0496113_0514836 | 3300048916 | Bacteria | 960 |
| 1007 | Ga0496113_0537012 | 3300048916 | Bacteria | 938 |
| 1008 | Ga0496113_0548728 | 3300048916 | Bacteria | 927 |
| 1009 | Ga0496114_0003344 | 3300048917 | Bacteria | 12327 |
| 1010 | Ga0496114_0041600 | 3300048917 | Bacteria | 3809 |
| 1011 | Ga0496114_0041653 | 3300048917 | Bacteria | 3806 |
| 1012 | Ga0496114_0049600 | 3300048917 | Bacteria | 3493 |
| 1013 | Ga0496114_0049741 | 3300048917 | Bacteria | 3489 |
| 1014 | Ga0496114_0317209 | 3300048917 | Bacteria | 1377 |
| 1015 | Ga0496114_1531768 | 3300048917 | Bacteria | 555 |
| 1016 | Ga0496115_0004846 | 3300048918 | Bacteria | 9767 |
| 1017 | Ga0496115_0019193 | 3300048918 | Bacteria | 5259 |
| 1018 | Ga0496115_0178180 | 3300048918 | Unclassified | 1758 |
| 1019 | Ga0496115_0235723 | 3300048918 | Bacteria | 1508 |
| 1020 | Ga0501034_0101789 | 3300049571 | Bacteria | 2866 |
| 1021 | Ga0501046_0700966 | 3300049580 | Unclassified | 713 |
| 1022 | Ga0501047_0359030 | 3300049581 | Bacteria | 1293 |
| 1023 | Ga0501067_0020546 | 3300049583 | Bacteria | 3654 |
| 1024 | Ga0501067_0020974 | 3300049583 | Bacteria | 3615 |
| 1025 | Ga0501067_0044763 | 3300049583 | Bacteria | 2459 |
| 1026 | Ga0501067_0331713 | 3300049583 | Bacteria | 847 |
| 1027 | Ga0501067_0802267 | 3300049583 | Bacteria | 530 |
| 1028 | Ga0501069_0004421 | 3300049585 | Bacteria | 7260 |
| 1029 | Ga0501069_0017354 | 3300049585 | Bacteria | 3872 |
| 1030 | Ga0501069_0332749 | 3300049585 | Bacteria | 893 |
| 1031 | Ga0501069_0977859 | 3300049585 | Bacteria | 516 |
| 1032 | Ga0501070_0013851 | 3300049586 | Bacteria | 6793 |
| 1033 | Ga0501070_0184081 | 3300049586 | Bacteria | 1718 |
| 1034 | Ga0501070_0944779 | 3300049586 | Bacteria | 671 |
| 1035 | Ga0501070_1303878 | 3300049586 | Unclassified | 554 |
| 1036 | Ga0501071_1177198 | 3300049587 | Unclassified | 592 |
| 1037 | Ga0501072_0001288 | 3300049588 | Bacteria | 18753 |
| 1038 | Ga0501073_0099410 | 3300049589 | Bacteria | 2020 |
| 1039 | Ga0501074_0117305 | 3300049590 | Bacteria | 1904 |
| 1040 | Ga0501076_0478579 | 3300049592 | Bacteria | 1026 |
| 1041 | Ga0501079_0111747 | 3300049741 | Bacteria | 2123 |
| 1042 | Ga0501080_0000892 | 3300049742 | Bacteria | 24442 |
| 1043 | Ga0501080_0037995 | 3300049742 | Bacteria | 4496 |
| 1044 | Ga0501083_0006059 | 3300049744 | Bacteria | 8565 |
| 1045 | Ga0501044_0780232 | 3300049823 | Bacteria | 836 |
| 1046 | nmdc:mga03n38_302356_c1 | 3300050490 | Unclassified | 859 |
| 1047 | nmdc:mga05p37_1025570_c1 | 3300050507 | Bacteria | 873 |
| 1048 | nmdc:mga08y16_25535_c1 | 3300050511 | Bacteria | 6231 |
| 1049 | nmdc:mga0n895_1670_c1 | 3300050512 | Bacteria | 16756 |
| 1050 | nmdc:mga0n895_294034_c1 | 3300050512 | Unclassified | 1647 |
| 1051 | nmdc:mga0n895_655801_c1 | 3300050512 | Bacteria | 1048 |
| 1052 | nmdc:mga0rr50_20750_c1 | 3300050513 | Bacteria | 4469 |
| 1053 | nmdc:mga0rr50_561516_c1 | 3300050513 | Bacteria | 972 |
| 1054 | nmdc:mga08x19_534_c1 | 3300050514 | Bacteria | 25204 |
| 1055 | nmdc:mga0a205_445021_c1 | 3300050515 | Unclassified | 1156 |
| 1056 | Ga0495601_0000275 | 3300053077 | Bacteria | 27636 |
| 1057 | Ga0495601_0008713 | 3300053077 | Bacteria | 5987 |
| 1058 | Ga0495601_0013067 | 3300053077 | Bacteria | 4990 |
| 1059 | Ga0495601_0034241 | 3300053077 | Bacteria | 3167 |
| 1060 | Ga0495601_0050954 | 3300053077 | Bacteria | 2612 |
| 1061 | Ga0495601_0191990 | 3300053077 | Bacteria | 1335 |
| 1062 | Ga0495612_0001639 | 3300053078 | Bacteria | 9214 |
| 1063 | Ga0495612_0157862 | 3300053078 | Bacteria | 989 |
| 1064 | Ga0495612_0320397 | 3300053078 | Unclassified | 697 |
| 1065 | Ga0495655_0141731 | 3300053083 | Bacteria | 749 |
| 1066 | Ga0495595_0029535 | 3300053084 | Bacteria | 2454 |
| 1067 | Ga0495595_0032339 | 3300053084 | Bacteria | 2356 |
| 1068 | Ga0495595_0059926 | 3300053084 | Bacteria | 1781 |
| 1069 | Ga0495595_0366164 | 3300053084 | Bacteria | 728 |
| 1070 | Ga0495595_0501460 | 3300053084 | Bacteria | 618 |
| 1071 | Ga0495619_0003160 | 3300053085 | Bacteria | 10682 |
| 1072 | Ga0495619_0008123 | 3300053085 | Bacteria | 6642 |
| 1073 | Ga0495619_0026190 | 3300053085 | Bacteria | 3751 |
| 1074 | Ga0495619_0081911 | 3300053085 | Bacteria | 2174 |
| 1075 | Ga0495619_0115270 | 3300053085 | Bacteria | 1839 |
| 1076 | Ga0495619_0576749 | 3300053085 | Unclassified | 771 |
| 1077 | Ga0495619_0756844 | 3300053085 | Bacteria | 659 |
| 1078 | Ga0500566_0093612 | 3300053094 | Bacteria | 1657 |
| 1079 | Ga0501084_0328382 | 3300054114 | Bacteria | 1292 |
| 1080 | Ga0587113_048470 | 3300059625 | Bacteria | 525 |
| 1081 | Ga0587122_047712 | 3300059628 | Bacteria | 548 |
| 1082 | Ga0587075_144779 | 3300059644 | Unclassified | 510 |
| 1083 | Ga0587114_135536 | 3300059655 | Bacteria | 511 |
| 1084 | Ga0587111_0181311 | 3300060346 | Bacteria | 586 |
| 1085 | Ga0587111_0205363 | 3300060346 | Unclassified | 561 |
| 1086 | Ga0466962_0001252 | 3300061719 | Bacteria | 11717 |
| 1087 | Ga0466962_0014341 | 3300061719 | Bacteria | 3819 |
| 1088 | Ga0466962_0046681 | 3300061719 | Bacteria | 2070 |
| 1089 | Ga0466962_0070582 | 3300061719 | Unclassified | 1669 |
| 1090 | Ga0466962_0079600 | 3300061719 | Bacteria | 1566 |
| 1091 | Ga0466962_0132251 | 3300061719 | Bacteria | 1206 |
| 1092 | Ga0466962_0235317 | 3300061719 | Bacteria | 898 |
| 1093 | Ga0466962_0615554 | 3300061719 | Unclassified | 554 |
| 1094 | Ga0530510_0078335 | 3300061734 | Bacteria | 2403 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006048 | Ga0075363_100352105 | Ga0075363_1003521052 | 93 |
| 2 | 3300009553 | Ga0105249_10566523 | Ga0105249_105665232 | 97 |
| 3 | 3300025961 | Ga0207712_10992159 | Ga0207712_109921592 | 97 |
| 4 | 3300005329 | Ga0070683_100021983 | Ga0070683_1000219832 | 98 |
| 5 | 3300005329 | Ga0070683_100332332 | Ga0070683_1003323323 | 98 |
| 6 | 3300005330 | Ga0070690_100394324 | Ga0070690_1003943242 | 98 |
| 7 | 3300005334 | Ga0068869_100749878 | Ga0068869_1007498782 | 98 |
| 8 | 3300005337 | Ga0070682_100212174 | Ga0070682_1002121742 | 98 |
| 9 | 3300005338 | Ga0068868_100125953 | Ga0068868_1001259532 | 98 |
| 10 | 3300005338 | Ga0068868_101420324 | Ga0068868_1014203242 | 98 |
| 11 | 3300005340 | Ga0070689_100386077 | Ga0070689_1003860771 | 98 |
| 12 | 3300005354 | Ga0070675_101408318 | Ga0070675_1014083182 | 98 |
| 13 | 3300005355 | Ga0070671_100279396 | Ga0070671_1002793962 | 98 |
| 14 | 3300005364 | Ga0070673_100623936 | Ga0070673_1006239361 | 98 |
| 15 | 3300005366 | Ga0070659_100562720 | Ga0070659_1005627202 | 98 |
| 16 | 3300005434 | Ga0070709_11030388 | Ga0070709_110303881 | 98 |
| 17 | 3300005435 | Ga0070714_100652924 | Ga0070714_1006529242 | 98 |
| 18 | 3300005439 | Ga0070711_100903416 | Ga0070711_1009034162 | 98 |
| 19 | 3300005440 | Ga0070705_101850306 | Ga0070705_1018503061 | 98 |
| 20 | 3300005455 | Ga0070663_100536657 | Ga0070663_1005366572 | 98 |
| 21 | 3300005456 | Ga0070678_100694726 | Ga0070678_1006947262 | 98 |
| 22 | 3300005456 | Ga0070678_101271716 | Ga0070678_1012717162 | 98 |
| 23 | 3300005458 | Ga0070681_10716761 | Ga0070681_107167612 | 98 |
| 24 | 3300005459 | Ga0068867_100110603 | Ga0068867_1001106033 | 98 |
| 25 | 3300005518 | Ga0070699_101147556 | Ga0070699_1011475562 | 98 |
| 26 | 3300005535 | Ga0070684_100201362 | Ga0070684_1002013623 | 98 |
| 27 | 3300005547 | Ga0070693_100277951 | Ga0070693_1002779511 | 98 |
| 28 | 3300005549 | Ga0070704_100700987 | Ga0070704_1007009871 | 98 |
| 29 | 3300005564 | Ga0070664_100486334 | Ga0070664_1004863342 | 98 |
| 30 | 3300005614 | Ga0068856_100027109 | Ga0068856_1000271094 | 98 |
| 31 | 3300005614 | Ga0068856_101153891 | Ga0068856_1011538911 | 98 |
| 32 | 3300005615 | Ga0070702_100197513 | Ga0070702_1001975131 | 98 |
| 33 | 3300005617 | Ga0068859_101892550 | Ga0068859_1018925502 | 98 |
| 34 | 3300005618 | Ga0068864_101400398 | Ga0068864_1014003982 | 98 |
| 35 | 3300005834 | Ga0068851_10588691 | Ga0068851_105886912 | 98 |
| 36 | 3300005840 | Ga0068870_10146188 | Ga0068870_101461882 | 98 |
| 37 | 3300005841 | Ga0068863_100871309 | Ga0068863_1008713092 | 98 |
| 38 | 3300006237 | Ga0097621_101272763 | Ga0097621_1012727632 | 98 |
| 39 | 3300006871 | Ga0075434_100008073 | Ga0075434_1000080736 | 98 |
| 40 | 3300006914 | Ga0075436_100000414 | Ga0075436_10000041434 | 98 |
| 41 | 3300006914 | Ga0075436_100506705 | Ga0075436_1005067052 | 98 |
| 42 | 3300006931 | Ga0097620_101892718 | Ga0097620_1018927182 | 98 |
| 43 | 3300007076 | Ga0075435_100024379 | Ga0075435_1000243795 | 98 |
| 44 | 3300009098 | Ga0105245_10125540 | Ga0105245_101255403 | 98 |
| 45 | 3300009098 | Ga0105245_10601252 | Ga0105245_106012522 | 98 |
| 46 | 3300009098 | Ga0105245_11146643 | Ga0105245_111466432 | 98 |
| 47 | 3300009101 | Ga0105247_10565844 | Ga0105247_105658442 | 98 |
| 48 | 3300009176 | Ga0105242_12792636 | Ga0105242_127926362 | 98 |
| 49 | 3300009545 | Ga0105237_10359809 | Ga0105237_103598092 | 98 |
| 50 | 3300009551 | Ga0105238_10149087 | Ga0105238_101490873 | 98 |
| 51 | 3300009551 | Ga0105238_11264766 | Ga0105238_112647662 | 98 |
| 52 | 3300010375 | Ga0105239_10338305 | Ga0105239_103383052 | 98 |
| 53 | 3300010375 | Ga0105239_11257004 | Ga0105239_112570042 | 98 |
| 54 | 3300011119 | Ga0105246_10498170 | Ga0105246_104981701 | 98 |
| 55 | 3300011119 | Ga0105246_10638103 | Ga0105246_106381031 | 98 |
| 56 | 3300013105 | Ga0157369_10267936 | Ga0157369_102679363 | 98 |
| 57 | 3300013296 | Ga0157374_10111411 | Ga0157374_101114114 | 98 |
| 58 | 3300013296 | Ga0157374_11447452 | Ga0157374_114474521 | 98 |
| 59 | 3300013307 | Ga0157372_10633548 | Ga0157372_106335482 | 98 |
| 60 | 3300013307 | Ga0157372_11173770 | Ga0157372_111737702 | 98 |
| 61 | 3300014745 | Ga0157377_10183641 | Ga0157377_101836413 | 98 |
| 62 | 3300014968 | Ga0157379_11880679 | Ga0157379_118806791 | 98 |
| 63 | 3300020069 | Ga0197907_10461500 | Ga0197907_104615002 | 98 |
| 64 | 3300020070 | Ga0206356_11789295 | Ga0206356_117892953 | 98 |
| 65 | 3300020082 | Ga0206353_10914373 | Ga0206353_109143732 | 98 |
| 66 | 3300022467 | Ga0224712_10071764 | Ga0224712_100717642 | 98 |
| 67 | 3300025908 | Ga0207643_10307168 | Ga0207643_103071681 | 98 |
| 68 | 3300025911 | Ga0207654_10434537 | Ga0207654_104345371 | 98 |
| 69 | 3300025911 | Ga0207654_11291441 | Ga0207654_112914412 | 98 |
| 70 | 3300025912 | Ga0207707_10086041 | Ga0207707_100860413 | 98 |
| 71 | 3300025915 | Ga0207693_10757545 | Ga0207693_107575452 | 98 |
| 72 | 3300025915 | Ga0207693_10921310 | Ga0207693_109213102 | 98 |
| 73 | 3300025916 | Ga0207663_10217378 | Ga0207663_102173782 | 98 |
| 74 | 3300025916 | Ga0207663_11074144 | Ga0207663_110741442 | 98 |
| 75 | 3300025924 | Ga0207694_10083135 | Ga0207694_100831353 | 98 |
| 76 | 3300025927 | Ga0207687_10039659 | Ga0207687_100396593 | 98 |
| 77 | 3300025927 | Ga0207687_10354716 | Ga0207687_103547162 | 98 |
| 78 | 3300025927 | Ga0207687_10730028 | Ga0207687_107300282 | 98 |
| 79 | 3300025929 | Ga0207664_11222614 | Ga0207664_112226141 | 98 |
| 80 | 3300025931 | Ga0207644_10511805 | Ga0207644_105118052 | 98 |
| 81 | 3300025932 | Ga0207690_10352695 | Ga0207690_103526952 | 98 |
| 82 | 3300025934 | Ga0207686_10681625 | Ga0207686_106816252 | 98 |
| 83 | 3300025938 | Ga0207704_10947747 | Ga0207704_109477472 | 98 |
| 84 | 3300025944 | Ga0207661_10082972 | Ga0207661_100829723 | 98 |
| 85 | 3300025944 | Ga0207661_11885971 | Ga0207661_118859711 | 98 |
| 86 | 3300026023 | Ga0207677_11084247 | Ga0207677_110842471 | 98 |
| 87 | 3300026041 | Ga0207639_10539343 | Ga0207639_105393432 | 98 |
| 88 | 3300026067 | Ga0207678_10102549 | Ga0207678_101025492 | 98 |
| 89 | 3300026067 | Ga0207678_11501939 | Ga0207678_115019392 | 98 |
| 90 | 3300026078 | Ga0207702_10165361 | Ga0207702_101653612 | 98 |
| 91 | 3300026078 | Ga0207702_10279925 | Ga0207702_102799251 | 98 |
| 92 | 3300026078 | Ga0207702_11085560 | Ga0207702_110855601 | 98 |
| 93 | 3300026095 | Ga0207676_11576823 | Ga0207676_115768232 | 98 |
| 94 | 3300026116 | Ga0207674_10034379 | Ga0207674_100343793 | 98 |
| 95 | 3300026121 | Ga0207683_10252452 | Ga0207683_102524523 | 98 |
| 96 | 3300026121 | Ga0207683_11617933 | Ga0207683_116179332 | 98 |
| 97 | 3300028800 | Ga0265338_10029352 | Ga0265338_100293522 | 98 |
| 98 | 3300031250 | Ga0265331_10108254 | Ga0265331_101082542 | 98 |
| 99 | 3300031251 | Ga0265327_10006564 | Ga0265327_100065646 | 98 |
| 100 | 3300035170 | Ga0373943_0270295 | Ga0373943_0270295_27_326 | 98 |
| 101 | 3300035725 | Ga0373947_0496951 | Ga0373947_0496951_374_673 | 98 |
| 102 | 3300037068 | Ga0373925_1291588 | Ga0373925_1291588_17_316 | 98 |
| 103 | 3300044694 | Ga0466963_0002419 | Ga0466963_0002419_3940_4239 | 98 |
| 104 | 3300044719 | Ga0466971_0051058 | Ga0466971_0051058_711_1010 | 98 |
| 105 | 3300044735 | Ga0466968_0110361 | Ga0466968_0110361_590_889 | 98 |
| 106 | 3300044842 | Ga0466957_0090534 | Ga0466957_0090534_1309_1608 | 98 |
| 107 | 3300044901 | Ga0466960_0005505 | Ga0466960_0005505_453_752 | 98 |
| 108 | 3300044901 | Ga0466960_0119577 | Ga0466960_0119577_386_685 | 98 |
| 109 | 3300045836 | Ga0466958_0034967 | Ga0466958_0034967_1141_1440 | 98 |
| 110 | 3300045976 | Ga0466967_0016513 | Ga0466967_0016513_3493_3792 | 98 |
| 111 | 3300045976 | Ga0466967_0153511 | Ga0466967_0153511_890_1189 | 98 |
| 112 | 3300045976 | Ga0466967_0233298 | Ga0466967_0233298_1226_1525 | 98 |
| 113 | 3300045976 | Ga0466967_0629454 | Ga0466967_0629454_465_764 | 98 |
| 114 | 3300045976 | Ga0466967_2327300 | Ga0466967_2327300_54_356 | 98 |
| 115 | 3300046459 | Ga0495629_0246577 | Ga0495629_0246577_16_315 | 98 |
| 116 | 3300046461 | Ga0495641_0032675 | Ga0495641_0032675_925_1224 | 98 |
| 117 | 3300046473 | Ga0495582_0528744 | Ga0495582_0528744_213_512 | 98 |
| 118 | 3300046526 | Ga0495666_0312377 | Ga0495666_0312377_369_668 | 98 |
| 119 | 3300046674 | Ga0495588_0558312 | Ga0495588_0558312_231_530 | 98 |
| 120 | 3300046681 | Ga0495647_0348646 | Ga0495647_0348646_243_542 | 98 |
| 121 | 3300046683 | Ga0495658_0038832 | Ga0495658_0038832_500_799 | 98 |
| 122 | 3300046689 | Ga0495613_0065038 | Ga0495613_0065038_2223_2522 | 98 |
| 123 | 3300048903 | Ga0496100_0001432 | Ga0496100_0001432_197_496 | 98 |
| 124 | 3300048903 | Ga0496100_0007313 | Ga0496100_0007313_772_1071 | 98 |
| 125 | 3300048903 | Ga0496100_1510666 | Ga0496100_1510666_69_365 | 98 |
| 126 | 3300048904 | Ga0496101_0004152 | Ga0496101_0004152_7908_8207 | 98 |
| 127 | 3300048904 | Ga0496101_0007006 | Ga0496101_0007006_5672_5971 | 98 |
| 128 | 3300048905 | Ga0496102_0011745 | Ga0496102_0011745_4873_5172 | 98 |
| 129 | 3300048905 | Ga0496102_0349843 | Ga0496102_0349843_50_349 | 98 |
| 130 | 3300048905 | Ga0496102_0485168 | Ga0496102_0485168_806_1105 | 98 |
| 131 | 3300048906 | Ga0496103_0190315 | Ga0496103_0190315_109_408 | 98 |
| 132 | 3300048906 | Ga0496103_0351687 | Ga0496103_0351687_386_685 | 98 |
| 133 | 3300048907 | Ga0496104_0020221 | Ga0496104_0020221_3837_4136 | 98 |
| 134 | 3300048907 | Ga0496104_0169409 | Ga0496104_0169409_194_493 | 98 |
| 135 | 3300048907 | Ga0496104_0184515 | Ga0496104_0184515_1500_1799 | 98 |
| 136 | 3300048908 | Ga0496105_0020574 | Ga0496105_0020574_4981_5280 | 98 |
| 137 | 3300048909 | Ga0496106_0000586 | Ga0496106_0000586_13541_13840 | 98 |
| 138 | 3300048909 | Ga0496106_0018426 | Ga0496106_0018426_834_1133 | 98 |
| 139 | 3300048910 | Ga0496107_0000178 | Ga0496107_0000178_19891_20190 | 98 |
| 140 | 3300048910 | Ga0496107_0015869 | Ga0496107_0015869_3868_4167 | 98 |
| 141 | 3300048911 | Ga0496108_0050199 | Ga0496108_0050199_84_383 | 98 |
| 142 | 3300048911 | Ga0496108_0728972 | Ga0496108_0728972_365_664 | 98 |
| 143 | 3300048911 | Ga0496108_1041126 | Ga0496108_1041126_64_363 | 98 |
| 144 | 3300048912 | Ga0496109_0023831 | Ga0496109_0023831_3147_3446 | 98 |
| 145 | 3300048912 | Ga0496109_0071716 | Ga0496109_0071716_1088_1387 | 98 |
| 146 | 3300048912 | Ga0496109_1545898 | Ga0496109_1545898_183_482 | 98 |
| 147 | 3300048914 | Ga0496111_0765421 | Ga0496111_0765421_340_639 | 98 |
| 148 | 3300048915 | Ga0496112_0052767 | Ga0496112_0052767_1220_1519 | 98 |
| 149 | 3300048916 | Ga0496113_0386151 | Ga0496113_0386151_668_967 | 98 |
| 150 | 3300048917 | Ga0496114_0003344 | Ga0496114_0003344_5590_5889 | 98 |
| 151 | 3300048917 | Ga0496114_0041600 | Ga0496114_0041600_3356_3655 | 98 |
| 152 | 3300048918 | Ga0496115_0004846 | Ga0496115_0004846_8933_9232 | 98 |
| 153 | 3300049583 | Ga0501067_0020974 | Ga0501067_0020974_911_1210 | 98 |
| 154 | 3300049585 | Ga0501069_0004421 | Ga0501069_0004421_3461_3760 | 98 |
| 155 | 3300049585 | Ga0501069_0977859 | Ga0501069_0977859_18_317 | 98 |
| 156 | 3300049586 | Ga0501070_0944779 | Ga0501070_0944779_200_499 | 98 |
| 157 | 3300049587 | Ga0501071_1177198 | Ga0501071_1177198_34_333 | 98 |
| 158 | 3300050512 | nmdc:mga0n895_1670_c1 | nmdc:mga0n895_1670_c1_9385_9684 | 98 |
| 159 | 3300050513 | nmdc:mga0rr50_20750_c1 | nmdc:mga0rr50_20750_c1_3165_3464 | 98 |
| 160 | 3300050514 | nmdc:mga08x19_534_c1 | nmdc:mga08x19_534_c1_18262_18561 | 98 |
| 161 | 3300050515 | nmdc:mga0a205_445021_c1 | nmdc:mga0a205_445021_c1_625_924 | 98 |
| 162 | 3300053083 | Ga0495655_0141731 | Ga0495655_0141731_238_534 | 98 |
| 163 | 3300061719 | Ga0466962_0132251 | Ga0466962_0132251_607_906 | 98 |
| 164 | 3300061734 | Ga0530510_0078335 | Ga0530510_0078335_1904_2203 | 98 |
| 165 | 3300003323 | rootH1_10182417 | rootH1_101824174 | 99 |
| 166 | 3300005327 | Ga0070658_10054511 | Ga0070658_100545115 | 99 |
| 167 | 3300005327 | Ga0070658_10182619 | Ga0070658_101826192 | 99 |
| 168 | 3300005329 | Ga0070683_100037771 | Ga0070683_1000377713 | 99 |
| 169 | 3300005329 | Ga0070683_100058070 | Ga0070683_1000580704 | 99 |
| 170 | 3300005329 | Ga0070683_100158239 | Ga0070683_1001582392 | 99 |
| 171 | 3300005329 | Ga0070683_100176387 | Ga0070683_1001763872 | 99 |
| 172 | 3300005336 | Ga0070680_100100044 | Ga0070680_1001000443 | 99 |
| 173 | 3300005337 | Ga0070682_100031764 | Ga0070682_1000317642 | 99 |
| 174 | 3300005337 | Ga0070682_100057409 | Ga0070682_1000574093 | 99 |
| 175 | 3300005339 | Ga0070660_100004655 | Ga0070660_1000046551 | 99 |
| 176 | 3300005339 | Ga0070660_100011588 | Ga0070660_1000115884 | 99 |
| 177 | 3300005339 | Ga0070660_100054116 | Ga0070660_1000541165 | 99 |
| 178 | 3300005339 | Ga0070660_100268286 | Ga0070660_1002682863 | 99 |
| 179 | 3300005344 | Ga0070661_100148351 | Ga0070661_1001483512 | 99 |
| 180 | 3300005344 | Ga0070661_100179146 | Ga0070661_1001791461 | 99 |
| 181 | 3300005344 | Ga0070661_100988022 | Ga0070661_1009880222 | 99 |
| 182 | 3300005355 | Ga0070671_100008449 | Ga0070671_1000084494 | 99 |
| 183 | 3300005366 | Ga0070659_100352978 | Ga0070659_1003529782 | 99 |
| 184 | 3300005366 | Ga0070659_100663549 | Ga0070659_1006635492 | 99 |
| 185 | 3300005366 | Ga0070659_101746678 | Ga0070659_1017466781 | 99 |
| 186 | 3300005434 | Ga0070709_10015673 | Ga0070709_100156734 | 99 |
| 187 | 3300005434 | Ga0070709_10044135 | Ga0070709_100441354 | 99 |
| 188 | 3300005434 | Ga0070709_10227194 | Ga0070709_102271942 | 99 |
| 189 | 3300005435 | Ga0070714_100038691 | Ga0070714_1000386916 | 99 |
| 190 | 3300005435 | Ga0070714_100042803 | Ga0070714_1000428032 | 99 |
| 191 | 3300005435 | Ga0070714_100058761 | Ga0070714_1000587611 | 99 |
| 192 | 3300005435 | Ga0070714_100104028 | Ga0070714_1001040282 | 99 |
| 193 | 3300005435 | Ga0070714_100363670 | Ga0070714_1003636702 | 99 |
| 194 | 3300005435 | Ga0070714_100380543 | Ga0070714_1003805433 | 99 |
| 195 | 3300005435 | Ga0070714_100445438 | Ga0070714_1004454383 | 99 |
| 196 | 3300005435 | Ga0070714_100514422 | Ga0070714_1005144222 | 99 |
| 197 | 3300005435 | Ga0070714_100655966 | Ga0070714_1006559662 | 99 |
| 198 | 3300005435 | Ga0070714_102504515 | Ga0070714_1025045151 | 99 |
| 199 | 3300005436 | Ga0070713_100001203 | Ga0070713_10000120310 | 99 |
| 200 | 3300005436 | Ga0070713_100002241 | Ga0070713_1000022414 | 99 |
| 201 | 3300005436 | Ga0070713_100108459 | Ga0070713_1001084593 | 99 |
| 202 | 3300005436 | Ga0070713_100333447 | Ga0070713_1003334472 | 99 |
| 203 | 3300005436 | Ga0070713_100820882 | Ga0070713_1008208823 | 99 |
| 204 | 3300005436 | Ga0070713_101034041 | Ga0070713_1010340413 | 99 |
| 205 | 3300005437 | Ga0070710_10029016 | Ga0070710_100290162 | 99 |
| 206 | 3300005438 | Ga0070701_10286859 | Ga0070701_102868593 | 99 |
| 207 | 3300005439 | Ga0070711_100626229 | Ga0070711_1006262292 | 99 |
| 208 | 3300005439 | Ga0070711_101280849 | Ga0070711_1012808491 | 99 |
| 209 | 3300005440 | Ga0070705_100182751 | Ga0070705_1001827513 | 99 |
| 210 | 3300005440 | Ga0070705_101597235 | Ga0070705_1015972351 | 99 |
| 211 | 3300005445 | Ga0070708_100413026 | Ga0070708_1004130262 | 99 |
| 212 | 3300005456 | Ga0070678_100113271 | Ga0070678_1001132714 | 99 |
| 213 | 3300005458 | Ga0070681_10076535 | Ga0070681_100765354 | 99 |
| 214 | 3300005458 | Ga0070681_10170989 | Ga0070681_101709894 | 99 |
| 215 | 3300005458 | Ga0070681_10215813 | Ga0070681_102158132 | 99 |
| 216 | 3300005458 | Ga0070681_10295237 | Ga0070681_102952373 | 99 |
| 217 | 3300005458 | Ga0070681_10464904 | Ga0070681_104649042 | 99 |
| 218 | 3300005467 | Ga0070706_100575867 | Ga0070706_1005758671 | 99 |
| 219 | 3300005467 | Ga0070706_101437744 | Ga0070706_1014377441 | 99 |
| 220 | 3300005468 | Ga0070707_100030113 | Ga0070707_1000301136 | 99 |
| 221 | 3300005468 | Ga0070707_100207249 | Ga0070707_1002072491 | 99 |
| 222 | 3300005468 | Ga0070707_100270671 | Ga0070707_1002706713 | 99 |
| 223 | 3300005468 | Ga0070707_100279985 | Ga0070707_1002799853 | 99 |
| 224 | 3300005471 | Ga0070698_100093650 | Ga0070698_1000936505 | 99 |
| 225 | 3300005471 | Ga0070698_100099098 | Ga0070698_1000990982 | 99 |
| 226 | 3300005471 | Ga0070698_100186057 | Ga0070698_1001860573 | 99 |
| 227 | 3300005518 | Ga0070699_100120520 | Ga0070699_1001205202 | 99 |
| 228 | 3300005518 | Ga0070699_100490186 | Ga0070699_1004901863 | 99 |
| 229 | 3300005530 | Ga0070679_100077669 | Ga0070679_1000776692 | 99 |
| 230 | 3300005530 | Ga0070679_100165280 | Ga0070679_1001652803 | 99 |
| 231 | 3300005530 | Ga0070679_100363496 | Ga0070679_1003634962 | 99 |
| 232 | 3300005530 | Ga0070679_100647073 | Ga0070679_1006470732 | 99 |
| 233 | 3300005535 | Ga0070684_100228248 | Ga0070684_1002282484 | 99 |
| 234 | 3300005535 | Ga0070684_100282112 | Ga0070684_1002821123 | 99 |
| 235 | 3300005535 | Ga0070684_100563308 | Ga0070684_1005633082 | 99 |
| 236 | 3300005535 | Ga0070684_100884080 | Ga0070684_1008840802 | 99 |
| 237 | 3300005536 | Ga0070697_100648554 | Ga0070697_1006485542 | 99 |
| 238 | 3300005536 | Ga0070697_101751406 | Ga0070697_1017514061 | 99 |
| 239 | 3300005545 | Ga0070695_100002173 | Ga0070695_10000217313 | 99 |
| 240 | 3300005545 | Ga0070695_100367759 | Ga0070695_1003677592 | 99 |
| 241 | 3300005546 | Ga0070696_100276356 | Ga0070696_1002763563 | 99 |
| 242 | 3300005547 | Ga0070693_100255798 | Ga0070693_1002557982 | 99 |
| 243 | 3300005549 | Ga0070704_100023732 | Ga0070704_1000237324 | 99 |
| 244 | 3300005549 | Ga0070704_100843591 | Ga0070704_1008435912 | 99 |
| 245 | 3300005549 | Ga0070704_101737097 | Ga0070704_1017370971 | 99 |
| 246 | 3300005563 | Ga0068855_100040522 | Ga0068855_1000405225 | 99 |
| 247 | 3300005563 | Ga0068855_100406343 | Ga0068855_1004063433 | 99 |
| 248 | 3300005577 | Ga0068857_100599808 | Ga0068857_1005998082 | 99 |
| 249 | 3300005577 | Ga0068857_102189640 | Ga0068857_1021896402 | 99 |
| 250 | 3300005578 | Ga0068854_100564760 | Ga0068854_1005647601 | 99 |
| 251 | 3300005614 | Ga0068856_100398044 | Ga0068856_1003980442 | 99 |
| 252 | 3300005614 | Ga0068856_100614668 | Ga0068856_1006146682 | 99 |
| 253 | 3300005616 | Ga0068852_100376413 | Ga0068852_1003764131 | 99 |
| 254 | 3300005616 | Ga0068852_102150848 | Ga0068852_1021508482 | 99 |
| 255 | 3300005841 | Ga0068863_100523911 | Ga0068863_1005239113 | 99 |
| 256 | 3300005937 | Ga0081455_10012981 | Ga0081455_100129814 | 99 |
| 257 | 3300005981 | Ga0081538_10016286 | Ga0081538_100162867 | 99 |
| 258 | 3300005985 | Ga0081539_10002873 | Ga0081539_1000287310 | 99 |
| 259 | 3300005985 | Ga0081539_10192609 | Ga0081539_101926092 | 99 |
| 260 | 3300006028 | Ga0070717_10012964 | Ga0070717_100129644 | 99 |
| 261 | 3300006028 | Ga0070717_10020908 | Ga0070717_100209083 | 99 |
| 262 | 3300006028 | Ga0070717_10023774 | Ga0070717_100237746 | 99 |
| 263 | 3300006028 | Ga0070717_10105783 | Ga0070717_101057831 | 99 |
| 264 | 3300006028 | Ga0070717_10306021 | Ga0070717_103060212 | 99 |
| 265 | 3300006028 | Ga0070717_11573191 | Ga0070717_115731912 | 99 |
| 266 | 3300006163 | Ga0070715_10014573 | Ga0070715_100145734 | 99 |
| 267 | 3300006173 | Ga0070716_100020680 | Ga0070716_1000206803 | 99 |
| 268 | 3300006173 | Ga0070716_100047188 | Ga0070716_1000471883 | 99 |
| 269 | 3300006175 | Ga0070712_100174603 | Ga0070712_1001746031 | 99 |
| 270 | 3300006175 | Ga0070712_100225115 | Ga0070712_1002251152 | 99 |
| 271 | 3300006175 | Ga0070712_100313291 | Ga0070712_1003132912 | 99 |
| 272 | 3300006175 | Ga0070712_100332211 | Ga0070712_1003322113 | 99 |
| 273 | 3300006358 | Ga0068871_100211151 | Ga0068871_1002111513 | 99 |
| 274 | 3300006358 | Ga0068871_100317163 | Ga0068871_1003171632 | 99 |
| 275 | 3300006844 | Ga0075428_100523095 | Ga0075428_1005230952 | 99 |
| 276 | 3300006871 | Ga0075434_100112032 | Ga0075434_1001120324 | 99 |
| 277 | 3300009093 | Ga0105240_10007770 | Ga0105240_100077704 | 99 |
| 278 | 3300009093 | Ga0105240_10095737 | Ga0105240_100957375 | 99 |
| 279 | 3300009093 | Ga0105240_10299716 | Ga0105240_102997163 | 99 |
| 280 | 3300009093 | Ga0105240_10985015 | Ga0105240_109850153 | 99 |
| 281 | 3300009093 | Ga0105240_11518419 | Ga0105240_115184192 | 99 |
| 282 | 3300009094 | Ga0111539_10025766 | Ga0111539_100257665 | 99 |
| 283 | 3300009094 | Ga0111539_10444558 | Ga0111539_104445583 | 99 |
| 284 | 3300009098 | Ga0105245_10056221 | Ga0105245_100562213 | 99 |
| 285 | 3300009098 | Ga0105245_10586584 | Ga0105245_105865843 | 99 |
| 286 | 3300009101 | Ga0105247_10049827 | Ga0105247_100498274 | 99 |
| 287 | 3300009147 | Ga0114129_10387450 | Ga0114129_103874503 | 99 |
| 288 | 3300009174 | Ga0105241_10232854 | Ga0105241_102328543 | 99 |
| 289 | 3300009174 | Ga0105241_11898426 | Ga0105241_118984262 | 99 |
| 290 | 3300009176 | Ga0105242_11225859 | Ga0105242_112258591 | 99 |
| 291 | 3300009177 | Ga0105248_10066829 | Ga0105248_100668294 | 99 |
| 292 | 3300009177 | Ga0105248_11246020 | Ga0105248_112460202 | 99 |
| 293 | 3300009177 | Ga0105248_12173912 | Ga0105248_121739121 | 99 |
| 294 | 3300009177 | Ga0105248_12731449 | Ga0105248_127314491 | 99 |
| 295 | 3300009545 | Ga0105237_10032857 | Ga0105237_100328574 | 99 |
| 296 | 3300009545 | Ga0105237_11657521 | Ga0105237_116575212 | 99 |
| 297 | 3300009551 | Ga0105238_10041072 | Ga0105238_100410724 | 99 |
| 298 | 3300009551 | Ga0105238_10936829 | Ga0105238_109368291 | 99 |
| 299 | 3300009551 | Ga0105238_11215201 | Ga0105238_112152012 | 99 |
| 300 | 3300012513 | Ga0157326_1085520 | Ga0157326_10855202 | 99 |
| 301 | 3300013100 | Ga0157373_10213475 | Ga0157373_102134754 | 99 |
| 302 | 3300013100 | Ga0157373_10323680 | Ga0157373_103236802 | 99 |
| 303 | 3300013102 | Ga0157371_10233720 | Ga0157371_102337201 | 99 |
| 304 | 3300013102 | Ga0157371_10337998 | Ga0157371_103379982 | 99 |
| 305 | 3300013102 | Ga0157371_10610075 | Ga0157371_106100751 | 99 |
| 306 | 3300013104 | Ga0157370_10012477 | Ga0157370_100124777 | 99 |
| 307 | 3300013104 | Ga0157370_10249700 | Ga0157370_102497002 | 99 |
| 308 | 3300013104 | Ga0157370_10578765 | Ga0157370_105787651 | 99 |
| 309 | 3300013105 | Ga0157369_10044290 | Ga0157369_100442906 | 99 |
| 310 | 3300013105 | Ga0157369_10077272 | Ga0157369_100772725 | 99 |
| 311 | 3300013105 | Ga0157369_10138744 | Ga0157369_101387444 | 99 |
| 312 | 3300013105 | Ga0157369_10707896 | Ga0157369_107078963 | 99 |
| 313 | 3300013105 | Ga0157369_11171718 | Ga0157369_111717181 | 99 |
| 314 | 3300013296 | Ga0157374_10032819 | Ga0157374_100328196 | 99 |
| 315 | 3300013296 | Ga0157374_12277291 | Ga0157374_122772912 | 99 |
| 316 | 3300013306 | Ga0163162_10213266 | Ga0163162_102132664 | 99 |
| 317 | 3300013307 | Ga0157372_10174552 | Ga0157372_101745525 | 99 |
| 318 | 3300013307 | Ga0157372_10250043 | Ga0157372_102500434 | 99 |
| 319 | 3300013307 | Ga0157372_10290131 | Ga0157372_102901313 | 99 |
| 320 | 3300013307 | Ga0157372_10401669 | Ga0157372_104016694 | 99 |
| 321 | 3300013307 | Ga0157372_11282877 | Ga0157372_112828771 | 99 |
| 322 | 3300013307 | Ga0157372_12861775 | Ga0157372_128617752 | 99 |
| 323 | 3300013308 | Ga0157375_11403085 | Ga0157375_114030852 | 99 |
| 324 | 3300014497 | Ga0182008_10002395 | Ga0182008_1000239510 | 99 |
| 325 | 3300014497 | Ga0182008_10067351 | Ga0182008_100673512 | 99 |
| 326 | 3300014497 | Ga0182008_10233466 | Ga0182008_102334661 | 99 |
| 327 | 3300014497 | Ga0182008_10241219 | Ga0182008_102412192 | 99 |
| 328 | 3300014745 | Ga0157377_10398077 | Ga0157377_103980773 | 99 |
| 329 | 3300014968 | Ga0157379_12206874 | Ga0157379_122068742 | 99 |
| 330 | 3300014969 | Ga0157376_10018483 | Ga0157376_100184838 | 99 |
| 331 | 3300014969 | Ga0157376_11443710 | Ga0157376_114437102 | 99 |
| 332 | 3300015261 | Ga0182006_1007014 | Ga0182006_10070143 | 99 |
| 333 | 3300015261 | Ga0182006_1300790 | Ga0182006_13007902 | 99 |
| 334 | 3300015262 | Ga0182007_10012095 | Ga0182007_100120953 | 99 |
| 335 | 3300015262 | Ga0182007_10310654 | Ga0182007_103106541 | 99 |
| 336 | 3300017792 | Ga0163161_10112500 | Ga0163161_101125003 | 99 |
| 337 | 3300020069 | Ga0197907_10283293 | Ga0197907_102832932 | 99 |
| 338 | 3300020070 | Ga0206356_10864395 | Ga0206356_108643952 | 99 |
| 339 | 3300020070 | Ga0206356_10933417 | Ga0206356_109334172 | 99 |
| 340 | 3300020070 | Ga0206356_11619042 | Ga0206356_116190427 | 99 |
| 341 | 3300020081 | Ga0206354_11139136 | Ga0206354_111391363 | 99 |
| 342 | 3300020081 | Ga0206354_11487989 | Ga0206354_114879892 | 99 |
| 343 | 3300020082 | Ga0206353_10752732 | Ga0206353_107527324 | 99 |
| 344 | 3300020082 | Ga0206353_10953357 | Ga0206353_109533577 | 99 |
| 345 | 3300020610 | Ga0154015_1573975 | Ga0154015_15739752 | 99 |
| 346 | 3300021441 | Ga0213871_10093261 | Ga0213871_100932611 | 99 |
| 347 | 3300022467 | Ga0224712_10003063 | Ga0224712_100030636 | 99 |
| 348 | 3300025898 | Ga0207692_10015333 | Ga0207692_100153334 | 99 |
| 349 | 3300025900 | Ga0207710_10471995 | Ga0207710_104719951 | 99 |
| 350 | 3300025905 | Ga0207685_10000585 | Ga0207685_100005852 | 99 |
| 351 | 3300025906 | Ga0207699_10055108 | Ga0207699_100551082 | 99 |
| 352 | 3300025906 | Ga0207699_10441744 | Ga0207699_104417441 | 99 |
| 353 | 3300025906 | Ga0207699_10477751 | Ga0207699_104777512 | 99 |
| 354 | 3300025909 | Ga0207705_10026024 | Ga0207705_100260245 | 99 |
| 355 | 3300025909 | Ga0207705_10037406 | Ga0207705_100374063 | 99 |
| 356 | 3300025909 | Ga0207705_10039859 | Ga0207705_100398593 | 99 |
| 357 | 3300025909 | Ga0207705_10109232 | Ga0207705_101092322 | 99 |
| 358 | 3300025909 | Ga0207705_10206687 | Ga0207705_102066872 | 99 |
| 359 | 3300025910 | Ga0207684_10485875 | Ga0207684_104858752 | 99 |
| 360 | 3300025910 | Ga0207684_10958173 | Ga0207684_109581732 | 99 |
| 361 | 3300025912 | Ga0207707_10046974 | Ga0207707_100469744 | 99 |
| 362 | 3300025912 | Ga0207707_10086836 | Ga0207707_100868364 | 99 |
| 363 | 3300025912 | Ga0207707_10192791 | Ga0207707_101927913 | 99 |
| 364 | 3300025912 | Ga0207707_11047522 | Ga0207707_110475222 | 99 |
| 365 | 3300025912 | Ga0207707_11387733 | Ga0207707_113877331 | 99 |
| 366 | 3300025913 | Ga0207695_10020007 | Ga0207695_100200079 | 99 |
| 367 | 3300025913 | Ga0207695_10229159 | Ga0207695_102291593 | 99 |
| 368 | 3300025915 | Ga0207693_10002991 | Ga0207693_100029917 | 99 |
| 369 | 3300025915 | Ga0207693_10183195 | Ga0207693_101831953 | 99 |
| 370 | 3300025915 | Ga0207693_10458463 | Ga0207693_104584632 | 99 |
| 371 | 3300025915 | Ga0207693_10655023 | Ga0207693_106550232 | 99 |
| 372 | 3300025916 | Ga0207663_10025210 | Ga0207663_100252102 | 99 |
| 373 | 3300025917 | Ga0207660_10011588 | Ga0207660_100115886 | 99 |
| 374 | 3300025917 | Ga0207660_10065159 | Ga0207660_100651591 | 99 |
| 375 | 3300025917 | Ga0207660_10209421 | Ga0207660_102094213 | 99 |
| 376 | 3300025917 | Ga0207660_10315776 | Ga0207660_103157761 | 99 |
| 377 | 3300025917 | Ga0207660_11699179 | Ga0207660_116991791 | 99 |
| 378 | 3300025919 | Ga0207657_10007972 | Ga0207657_1000797212 | 99 |
| 379 | 3300025919 | Ga0207657_10011057 | Ga0207657_100110579 | 99 |
| 380 | 3300025919 | Ga0207657_10017187 | Ga0207657_100171874 | 99 |
| 381 | 3300025919 | Ga0207657_10070513 | Ga0207657_100705133 | 99 |
| 382 | 3300025919 | Ga0207657_10338694 | Ga0207657_103386943 | 99 |
| 383 | 3300025920 | Ga0207649_10029273 | Ga0207649_100292734 | 99 |
| 384 | 3300025920 | Ga0207649_10171989 | Ga0207649_101719892 | 99 |
| 385 | 3300025921 | Ga0207652_10153809 | Ga0207652_101538092 | 99 |
| 386 | 3300025921 | Ga0207652_10191058 | Ga0207652_101910582 | 99 |
| 387 | 3300025921 | Ga0207652_10202188 | Ga0207652_102021881 | 99 |
| 388 | 3300025921 | Ga0207652_10500455 | Ga0207652_105004553 | 99 |
| 389 | 3300025921 | Ga0207652_10590565 | Ga0207652_105905651 | 99 |
| 390 | 3300025921 | Ga0207652_11169981 | Ga0207652_111699813 | 99 |
| 391 | 3300025922 | Ga0207646_10215625 | Ga0207646_102156251 | 99 |
| 392 | 3300025922 | Ga0207646_10225468 | Ga0207646_102254683 | 99 |
| 393 | 3300025922 | Ga0207646_10304218 | Ga0207646_103042182 | 99 |
| 394 | 3300025922 | Ga0207646_10441760 | Ga0207646_104417602 | 99 |
| 395 | 3300025922 | Ga0207646_10553132 | Ga0207646_105531322 | 99 |
| 396 | 3300025922 | Ga0207646_10797825 | Ga0207646_107978252 | 99 |
| 397 | 3300025924 | Ga0207694_11460793 | Ga0207694_114607932 | 99 |
| 398 | 3300025927 | Ga0207687_10428304 | Ga0207687_104283043 | 99 |
| 399 | 3300025928 | Ga0207700_10000002 | Ga0207700_10000002165 | 99 |
| 400 | 3300025928 | Ga0207700_10047743 | Ga0207700_100477435 | 99 |
| 401 | 3300025928 | Ga0207700_10302606 | Ga0207700_103026062 | 99 |
| 402 | 3300025928 | Ga0207700_11206905 | Ga0207700_112069052 | 99 |
| 403 | 3300025928 | Ga0207700_11416250 | Ga0207700_114162502 | 99 |
| 404 | 3300025929 | Ga0207664_10006174 | Ga0207664_100061742 | 99 |
| 405 | 3300025929 | Ga0207664_10032406 | Ga0207664_100324063 | 99 |
| 406 | 3300025929 | Ga0207664_10039220 | Ga0207664_100392205 | 99 |
| 407 | 3300025929 | Ga0207664_10039805 | Ga0207664_100398053 | 99 |
| 408 | 3300025929 | Ga0207664_10048590 | Ga0207664_100485904 | 99 |
| 409 | 3300025929 | Ga0207664_10106287 | Ga0207664_101062872 | 99 |
| 410 | 3300025929 | Ga0207664_10113318 | Ga0207664_101133182 | 99 |
| 411 | 3300025929 | Ga0207664_10127435 | Ga0207664_101274353 | 99 |
| 412 | 3300025929 | Ga0207664_10190821 | Ga0207664_101908211 | 99 |
| 413 | 3300025929 | Ga0207664_10273944 | Ga0207664_102739441 | 99 |
| 414 | 3300025929 | Ga0207664_10293628 | Ga0207664_102936283 | 99 |
| 415 | 3300025929 | Ga0207664_10749569 | Ga0207664_107495692 | 99 |
| 416 | 3300025929 | Ga0207664_11818597 | Ga0207664_118185971 | 99 |
| 417 | 3300025929 | Ga0207664_11975302 | Ga0207664_119753021 | 99 |
| 418 | 3300025931 | Ga0207644_10072648 | Ga0207644_100726483 | 99 |
| 419 | 3300025939 | Ga0207665_10000336 | Ga0207665_1000033619 | 99 |
| 420 | 3300025939 | Ga0207665_10014097 | Ga0207665_100140971 | 99 |
| 421 | 3300025939 | Ga0207665_10697408 | Ga0207665_106974081 | 99 |
| 422 | 3300025941 | Ga0207711_11931514 | Ga0207711_119315141 | 99 |
| 423 | 3300025944 | Ga0207661_10087031 | Ga0207661_100870313 | 99 |
| 424 | 3300025944 | Ga0207661_10091855 | Ga0207661_100918552 | 99 |
| 425 | 3300025944 | Ga0207661_10322409 | Ga0207661_103224093 | 99 |
| 426 | 3300025944 | Ga0207661_10399644 | Ga0207661_103996443 | 99 |
| 427 | 3300025944 | Ga0207661_10571805 | Ga0207661_105718051 | 99 |
| 428 | 3300025944 | Ga0207661_10801812 | Ga0207661_108018121 | 99 |
| 429 | 3300025949 | Ga0207667_10168616 | Ga0207667_101686164 | 99 |
| 430 | 3300025949 | Ga0207667_10442639 | Ga0207667_104426393 | 99 |
| 431 | 3300025949 | Ga0207667_11408199 | Ga0207667_114081991 | 99 |
| 432 | 3300025961 | Ga0207712_10820122 | Ga0207712_108201223 | 99 |
| 433 | 3300025981 | Ga0207640_10638152 | Ga0207640_106381521 | 99 |
| 434 | 3300026041 | Ga0207639_12032513 | Ga0207639_120325132 | 99 |
| 435 | 3300026078 | Ga0207702_10398619 | Ga0207702_103986193 | 99 |
| 436 | 3300026078 | Ga0207702_10448189 | Ga0207702_104481892 | 99 |
| 437 | 3300026078 | Ga0207702_11402579 | Ga0207702_114025792 | 99 |
| 438 | 3300026095 | Ga0207676_10158246 | Ga0207676_101582463 | 99 |
| 439 | 3300026116 | Ga0207674_10526597 | Ga0207674_105265972 | 99 |
| 440 | 3300026116 | Ga0207674_11905607 | Ga0207674_119056072 | 99 |
| 441 | 3300026121 | Ga0207683_10427060 | Ga0207683_104270603 | 99 |
| 442 | 3300026121 | Ga0207683_11857800 | Ga0207683_118578002 | 99 |
| 443 | 3300026142 | Ga0207698_10066518 | Ga0207698_100665181 | 99 |
| 444 | 3300026142 | Ga0207698_10075391 | Ga0207698_100753914 | 99 |
| 445 | 3300027907 | Ga0207428_10029986 | Ga0207428_100299862 | 99 |
| 446 | 3300028556 | Ga0265337_1068031 | Ga0265337_10680312 | 99 |
| 447 | 3300028563 | Ga0265319_1007014 | Ga0265319_10070146 | 99 |
| 448 | 3300028563 | Ga0265319_1045523 | Ga0265319_10455232 | 99 |
| 449 | 3300028563 | Ga0265319_1065316 | Ga0265319_10653162 | 99 |
| 450 | 3300028563 | Ga0265319_1274886 | Ga0265319_12748861 | 99 |
| 451 | 3300028573 | Ga0265334_10002797 | Ga0265334_100027977 | 99 |
| 452 | 3300028573 | Ga0265334_10032929 | Ga0265334_100329294 | 99 |
| 453 | 3300028573 | Ga0265334_10205416 | Ga0265334_102054162 | 99 |
| 454 | 3300028573 | Ga0265334_10261808 | Ga0265334_102618081 | 99 |
| 455 | 3300028577 | Ga0265318_10000604 | Ga0265318_100006047 | 99 |
| 456 | 3300028577 | Ga0265318_10000968 | Ga0265318_100009689 | 99 |
| 457 | 3300028577 | Ga0265318_10065658 | Ga0265318_100656584 | 99 |
| 458 | 3300028577 | Ga0265318_10129217 | Ga0265318_101292172 | 99 |
| 459 | 3300028653 | Ga0265323_10036409 | Ga0265323_100364094 | 99 |
| 460 | 3300028654 | Ga0265322_10009234 | Ga0265322_100092342 | 99 |
| 461 | 3300028654 | Ga0265322_10128455 | Ga0265322_101284552 | 99 |
| 462 | 3300028654 | Ga0265322_10158670 | Ga0265322_101586702 | 99 |
| 463 | 3300028654 | Ga0265322_10213306 | Ga0265322_102133061 | 99 |
| 464 | 3300028666 | Ga0265336_10018326 | Ga0265336_100183263 | 99 |
| 465 | 3300028666 | Ga0265336_10076088 | Ga0265336_100760882 | 99 |
| 466 | 3300028666 | Ga0265336_10115943 | Ga0265336_101159432 | 99 |
| 467 | 3300028666 | Ga0265336_10174194 | Ga0265336_101741941 | 99 |
| 468 | 3300028666 | Ga0265336_10205984 | Ga0265336_102059841 | 99 |
| 469 | 3300028800 | Ga0265338_10003462 | Ga0265338_100034627 | 99 |
| 470 | 3300028800 | Ga0265338_10005686 | Ga0265338_1000568616 | 99 |
| 471 | 3300028800 | Ga0265338_10006184 | Ga0265338_1000618414 | 99 |
| 472 | 3300028800 | Ga0265338_10007091 | Ga0265338_100070914 | 99 |
| 473 | 3300028800 | Ga0265338_10010810 | Ga0265338_100108108 | 99 |
| 474 | 3300028800 | Ga0265338_10014548 | Ga0265338_100145485 | 99 |
| 475 | 3300028800 | Ga0265338_10219615 | Ga0265338_102196151 | 99 |
| 476 | 3300028800 | Ga0265338_10595353 | Ga0265338_105953531 | 99 |
| 477 | 3300029957 | Ga0265324_10080610 | Ga0265324_100806102 | 99 |
| 478 | 3300029957 | Ga0265324_10128708 | Ga0265324_101287081 | 99 |
| 479 | 3300031235 | Ga0265330_10004102 | Ga0265330_100041024 | 99 |
| 480 | 3300031235 | Ga0265330_10516806 | Ga0265330_105168061 | 99 |
| 481 | 3300031238 | Ga0265332_10003579 | Ga0265332_100035794 | 99 |
| 482 | 3300031238 | Ga0265332_10389918 | Ga0265332_103899181 | 99 |
| 483 | 3300031239 | Ga0265328_10003809 | Ga0265328_100038094 | 99 |
| 484 | 3300031240 | Ga0265320_10003921 | Ga0265320_100039219 | 99 |
| 485 | 3300031240 | Ga0265320_10004476 | Ga0265320_100044766 | 99 |
| 486 | 3300031240 | Ga0265320_10051042 | Ga0265320_100510423 | 99 |
| 487 | 3300031241 | Ga0265325_10006354 | Ga0265325_100063546 | 99 |
| 488 | 3300031241 | Ga0265325_10076428 | Ga0265325_100764282 | 99 |
| 489 | 3300031241 | Ga0265325_10110880 | Ga0265325_101108803 | 99 |
| 490 | 3300031242 | Ga0265329_10003633 | Ga0265329_100036336 | 99 |
| 491 | 3300031242 | Ga0265329_10034868 | Ga0265329_100348682 | 99 |
| 492 | 3300031247 | Ga0265340_10005417 | Ga0265340_100054176 | 99 |
| 493 | 3300031249 | Ga0265339_10016814 | Ga0265339_100168145 | 99 |
| 494 | 3300031249 | Ga0265339_10061903 | Ga0265339_100619033 | 99 |
| 495 | 3300031249 | Ga0265339_10413030 | Ga0265339_104130302 | 99 |
| 496 | 3300031250 | Ga0265331_10007022 | Ga0265331_100070227 | 99 |
| 497 | 3300031250 | Ga0265331_10018747 | Ga0265331_100187472 | 99 |
| 498 | 3300031250 | Ga0265331_10129465 | Ga0265331_101294652 | 99 |
| 499 | 3300031250 | Ga0265331_10327769 | Ga0265331_103277691 | 99 |
| 500 | 3300031251 | Ga0265327_10013358 | Ga0265327_100133585 | 99 |
| 501 | 3300031251 | Ga0265327_10024976 | Ga0265327_100249764 | 99 |
| 502 | 3300031251 | Ga0265327_10412796 | Ga0265327_104127962 | 99 |
| 503 | 3300031344 | Ga0265316_10002341 | Ga0265316_1000234119 | 99 |
| 504 | 3300031344 | Ga0265316_10107154 | Ga0265316_101071543 | 99 |
| 505 | 3300031344 | Ga0265316_10329194 | Ga0265316_103291943 | 99 |
| 506 | 3300031344 | Ga0265316_10971713 | Ga0265316_109717131 | 99 |
| 507 | 3300031595 | Ga0265313_10007877 | Ga0265313_100078776 | 99 |
| 508 | 3300031595 | Ga0265313_10012894 | Ga0265313_100128944 | 99 |
| 509 | 3300031595 | Ga0265313_10013344 | Ga0265313_100133444 | 99 |
| 510 | 3300031595 | Ga0265313_10029304 | Ga0265313_100293043 | 99 |
| 511 | 3300031711 | Ga0265314_10007984 | Ga0265314_100079843 | 99 |
| 512 | 3300031711 | Ga0265314_10025861 | Ga0265314_100258614 | 99 |
| 513 | 3300031711 | Ga0265314_10089993 | Ga0265314_100899932 | 99 |
| 514 | 3300031711 | Ga0265314_10101987 | Ga0265314_101019872 | 99 |
| 515 | 3300031712 | Ga0265342_10005023 | Ga0265342_100050237 | 99 |
| 516 | 3300031712 | Ga0265342_10049105 | Ga0265342_100491052 | 99 |
| 517 | 3300031712 | Ga0265342_10076530 | Ga0265342_100765304 | 99 |
| 518 | 3300034818 | Ga0373950_0076174 | Ga0373950_0076174_303_602 | 99 |
| 519 | 3300035083 | Ga0373926_0378313 | Ga0373926_0378313_195_494 | 99 |
| 520 | 3300035114 | Ga0373939_0009501 | Ga0373939_0009501_1076_1375 | 99 |
| 521 | 3300035116 | Ga0373945_0104171 | Ga0373945_0104171_687_986 | 99 |
| 522 | 3300035117 | Ga0373953_0125925 | Ga0373953_0125925_39_338 | 99 |
| 523 | 3300035119 | Ga0373956_0071452 | Ga0373956_0071452_391_690 | 99 |
| 524 | 3300035120 | Ga0373957_0092945 | Ga0373957_0092945_756_1055 | 99 |
| 525 | 3300035120 | Ga0373957_0319511 | Ga0373957_0319511_94_393 | 99 |
| 526 | 3300035120 | Ga0373957_0514371 | Ga0373957_0514371_184_483 | 99 |
| 527 | 3300035121 | Ga0373960_0022012 | Ga0373960_0022012_137_436 | 99 |
| 528 | 3300035121 | Ga0373960_0040923 | Ga0373960_0040923_39_338 | 99 |
| 529 | 3300035121 | Ga0373960_0196255 | Ga0373960_0196255_319_618 | 99 |
| 530 | 3300035170 | Ga0373943_0000829 | Ga0373943_0000829_658_957 | 99 |
| 531 | 3300035170 | Ga0373943_0293523 | Ga0373943_0293523_259_558 | 99 |
| 532 | 3300035172 | Ga0373955_0019481 | Ga0373955_0019481_1281_1580 | 99 |
| 533 | 3300035172 | Ga0373955_0221916 | Ga0373955_0221916_11_310 | 99 |
| 534 | 3300035172 | Ga0373955_0901872 | Ga0373955_0901872_197_499 | 99 |
| 535 | 3300035207 | Ga0373942_0071180 | Ga0373942_0071180_70_369 | 99 |
| 536 | 3300035410 | Ga0373924_0435236 | Ga0373924_0435236_266_565 | 99 |
| 537 | 3300035691 | Ga0373931_0457403 | Ga0373931_0457403_444_743 | 99 |
| 538 | 3300035691 | Ga0373931_0458111 | Ga0373931_0458111_12_311 | 99 |
| 539 | 3300035692 | Ga0373935_0221248 | Ga0373935_0221248_658_957 | 99 |
| 540 | 3300035695 | Ga0373927_0381012 | Ga0373927_0381012_428_727 | 99 |
| 541 | 3300035724 | Ga0373933_0036055 | Ga0373933_0036055_234_533 | 99 |
| 542 | 3300035724 | Ga0373933_0646094 | Ga0373933_0646094_65_364 | 99 |
| 543 | 3300035724 | Ga0373933_1062572 | Ga0373933_1062572_61_363 | 99 |
| 544 | 3300035725 | Ga0373947_0000984 | Ga0373947_0000984_1977_2276 | 99 |
| 545 | 3300035725 | Ga0373947_0407910 | Ga0373947_0407910_323_622 | 99 |
| 546 | 3300035725 | Ga0373947_1226988 | Ga0373947_1226988_56_355 | 99 |
| 547 | 3300036401 | Ga0373937_0004827 | Ga0373937_0004827_7116_7415 | 99 |
| 548 | 3300036401 | Ga0373937_0015379 | Ga0373937_0015379_5744_6043 | 99 |
| 549 | 3300036401 | Ga0373937_0132585 | Ga0373937_0132585_387_686 | 99 |
| 550 | 3300036401 | Ga0373937_1418610 | Ga0373937_1418610_317_616 | 99 |
| 551 | 3300037068 | Ga0373925_0010018 | Ga0373925_0010018_2690_2989 | 99 |
| 552 | 3300037312 | Ga0395899_0016363 | Ga0395899_0016363_3702_4001 | 99 |
| 553 | 3300037312 | Ga0395899_0047945 | Ga0395899_0047945_451_750 | 99 |
| 554 | 3300037312 | Ga0395899_0161295 | Ga0395899_0161295_1168_1467 | 99 |
| 555 | 3300037418 | Ga0395900_0095627 | Ga0395900_0095627_1985_2284 | 99 |
| 556 | 3300037418 | Ga0395900_0147160 | Ga0395900_0147160_1974_2273 | 99 |
| 557 | 3300037418 | Ga0395900_0300820 | Ga0395900_0300820_444_749 | 99 |
| 558 | 3300037418 | Ga0395900_0441507 | Ga0395900_0441507_720_1019 | 99 |
| 559 | 3300037418 | Ga0395900_0948931 | Ga0395900_0948931_111_410 | 99 |
| 560 | 3300037418 | Ga0395900_1259629 | Ga0395900_1259629_237_536 | 99 |
| 561 | 3300037466 | Ga0395898_0029255 | Ga0395898_0029255_1562_1861 | 99 |
| 562 | 3300037466 | Ga0395898_0089588 | Ga0395898_0089588_1765_2064 | 99 |
| 563 | 3300037466 | Ga0395898_0105649 | Ga0395898_0105649_828_1133 | 99 |
| 564 | 3300037466 | Ga0395898_0136846 | Ga0395898_0136846_1249_1548 | 99 |
| 565 | 3300037466 | Ga0395898_0303429 | Ga0395898_0303429_251_550 | 99 |
| 566 | 3300037466 | Ga0395898_0365992 | Ga0395898_0365992_399_698 | 99 |
| 567 | 3300037466 | Ga0395898_0726818 | Ga0395898_0726818_15_314 | 99 |
| 568 | 3300037466 | Ga0395898_0821786 | Ga0395898_0821786_261_560 | 99 |
| 569 | 3300037466 | Ga0395898_1596162 | Ga0395898_1596162_30_329 | 99 |
| 570 | 3300037466 | Ga0395898_1700882 | Ga0395898_1700882_67_366 | 99 |
| 571 | 3300037466 | Ga0395898_1729812 | Ga0395898_1729812_154_453 | 99 |
| 572 | 3300037471 | Ga0395905_0012643 | Ga0395905_0012643_2498_2797 | 99 |
| 573 | 3300037471 | Ga0395905_0020541 | Ga0395905_0020541_4793_5092 | 99 |
| 574 | 3300037471 | Ga0395905_0172811 | Ga0395905_0172811_869_1174 | 99 |
| 575 | 3300037471 | Ga0395905_1066785 | Ga0395905_1066785_21_320 | 99 |
| 576 | 3300038443 | Ga0395901_0085688 | Ga0395901_0085688_1765_2064 | 99 |
| 577 | 3300038443 | Ga0395901_0104451 | Ga0395901_0104451_944_1243 | 99 |
| 578 | 3300038443 | Ga0395901_0206329 | Ga0395901_0206329_1517_1822 | 99 |
| 579 | 3300038443 | Ga0395901_0210507 | Ga0395901_0210507_1132_1431 | 99 |
| 580 | 3300038443 | Ga0395901_0311953 | Ga0395901_0311953_123_422 | 99 |
| 581 | 3300038443 | Ga0395901_0395880 | Ga0395901_0395880_506_805 | 99 |
| 582 | 3300038443 | Ga0395901_0815489 | Ga0395901_0815489_85_384 | 99 |
| 583 | 3300038443 | Ga0395901_1030888 | Ga0395901_1030888_253_552 | 99 |
| 584 | 3300038443 | Ga0395901_1050423 | Ga0395901_1050423_351_650 | 99 |
| 585 | 3300038996 | Ga0242420_092276 | Ga0242420_092276_17_316 | 99 |
| 586 | 3300039437 | Ga0436365_0098300 | Ga0436365_0098300_46_345 | 99 |
| 587 | 3300039438 | Ga0436360_0759873 | Ga0436360_0759873_936_1235 | 99 |
| 588 | 3300039438 | Ga0436360_1273503 | Ga0436360_1273503_511_831 | 99 |
| 589 | 3300039450 | Ga0436363_0525738 | Ga0436363_0525738_373_672 | 99 |
| 590 | 3300039453 | Ga0436362_1298139 | Ga0436362_1298139_89_388 | 99 |
| 591 | 3300041460 | Ga0451802_1315935 | Ga0451802_1315935_226_525 | 99 |
| 592 | 3300042005 | Ga0439448_0339757 | Ga0439448_0339757_148_447 | 99 |
| 593 | 3300042146 | Ga0450907_089521 | Ga0450907_089521_17_316 | 99 |
| 594 | 3300044656 | Ga0466969_0008320 | Ga0466969_0008320_1399_1698 | 99 |
| 595 | 3300044656 | Ga0466969_0028314 | Ga0466969_0028314_391_690 | 99 |
| 596 | 3300044656 | Ga0466969_0079059 | Ga0466969_0079059_1159_1458 | 99 |
| 597 | 3300044656 | Ga0466969_0093558 | Ga0466969_0093558_868_1167 | 99 |
| 598 | 3300044656 | Ga0466969_0204172 | Ga0466969_0204172_172_471 | 99 |
| 599 | 3300044683 | Ga0466965_0006762 | Ga0466965_0006762_4587_4886 | 99 |
| 600 | 3300044683 | Ga0466965_0047491 | Ga0466965_0047491_175_474 | 99 |
| 601 | 3300044683 | Ga0466965_0582917 | Ga0466965_0582917_188_487 | 99 |
| 602 | 3300044683 | Ga0466965_0624773 | Ga0466965_0624773_216_515 | 99 |
| 603 | 3300044684 | Ga0466966_0010121 | Ga0466966_0010121_4992_5291 | 99 |
| 604 | 3300044684 | Ga0466966_0027613 | Ga0466966_0027613_567_866 | 99 |
| 605 | 3300044684 | Ga0466966_0332827 | Ga0466966_0332827_377_676 | 99 |
| 606 | 3300044684 | Ga0466966_0941860 | Ga0466966_0941860_40_339 | 99 |
| 607 | 3300044693 | Ga0466961_0002598 | Ga0466961_0002598_9044_9343 | 99 |
| 608 | 3300044693 | Ga0466961_0009627 | Ga0466961_0009627_406_705 | 99 |
| 609 | 3300044693 | Ga0466961_0011449 | Ga0466961_0011449_488_787 | 99 |
| 610 | 3300044693 | Ga0466961_0029655 | Ga0466961_0029655_3073_3372 | 99 |
| 611 | 3300044693 | Ga0466961_0305177 | Ga0466961_0305177_606_905 | 99 |
| 612 | 3300044693 | Ga0466961_0369298 | Ga0466961_0369298_411_737 | 99 |
| 613 | 3300044693 | Ga0466961_0373865 | Ga0466961_0373865_41_340 | 99 |
| 614 | 3300044693 | Ga0466961_0723268 | Ga0466961_0723268_236_535 | 99 |
| 615 | 3300044693 | Ga0466961_0739063 | Ga0466961_0739063_237_536 | 99 |
| 616 | 3300044694 | Ga0466963_0000638 | Ga0466963_0000638_3356_3655 | 99 |
| 617 | 3300044694 | Ga0466963_0001960 | Ga0466963_0001960_9122_9421 | 99 |
| 618 | 3300044694 | Ga0466963_0002874 | Ga0466963_0002874_2644_2943 | 99 |
| 619 | 3300044694 | Ga0466963_0007500 | Ga0466963_0007500_595_894 | 99 |
| 620 | 3300044694 | Ga0466963_0008277 | Ga0466963_0008277_2035_2334 | 99 |
| 621 | 3300044694 | Ga0466963_0010088 | Ga0466963_0010088_1353_1652 | 99 |
| 622 | 3300044694 | Ga0466963_0015895 | Ga0466963_0015895_95_394 | 99 |
| 623 | 3300044694 | Ga0466963_0018310 | Ga0466963_0018310_3277_3576 | 99 |
| 624 | 3300044694 | Ga0466963_0041043 | Ga0466963_0041043_909_1208 | 99 |
| 625 | 3300044694 | Ga0466963_0061838 | Ga0466963_0061838_1890_2189 | 99 |
| 626 | 3300044694 | Ga0466963_0074842 | Ga0466963_0074842_150_449 | 99 |
| 627 | 3300044694 | Ga0466963_0124604 | Ga0466963_0124604_242_541 | 99 |
| 628 | 3300044694 | Ga0466963_0126152 | Ga0466963_0126152_1232_1531 | 99 |
| 629 | 3300044694 | Ga0466963_0135344 | Ga0466963_0135344_1082_1381 | 99 |
| 630 | 3300044694 | Ga0466963_0305487 | Ga0466963_0305487_407_733 | 99 |
| 631 | 3300044694 | Ga0466963_0315279 | Ga0466963_0315279_248_547 | 99 |
| 632 | 3300044694 | Ga0466963_0491748 | Ga0466963_0491748_313_612 | 99 |
| 633 | 3300044694 | Ga0466963_0702076 | Ga0466963_0702076_140_439 | 99 |
| 634 | 3300044694 | Ga0466963_0733865 | Ga0466963_0733865_288_587 | 99 |
| 635 | 3300044694 | Ga0466963_1263664 | Ga0466963_1263664_19_318 | 99 |
| 636 | 3300044694 | Ga0466963_1285127 | Ga0466963_1285127_16_315 | 99 |
| 637 | 3300044694 | Ga0466963_1290516 | Ga0466963_1290516_149_448 | 99 |
| 638 | 3300044706 | Ga0466964_0009667 | Ga0466964_0009667_1818_2117 | 99 |
| 639 | 3300044706 | Ga0466964_0011996 | Ga0466964_0011996_2250_2549 | 99 |
| 640 | 3300044706 | Ga0466964_0012986 | Ga0466964_0012986_2281_2580 | 99 |
| 641 | 3300044706 | Ga0466964_0043632 | Ga0466964_0043632_1474_1773 | 99 |
| 642 | 3300044706 | Ga0466964_0048436 | Ga0466964_0048436_220_519 | 99 |
| 643 | 3300044706 | Ga0466964_0082260 | Ga0466964_0082260_481_780 | 99 |
| 644 | 3300044706 | Ga0466964_0125995 | Ga0466964_0125995_45_344 | 99 |
| 645 | 3300044706 | Ga0466964_0159160 | Ga0466964_0159160_695_994 | 99 |
| 646 | 3300044712 | Ga0453684_0919400 | Ga0453684_0919400_76_375 | 99 |
| 647 | 3300044719 | Ga0466971_0003820 | Ga0466971_0003820_3228_3527 | 99 |
| 648 | 3300044719 | Ga0466971_0006453 | Ga0466971_0006453_481_780 | 99 |
| 649 | 3300044719 | Ga0466971_0009099 | Ga0466971_0009099_2153_2452 | 99 |
| 650 | 3300044719 | Ga0466971_0106507 | Ga0466971_0106507_251_550 | 99 |
| 651 | 3300044719 | Ga0466971_0197398 | Ga0466971_0197398_300_626 | 99 |
| 652 | 3300044719 | Ga0466971_0201894 | Ga0466971_0201894_40_339 | 99 |
| 653 | 3300044719 | Ga0466971_0300313 | Ga0466971_0300313_228_527 | 99 |
| 654 | 3300044719 | Ga0466971_0530280 | Ga0466971_0530280_187_486 | 99 |
| 655 | 3300044735 | Ga0466968_0007699 | Ga0466968_0007699_2510_2809 | 99 |
| 656 | 3300044735 | Ga0466968_0007930 | Ga0466968_0007930_2043_2342 | 99 |
| 657 | 3300044735 | Ga0466968_0104565 | Ga0466968_0104565_733_1032 | 99 |
| 658 | 3300044735 | Ga0466968_0138544 | Ga0466968_0138544_56_355 | 99 |
| 659 | 3300044735 | Ga0466968_0235870 | Ga0466968_0235870_45_344 | 99 |
| 660 | 3300044735 | Ga0466968_0318970 | Ga0466968_0318970_334_633 | 99 |
| 661 | 3300044765 | Ga0466970_0031380 | Ga0466970_0031380_781_1080 | 99 |
| 662 | 3300044765 | Ga0466970_0127310 | Ga0466970_0127310_928_1227 | 99 |
| 663 | 3300044765 | Ga0466970_0432096 | Ga0466970_0432096_323_622 | 99 |
| 664 | 3300044765 | Ga0466970_0837061 | Ga0466970_0837061_51_350 | 99 |
| 665 | 3300044842 | Ga0466957_0004248 | Ga0466957_0004248_415_714 | 99 |
| 666 | 3300044842 | Ga0466957_0016146 | Ga0466957_0016146_3981_4280 | 99 |
| 667 | 3300044842 | Ga0466957_0045674 | Ga0466957_0045674_1052_1351 | 99 |
| 668 | 3300044842 | Ga0466957_0046935 | Ga0466957_0046935_1043_1342 | 99 |
| 669 | 3300044842 | Ga0466957_0056358 | Ga0466957_0056358_483_782 | 99 |
| 670 | 3300044842 | Ga0466957_0065101 | Ga0466957_0065101_137_457 | 99 |
| 671 | 3300044842 | Ga0466957_0069326 | Ga0466957_0069326_108_407 | 99 |
| 672 | 3300044842 | Ga0466957_0083788 | Ga0466957_0083788_288_587 | 99 |
| 673 | 3300044842 | Ga0466957_0130720 | Ga0466957_0130720_498_797 | 99 |
| 674 | 3300044842 | Ga0466957_0173250 | Ga0466957_0173250_485_784 | 99 |
| 675 | 3300044842 | Ga0466957_0226265 | Ga0466957_0226265_132_431 | 99 |
| 676 | 3300044842 | Ga0466957_1314679 | Ga0466957_1314679_128_427 | 99 |
| 677 | 3300044901 | Ga0466960_0014667 | Ga0466960_0014667_2956_3255 | 99 |
| 678 | 3300044901 | Ga0466960_0034473 | Ga0466960_0034473_1216_1515 | 99 |
| 679 | 3300044901 | Ga0466960_0069363 | Ga0466960_0069363_1284_1583 | 99 |
| 680 | 3300044901 | Ga0466960_0272081 | Ga0466960_0272081_316_615 | 99 |
| 681 | 3300044901 | Ga0466960_1007120 | Ga0466960_1007120_164_463 | 99 |
| 682 | 3300045049 | Ga0466959_0003027 | Ga0466959_0003027_3235_3534 | 99 |
| 683 | 3300045049 | Ga0466959_0007099 | Ga0466959_0007099_966_1265 | 99 |
| 684 | 3300045049 | Ga0466959_0007785 | Ga0466959_0007785_4558_4857 | 99 |
| 685 | 3300045049 | Ga0466959_0028569 | Ga0466959_0028569_1831_2130 | 99 |
| 686 | 3300045049 | Ga0466959_0045281 | Ga0466959_0045281_2088_2387 | 99 |
| 687 | 3300045049 | Ga0466959_0098643 | Ga0466959_0098643_1500_1826 | 99 |
| 688 | 3300045049 | Ga0466959_0160810 | Ga0466959_0160810_1037_1336 | 99 |
| 689 | 3300045836 | Ga0466958_0005189 | Ga0466958_0005189_137_436 | 99 |
| 690 | 3300045836 | Ga0466958_0006933 | Ga0466958_0006933_3058_3357 | 99 |
| 691 | 3300045836 | Ga0466958_0007722 | Ga0466958_0007722_978_1277 | 99 |
| 692 | 3300045836 | Ga0466958_0013137 | Ga0466958_0013137_1030_1329 | 99 |
| 693 | 3300045836 | Ga0466958_0025514 | Ga0466958_0025514_605_904 | 99 |
| 694 | 3300045836 | Ga0466958_0041133 | Ga0466958_0041133_667_966 | 99 |
| 695 | 3300045836 | Ga0466958_0081052 | Ga0466958_0081052_948_1247 | 99 |
| 696 | 3300045836 | Ga0466958_0118993 | Ga0466958_0118993_825_1124 | 99 |
| 697 | 3300045836 | Ga0466958_0135384 | Ga0466958_0135384_201_500 | 99 |
| 698 | 3300045836 | Ga0466958_0326158 | Ga0466958_0326158_383_682 | 99 |
| 699 | 3300045836 | Ga0466958_0930329 | Ga0466958_0930329_190_489 | 99 |
| 700 | 3300045976 | Ga0466967_0000179 | Ga0466967_0000179_8244_8543 | 99 |
| 701 | 3300045976 | Ga0466967_0001152 | Ga0466967_0001152_1915_2214 | 99 |
| 702 | 3300045976 | Ga0466967_0004521 | Ga0466967_0004521_1444_1743 | 99 |
| 703 | 3300045976 | Ga0466967_0010503 | Ga0466967_0010503_1540_1839 | 99 |
| 704 | 3300045976 | Ga0466967_0010586 | Ga0466967_0010586_82_381 | 99 |
| 705 | 3300045976 | Ga0466967_0013317 | Ga0466967_0013317_5036_5335 | 99 |
| 706 | 3300045976 | Ga0466967_0014204 | Ga0466967_0014204_2892_3191 | 99 |
| 707 | 3300045976 | Ga0466967_0016668 | Ga0466967_0016668_1966_2265 | 99 |
| 708 | 3300045976 | Ga0466967_0018352 | Ga0466967_0018352_4775_5074 | 99 |
| 709 | 3300045976 | Ga0466967_0027751 | Ga0466967_0027751_933_1232 | 99 |
| 710 | 3300045976 | Ga0466967_0031328 | Ga0466967_0031328_1563_1862 | 99 |
| 711 | 3300045976 | Ga0466967_0052497 | Ga0466967_0052497_1964_2263 | 99 |
| 712 | 3300045976 | Ga0466967_0063760 | Ga0466967_0063760_2661_2960 | 99 |
| 713 | 3300045976 | Ga0466967_0080521 | Ga0466967_0080521_846_1145 | 99 |
| 714 | 3300045976 | Ga0466967_0083995 | Ga0466967_0083995_1814_2134 | 99 |
| 715 | 3300045976 | Ga0466967_0124820 | Ga0466967_0124820_1809_2135 | 99 |
| 716 | 3300045976 | Ga0466967_0143030 | Ga0466967_0143030_486_785 | 99 |
| 717 | 3300045976 | Ga0466967_0168690 | Ga0466967_0168690_1648_1947 | 99 |
| 718 | 3300045976 | Ga0466967_0176788 | Ga0466967_0176788_166_465 | 99 |
| 719 | 3300045976 | Ga0466967_0183394 | Ga0466967_0183394_330_629 | 99 |
| 720 | 3300045976 | Ga0466967_0188349 | Ga0466967_0188349_100_399 | 99 |
| 721 | 3300045976 | Ga0466967_0189269 | Ga0466967_0189269_983_1282 | 99 |
| 722 | 3300045976 | Ga0466967_0227190 | Ga0466967_0227190_636_935 | 99 |
| 723 | 3300045976 | Ga0466967_0243407 | Ga0466967_0243407_562_861 | 99 |
| 724 | 3300045976 | Ga0466967_0327057 | Ga0466967_0327057_103_402 | 99 |
| 725 | 3300045976 | Ga0466967_0332887 | Ga0466967_0332887_555_854 | 99 |
| 726 | 3300045976 | Ga0466967_0337537 | Ga0466967_0337537_1094_1393 | 99 |
| 727 | 3300045976 | Ga0466967_0388249 | Ga0466967_0388249_1026_1325 | 99 |
| 728 | 3300045976 | Ga0466967_0595710 | Ga0466967_0595710_413_712 | 99 |
| 729 | 3300045976 | Ga0466967_0730565 | Ga0466967_0730565_29_328 | 99 |
| 730 | 3300045976 | Ga0466967_0789590 | Ga0466967_0789590_117_416 | 99 |
| 731 | 3300045976 | Ga0466967_1000869 | Ga0466967_1000869_217_516 | 99 |
| 732 | 3300045976 | Ga0466967_1062852 | Ga0466967_1062852_483_782 | 99 |
| 733 | 3300045976 | Ga0466967_1361528 | Ga0466967_1361528_15_314 | 99 |
| 734 | 3300045976 | Ga0466967_1439467 | Ga0466967_1439467_185_484 | 99 |
| 735 | 3300045976 | Ga0466967_1637288 | Ga0466967_1637288_107_406 | 99 |
| 736 | 3300045976 | Ga0466967_2037987 | Ga0466967_2037987_47_346 | 99 |
| 737 | 3300046454 | Ga0495592_0000467 | Ga0495592_0000467_2083_2382 | 99 |
| 738 | 3300046454 | Ga0495592_0004809 | Ga0495592_0004809_2685_2984 | 99 |
| 739 | 3300046454 | Ga0495592_0038526 | Ga0495592_0038526_1204_1503 | 99 |
| 740 | 3300046454 | Ga0495592_0524998 | Ga0495592_0524998_366_668 | 99 |
| 741 | 3300046454 | Ga0495592_0532538 | Ga0495592_0532538_125_424 | 99 |
| 742 | 3300046455 | Ga0495603_0122187 | Ga0495603_0122187_451_750 | 99 |
| 743 | 3300046459 | Ga0495629_0024661 | Ga0495629_0024661_1420_1719 | 99 |
| 744 | 3300046459 | Ga0495629_0042187 | Ga0495629_0042187_898_1197 | 99 |
| 745 | 3300046459 | Ga0495629_0051469 | Ga0495629_0051469_1171_1470 | 99 |
| 746 | 3300046459 | Ga0495629_0794009 | Ga0495629_0794009_316_615 | 99 |
| 747 | 3300046461 | Ga0495641_0048267 | Ga0495641_0048267_658_957 | 99 |
| 748 | 3300046461 | Ga0495641_0065685 | Ga0495641_0065685_804_1103 | 99 |
| 749 | 3300046461 | Ga0495641_0100956 | Ga0495641_0100956_687_986 | 99 |
| 750 | 3300046461 | Ga0495641_0156768 | Ga0495641_0156768_384_683 | 99 |
| 751 | 3300046461 | Ga0495641_0194596 | Ga0495641_0194596_211_510 | 99 |
| 752 | 3300046462 | Ga0495651_0000621 | Ga0495651_0000621_2617_2916 | 99 |
| 753 | 3300046462 | Ga0495651_0065300 | Ga0495651_0065300_1980_2279 | 99 |
| 754 | 3300046462 | Ga0495651_0218634 | Ga0495651_0218634_423_722 | 99 |
| 755 | 3300046462 | Ga0495651_0284014 | Ga0495651_0284014_446_745 | 99 |
| 756 | 3300046462 | Ga0495651_0475159 | Ga0495651_0475159_437_736 | 99 |
| 757 | 3300046462 | Ga0495651_0646106 | Ga0495651_0646106_329_628 | 99 |
| 758 | 3300046462 | Ga0495651_0791234 | Ga0495651_0791234_87_386 | 99 |
| 759 | 3300046463 | Ga0495653_0071507 | Ga0495653_0071507_969_1268 | 99 |
| 760 | 3300046463 | Ga0495653_0088791 | Ga0495653_0088791_928_1227 | 99 |
| 761 | 3300046463 | Ga0495653_0148364 | Ga0495653_0148364_1178_1477 | 99 |
| 762 | 3300046463 | Ga0495653_0161594 | Ga0495653_0161594_88_387 | 99 |
| 763 | 3300046463 | Ga0495653_0226612 | Ga0495653_0226612_775_1074 | 99 |
| 764 | 3300046463 | Ga0495653_0321024 | Ga0495653_0321024_329_628 | 99 |
| 765 | 3300046463 | Ga0495653_0337587 | Ga0495653_0337587_331_630 | 99 |
| 766 | 3300046463 | Ga0495653_0350983 | Ga0495653_0350983_346_645 | 99 |
| 767 | 3300046463 | Ga0495653_0759791 | Ga0495653_0759791_117_416 | 99 |
| 768 | 3300046472 | Ga0495580_0097510 | Ga0495580_0097510_297_596 | 99 |
| 769 | 3300046473 | Ga0495582_0006911 | Ga0495582_0006911_531_830 | 99 |
| 770 | 3300046473 | Ga0495582_0018061 | Ga0495582_0018061_2688_2987 | 99 |
| 771 | 3300046473 | Ga0495582_0060129 | Ga0495582_0060129_643_942 | 99 |
| 772 | 3300046473 | Ga0495582_0121278 | Ga0495582_0121278_90_389 | 99 |
| 773 | 3300046473 | Ga0495582_0737679 | Ga0495582_0737679_127_426 | 99 |
| 774 | 3300046475 | Ga0495639_0009136 | Ga0495639_0009136_1473_1772 | 99 |
| 775 | 3300046476 | Ga0495662_0018780 | Ga0495662_0018780_919_1218 | 99 |
| 776 | 3300046476 | Ga0495662_0159618 | Ga0495662_0159618_587_886 | 99 |
| 777 | 3300046476 | Ga0495662_0617719 | Ga0495662_0617719_78_377 | 99 |
| 778 | 3300046477 | Ga0495664_0089788 | Ga0495664_0089788_1394_1693 | 99 |
| 779 | 3300046477 | Ga0495664_0159897 | Ga0495664_0159897_1039_1338 | 99 |
| 780 | 3300046477 | Ga0495664_0234408 | Ga0495664_0234408_233_532 | 99 |
| 781 | 3300046477 | Ga0495664_0735392 | Ga0495664_0735392_263_562 | 99 |
| 782 | 3300046491 | Ga0495584_0654457 | Ga0495584_0654457_165_464 | 99 |
| 783 | 3300046492 | Ga0495585_0057908 | Ga0495585_0057908_977_1276 | 99 |
| 784 | 3300046499 | Ga0495594_0258448 | Ga0495594_0258448_651_950 | 99 |
| 785 | 3300046511 | Ga0495608_0011270 | Ga0495608_0011270_3327_3626 | 99 |
| 786 | 3300046511 | Ga0495608_0042449 | Ga0495608_0042449_1656_1955 | 99 |
| 787 | 3300046511 | Ga0495608_0062849 | Ga0495608_0062849_1132_1431 | 99 |
| 788 | 3300046511 | Ga0495608_0127149 | Ga0495608_0127149_109_408 | 99 |
| 789 | 3300046511 | Ga0495608_0616873 | Ga0495608_0616873_101_400 | 99 |
| 790 | 3300046514 | Ga0495618_0000514 | Ga0495618_0000514_21808_22107 | 99 |
| 791 | 3300046514 | Ga0495618_0025530 | Ga0495618_0025530_3237_3536 | 99 |
| 792 | 3300046514 | Ga0495618_0036609 | Ga0495618_0036609_1444_1743 | 99 |
| 793 | 3300046514 | Ga0495618_0046686 | Ga0495618_0046686_1334_1633 | 99 |
| 794 | 3300046514 | Ga0495618_0110550 | Ga0495618_0110550_1195_1494 | 99 |
| 795 | 3300046514 | Ga0495618_0482599 | Ga0495618_0482599_202_501 | 99 |
| 796 | 3300046516 | Ga0495628_0000209 | Ga0495628_0000209_26374_26673 | 99 |
| 797 | 3300046516 | Ga0495628_0023732 | Ga0495628_0023732_298_597 | 99 |
| 798 | 3300046516 | Ga0495628_0154623 | Ga0495628_0154623_1337_1636 | 99 |
| 799 | 3300046516 | Ga0495628_0244842 | Ga0495628_0244842_266_565 | 99 |
| 800 | 3300046516 | Ga0495628_0351723 | Ga0495628_0351723_405_704 | 99 |
| 801 | 3300046516 | Ga0495628_0597604 | Ga0495628_0597604_184_486 | 99 |
| 802 | 3300046517 | Ga0495630_0029915 | Ga0495630_0029915_166_465 | 99 |
| 803 | 3300046517 | Ga0495630_0032508 | Ga0495630_0032508_3574_3873 | 99 |
| 804 | 3300046517 | Ga0495630_0077000 | Ga0495630_0077000_640_939 | 99 |
| 805 | 3300046517 | Ga0495630_0113955 | Ga0495630_0113955_769_1071 | 99 |
| 806 | 3300046517 | Ga0495630_0153890 | Ga0495630_0153890_43_342 | 99 |
| 807 | 3300046517 | Ga0495630_0187855 | Ga0495630_0187855_1022_1321 | 99 |
| 808 | 3300046517 | Ga0495630_0449837 | Ga0495630_0449837_394_693 | 99 |
| 809 | 3300046517 | Ga0495630_0509571 | Ga0495630_0509571_178_477 | 99 |
| 810 | 3300046517 | Ga0495630_1143774 | Ga0495630_1143774_111_410 | 99 |
| 811 | 3300046523 | Ga0495644_0255444 | Ga0495644_0255444_100_399 | 99 |
| 812 | 3300046526 | Ga0495666_0000649 | Ga0495666_0000649_13209_13508 | 99 |
| 813 | 3300046529 | Ga0495652_0001901 | Ga0495652_0001901_19970_20269 | 99 |
| 814 | 3300046529 | Ga0495652_0045105 | Ga0495652_0045105_82_381 | 99 |
| 815 | 3300046529 | Ga0495652_0068779 | Ga0495652_0068779_2286_2588 | 99 |
| 816 | 3300046529 | Ga0495652_0080097 | Ga0495652_0080097_1324_1623 | 99 |
| 817 | 3300046529 | Ga0495652_0129406 | Ga0495652_0129406_461_760 | 99 |
| 818 | 3300046529 | Ga0495652_0143141 | Ga0495652_0143141_1493_1792 | 99 |
| 819 | 3300046529 | Ga0495652_0172940 | Ga0495652_0172940_15_314 | 99 |
| 820 | 3300046529 | Ga0495652_0243299 | Ga0495652_0243299_466_765 | 99 |
| 821 | 3300046529 | Ga0495652_0276313 | Ga0495652_0276313_824_1123 | 99 |
| 822 | 3300046529 | Ga0495652_0550187 | Ga0495652_0550187_28_327 | 99 |
| 823 | 3300046529 | Ga0495652_0620493 | Ga0495652_0620493_350_649 | 99 |
| 824 | 3300046529 | Ga0495652_0732378 | Ga0495652_0732378_63_362 | 99 |
| 825 | 3300046531 | Ga0495665_0375708 | Ga0495665_0375708_172_471 | 99 |
| 826 | 3300046533 | Ga0495640_0024570 | Ga0495640_0024570_143_442 | 99 |
| 827 | 3300046533 | Ga0495640_0074914 | Ga0495640_0074914_1567_1866 | 99 |
| 828 | 3300046533 | Ga0495640_0256326 | Ga0495640_0256326_427_726 | 99 |
| 829 | 3300046533 | Ga0495640_0257193 | Ga0495640_0257193_477_779 | 99 |
| 830 | 3300046533 | Ga0495640_0883995 | Ga0495640_0883995_170_469 | 99 |
| 831 | 3300046535 | Ga0495586_0051724 | Ga0495586_0051724_776_1075 | 99 |
| 832 | 3300046535 | Ga0495586_0189050 | Ga0495586_0189050_87_386 | 99 |
| 833 | 3300046535 | Ga0495586_0228486 | Ga0495586_0228486_31_330 | 99 |
| 834 | 3300046535 | Ga0495586_0293847 | Ga0495586_0293847_29_328 | 99 |
| 835 | 3300046535 | Ga0495586_0523725 | Ga0495586_0523725_133_432 | 99 |
| 836 | 3300046535 | Ga0495586_0675005 | Ga0495586_0675005_262_564 | 99 |
| 837 | 3300046536 | Ga0495587_0000492 | Ga0495587_0000492_10946_11245 | 99 |
| 838 | 3300046536 | Ga0495587_0034131 | Ga0495587_0034131_1152_1451 | 99 |
| 839 | 3300046536 | Ga0495587_0038267 | Ga0495587_0038267_1671_1970 | 99 |
| 840 | 3300046543 | Ga0495645_0000126 | Ga0495645_0000126_24501_24800 | 99 |
| 841 | 3300046543 | Ga0495645_0047549 | Ga0495645_0047549_2038_2337 | 99 |
| 842 | 3300046543 | Ga0495645_0078324 | Ga0495645_0078324_202_501 | 99 |
| 843 | 3300046543 | Ga0495645_0246482 | Ga0495645_0246482_777_1076 | 99 |
| 844 | 3300046559 | Ga0495667_0025462 | Ga0495667_0025462_3385_3684 | 99 |
| 845 | 3300046559 | Ga0495667_0058958 | Ga0495667_0058958_2206_2505 | 99 |
| 846 | 3300046559 | Ga0495667_0069471 | Ga0495667_0069471_1917_2216 | 99 |
| 847 | 3300046559 | Ga0495667_0073553 | Ga0495667_0073553_422_721 | 99 |
| 848 | 3300046559 | Ga0495667_0077102 | Ga0495667_0077102_1778_2077 | 99 |
| 849 | 3300046559 | Ga0495667_0398011 | Ga0495667_0398011_58_357 | 99 |
| 850 | 3300046559 | Ga0495667_0753862 | Ga0495667_0753862_277_576 | 99 |
| 851 | 3300046615 | Ga0495656_0006189 | Ga0495656_0006189_737_1036 | 99 |
| 852 | 3300046615 | Ga0495656_0319665 | Ga0495656_0319665_188_487 | 99 |
| 853 | 3300046642 | Ga0495634_0163911 | Ga0495634_0163911_891_1190 | 99 |
| 854 | 3300046642 | Ga0495634_0190572 | Ga0495634_0190572_50_349 | 99 |
| 855 | 3300046642 | Ga0495634_0248988 | Ga0495634_0248988_64_363 | 99 |
| 856 | 3300046642 | Ga0495634_0796533 | Ga0495634_0796533_13_312 | 99 |
| 857 | 3300046663 | Ga0495635_0010795 | Ga0495635_0010795_3406_3705 | 99 |
| 858 | 3300046663 | Ga0495635_0052818 | Ga0495635_0052818_1753_2052 | 99 |
| 859 | 3300046663 | Ga0495635_0054282 | Ga0495635_0054282_1649_1948 | 99 |
| 860 | 3300046663 | Ga0495635_0059338 | Ga0495635_0059338_1413_1712 | 99 |
| 861 | 3300046663 | Ga0495635_0081459 | Ga0495635_0081459_1806_2105 | 99 |
| 862 | 3300046663 | Ga0495635_0131326 | Ga0495635_0131326_1270_1569 | 99 |
| 863 | 3300046663 | Ga0495635_0137700 | Ga0495635_0137700_82_381 | 99 |
| 864 | 3300046663 | Ga0495635_0156451 | Ga0495635_0156451_657_956 | 99 |
| 865 | 3300046675 | Ga0495657_0007470 | Ga0495657_0007470_7958_8257 | 99 |
| 866 | 3300046675 | Ga0495657_0007590 | Ga0495657_0007590_2468_2767 | 99 |
| 867 | 3300046675 | Ga0495657_0021368 | Ga0495657_0021368_2493_2792 | 99 |
| 868 | 3300046675 | Ga0495657_0022121 | Ga0495657_0022121_537_836 | 99 |
| 869 | 3300046678 | Ga0495599_0000130 | Ga0495599_0000130_24559_24858 | 99 |
| 870 | 3300046678 | Ga0495599_0235459 | Ga0495599_0235459_175_474 | 99 |
| 871 | 3300046678 | Ga0495599_0360090 | Ga0495599_0360090_491_790 | 99 |
| 872 | 3300046679 | Ga0495623_0000041 | Ga0495623_0000041_10222_10521 | 99 |
| 873 | 3300046679 | Ga0495623_0373170 | Ga0495623_0373170_47_346 | 99 |
| 874 | 3300046679 | Ga0495623_0424907 | Ga0495623_0424907_73_372 | 99 |
| 875 | 3300046680 | Ga0495646_0268246 | Ga0495646_0268246_125_424 | 99 |
| 876 | 3300046680 | Ga0495646_0332758 | Ga0495646_0332758_439_738 | 99 |
| 877 | 3300046681 | Ga0495647_0005935 | Ga0495647_0005935_2555_2854 | 99 |
| 878 | 3300046681 | Ga0495647_0038165 | Ga0495647_0038165_1355_1654 | 99 |
| 879 | 3300046681 | Ga0495647_0541745 | Ga0495647_0541745_197_496 | 99 |
| 880 | 3300046683 | Ga0495658_0004962 | Ga0495658_0004962_5056_5355 | 99 |
| 881 | 3300046683 | Ga0495658_0077855 | Ga0495658_0077855_349_648 | 99 |
| 882 | 3300046683 | Ga0495658_0638210 | Ga0495658_0638210_240_539 | 99 |
| 883 | 3300046689 | Ga0495613_0004077 | Ga0495613_0004077_9203_9502 | 99 |
| 884 | 3300046689 | Ga0495613_0075657 | Ga0495613_0075657_1768_2067 | 99 |
| 885 | 3300046689 | Ga0495613_0077256 | Ga0495613_0077256_1252_1551 | 99 |
| 886 | 3300046689 | Ga0495613_0083914 | Ga0495613_0083914_1393_1692 | 99 |
| 887 | 3300046689 | Ga0495613_0117564 | Ga0495613_0117564_200_499 | 99 |
| 888 | 3300046689 | Ga0495613_0395861 | Ga0495613_0395861_322_621 | 99 |
| 889 | 3300046689 | Ga0495613_0712973 | Ga0495613_0712973_249_548 | 99 |
| 890 | 3300046689 | Ga0495613_0789962 | Ga0495613_0789962_198_497 | 99 |
| 891 | 3300046689 | Ga0495613_0798449 | Ga0495613_0798449_158_460 | 99 |
| 892 | 3300046690 | Ga0495624_0003577 | Ga0495624_0003577_10676_10975 | 99 |
| 893 | 3300046690 | Ga0495624_0032360 | Ga0495624_0032360_893_1192 | 99 |
| 894 | 3300046690 | Ga0495624_0050268 | Ga0495624_0050268_1449_1748 | 99 |
| 895 | 3300046690 | Ga0495624_0394708 | Ga0495624_0394708_466_765 | 99 |
| 896 | 3300046690 | Ga0495624_0627360 | Ga0495624_0627360_154_453 | 99 |
| 897 | 3300046794 | Ga0495589_0419934 | Ga0495589_0419934_236_535 | 99 |
| 898 | 3300046809 | Ga0495600_0114072 | Ga0495600_0114072_1023_1322 | 99 |
| 899 | 3300046809 | Ga0495600_0174744 | Ga0495600_0174744_994_1293 | 99 |
| 900 | 3300046809 | Ga0495600_0350087 | Ga0495600_0350087_419_718 | 99 |
| 901 | 3300047315 | Ga0495581_0007047 | Ga0495581_0007047_5081_5380 | 99 |
| 902 | 3300047315 | Ga0495581_0045247 | Ga0495581_0045247_2103_2402 | 99 |
| 903 | 3300047315 | Ga0495581_0612098 | Ga0495581_0612098_76_375 | 99 |
| 904 | 3300047317 | Ga0495604_0000167 | Ga0495604_0000167_51911_52210 | 99 |
| 905 | 3300047317 | Ga0495604_0561258 | Ga0495604_0561258_104_403 | 99 |
| 906 | 3300047317 | Ga0495604_0740947 | Ga0495604_0740947_311_610 | 99 |
| 907 | 3300047319 | Ga0495674_0037111 | Ga0495674_0037111_2142_2441 | 99 |
| 908 | 3300047319 | Ga0495674_0037491 | Ga0495674_0037491_117_416 | 99 |
| 909 | 3300047319 | Ga0495674_0126018 | Ga0495674_0126018_1529_1828 | 99 |
| 910 | 3300047319 | Ga0495674_0134915 | Ga0495674_0134915_1538_1837 | 99 |
| 911 | 3300047319 | Ga0495674_0141468 | Ga0495674_0141468_279_578 | 99 |
| 912 | 3300047319 | Ga0495674_0307582 | Ga0495674_0307582_811_1110 | 99 |
| 913 | 3300047319 | Ga0495674_0417003 | Ga0495674_0417003_289_588 | 99 |
| 914 | 3300047319 | Ga0495674_0446413 | Ga0495674_0446413_728_1027 | 99 |
| 915 | 3300047319 | Ga0495674_0970014 | Ga0495674_0970014_338_640 | 99 |
| 916 | 3300047319 | Ga0495674_1082072 | Ga0495674_1082072_168_467 | 99 |
| 917 | 3300047319 | Ga0495674_1162632 | Ga0495674_1162632_89_388 | 99 |
| 918 | 3300047321 | Ga0495676_0002388 | Ga0495676_0002388_1343_1642 | 99 |
| 919 | 3300047321 | Ga0495676_0229986 | Ga0495676_0229986_685_984 | 99 |
| 920 | 3300047321 | Ga0495676_0416105 | Ga0495676_0416105_132_431 | 99 |
| 921 | 3300047321 | Ga0495676_0750082 | Ga0495676_0750082_247_546 | 99 |
| 922 | 3300047322 | Ga0495680_0003097 | Ga0495680_0003097_5042_5341 | 99 |
| 923 | 3300047322 | Ga0495680_0023872 | Ga0495680_0023872_3030_3329 | 99 |
| 924 | 3300047322 | Ga0495680_0027741 | Ga0495680_0027741_4163_4462 | 99 |
| 925 | 3300047322 | Ga0495680_0027979 | Ga0495680_0027979_2905_3204 | 99 |
| 926 | 3300047322 | Ga0495680_0033027 | Ga0495680_0033027_2356_2655 | 99 |
| 927 | 3300047322 | Ga0495680_0079172 | Ga0495680_0079172_1628_1927 | 99 |
| 928 | 3300047322 | Ga0495680_0272241 | Ga0495680_0272241_513_812 | 99 |
| 929 | 3300047322 | Ga0495680_0357225 | Ga0495680_0357225_448_747 | 99 |
| 930 | 3300047322 | Ga0495680_0454678 | Ga0495680_0454678_492_791 | 99 |
| 931 | 3300047322 | Ga0495680_0686863 | Ga0495680_0686863_87_386 | 99 |
| 932 | 3300047444 | Ga0495675_0000724 | Ga0495675_0000724_15266_15565 | 99 |
| 933 | 3300047444 | Ga0495675_0356176 | Ga0495675_0356176_92_391 | 99 |
| 934 | 3300047471 | Ga0495684_0014897 | Ga0495684_0014897_3571_3870 | 99 |
| 935 | 3300047471 | Ga0495684_0020918 | Ga0495684_0020918_4161_4460 | 99 |
| 936 | 3300047471 | Ga0495684_0026533 | Ga0495684_0026533_4142_4441 | 99 |
| 937 | 3300047471 | Ga0495684_0040798 | Ga0495684_0040798_1030_1329 | 99 |
| 938 | 3300047471 | Ga0495684_0082568 | Ga0495684_0082568_1471_1770 | 99 |
| 939 | 3300047471 | Ga0495684_0104324 | Ga0495684_0104324_1815_2114 | 99 |
| 940 | 3300047471 | Ga0495684_0175847 | Ga0495684_0175847_204_503 | 99 |
| 941 | 3300047471 | Ga0495684_1002535 | Ga0495684_1002535_82_381 | 99 |
| 942 | 3300047673 | Ga0495593_0006002 | Ga0495593_0006002_919_1218 | 99 |
| 943 | 3300047673 | Ga0495593_0337721 | Ga0495593_0337721_42_341 | 99 |
| 944 | 3300048088 | Ga0495602_0000147 | Ga0495602_0000147_40573_40872 | 99 |
| 945 | 3300048088 | Ga0495602_0251666 | Ga0495602_0251666_105_404 | 99 |
| 946 | 3300048089 | Ga0495614_0010756 | Ga0495614_0010756_995_1294 | 99 |
| 947 | 3300048089 | Ga0495614_0524370 | Ga0495614_0524370_76_375 | 99 |
| 948 | 3300048903 | Ga0496100_0014542 | Ga0496100_0014542_2821_3120 | 99 |
| 949 | 3300048903 | Ga0496100_0194027 | Ga0496100_0194027_770_1069 | 99 |
| 950 | 3300048903 | Ga0496100_1034076 | Ga0496100_1034076_179_478 | 99 |
| 951 | 3300048904 | Ga0496101_0015812 | Ga0496101_0015812_2784_3083 | 99 |
| 952 | 3300048904 | Ga0496101_0158788 | Ga0496101_0158788_1251_1550 | 99 |
| 953 | 3300048904 | Ga0496101_0630182 | Ga0496101_0630182_471_770 | 99 |
| 954 | 3300048904 | Ga0496101_0643906 | Ga0496101_0643906_103_402 | 99 |
| 955 | 3300048905 | Ga0496102_0002713 | Ga0496102_0002713_2102_2428 | 99 |
| 956 | 3300048905 | Ga0496102_0014363 | Ga0496102_0014363_3755_4054 | 99 |
| 957 | 3300048905 | Ga0496102_0116347 | Ga0496102_0116347_1420_1719 | 99 |
| 958 | 3300048905 | Ga0496102_1703307 | Ga0496102_1703307_215_514 | 99 |
| 959 | 3300048906 | Ga0496103_0030216 | Ga0496103_0030216_266_565 | 99 |
| 960 | 3300048906 | Ga0496103_0034710 | Ga0496103_0034710_185_484 | 99 |
| 961 | 3300048906 | Ga0496103_0071000 | Ga0496103_0071000_936_1262 | 99 |
| 962 | 3300048907 | Ga0496104_0078038 | Ga0496104_0078038_468_767 | 99 |
| 963 | 3300048907 | Ga0496104_0104879 | Ga0496104_0104879_840_1139 | 99 |
| 964 | 3300048907 | Ga0496104_0113105 | Ga0496104_0113105_2260_2559 | 99 |
| 965 | 3300048907 | Ga0496104_0157942 | Ga0496104_0157942_1680_1979 | 99 |
| 966 | 3300048907 | Ga0496104_0161795 | Ga0496104_0161795_1010_1309 | 99 |
| 967 | 3300048907 | Ga0496104_0325595 | Ga0496104_0325595_870_1169 | 99 |
| 968 | 3300048907 | Ga0496104_0468114 | Ga0496104_0468114_803_1102 | 99 |
| 969 | 3300048907 | Ga0496104_0520879 | Ga0496104_0520879_671_970 | 99 |
| 970 | 3300048907 | Ga0496104_1122189 | Ga0496104_1122189_25_324 | 99 |
| 971 | 3300048907 | Ga0496104_1663280 | Ga0496104_1663280_60_362 | 99 |
| 972 | 3300048908 | Ga0496105_0032718 | Ga0496105_0032718_1291_1590 | 99 |
| 973 | 3300048908 | Ga0496105_0087793 | Ga0496105_0087793_1967_2266 | 99 |
| 974 | 3300048908 | Ga0496105_0255319 | Ga0496105_0255319_913_1212 | 99 |
| 975 | 3300048908 | Ga0496105_0393485 | Ga0496105_0393485_498_797 | 99 |
| 976 | 3300048908 | Ga0496105_1040315 | Ga0496105_1040315_107_406 | 99 |
| 977 | 3300048908 | Ga0496105_1222188 | Ga0496105_1222188_59_358 | 99 |
| 978 | 3300048909 | Ga0496106_0005920 | Ga0496106_0005920_2484_2783 | 99 |
| 979 | 3300048909 | Ga0496106_0392785 | Ga0496106_0392785_57_356 | 99 |
| 980 | 3300048910 | Ga0496107_0001702 | Ga0496107_0001702_11523_11822 | 99 |
| 981 | 3300048910 | Ga0496107_0022441 | Ga0496107_0022441_2711_3010 | 99 |
| 982 | 3300048910 | Ga0496107_0033804 | Ga0496107_0033804_2903_3202 | 99 |
| 983 | 3300048910 | Ga0496107_0454106 | Ga0496107_0454106_498_797 | 99 |
| 984 | 3300048911 | Ga0496108_0034028 | Ga0496108_0034028_3482_3781 | 99 |
| 985 | 3300048911 | Ga0496108_0062684 | Ga0496108_0062684_2218_2517 | 99 |
| 986 | 3300048911 | Ga0496108_0103999 | Ga0496108_0103999_1097_1396 | 99 |
| 987 | 3300048911 | Ga0496108_0562960 | Ga0496108_0562960_413_712 | 99 |
| 988 | 3300048911 | Ga0496108_0806035 | Ga0496108_0806035_421_723 | 99 |
| 989 | 3300048911 | Ga0496108_1366947 | Ga0496108_1366947_201_500 | 99 |
| 990 | 3300048912 | Ga0496109_0034023 | Ga0496109_0034023_2234_2533 | 99 |
| 991 | 3300048912 | Ga0496109_0060193 | Ga0496109_0060193_1770_2069 | 99 |
| 992 | 3300048912 | Ga0496109_0067859 | Ga0496109_0067859_120_419 | 99 |
| 993 | 3300048912 | Ga0496109_0101168 | Ga0496109_0101168_618_917 | 99 |
| 994 | 3300048912 | Ga0496109_0414694 | Ga0496109_0414694_282_581 | 99 |
| 995 | 3300048912 | Ga0496109_0992911 | Ga0496109_0992911_304_603 | 99 |
| 996 | 3300048912 | Ga0496109_1689725 | Ga0496109_1689725_180_479 | 99 |
| 997 | 3300048913 | Ga0496110_0012051 | Ga0496110_0012051_5821_6120 | 99 |
| 998 | 3300048913 | Ga0496110_0019384 | Ga0496110_0019384_3464_3763 | 99 |
| 999 | 3300048913 | Ga0496110_0648594 | Ga0496110_0648594_20_319 | 99 |
| 1000 | 3300048913 | Ga0496110_1566194 | Ga0496110_1566194_72_371 | 99 |
| 1001 | 3300048914 | Ga0496111_0006770 | Ga0496111_0006770_139_438 | 99 |
| 1002 | 3300048914 | Ga0496111_0028995 | Ga0496111_0028995_1802_2101 | 99 |
| 1003 | 3300048914 | Ga0496111_0070656 | Ga0496111_0070656_1936_2235 | 99 |
| 1004 | 3300048914 | Ga0496111_0163351 | Ga0496111_0163351_355_654 | 99 |
| 1005 | 3300048914 | Ga0496111_0460116 | Ga0496111_0460116_297_596 | 99 |
| 1006 | 3300048915 | Ga0496112_0002974 | Ga0496112_0002974_10069_10389 | 99 |
| 1007 | 3300048915 | Ga0496112_0009862 | Ga0496112_0009862_5561_5860 | 99 |
| 1008 | 3300048915 | Ga0496112_0058651 | Ga0496112_0058651_138_437 | 99 |
| 1009 | 3300048915 | Ga0496112_0127224 | Ga0496112_0127224_2096_2395 | 99 |
| 1010 | 3300048915 | Ga0496112_0193892 | Ga0496112_0193892_459_758 | 99 |
| 1011 | 3300048915 | Ga0496112_0220626 | Ga0496112_0220626_1483_1782 | 99 |
| 1012 | 3300048915 | Ga0496112_0503077 | Ga0496112_0503077_131_430 | 99 |
| 1013 | 3300048915 | Ga0496112_0839333 | Ga0496112_0839333_52_351 | 99 |
| 1014 | 3300048915 | Ga0496112_1313235 | Ga0496112_1313235_21_320 | 99 |
| 1015 | 3300048915 | Ga0496112_1707767 | Ga0496112_1707767_48_524 | 99 |
| 1016 | 3300048916 | Ga0496113_0177054 | Ga0496113_0177054_1131_1430 | 99 |
| 1017 | 3300048916 | Ga0496113_0230776 | Ga0496113_0230776_924_1223 | 99 |
| 1018 | 3300048916 | Ga0496113_0231059 | Ga0496113_0231059_711_1010 | 99 |
| 1019 | 3300048916 | Ga0496113_0242879 | Ga0496113_0242879_209_508 | 99 |
| 1020 | 3300048916 | Ga0496113_0324821 | Ga0496113_0324821_900_1199 | 99 |
| 1021 | 3300048916 | Ga0496113_0514836 | Ga0496113_0514836_144_443 | 99 |
| 1022 | 3300048916 | Ga0496113_0537012 | Ga0496113_0537012_605_904 | 99 |
| 1023 | 3300048916 | Ga0496113_0548728 | Ga0496113_0548728_146_466 | 99 |
| 1024 | 3300048917 | Ga0496114_0041653 | Ga0496114_0041653_2319_2618 | 99 |
| 1025 | 3300048917 | Ga0496114_0049600 | Ga0496114_0049600_2079_2378 | 99 |
| 1026 | 3300048917 | Ga0496114_0049741 | Ga0496114_0049741_1476_1775 | 99 |
| 1027 | 3300048917 | Ga0496114_0317209 | Ga0496114_0317209_1037_1336 | 99 |
| 1028 | 3300048917 | Ga0496114_1531768 | Ga0496114_1531768_22_321 | 99 |
| 1029 | 3300048918 | Ga0496115_0019193 | Ga0496115_0019193_4272_4571 | 99 |
| 1030 | 3300048918 | Ga0496115_0178180 | Ga0496115_0178180_195_494 | 99 |
| 1031 | 3300048918 | Ga0496115_0235723 | Ga0496115_0235723_662_961 | 99 |
| 1032 | 3300049571 | Ga0501034_0101789 | Ga0501034_0101789_1329_1628 | 99 |
| 1033 | 3300049580 | Ga0501046_0700966 | Ga0501046_0700966_130_429 | 99 |
| 1034 | 3300049581 | Ga0501047_0359030 | Ga0501047_0359030_453_752 | 99 |
| 1035 | 3300049583 | Ga0501067_0020546 | Ga0501067_0020546_1828_2127 | 99 |
| 1036 | 3300049583 | Ga0501067_0044763 | Ga0501067_0044763_2109_2408 | 99 |
| 1037 | 3300049583 | Ga0501067_0331713 | Ga0501067_0331713_250_549 | 99 |
| 1038 | 3300049583 | Ga0501067_0802267 | Ga0501067_0802267_134_433 | 99 |
| 1039 | 3300049585 | Ga0501069_0017354 | Ga0501069_0017354_2191_2490 | 99 |
| 1040 | 3300049585 | Ga0501069_0332749 | Ga0501069_0332749_40_339 | 99 |
| 1041 | 3300049586 | Ga0501070_0013851 | Ga0501070_0013851_5835_6134 | 99 |
| 1042 | 3300049586 | Ga0501070_0184081 | Ga0501070_0184081_562_861 | 99 |
| 1043 | 3300049586 | Ga0501070_1303878 | Ga0501070_1303878_43_342 | 99 |
| 1044 | 3300049588 | Ga0501072_0001288 | Ga0501072_0001288_6877_7176 | 99 |
| 1045 | 3300049589 | Ga0501073_0099410 | Ga0501073_0099410_1247_1546 | 99 |
| 1046 | 3300049590 | Ga0501074_0117305 | Ga0501074_0117305_568_867 | 99 |
| 1047 | 3300049592 | Ga0501076_0478579 | Ga0501076_0478579_508_807 | 99 |
| 1048 | 3300049741 | Ga0501079_0111747 | Ga0501079_0111747_1136_1435 | 99 |
| 1049 | 3300049742 | Ga0501080_0000892 | Ga0501080_0000892_5109_5408 | 99 |
| 1050 | 3300049742 | Ga0501080_0037995 | Ga0501080_0037995_704_1003 | 99 |
| 1051 | 3300049744 | Ga0501083_0006059 | Ga0501083_0006059_5890_6189 | 99 |
| 1052 | 3300049823 | Ga0501044_0780232 | Ga0501044_0780232_45_344 | 99 |
| 1053 | 3300050490 | nmdc:mga03n38_302356_c1 | nmdc:mga03n38_302356_c1_153_452 | 99 |
| 1054 | 3300050507 | nmdc:mga05p37_1025570_c1 | nmdc:mga05p37_1025570_c1_548_847 | 99 |
| 1055 | 3300050511 | nmdc:mga08y16_25535_c1 | nmdc:mga08y16_25535_c1_2270_2569 | 99 |
| 1056 | 3300050512 | nmdc:mga0n895_294034_c1 | nmdc:mga0n895_294034_c1_177_476 | 99 |
| 1057 | 3300050512 | nmdc:mga0n895_655801_c1 | nmdc:mga0n895_655801_c1_316_615 | 99 |
| 1058 | 3300050513 | nmdc:mga0rr50_561516_c1 | nmdc:mga0rr50_561516_c1_90_389 | 99 |
| 1059 | 3300053077 | Ga0495601_0000275 | Ga0495601_0000275_3025_3324 | 99 |
| 1060 | 3300053077 | Ga0495601_0008713 | Ga0495601_0008713_24_323 | 99 |
| 1061 | 3300053077 | Ga0495601_0013067 | Ga0495601_0013067_4594_4893 | 99 |
| 1062 | 3300053077 | Ga0495601_0034241 | Ga0495601_0034241_2809_3108 | 99 |
| 1063 | 3300053077 | Ga0495601_0050954 | Ga0495601_0050954_286_585 | 99 |
| 1064 | 3300053077 | Ga0495601_0191990 | Ga0495601_0191990_786_1085 | 99 |
| 1065 | 3300053078 | Ga0495612_0001639 | Ga0495612_0001639_5338_5637 | 99 |
| 1066 | 3300053078 | Ga0495612_0157862 | Ga0495612_0157862_462_761 | 99 |
| 1067 | 3300053078 | Ga0495612_0320397 | Ga0495612_0320397_348_647 | 99 |
| 1068 | 3300053084 | Ga0495595_0029535 | Ga0495595_0029535_568_867 | 99 |
| 1069 | 3300053084 | Ga0495595_0032339 | Ga0495595_0032339_1804_2103 | 99 |
| 1070 | 3300053084 | Ga0495595_0059926 | Ga0495595_0059926_986_1288 | 99 |
| 1071 | 3300053084 | Ga0495595_0366164 | Ga0495595_0366164_351_650 | 99 |
| 1072 | 3300053084 | Ga0495595_0501460 | Ga0495595_0501460_184_483 | 99 |
| 1073 | 3300053085 | Ga0495619_0003160 | Ga0495619_0003160_8580_8879 | 99 |
| 1074 | 3300053085 | Ga0495619_0008123 | Ga0495619_0008123_4421_4720 | 99 |
| 1075 | 3300053085 | Ga0495619_0026190 | Ga0495619_0026190_2183_2482 | 99 |
| 1076 | 3300053085 | Ga0495619_0081911 | Ga0495619_0081911_548_847 | 99 |
| 1077 | 3300053085 | Ga0495619_0115270 | Ga0495619_0115270_224_523 | 99 |
| 1078 | 3300053085 | Ga0495619_0576749 | Ga0495619_0576749_263_562 | 99 |
| 1079 | 3300053085 | Ga0495619_0756844 | Ga0495619_0756844_43_342 | 99 |
| 1080 | 3300053094 | Ga0500566_0093612 | Ga0500566_0093612_626_925 | 99 |
| 1081 | 3300054114 | Ga0501084_0328382 | Ga0501084_0328382_635_934 | 99 |
| 1082 | 3300059625 | Ga0587113_048470 | Ga0587113_048470_166_465 | 99 |
| 1083 | 3300059628 | Ga0587122_047712 | Ga0587122_047712_79_378 | 99 |
| 1084 | 3300059644 | Ga0587075_144779 | Ga0587075_144779_156_455 | 99 |
| 1085 | 3300059655 | Ga0587114_135536 | Ga0587114_135536_143_442 | 99 |
| 1086 | 3300060346 | Ga0587111_0181311 | Ga0587111_0181311_151_450 | 99 |
| 1087 | 3300060346 | Ga0587111_0205363 | Ga0587111_0205363_116_415 | 99 |
| 1088 | 3300061719 | Ga0466962_0001252 | Ga0466962_0001252_6045_6344 | 99 |
| 1089 | 3300061719 | Ga0466962_0014341 | Ga0466962_0014341_919_1218 | 99 |
| 1090 | 3300061719 | Ga0466962_0046681 | Ga0466962_0046681_664_963 | 99 |
| 1091 | 3300061719 | Ga0466962_0070582 | Ga0466962_0070582_337_663 | 99 |
| 1092 | 3300061719 | Ga0466962_0079600 | Ga0466962_0079600_29_328 | 99 |
| 1093 | 3300061719 | Ga0466962_0235317 | Ga0466962_0235317_311_610 | 99 |
| 1094 | 3300061719 | Ga0466962_0615554 | Ga0466962_0615554_158_457 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cu6-assembly1.cif.gz_A | crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 | 0.8803 | 5 | 92 |
| 1wcj-assembly1.cif.gz_A | conserved hypothetical protein tm0487 from thermotoga maritima | 0.8701 | 2 | 97 |
| 3cq2-assembly1.cif.gz_B | structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 | 0.8651 | 5 | 97 |
| 3lno-assembly1.cif.gz_A | crystal structure of domain of unknown function duf59 from bacillus anthracis | 0.8537 | 4 | 99 |
| 2cu6-assembly1.cif.gz_A | crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 | 0.8448 | 5 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0JJS8_71_163_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9195 | 4 | 81 | 3.30.300.130 |
| af_Q2FZT0_1_88_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9057 | 13 | 97 | 3.30.300.130 |
| af_Q8II78_18_117_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9033 | 4 | 81 | 3.30.300.130 |
| 1wcjA00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.8701 | 2 | 97 | 3.30.300.130 |
| af_Q2FZT0_1_88_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.8674 | 13 | 97 | 3.30.300.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7PWA1-F1-model_v4 | MIP18 family-like domain-containing protein | 0.9789 | 1 | 76 |
|
| AF-A0A3N5X0N5-F1-model_v4 | MRP family ATP-binding protein | 0.9779 | 1 | 77 |
GO:0005524
GO:0016226 GO:0046872 GO:0051539 GO:0140663 |
| AF-A0A352L083-F1-model_v4 | MIP18 family-like domain-containing protein | 0.9754 | 1 | 79 |
|
| AF-A0A538EI59-F1-model_v4 | Metal-sulfur cluster assembly factor | 0.974 | 1 | 76 |
|
| AF-A0A7C5YHH7-F1-model_v4 | Iron-sulfur cluster carrier protein | 0.9713 | 2 | 78 |
GO:0005524
GO:0016226 GO:0016887 GO:0046872 GO:0051539 GO:0140663 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar