F489941

General Info

Members Datasets Scaffolds Average Seq Length
1094 314 1094 99

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10992159|Ga0207712_109921592
Length 99
Sequence MTSPTREDVIEALRQVEDPELGMDIVDLGLLYDVEVAGAKVKVTHSLTSMGCPAGPMIQEDIHRVVADLGVDDVEIDLTWDPPWTPDRMSEDAKFILGF

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
143 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
147 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
148 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
303 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
314 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 1.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 10.51
Rhizosphere 88.94
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10182417 3300003323 Bacteria 2601
2 Ga0070658_10054511 3300005327 Bacteria 3247
3 Ga0070658_10182619 3300005327 Bacteria 1765
4 Ga0070683_100021983 3300005329 Bacteria 5695
5 Ga0070683_100037771 3300005329 Bacteria 4422
6 Ga0070683_100058070 3300005329 Bacteria 3595
7 Ga0070683_100158239 3300005329 Bacteria 2149
8 Ga0070683_100176387 3300005329 Bacteria 2029
9 Ga0070683_100332332 3300005329 Bacteria 1447
10 Ga0070690_100394324 3300005330 Bacteria 1015
11 Ga0068869_100749878 3300005334 Unclassified 836
12 Ga0070680_100100044 3300005336 Bacteria 2406
13 Ga0070682_100031764 3300005337 Unclassified 3196
14 Ga0070682_100057409 3300005337 Bacteria 2452
15 Ga0070682_100212174 3300005337 Unclassified 1373
16 Ga0068868_100125953 3300005338 Bacteria 2093
17 Ga0068868_101420324 3300005338 Unclassified 648
18 Ga0070660_100004655 3300005339 Bacteria 9496
19 Ga0070660_100011588 3300005339 Bacteria 6273
20 Ga0070660_100054116 3300005339 Bacteria 3098
21 Ga0070660_100268286 3300005339 Bacteria 1394
22 Ga0070689_100386077 3300005340 Bacteria 1181
23 Ga0070661_100148351 3300005344 Bacteria 1772
24 Ga0070661_100179146 3300005344 Bacteria 1612
25 Ga0070661_100988022 3300005344 Unclassified 698
26 Ga0070675_101408318 3300005354 Bacteria 643
27 Ga0070671_100008449 3300005355 Bacteria 8253
28 Ga0070671_100279396 3300005355 Bacteria 1420
29 Ga0070673_100623936 3300005364 Bacteria 985
30 Ga0070659_100352978 3300005366 Bacteria 1234
31 Ga0070659_100562720 3300005366 Unclassified 977
32 Ga0070659_100663549 3300005366 Bacteria 900
33 Ga0070659_101746678 3300005366 Unclassified 557
34 Ga0070709_10015673 3300005434 Bacteria 4316
35 Ga0070709_10044135 3300005434 Bacteria 2759
36 Ga0070709_10227194 3300005434 Unclassified 1334
37 Ga0070709_11030388 3300005434 Unclassified 656
38 Ga0070714_100038691 3300005435 Bacteria 4011
39 Ga0070714_100042803 3300005435 Bacteria 3827
40 Ga0070714_100058761 3300005435 Bacteria 3296
41 Ga0070714_100104028 3300005435 Unclassified 2505
42 Ga0070714_100363670 3300005435 Bacteria 1361
43 Ga0070714_100380543 3300005435 Bacteria 1331
44 Ga0070714_100445438 3300005435 Bacteria 1229
45 Ga0070714_100514422 3300005435 Bacteria 1143
46 Ga0070714_100652924 3300005435 Bacteria 1013
47 Ga0070714_100655966 3300005435 Bacteria 1010
48 Ga0070714_102504515 3300005435 Unclassified 501
49 Ga0070713_100001203 3300005436 Bacteria 16520
50 Ga0070713_100002241 3300005436 Bacteria 12548
51 Ga0070713_100108459 3300005436 Bacteria 2417
52 Ga0070713_100333447 3300005436 Bacteria 1404
53 Ga0070713_100820882 3300005436 Unclassified 892
54 Ga0070713_101034041 3300005436 Bacteria 793
55 Ga0070710_10029016 3300005437 Bacteria 2964
56 Ga0070701_10286859 3300005438 Bacteria 1007
57 Ga0070711_100626229 3300005439 Bacteria 900
58 Ga0070711_100903416 3300005439 Unclassified 754
59 Ga0070711_101280849 3300005439 Bacteria 636
60 Ga0070705_100182751 3300005440 Unclassified 1422
61 Ga0070705_101597235 3300005440 Bacteria 549
62 Ga0070705_101850306 3300005440 Unclassified 513
63 Ga0070708_100413026 3300005445 Bacteria 1273
64 Ga0070663_100536657 3300005455 Bacteria 976
65 Ga0070678_100113271 3300005456 Bacteria 2126
66 Ga0070678_100694726 3300005456 Unclassified 916
67 Ga0070678_101271716 3300005456 Bacteria 684
68 Ga0070681_10076535 3300005458 Bacteria 3304
69 Ga0070681_10170989 3300005458 Bacteria 2095
70 Ga0070681_10215813 3300005458 Unclassified 1834
71 Ga0070681_10295237 3300005458 Bacteria 1530
72 Ga0070681_10464904 3300005458 Bacteria 1178
73 Ga0070681_10716761 3300005458 Unclassified 916
74 Ga0068867_100110603 3300005459 Bacteria 2111
75 Ga0070706_100575867 3300005467 Bacteria 1047
76 Ga0070706_101437744 3300005467 Bacteria 631
77 Ga0070707_100030113 3300005468 Bacteria 5164
78 Ga0070707_100207249 3300005468 Bacteria 1911
79 Ga0070707_100270671 3300005468 Unclassified 1651
80 Ga0070707_100279985 3300005468 Bacteria 1621
81 Ga0070698_100093650 3300005471 Bacteria 2984
82 Ga0070698_100099098 3300005471 Bacteria 2888
83 Ga0070698_100186057 3300005471 Bacteria 2015
84 Ga0070699_100120520 3300005518 Bacteria 2306
85 Ga0070699_100490186 3300005518 Bacteria 1116
86 Ga0070699_101147556 3300005518 Unclassified 713
87 Ga0070679_100077669 3300005530 Bacteria 3310
88 Ga0070679_100165280 3300005530 Bacteria 2186
89 Ga0070679_100363496 3300005530 Bacteria 1394
90 Ga0070679_100647073 3300005530 Unclassified 1000
91 Ga0070684_100201362 3300005535 Bacteria 1813
92 Ga0070684_100228248 3300005535 Bacteria 1700
93 Ga0070684_100282112 3300005535 Unclassified 1522
94 Ga0070684_100563308 3300005535 Bacteria 1058
95 Ga0070684_100884080 3300005535 Unclassified 837
96 Ga0070697_100648554 3300005536 Bacteria 930
97 Ga0070697_101751406 3300005536 Bacteria 556
98 Ga0070695_100002173 3300005545 Bacteria 11236
99 Ga0070695_100367759 3300005545 Bacteria 1082
100 Ga0070696_100276356 3300005546 Bacteria 1279
101 Ga0070693_100255798 3300005547 Bacteria 1163
102 Ga0070693_100277951 3300005547 Bacteria 1120
103 Ga0070704_100023732 3300005549 Bacteria 4013
104 Ga0070704_100700987 3300005549 Unclassified 898
105 Ga0070704_100843591 3300005549 Unclassified 821
106 Ga0070704_101737097 3300005549 Bacteria 577
107 Ga0068855_100040522 3300005563 Bacteria 5528
108 Ga0068855_100406343 3300005563 Bacteria 1491
109 Ga0070664_100486334 3300005564 Bacteria 1136
110 Ga0068857_100599808 3300005577 Bacteria 1041
111 Ga0068857_102189640 3300005577 Bacteria 543
112 Ga0068854_100564760 3300005578 Bacteria 967
113 Ga0068856_100027109 3300005614 Bacteria 5589
114 Ga0068856_100398044 3300005614 Bacteria 1397
115 Ga0068856_100614668 3300005614 Bacteria 1108
116 Ga0068856_101153891 3300005614 Unclassified 791
117 Ga0070702_100197513 3300005615 Bacteria 1329
118 Ga0068852_100376413 3300005616 Bacteria 1392
119 Ga0068852_102150848 3300005616 Bacteria 580
120 Ga0068859_101892550 3300005617 Unclassified 659
121 Ga0068864_101400398 3300005618 Unclassified 701
122 Ga0068851_10588691 3300005834 Unclassified 676
123 Ga0068870_10146188 3300005840 Bacteria 1388
124 Ga0068863_100523911 3300005841 Bacteria 1169
125 Ga0068863_100871309 3300005841 Bacteria 900
126 Ga0081455_10012981 3300005937 Bacteria 8262
127 Ga0081538_10016286 3300005981 Bacteria 5708
128 Ga0081539_10002873 3300005985 Bacteria 22878
129 Ga0081539_10192609 3300005985 Bacteria 948
130 Ga0070717_10012964 3300006028 Bacteria 6367
131 Ga0070717_10020908 3300006028 Bacteria 5152
132 Ga0070717_10023774 3300006028 Bacteria 4860
133 Ga0070717_10105783 3300006028 Bacteria 2395
134 Ga0070717_10306021 3300006028 Bacteria 1413
135 Ga0070717_11573191 3300006028 Bacteria 596
136 Ga0075363_100352105 3300006048 Unclassified 860
137 Ga0070715_10014573 3300006163 Bacteria 2914
138 Ga0070716_100020680 3300006173 Bacteria 3457
139 Ga0070716_100047188 3300006173 Bacteria 2428
140 Ga0070712_100174603 3300006175 Bacteria 1670
141 Ga0070712_100225115 3300006175 Unclassified 1487
142 Ga0070712_100313291 3300006175 Unclassified 1274
143 Ga0070712_100332211 3300006175 Bacteria 1239
144 Ga0097621_101272763 3300006237 Bacteria 694
145 Ga0068871_100211151 3300006358 Bacteria 1679
146 Ga0068871_100317163 3300006358 Unclassified 1372
147 Ga0075428_100523095 3300006844 Bacteria 1269
148 Ga0075434_100008073 3300006871 Bacteria 9761
149 Ga0075434_100112032 3300006871 Bacteria 2740
150 Ga0075436_100000414 3300006914 Bacteria 27543
151 Ga0075436_100506705 3300006914 Unclassified 883
152 Ga0097620_101892718 3300006931 Unclassified 659
153 Ga0075435_100024379 3300007076 Bacteria 4694
154 Ga0105240_10007770 3300009093 Bacteria 15505
155 Ga0105240_10095737 3300009093 Bacteria 3619
156 Ga0105240_10299716 3300009093 Bacteria 1839
157 Ga0105240_10985015 3300009093 Bacteria 902
158 Ga0105240_11518419 3300009093 Bacteria 702
159 Ga0111539_10025766 3300009094 Bacteria 7203
160 Ga0111539_10444558 3300009094 Unclassified 1510
161 Ga0105245_10056221 3300009098 Bacteria 3536
162 Ga0105245_10125540 3300009098 Bacteria 2402
163 Ga0105245_10586584 3300009098 Bacteria 1140
164 Ga0105245_10601252 3300009098 Unclassified 1126
165 Ga0105245_11146643 3300009098 Bacteria 824
166 Ga0105247_10049827 3300009101 Bacteria 2576
167 Ga0105247_10565844 3300009101 Unclassified 838
168 Ga0114129_10387450 3300009147 Bacteria 1844
169 Ga0105241_10232854 3300009174 Bacteria 1553
170 Ga0105241_11898426 3300009174 Bacteria 584
171 Ga0105242_11225859 3300009176 Unclassified 771
172 Ga0105242_12792636 3300009176 Unclassified 539
173 Ga0105248_10066829 3300009177 Bacteria 4036
174 Ga0105248_11246020 3300009177 Unclassified 841
175 Ga0105248_12173912 3300009177 Unclassified 631
176 Ga0105248_12731449 3300009177 Unclassified 563
177 Ga0105237_10032857 3300009545 Bacteria 5253
178 Ga0105237_10359809 3300009545 Unclassified 1459
179 Ga0105237_11657521 3300009545 Bacteria 647
180 Ga0105238_10041072 3300009551 Bacteria 4686
181 Ga0105238_10149087 3300009551 Bacteria 2315
182 Ga0105238_10936829 3300009551 Unclassified 885
183 Ga0105238_11215201 3300009551 Bacteria 778
184 Ga0105238_11264766 3300009551 Bacteria 763
185 Ga0105249_10566523 3300009553 Bacteria 1188
186 Ga0105239_10338305 3300010375 Bacteria 1698
187 Ga0105239_11257004 3300010375 Unclassified 854
188 Ga0105246_10498170 3300011119 Bacteria 1034
189 Ga0105246_10638103 3300011119 Bacteria 925
190 Ga0157326_1085520 3300012513 Bacteria 523
191 Ga0157373_10213475 3300013100 Bacteria 1361
192 Ga0157373_10323680 3300013100 Bacteria 1097
193 Ga0157371_10233720 3300013102 Bacteria 1322
194 Ga0157371_10337998 3300013102 Bacteria 1095
195 Ga0157371_10610075 3300013102 Bacteria 812
196 Ga0157370_10012477 3300013104 Bacteria 8807
197 Ga0157370_10249700 3300013104 Bacteria 1641
198 Ga0157370_10578765 3300013104 Bacteria 1029
199 Ga0157369_10044290 3300013105 Bacteria 4844
200 Ga0157369_10077272 3300013105 Bacteria 3568
201 Ga0157369_10138744 3300013105 Bacteria 2573
202 Ga0157369_10267936 3300013105 Unclassified 1780
203 Ga0157369_10707896 3300013105 Unclassified 1037
204 Ga0157369_11171718 3300013105 Bacteria 785
205 Ga0157374_10032819 3300013296 Bacteria 4731
206 Ga0157374_10111411 3300013296 Bacteria 2633
207 Ga0157374_11447452 3300013296 Unclassified 710
208 Ga0157374_12277291 3300013296 Bacteria 569
209 Ga0163162_10213266 3300013306 Bacteria 2061
210 Ga0157372_10174552 3300013307 Bacteria 2487
211 Ga0157372_10250043 3300013307 Bacteria 2058
212 Ga0157372_10290131 3300013307 Bacteria 1903
213 Ga0157372_10401669 3300013307 Bacteria 1597
214 Ga0157372_10633548 3300013307 Bacteria 1245
215 Ga0157372_11173770 3300013307 Bacteria 887
216 Ga0157372_11282877 3300013307 Bacteria 845
217 Ga0157372_12861775 3300013307 Bacteria 553
218 Ga0157375_11403085 3300013308 Unclassified 823
219 Ga0182008_10002395 3300014497 Bacteria 11786
220 Ga0182008_10067351 3300014497 Bacteria 1762
221 Ga0182008_10233466 3300014497 Bacteria 944
222 Ga0182008_10241219 3300014497 Unclassified 930
223 Ga0157377_10183641 3300014745 Bacteria 1317
224 Ga0157377_10398077 3300014745 Unclassified 937
225 Ga0157379_11880679 3300014968 Unclassified 589
226 Ga0157379_12206874 3300014968 Unclassified 547
227 Ga0157376_10018483 3300014969 Bacteria 5346
228 Ga0157376_11443710 3300014969 Unclassified 720
229 Ga0182006_1007014 3300015261 Bacteria 5187
230 Ga0182006_1300790 3300015261 Bacteria 527
231 Ga0182007_10012095 3300015262 Bacteria 3332
232 Ga0182007_10310654 3300015262 Bacteria 581
233 Ga0163161_10112500 3300017792 Bacteria 2037
234 Ga0197907_10283293 3300020069 Bacteria 760
235 Ga0197907_10461500 3300020069 Unclassified 726
236 Ga0206356_10864395 3300020070 Bacteria 620
237 Ga0206356_10933417 3300020070 Unclassified 535
238 Ga0206356_11619042 3300020070 Bacteria 8693
239 Ga0206356_11789295 3300020070 Unclassified 1629
240 Ga0206354_11139136 3300020081 Bacteria 2169
241 Ga0206354_11487989 3300020081 Bacteria 878
242 Ga0206353_10752732 3300020082 Bacteria 9937
243 Ga0206353_10914373 3300020082 Bacteria 1140
244 Ga0206353_10953357 3300020082 Bacteria 8226
245 Ga0154015_1573975 3300020610 Bacteria 902
246 Ga0213871_10093261 3300021441 Unclassified 874
247 Ga0224712_10003063 3300022467 Bacteria 4265
248 Ga0224712_10071764 3300022467 Unclassified 1408
249 Ga0207692_10015333 3300025898 Bacteria 3369
250 Ga0207710_10471995 3300025900 Unclassified 649
251 Ga0207685_10000585 3300025905 Bacteria 6339
252 Ga0207699_10055108 3300025906 Bacteria 2364
253 Ga0207699_10441744 3300025906 Unclassified 932
254 Ga0207699_10477751 3300025906 Bacteria 897
255 Ga0207643_10307168 3300025908 Unclassified 988
256 Ga0207705_10026024 3300025909 Bacteria 4175
257 Ga0207705_10037406 3300025909 Bacteria 3473
258 Ga0207705_10039859 3300025909 Bacteria 3367
259 Ga0207705_10109232 3300025909 Bacteria 2042
260 Ga0207705_10206687 3300025909 Bacteria 1488
261 Ga0207684_10485875 3300025910 Bacteria 1059
262 Ga0207684_10958173 3300025910 Bacteria 717
263 Ga0207654_10434537 3300025911 Unclassified 918
264 Ga0207654_11291441 3300025911 Unclassified 532
265 Ga0207707_10046974 3300025912 Bacteria 3760
266 Ga0207707_10086041 3300025912 Bacteria 2747
267 Ga0207707_10086836 3300025912 Bacteria 2733
268 Ga0207707_10192791 3300025912 Bacteria 1777
269 Ga0207707_11047522 3300025912 Bacteria 667
270 Ga0207707_11387733 3300025912 Unclassified 561
271 Ga0207695_10020007 3300025913 Bacteria 7682
272 Ga0207695_10229159 3300025913 Unclassified 1763
273 Ga0207693_10002991 3300025915 Bacteria 14628
274 Ga0207693_10183195 3300025915 Bacteria 1648
275 Ga0207693_10458463 3300025915 Bacteria 996
276 Ga0207693_10655023 3300025915 Bacteria 815
277 Ga0207693_10757545 3300025915 Unclassified 750
278 Ga0207693_10921310 3300025915 Unclassified 670
279 Ga0207663_10025210 3300025916 Bacteria 3434
280 Ga0207663_10217378 3300025916 Bacteria 1389
281 Ga0207663_11074144 3300025916 Unclassified 647
282 Ga0207660_10011588 3300025917 Bacteria 5746
283 Ga0207660_10065159 3300025917 Bacteria 2632
284 Ga0207660_10209421 3300025917 Bacteria 1526
285 Ga0207660_10315776 3300025917 Bacteria 1247
286 Ga0207660_11699179 3300025917 Unclassified 508
287 Ga0207657_10007972 3300025919 Bacteria 10797
288 Ga0207657_10011057 3300025919 Bacteria 8972
289 Ga0207657_10017187 3300025919 Bacteria 6949
290 Ga0207657_10070513 3300025919 Bacteria 2962
291 Ga0207657_10338694 3300025919 Bacteria 1187
292 Ga0207649_10029273 3300025920 Bacteria 3252
293 Ga0207649_10171989 3300025920 Bacteria 1510
294 Ga0207652_10153809 3300025921 Bacteria 2060
295 Ga0207652_10191058 3300025921 Bacteria 1842
296 Ga0207652_10202188 3300025921 Bacteria 1788
297 Ga0207652_10500455 3300025921 Bacteria 1094
298 Ga0207652_10590565 3300025921 Unclassified 996
299 Ga0207652_11169981 3300025921 Bacteria 670
300 Ga0207646_10215625 3300025922 Bacteria 1734
301 Ga0207646_10225468 3300025922 Bacteria 1693
302 Ga0207646_10304218 3300025922 Bacteria 1441
303 Ga0207646_10441760 3300025922 Bacteria 1174
304 Ga0207646_10553132 3300025922 Unclassified 1035
305 Ga0207646_10797825 3300025922 Bacteria 841
306 Ga0207694_10083135 3300025924 Bacteria 2517
307 Ga0207694_11460793 3300025924 Bacteria 577
308 Ga0207687_10039659 3300025927 Bacteria 3225
309 Ga0207687_10354716 3300025927 Unclassified 1196
310 Ga0207687_10428304 3300025927 Bacteria 1093
311 Ga0207687_10730028 3300025927 Bacteria 842
312 Ga0207700_10000002 3300025928 Bacteria 775978
313 Ga0207700_10047743 3300025928 Bacteria 3175
314 Ga0207700_10302606 3300025928 Unclassified 1381
315 Ga0207700_11206905 3300025928 Bacteria 675
316 Ga0207700_11416250 3300025928 Unclassified 618
317 Ga0207664_10006174 3300025929 Bacteria 8220
318 Ga0207664_10032406 3300025929 Bacteria 4004
319 Ga0207664_10039220 3300025929 Bacteria 3677
320 Ga0207664_10039805 3300025929 Bacteria 3650
321 Ga0207664_10048590 3300025929 Bacteria 3337
322 Ga0207664_10106287 3300025929 Bacteria 2327
323 Ga0207664_10113318 3300025929 Unclassified 2258
324 Ga0207664_10127435 3300025929 Bacteria 2138
325 Ga0207664_10190821 3300025929 Bacteria 1764
326 Ga0207664_10273944 3300025929 Bacteria 1479
327 Ga0207664_10293628 3300025929 Bacteria 1429
328 Ga0207664_10749569 3300025929 Bacteria 878
329 Ga0207664_11222614 3300025929 Bacteria 670
330 Ga0207664_11818597 3300025929 Bacteria 532
331 Ga0207664_11975302 3300025929 Bacteria 506
332 Ga0207644_10072648 3300025931 Bacteria 2520
333 Ga0207644_10511805 3300025931 Unclassified 991
334 Ga0207690_10352695 3300025932 Unclassified 1164
335 Ga0207686_10681625 3300025934 Unclassified 816
336 Ga0207704_10947747 3300025938 Unclassified 726
337 Ga0207665_10000336 3300025939 Bacteria 32436
338 Ga0207665_10014097 3300025939 Bacteria 5259
339 Ga0207665_10697408 3300025939 Bacteria 798
340 Ga0207711_11931514 3300025941 Unclassified 533
341 Ga0207661_10082972 3300025944 Unclassified 2651
342 Ga0207661_10087031 3300025944 Bacteria 2594
343 Ga0207661_10091855 3300025944 Bacteria 2530
344 Ga0207661_10322409 3300025944 Unclassified 1389
345 Ga0207661_10399644 3300025944 Bacteria 1246
346 Ga0207661_10571805 3300025944 Bacteria 1036
347 Ga0207661_10801812 3300025944 Bacteria 867
348 Ga0207661_11885971 3300025944 Unclassified 543
349 Ga0207667_10168616 3300025949 Bacteria 2250
350 Ga0207667_10442639 3300025949 Bacteria 1321
351 Ga0207667_11408199 3300025949 Bacteria 670
352 Ga0207712_10820122 3300025961 Unclassified 819
353 Ga0207712_10992159 3300025961 Bacteria 745
354 Ga0207640_10638152 3300025981 Bacteria 906
355 Ga0207677_11084247 3300026023 Unclassified 729
356 Ga0207639_10539343 3300026041 Bacteria 1070
357 Ga0207639_12032513 3300026041 Bacteria 536
358 Ga0207678_10102549 3300026067 Bacteria 2442
359 Ga0207678_11501939 3300026067 Bacteria 595
360 Ga0207702_10165361 3300026078 Bacteria 2023
361 Ga0207702_10279925 3300026078 Bacteria 1576
362 Ga0207702_10398619 3300026078 Unclassified 1327
363 Ga0207702_10448189 3300026078 Bacteria 1252
364 Ga0207702_11085560 3300026078 Unclassified 794
365 Ga0207702_11402579 3300026078 Unclassified 692
366 Ga0207676_10158246 3300026095 Bacteria 1960
367 Ga0207676_11576823 3300026095 Unclassified 654
368 Ga0207674_10034379 3300026116 Bacteria 5299
369 Ga0207674_10526597 3300026116 Bacteria 1142
370 Ga0207674_11905607 3300026116 Bacteria 560
371 Ga0207683_10252452 3300026121 Bacteria 1610
372 Ga0207683_10427060 3300026121 Bacteria 1221
373 Ga0207683_11617933 3300026121 Bacteria 597
374 Ga0207683_11857800 3300026121 Bacteria 551
375 Ga0207698_10066518 3300026142 Bacteria 2837
376 Ga0207698_10075391 3300026142 Bacteria 2696
377 Ga0207428_10029986 3300027907 Bacteria 4500
378 Ga0265337_1068031 3300028556 Bacteria 981
379 Ga0265319_1007014 3300028563 Bacteria 5123
380 Ga0265319_1045523 3300028563 Unclassified 1466
381 Ga0265319_1065316 3300028563 Bacteria 1173
382 Ga0265319_1274886 3300028563 Bacteria 512
383 Ga0265334_10002797 3300028573 Bacteria 8049
384 Ga0265334_10032929 3300028573 Bacteria 2064
385 Ga0265334_10205416 3300028573 Bacteria 683
386 Ga0265334_10261808 3300028573 Bacteria 594
387 Ga0265318_10000604 3300028577 Bacteria 25020
388 Ga0265318_10000968 3300028577 Bacteria 18432
389 Ga0265318_10065658 3300028577 Bacteria 1349
390 Ga0265318_10129217 3300028577 Bacteria 929
391 Ga0265323_10036409 3300028653 Bacteria 1809
392 Ga0265322_10009234 3300028654 Bacteria 2863
393 Ga0265322_10128455 3300028654 Bacteria 723
394 Ga0265322_10158670 3300028654 Unclassified 647
395 Ga0265322_10213306 3300028654 Bacteria 553
396 Ga0265336_10018326 3300028666 Bacteria 2269
397 Ga0265336_10076088 3300028666 Bacteria 1002
398 Ga0265336_10115943 3300028666 Bacteria 798
399 Ga0265336_10174194 3300028666 Bacteria 640
400 Ga0265336_10205984 3300028666 Bacteria 584
401 Ga0265338_10003462 3300028800 Bacteria 22216
402 Ga0265338_10005686 3300028800 Bacteria 16138
403 Ga0265338_10006184 3300028800 Bacteria 15349
404 Ga0265338_10007091 3300028800 Bacteria 14041
405 Ga0265338_10010810 3300028800 Bacteria 10641
406 Ga0265338_10014548 3300028800 Bacteria 8742
407 Ga0265338_10029352 3300028800 Bacteria 5453
408 Ga0265338_10219615 3300028800 Bacteria 1420
409 Ga0265338_10595353 3300028800 Bacteria 770
410 Ga0265324_10080610 3300029957 Bacteria 1107
411 Ga0265324_10128708 3300029957 Bacteria 859
412 Ga0265330_10004102 3300031235 Bacteria 7466
413 Ga0265330_10516806 3300031235 Unclassified 509
414 Ga0265332_10003579 3300031238 Bacteria 7458
415 Ga0265332_10389918 3300031238 Bacteria 575
416 Ga0265328_10003809 3300031239 Bacteria 6627
417 Ga0265320_10003921 3300031240 Bacteria 9831
418 Ga0265320_10004476 3300031240 Bacteria 9158
419 Ga0265320_10051042 3300031240 Bacteria 2009
420 Ga0265325_10006354 3300031241 Bacteria 7183
421 Ga0265325_10076428 3300031241 Bacteria 1671
422 Ga0265325_10110880 3300031241 Bacteria 1333
423 Ga0265329_10003633 3300031242 Bacteria 6660
424 Ga0265329_10034868 3300031242 Bacteria 1625
425 Ga0265340_10005417 3300031247 Bacteria 7091
426 Ga0265339_10016814 3300031249 Bacteria 4350
427 Ga0265339_10061903 3300031249 Bacteria 2012
428 Ga0265339_10413030 3300031249 Bacteria 629
429 Ga0265331_10007022 3300031250 Bacteria 6570
430 Ga0265331_10018747 3300031250 Bacteria 3581
431 Ga0265331_10108254 3300031250 Bacteria 1276
432 Ga0265331_10129465 3300031250 Bacteria 1152
433 Ga0265331_10327769 3300031250 Bacteria 686
434 Ga0265327_10006564 3300031251 Bacteria 9254
435 Ga0265327_10013358 3300031251 Bacteria 5458
436 Ga0265327_10024976 3300031251 Bacteria 3494
437 Ga0265327_10412796 3300031251 Bacteria 585
438 Ga0265316_10002341 3300031344 Bacteria 19753
439 Ga0265316_10107154 3300031344 Bacteria 2119
440 Ga0265316_10329194 3300031344 Bacteria 1108
441 Ga0265316_10971713 3300031344 Bacteria 591
442 Ga0265313_10007877 3300031595 Bacteria 7181
443 Ga0265313_10012894 3300031595 Bacteria 5069
444 Ga0265313_10013344 3300031595 Bacteria 4937
445 Ga0265313_10029304 3300031595 Bacteria 2849
446 Ga0265314_10007984 3300031711 Bacteria 9128
447 Ga0265314_10025861 3300031711 Bacteria 4419
448 Ga0265314_10089993 3300031711 Bacteria 2000
449 Ga0265314_10101987 3300031711 Bacteria 1842
450 Ga0265342_10005023 3300031712 Bacteria 10204
451 Ga0265342_10049105 3300031712 Bacteria 2527
452 Ga0265342_10076530 3300031712 Bacteria 1939
453 Ga0373950_0076174 3300034818 Bacteria 694
454 Ga0373926_0378313 3300035083 Archaea 557
455 Ga0373939_0009501 3300035114 Bacteria 2413
456 Ga0373945_0104171 3300035116 Bacteria 1113
457 Ga0373953_0125925 3300035117 Bacteria 1090
458 Ga0373956_0071452 3300035119 Bacteria 1584
459 Ga0373957_0092945 3300035120 Bacteria 1201
460 Ga0373957_0319511 3300035120 Bacteria 660
461 Ga0373957_0514371 3300035120 Unclassified 522
462 Ga0373960_0022012 3300035121 Bacteria 1702
463 Ga0373960_0040923 3300035121 Bacteria 1340
464 Ga0373960_0196255 3300035121 Bacteria 712
465 Ga0373943_0000829 3300035170 Bacteria 13619
466 Ga0373943_0270295 3300035170 Unclassified 959
467 Ga0373943_0293523 3300035170 Bacteria 922
468 Ga0373955_0019481 3300035172 Bacteria 3393
469 Ga0373955_0221916 3300035172 Bacteria 1129
470 Ga0373955_0901872 3300035172 Unclassified 544
471 Ga0373942_0071180 3300035207 Bacteria 1016
472 Ga0373924_0435236 3300035410 Bacteria 587
473 Ga0373931_0457403 3300035691 Bacteria 817
474 Ga0373931_0458111 3300035691 Bacteria 817
475 Ga0373935_0221248 3300035692 Bacteria 1315
476 Ga0373927_0381012 3300035695 Archaea 930
477 Ga0373933_0036055 3300035724 Bacteria 2893
478 Ga0373933_0646094 3300035724 Unclassified 695
479 Ga0373933_1062572 3300035724 Bacteria 533
480 Ga0373947_0000984 3300035725 Bacteria 17384
481 Ga0373947_0407910 3300035725 Bacteria 917
482 Ga0373947_0496951 3300035725 Bacteria 829
483 Ga0373947_1226988 3300035725 Bacteria 511
484 Ga0373937_0004827 3300036401 Bacteria 11460
485 Ga0373937_0015379 3300036401 Bacteria 6767
486 Ga0373937_0132585 3300036401 Unclassified 2328
487 Ga0373937_1418610 3300036401 Bacteria 642
488 Ga0373925_0010018 3300037068 Bacteria 6883
489 Ga0373925_1291588 3300037068 Bacteria 599
490 Ga0395899_0016363 3300037312 Bacteria 5652
491 Ga0395899_0047945 3300037312 Bacteria 3179
492 Ga0395899_0161295 3300037312 Bacteria 1584
493 Ga0395900_0095627 3300037418 Bacteria 3052
494 Ga0395900_0147160 3300037418 Bacteria 2408
495 Ga0395900_0300820 3300037418 Bacteria 1590
496 Ga0395900_0441507 3300037418 Bacteria 1259
497 Ga0395900_0948931 3300037418 Bacteria 782
498 Ga0395900_1259629 3300037418 Bacteria 654
499 Ga0395898_0029255 3300037466 Bacteria 5519
500 Ga0395898_0089588 3300037466 Bacteria 2960
501 Ga0395898_0105649 3300037466 Bacteria 2700
502 Ga0395898_0136846 3300037466 Bacteria 2345
503 Ga0395898_0303429 3300037466 Bacteria 1523
504 Ga0395898_0365992 3300037466 Bacteria 1375
505 Ga0395898_0726818 3300037466 Bacteria 934
506 Ga0395898_0821786 3300037466 Bacteria 869
507 Ga0395898_1596162 3300037466 Bacteria 577
508 Ga0395898_1700882 3300037466 Bacteria 553
509 Ga0395898_1729812 3300037466 Bacteria 548
510 Ga0395905_0012643 3300037471 Bacteria 8120
511 Ga0395905_0020541 3300037471 Bacteria 6254
512 Ga0395905_0172811 3300037471 Bacteria 2029
513 Ga0395905_1066785 3300037471 Bacteria 711
514 Ga0395901_0085688 3300038443 Bacteria 3293
515 Ga0395901_0104451 3300038443 Bacteria 2973
516 Ga0395901_0206329 3300038443 Bacteria 2058
517 Ga0395901_0210507 3300038443 Bacteria 2035
518 Ga0395901_0311953 3300038443 Bacteria 1629
519 Ga0395901_0395880 3300038443 Bacteria 1419
520 Ga0395901_0815489 3300038443 Unclassified 921
521 Ga0395901_1030888 3300038443 Bacteria 797
522 Ga0395901_1050423 3300038443 Bacteria 788
523 Ga0242420_092276 3300038996 Bacteria 637
524 Ga0436365_0098300 3300039437 Unclassified 544
525 Ga0436360_0759873 3300039438 Bacteria 3368
526 Ga0436360_1273503 3300039438 Bacteria 3604
527 Ga0436363_0525738 3300039450 Bacteria 1238
528 Ga0436362_1298139 3300039453 Bacteria 506
529 Ga0451802_1315935 3300041460 Bacteria 647
530 Ga0439448_0339757 3300042005 Bacteria 535
531 Ga0450907_089521 3300042146 Bacteria 535
532 Ga0466969_0008320 3300044656 Bacteria 5502
533 Ga0466969_0028314 3300044656 Bacteria 2864
534 Ga0466969_0079059 3300044656 Bacteria 1572
535 Ga0466969_0093558 3300044656 Bacteria 1422
536 Ga0466969_0204172 3300044656 Bacteria 901
537 Ga0466965_0006762 3300044683 Bacteria 5234
538 Ga0466965_0047491 3300044683 Unclassified 2126
539 Ga0466965_0582917 3300044683 Unclassified 634
540 Ga0466965_0624773 3300044683 Bacteria 613
541 Ga0466966_0010121 3300044684 Bacteria 6256
542 Ga0466966_0027613 3300044684 Bacteria 3699
543 Ga0466966_0332827 3300044684 Bacteria 912
544 Ga0466966_0941860 3300044684 Unclassified 521
545 Ga0466961_0002598 3300044693 Bacteria 11208
546 Ga0466961_0009627 3300044693 Bacteria 6151
547 Ga0466961_0011449 3300044693 Bacteria 5673
548 Ga0466961_0029655 3300044693 Bacteria 3515
549 Ga0466961_0305177 3300044693 Bacteria 972
550 Ga0466961_0369298 3300044693 Bacteria 872
551 Ga0466961_0373865 3300044693 Unclassified 866
552 Ga0466961_0723268 3300044693 Unclassified 596
553 Ga0466961_0739063 3300044693 Bacteria 588
554 Ga0466963_0000638 3300044694 Bacteria 16848
555 Ga0466963_0001960 3300044694 Bacteria 11294
556 Ga0466963_0002419 3300044694 Bacteria 10446
557 Ga0466963_0002874 3300044694 Bacteria 9728
558 Ga0466963_0007500 3300044694 Bacteria 6509
559 Ga0466963_0008277 3300044694 Bacteria 6230
560 Ga0466963_0010088 3300044694 Bacteria 5711
561 Ga0466963_0015895 3300044694 Bacteria 4672
562 Ga0466963_0018310 3300044694 Bacteria 4376
563 Ga0466963_0041043 3300044694 Bacteria 3033
564 Ga0466963_0061838 3300044694 Bacteria 2504
565 Ga0466963_0074842 3300044694 Bacteria 2284
566 Ga0466963_0124604 3300044694 Bacteria 1775
567 Ga0466963_0126152 3300044694 Bacteria 1765
568 Ga0466963_0135344 3300044694 Bacteria 1704
569 Ga0466963_0305487 3300044694 Unclassified 1119
570 Ga0466963_0315279 3300044694 Bacteria 1100
571 Ga0466963_0491748 3300044694 Bacteria 866
572 Ga0466963_0702076 3300044694 Bacteria 714
573 Ga0466963_0733865 3300044694 Bacteria 697
574 Ga0466963_1263664 3300044694 Bacteria 518
575 Ga0466963_1285127 3300044694 Bacteria 514
576 Ga0466963_1290516 3300044694 Bacteria 512
577 Ga0466964_0009667 3300044706 Bacteria 3633
578 Ga0466964_0011996 3300044706 Bacteria 3277
579 Ga0466964_0012986 3300044706 Bacteria 3155
580 Ga0466964_0043632 3300044706 Unclassified 1819
581 Ga0466964_0048436 3300044706 Bacteria 1737
582 Ga0466964_0082260 3300044706 Bacteria 1384
583 Ga0466964_0125995 3300044706 Bacteria 1160
584 Ga0466964_0159160 3300044706 Bacteria 1054
585 Ga0453684_0919400 3300044712 Bacteria 936
586 Ga0466971_0003820 3300044719 Bacteria 6448
587 Ga0466971_0006453 3300044719 Bacteria 5096
588 Ga0466971_0009099 3300044719 Bacteria 4340
589 Ga0466971_0051058 3300044719 Bacteria 1861
590 Ga0466971_0106507 3300044719 Bacteria 1292
591 Ga0466971_0197398 3300044719 Unclassified 949
592 Ga0466971_0201894 3300044719 Bacteria 939
593 Ga0466971_0300313 3300044719 Unclassified 771
594 Ga0466971_0530280 3300044719 Bacteria 583
595 Ga0466968_0007699 3300044735 Unclassified 4102
596 Ga0466968_0007930 3300044735 Bacteria 4055
597 Ga0466968_0104565 3300044735 Bacteria 1267
598 Ga0466968_0110361 3300044735 Bacteria 1236
599 Ga0466968_0138544 3300044735 Bacteria 1111
600 Ga0466968_0235870 3300044735 Unclassified 865
601 Ga0466968_0318970 3300044735 Bacteria 750
602 Ga0466970_0031380 3300044765 Bacteria 2806
603 Ga0466970_0127310 3300044765 Bacteria 1397
604 Ga0466970_0432096 3300044765 Bacteria 754
605 Ga0466970_0837061 3300044765 Bacteria 540
606 Ga0466957_0004248 3300044842 Bacteria 7943
607 Ga0466957_0016146 3300044842 Bacteria 4365
608 Ga0466957_0045674 3300044842 Bacteria 2657
609 Ga0466957_0046935 3300044842 Bacteria 2623
610 Ga0466957_0056358 3300044842 Bacteria 2403
611 Ga0466957_0065101 3300044842 Bacteria 2244
612 Ga0466957_0069326 3300044842 Bacteria 2178
613 Ga0466957_0083788 3300044842 Bacteria 1990
614 Ga0466957_0090534 3300044842 Bacteria 1916
615 Ga0466957_0130720 3300044842 Bacteria 1608
616 Ga0466957_0173250 3300044842 Bacteria 1406
617 Ga0466957_0226265 3300044842 Bacteria 1237
618 Ga0466957_1314679 3300044842 Bacteria 525
619 Ga0466960_0005505 3300044901 Bacteria 5020
620 Ga0466960_0014667 3300044901 Bacteria 3362
621 Ga0466960_0034473 3300044901 Bacteria 2359
622 Ga0466960_0069363 3300044901 Unclassified 1751
623 Ga0466960_0119577 3300044901 Bacteria 1378
624 Ga0466960_0272081 3300044901 Bacteria 947
625 Ga0466960_1007120 3300044901 Bacteria 512
626 Ga0466959_0003027 3300045049 Bacteria 10865
627 Ga0466959_0007099 3300045049 Bacteria 7837
628 Ga0466959_0007785 3300045049 Bacteria 7537
629 Ga0466959_0028569 3300045049 Bacteria 4135
630 Ga0466959_0045281 3300045049 Bacteria 3240
631 Ga0466959_0098643 3300045049 Bacteria 2093
632 Ga0466959_0160810 3300045049 Bacteria 1579
633 Ga0466958_0005189 3300045836 Bacteria 6975
634 Ga0466958_0006933 3300045836 Bacteria 6200
635 Ga0466958_0007722 3300045836 Bacteria 5934
636 Ga0466958_0013137 3300045836 Bacteria 4708
637 Ga0466958_0025514 3300045836 Bacteria 3485
638 Ga0466958_0034967 3300045836 Bacteria 3000
639 Ga0466958_0041133 3300045836 Bacteria 2779
640 Ga0466958_0081052 3300045836 Bacteria 1997
641 Ga0466958_0118993 3300045836 Bacteria 1652
642 Ga0466958_0135384 3300045836 Bacteria 1549
643 Ga0466958_0326158 3300045836 Bacteria 987
644 Ga0466958_0930329 3300045836 Bacteria 567
645 Ga0466967_0000179 3300045976 Bacteria 26199
646 Ga0466967_0001152 3300045976 Bacteria 14777
647 Ga0466967_0004521 3300045976 Bacteria 9404
648 Ga0466967_0010503 3300045976 Bacteria 6951
649 Ga0466967_0010586 3300045976 Bacteria 6929
650 Ga0466967_0013317 3300045976 Bacteria 6349
651 Ga0466967_0014204 3300045976 Bacteria 6192
652 Ga0466967_0016513 3300045976 Bacteria 5825
653 Ga0466967_0016668 3300045976 Bacteria 5802
654 Ga0466967_0018352 3300045976 Bacteria 5588
655 Ga0466967_0027751 3300045976 Bacteria 4713
656 Ga0466967_0031328 3300045976 Bacteria 4476
657 Ga0466967_0052497 3300045976 Bacteria 3578
658 Ga0466967_0063760 3300045976 Bacteria 3275
659 Ga0466967_0080521 3300045976 Bacteria 2939
660 Ga0466967_0083995 3300045976 Bacteria 2880
661 Ga0466967_0124820 3300045976 Unclassified 2383
662 Ga0466967_0143030 3300045976 Bacteria 2229
663 Ga0466967_0153511 3300045976 Bacteria 2154
664 Ga0466967_0168690 3300045976 Unclassified 2058
665 Ga0466967_0176788 3300045976 Bacteria 2011
666 Ga0466967_0183394 3300045976 Bacteria 1975
667 Ga0466967_0188349 3300045976 Bacteria 1949
668 Ga0466967_0189269 3300045976 Bacteria 1944
669 Ga0466967_0227190 3300045976 Bacteria 1776
670 Ga0466967_0233298 3300045976 Bacteria 1753
671 Ga0466967_0243407 3300045976 Unclassified 1716
672 Ga0466967_0327057 3300045976 Bacteria 1480
673 Ga0466967_0332887 3300045976 Bacteria 1466
674 Ga0466967_0337537 3300045976 Bacteria 1456
675 Ga0466967_0388249 3300045976 Bacteria 1356
676 Ga0466967_0595710 3300045976 Unclassified 1091
677 Ga0466967_0629454 3300045976 Bacteria 1060
678 Ga0466967_0730565 3300045976 Bacteria 981
679 Ga0466967_0789590 3300045976 Bacteria 942
680 Ga0466967_1000869 3300045976 Bacteria 832
681 Ga0466967_1062852 3300045976 Bacteria 806
682 Ga0466967_1361528 3300045976 Unclassified 707
683 Ga0466967_1439467 3300045976 Bacteria 686
684 Ga0466967_1637288 3300045976 Bacteria 641
685 Ga0466967_2037987 3300045976 Bacteria 570
686 Ga0466967_2327300 3300045976 Unclassified 531
687 Ga0495592_0000467 3300046454 Bacteria 29720
688 Ga0495592_0004809 3300046454 Bacteria 9927
689 Ga0495592_0038526 3300046454 Bacteria 3596
690 Ga0495592_0524998 3300046454 Bacteria 731
691 Ga0495592_0532538 3300046454 Bacteria 725
692 Ga0495603_0122187 3300046455 Bacteria 1517
693 Ga0495629_0024661 3300046459 Bacteria 4281
694 Ga0495629_0042187 3300046459 Bacteria 3207
695 Ga0495629_0051469 3300046459 Bacteria 2882
696 Ga0495629_0246577 3300046459 Unclassified 1229
697 Ga0495629_0794009 3300046459 Unclassified 625
698 Ga0495641_0032675 3300046461 Bacteria 2475
699 Ga0495641_0048267 3300046461 Bacteria 1952
700 Ga0495641_0065685 3300046461 Bacteria 1633
701 Ga0495641_0100956 3300046461 Bacteria 1287
702 Ga0495641_0156768 3300046461 Bacteria 1018
703 Ga0495641_0194596 3300046461 Unclassified 909
704 Ga0495651_0000621 3300046462 Bacteria 27474
705 Ga0495651_0065300 3300046462 Bacteria 2779
706 Ga0495651_0218634 3300046462 Bacteria 1320
707 Ga0495651_0284014 3300046462 Bacteria 1117
708 Ga0495651_0475159 3300046462 Bacteria 804
709 Ga0495651_0646106 3300046462 Bacteria 664
710 Ga0495651_0791234 3300046462 Archaea 586
711 Ga0495653_0071507 3300046463 Bacteria 2593
712 Ga0495653_0088791 3300046463 Bacteria 2266
713 Ga0495653_0148364 3300046463 Bacteria 1641
714 Ga0495653_0161594 3300046463 Bacteria 1554
715 Ga0495653_0226612 3300046463 Bacteria 1253
716 Ga0495653_0321024 3300046463 Bacteria 1004
717 Ga0495653_0337587 3300046463 Unclassified 972
718 Ga0495653_0350983 3300046463 Bacteria 949
719 Ga0495653_0759791 3300046463 Bacteria 585
720 Ga0495580_0097510 3300046472 Bacteria 2044
721 Ga0495582_0006911 3300046473 Bacteria 6308
722 Ga0495582_0018061 3300046473 Bacteria 3858
723 Ga0495582_0060129 3300046473 Bacteria 2096
724 Ga0495582_0121278 3300046473 Bacteria 1473
725 Ga0495582_0528744 3300046473 Bacteria 682
726 Ga0495582_0737679 3300046473 Bacteria 570
727 Ga0495639_0009136 3300046475 Bacteria 4247
728 Ga0495662_0018780 3300046476 Bacteria 3346
729 Ga0495662_0159618 3300046476 Bacteria 1111
730 Ga0495662_0617719 3300046476 Bacteria 530
731 Ga0495664_0089788 3300046477 Bacteria 1847
732 Ga0495664_0159897 3300046477 Bacteria 1366
733 Ga0495664_0234408 3300046477 Bacteria 1110
734 Ga0495664_0735392 3300046477 Unclassified 582
735 Ga0495584_0654457 3300046491 Unclassified 536
736 Ga0495585_0057908 3300046492 Bacteria 2138
737 Ga0495594_0258448 3300046499 Bacteria 992
738 Ga0495608_0011270 3300046511 Bacteria 6225
739 Ga0495608_0042449 3300046511 Bacteria 3042
740 Ga0495608_0062849 3300046511 Bacteria 2438
741 Ga0495608_0127149 3300046511 Bacteria 1632
742 Ga0495608_0616873 3300046511 Bacteria 650
743 Ga0495618_0000514 3300046514 Bacteria 27432
744 Ga0495618_0025530 3300046514 Bacteria 3668
745 Ga0495618_0036609 3300046514 Bacteria 3079
746 Ga0495618_0046686 3300046514 Bacteria 2733
747 Ga0495618_0110550 3300046514 Bacteria 1760
748 Ga0495618_0482599 3300046514 Bacteria 749
749 Ga0495628_0000209 3300046516 Bacteria 51173
750 Ga0495628_0023732 3300046516 Bacteria 5029
751 Ga0495628_0154623 3300046516 Bacteria 1746
752 Ga0495628_0244842 3300046516 Bacteria 1340
753 Ga0495628_0351723 3300046516 Bacteria 1083
754 Ga0495628_0597604 3300046516 Bacteria 788
755 Ga0495630_0029915 3300046517 Bacteria 4050
756 Ga0495630_0032508 3300046517 Bacteria 3888
757 Ga0495630_0077000 3300046517 Bacteria 2514
758 Ga0495630_0113955 3300046517 Bacteria 2049
759 Ga0495630_0153890 3300046517 Bacteria 1750
760 Ga0495630_0187855 3300046517 Bacteria 1576
761 Ga0495630_0449837 3300046517 Bacteria 987
762 Ga0495630_0509571 3300046517 Bacteria 923
763 Ga0495630_1143774 3300046517 Bacteria 589
764 Ga0495644_0255444 3300046523 Bacteria 681
765 Ga0495666_0000649 3300046526 Bacteria 15639
766 Ga0495666_0312377 3300046526 Bacteria 710
767 Ga0495652_0001901 3300046529 Bacteria 22205
768 Ga0495652_0045105 3300046529 Bacteria 3793
769 Ga0495652_0068779 3300046529 Bacteria 2966
770 Ga0495652_0080097 3300046529 Bacteria 2699
771 Ga0495652_0129406 3300046529 Bacteria 2000
772 Ga0495652_0143141 3300046529 Unclassified 1878
773 Ga0495652_0172940 3300046529 Bacteria 1665
774 Ga0495652_0243299 3300046529 Bacteria 1337
775 Ga0495652_0276313 3300046529 Bacteria 1232
776 Ga0495652_0550187 3300046529 Bacteria 794
777 Ga0495652_0620493 3300046529 Archaea 735
778 Ga0495652_0732378 3300046529 Bacteria 663
779 Ga0495665_0375708 3300046531 Unclassified 722
780 Ga0495640_0024570 3300046533 Bacteria 4382
781 Ga0495640_0074914 3300046533 Unclassified 2261
782 Ga0495640_0256326 3300046533 Bacteria 1094
783 Ga0495640_0257193 3300046533 Bacteria 1092
784 Ga0495640_0883995 3300046533 Bacteria 530
785 Ga0495586_0051724 3300046535 Bacteria 2223
786 Ga0495586_0189050 3300046535 Bacteria 1166
787 Ga0495586_0228486 3300046535 Bacteria 1058
788 Ga0495586_0293847 3300046535 Bacteria 930
789 Ga0495586_0523725 3300046535 Bacteria 684
790 Ga0495586_0675005 3300046535 Bacteria 597
791 Ga0495587_0000492 3300046536 Bacteria 27537
792 Ga0495587_0034131 3300046536 Bacteria 3069
793 Ga0495587_0038267 3300046536 Bacteria 2877
794 Ga0495645_0000126 3300046543 Bacteria 51697
795 Ga0495645_0047549 3300046543 Bacteria 3125
796 Ga0495645_0078324 3300046543 Bacteria 2375
797 Ga0495645_0246482 3300046543 Bacteria 1189
798 Ga0495667_0025462 3300046559 Bacteria 3987
799 Ga0495667_0058958 3300046559 Bacteria 2520
800 Ga0495667_0069471 3300046559 Bacteria 2299
801 Ga0495667_0073553 3300046559 Bacteria 2226
802 Ga0495667_0077102 3300046559 Bacteria 2168
803 Ga0495667_0398011 3300046559 Bacteria 868
804 Ga0495667_0753862 3300046559 Bacteria 602
805 Ga0495656_0006189 3300046615 Bacteria 4187
806 Ga0495656_0319665 3300046615 Bacteria 799
807 Ga0495634_0163911 3300046642 Bacteria 1400
808 Ga0495634_0190572 3300046642 Unclassified 1279
809 Ga0495634_0248988 3300046642 Bacteria 1087
810 Ga0495634_0796533 3300046642 Bacteria 539
811 Ga0495635_0010795 3300046663 Bacteria 6400
812 Ga0495635_0052818 3300046663 Bacteria 2799
813 Ga0495635_0054282 3300046663 Bacteria 2760
814 Ga0495635_0059338 3300046663 Bacteria 2630
815 Ga0495635_0081459 3300046663 Bacteria 2215
816 Ga0495635_0131326 3300046663 Unclassified 1707
817 Ga0495635_0137700 3300046663 Bacteria 1663
818 Ga0495635_0156451 3300046663 Bacteria 1551
819 Ga0495588_0558312 3300046674 Bacteria 600
820 Ga0495657_0007470 3300046675 Bacteria 8447
821 Ga0495657_0007590 3300046675 Bacteria 8367
822 Ga0495657_0021368 3300046675 Bacteria 4644
823 Ga0495657_0022121 3300046675 Bacteria 4559
824 Ga0495599_0000130 3300046678 Bacteria 48631
825 Ga0495599_0235459 3300046678 Bacteria 1117
826 Ga0495599_0360090 3300046678 Archaea 871
827 Ga0495623_0000041 3300046679 Bacteria 78481
828 Ga0495623_0373170 3300046679 Bacteria 773
829 Ga0495623_0424907 3300046679 Bacteria 711
830 Ga0495646_0268246 3300046680 Bacteria 910
831 Ga0495646_0332758 3300046680 Bacteria 798
832 Ga0495647_0005935 3300046681 Bacteria 4021
833 Ga0495647_0038165 3300046681 Bacteria 1815
834 Ga0495647_0348646 3300046681 Bacteria 674
835 Ga0495647_0541745 3300046681 Unclassified 544
836 Ga0495658_0004962 3300046683 Bacteria 6527
837 Ga0495658_0038832 3300046683 Bacteria 2638
838 Ga0495658_0077855 3300046683 Bacteria 1940
839 Ga0495658_0638210 3300046683 Bacteria 682
840 Ga0495613_0004077 3300046689 Bacteria 10921
841 Ga0495613_0065038 3300046689 Bacteria 2666
842 Ga0495613_0075657 3300046689 Bacteria 2451
843 Ga0495613_0077256 3300046689 Bacteria 2423
844 Ga0495613_0083914 3300046689 Bacteria 2313
845 Ga0495613_0117564 3300046689 Bacteria 1911
846 Ga0495613_0395861 3300046689 Bacteria 943
847 Ga0495613_0712973 3300046689 Bacteria 660
848 Ga0495613_0789962 3300046689 Bacteria 620
849 Ga0495613_0798449 3300046689 Bacteria 616
850 Ga0495624_0003577 3300046690 Bacteria 11505
851 Ga0495624_0032360 3300046690 Unclassified 3392
852 Ga0495624_0050268 3300046690 Bacteria 2641
853 Ga0495624_0394708 3300046690 Unclassified 831
854 Ga0495624_0627360 3300046690 Bacteria 640
855 Ga0495589_0419934 3300046794 Bacteria 613
856 Ga0495600_0114072 3300046809 Bacteria 1760
857 Ga0495600_0174744 3300046809 Bacteria 1385
858 Ga0495600_0350087 3300046809 Bacteria 925
859 Ga0495581_0007047 3300047315 Bacteria 6516
860 Ga0495581_0045247 3300047315 Bacteria 2545
861 Ga0495581_0612098 3300047315 Unclassified 631
862 Ga0495604_0000167 3300047317 Bacteria 57533
863 Ga0495604_0561258 3300047317 Bacteria 735
864 Ga0495604_0740947 3300047317 Bacteria 622
865 Ga0495674_0037111 3300047319 Bacteria 4380
866 Ga0495674_0037491 3300047319 Bacteria 4356
867 Ga0495674_0126018 3300047319 Bacteria 2161
868 Ga0495674_0134915 3300047319 Bacteria 2077
869 Ga0495674_0141468 3300047319 Bacteria 2022
870 Ga0495674_0307582 3300047319 Bacteria 1294
871 Ga0495674_0417003 3300047319 Unclassified 1082
872 Ga0495674_0446413 3300047319 Bacteria 1040
873 Ga0495674_0970014 3300047319 Bacteria 653
874 Ga0495674_1082072 3300047319 Bacteria 611
875 Ga0495674_1162632 3300047319 Bacteria 585
876 Ga0495676_0002388 3300047321 Bacteria 16667
877 Ga0495676_0229986 3300047321 Bacteria 1274
878 Ga0495676_0416105 3300047321 Bacteria 890
879 Ga0495676_0750082 3300047321 Unclassified 630
880 Ga0495680_0003097 3300047322 Bacteria 16573
881 Ga0495680_0023872 3300047322 Bacteria 5081
882 Ga0495680_0027741 3300047322 Bacteria 4647
883 Ga0495680_0027979 3300047322 Bacteria 4626
884 Ga0495680_0033027 3300047322 Bacteria 4194
885 Ga0495680_0079172 3300047322 Bacteria 2486
886 Ga0495680_0272241 3300047322 Bacteria 1195
887 Ga0495680_0357225 3300047322 Bacteria 1016
888 Ga0495680_0454678 3300047322 Bacteria 876
889 Ga0495680_0686863 3300047322 Bacteria 677
890 Ga0495675_0000724 3300047444 Bacteria 20636
891 Ga0495675_0356176 3300047444 Bacteria 860
892 Ga0495684_0014897 3300047471 Bacteria 5988
893 Ga0495684_0020918 3300047471 Bacteria 5041
894 Ga0495684_0026533 3300047471 Bacteria 4452
895 Ga0495684_0040798 3300047471 Bacteria 3557
896 Ga0495684_0082568 3300047471 Bacteria 2438
897 Ga0495684_0104324 3300047471 Bacteria 2142
898 Ga0495684_0175847 3300047471 Unclassified 1589
899 Ga0495684_1002535 3300047471 Bacteria 530
900 Ga0495593_0006002 3300047673 Bacteria 7152
901 Ga0495593_0337721 3300047673 Bacteria 753
902 Ga0495602_0000147 3300048088 Bacteria 65372
903 Ga0495602_0251666 3300048088 Bacteria 1316
904 Ga0495614_0010756 3300048089 Bacteria 4029
905 Ga0495614_0524370 3300048089 Bacteria 565
906 Ga0496100_0001432 3300048903 Bacteria 11671
907 Ga0496100_0007313 3300048903 Bacteria 6080
908 Ga0496100_0014542 3300048903 Bacteria 4571
909 Ga0496100_0194027 3300048903 Unclassified 1476
910 Ga0496100_1034076 3300048903 Unclassified 647
911 Ga0496100_1510666 3300048903 Bacteria 531
912 Ga0496101_0004152 3300048904 Bacteria 9073
913 Ga0496101_0007006 3300048904 Bacteria 7281
914 Ga0496101_0015812 3300048904 Bacteria 5092
915 Ga0496101_0158788 3300048904 Bacteria 1733
916 Ga0496101_0630182 3300048904 Unclassified 847
917 Ga0496101_0643906 3300048904 Bacteria 837
918 Ga0496102_0002713 3300048905 Bacteria 15060
919 Ga0496102_0011745 3300048905 Bacteria 7558
920 Ga0496102_0014363 3300048905 Bacteria 6879
921 Ga0496102_0116347 3300048905 Bacteria 2495
922 Ga0496102_0349843 3300048905 Bacteria 1391
923 Ga0496102_0485168 3300048905 Unclassified 1157
924 Ga0496102_1703307 3300048905 Unclassified 548
925 Ga0496103_0030216 3300048906 Bacteria 3296
926 Ga0496103_0034710 3300048906 Bacteria 3086
927 Ga0496103_0071000 3300048906 Bacteria 2179
928 Ga0496103_0190315 3300048906 Bacteria 1319
929 Ga0496103_0351687 3300048906 Unclassified 947
930 Ga0496104_0020221 3300048907 Bacteria 6100
931 Ga0496104_0078038 3300048907 Bacteria 3155
932 Ga0496104_0104879 3300048907 Bacteria 2709
933 Ga0496104_0113105 3300048907 Bacteria 2603
934 Ga0496104_0157942 3300048907 Bacteria 2176
935 Ga0496104_0161795 3300048907 Bacteria 2147
936 Ga0496104_0169409 3300048907 Bacteria 2094
937 Ga0496104_0184515 3300048907 Bacteria 1997
938 Ga0496104_0325595 3300048907 Bacteria 1450
939 Ga0496104_0468114 3300048907 Bacteria 1172
940 Ga0496104_0520879 3300048907 Bacteria 1100
941 Ga0496104_1122189 3300048907 Unclassified 690
942 Ga0496104_1663280 3300048907 Bacteria 541
943 Ga0496105_0020574 3300048908 Bacteria 5334
944 Ga0496105_0032718 3300048908 Bacteria 4269
945 Ga0496105_0087793 3300048908 Bacteria 2569
946 Ga0496105_0255319 3300048908 Bacteria 1419
947 Ga0496105_0393485 3300048908 Unclassified 1101
948 Ga0496105_1040315 3300048908 Unclassified 610
949 Ga0496105_1222188 3300048908 Bacteria 552
950 Ga0496106_0000586 3300048909 Bacteria 26020
951 Ga0496106_0005920 3300048909 Bacteria 9040
952 Ga0496106_0018426 3300048909 Bacteria 5161
953 Ga0496106_0392785 3300048909 Bacteria 1115
954 Ga0496107_0000178 3300048910 Bacteria 32998
955 Ga0496107_0001702 3300048910 Bacteria 13784
956 Ga0496107_0015869 3300048910 Bacteria 5284
957 Ga0496107_0022441 3300048910 Bacteria 4460
958 Ga0496107_0033804 3300048910 Bacteria 3660
959 Ga0496107_0454106 3300048910 Unclassified 952
960 Ga0496108_0034028 3300048911 Bacteria 4233
961 Ga0496108_0050199 3300048911 Bacteria 3492
962 Ga0496108_0062684 3300048911 Bacteria 3130
963 Ga0496108_0103999 3300048911 Bacteria 2423
964 Ga0496108_0562960 3300048911 Bacteria 994
965 Ga0496108_0728972 3300048911 Unclassified 858
966 Ga0496108_0806035 3300048911 Bacteria 810
967 Ga0496108_1041126 3300048911 Unclassified 698
968 Ga0496108_1366947 3300048911 Bacteria 593
969 Ga0496109_0023831 3300048912 Bacteria 5433
970 Ga0496109_0034023 3300048912 Bacteria 4586
971 Ga0496109_0060193 3300048912 Bacteria 3470
972 Ga0496109_0067859 3300048912 Bacteria 3268
973 Ga0496109_0071716 3300048912 Bacteria 3181
974 Ga0496109_0101168 3300048912 Unclassified 2674
975 Ga0496109_0414694 3300048912 Bacteria 1272
976 Ga0496109_0992911 3300048912 Bacteria 777
977 Ga0496109_1545898 3300048912 Unclassified 598
978 Ga0496109_1689725 3300048912 Bacteria 567
979 Ga0496110_0012051 3300048913 Bacteria 7102
980 Ga0496110_0019384 3300048913 Bacteria 5723
981 Ga0496110_0648594 3300048913 Bacteria 955
982 Ga0496110_1566194 3300048913 Bacteria 569
983 Ga0496111_0006770 3300048914 Bacteria 7468
984 Ga0496111_0028995 3300048914 Bacteria 3927
985 Ga0496111_0070656 3300048914 Bacteria 2540
986 Ga0496111_0163351 3300048914 Bacteria 1654
987 Ga0496111_0460116 3300048914 Bacteria 938
988 Ga0496111_0765421 3300048914 Bacteria 700
989 Ga0496112_0002974 3300048915 Bacteria 13822
990 Ga0496112_0009862 3300048915 Bacteria 8631
991 Ga0496112_0052767 3300048915 Bacteria 3991
992 Ga0496112_0058651 3300048915 Bacteria 3791
993 Ga0496112_0127224 3300048915 Bacteria 2518
994 Ga0496112_0193892 3300048915 Bacteria 1993
995 Ga0496112_0220626 3300048915 Bacteria 1852
996 Ga0496112_0503077 3300048915 Bacteria 1147
997 Ga0496112_0839333 3300048915 Bacteria 842
998 Ga0496112_1313235 3300048915 Unclassified 639
999 Ga0496112_1707767 3300048915 Archaea 542
1000 Ga0496113_0177054 3300048916 Bacteria 1690
1001 Ga0496113_0230776 3300048916 Bacteria 1476
1002 Ga0496113_0231059 3300048916 Bacteria 1475
1003 Ga0496113_0242879 3300048916 Bacteria 1437
1004 Ga0496113_0324821 3300048916 Unclassified 1234
1005 Ga0496113_0386151 3300048916 Bacteria 1124
1006 Ga0496113_0514836 3300048916 Bacteria 960
1007 Ga0496113_0537012 3300048916 Bacteria 938
1008 Ga0496113_0548728 3300048916 Bacteria 927
1009 Ga0496114_0003344 3300048917 Bacteria 12327
1010 Ga0496114_0041600 3300048917 Bacteria 3809
1011 Ga0496114_0041653 3300048917 Bacteria 3806
1012 Ga0496114_0049600 3300048917 Bacteria 3493
1013 Ga0496114_0049741 3300048917 Bacteria 3489
1014 Ga0496114_0317209 3300048917 Bacteria 1377
1015 Ga0496114_1531768 3300048917 Bacteria 555
1016 Ga0496115_0004846 3300048918 Bacteria 9767
1017 Ga0496115_0019193 3300048918 Bacteria 5259
1018 Ga0496115_0178180 3300048918 Unclassified 1758
1019 Ga0496115_0235723 3300048918 Bacteria 1508
1020 Ga0501034_0101789 3300049571 Bacteria 2866
1021 Ga0501046_0700966 3300049580 Unclassified 713
1022 Ga0501047_0359030 3300049581 Bacteria 1293
1023 Ga0501067_0020546 3300049583 Bacteria 3654
1024 Ga0501067_0020974 3300049583 Bacteria 3615
1025 Ga0501067_0044763 3300049583 Bacteria 2459
1026 Ga0501067_0331713 3300049583 Bacteria 847
1027 Ga0501067_0802267 3300049583 Bacteria 530
1028 Ga0501069_0004421 3300049585 Bacteria 7260
1029 Ga0501069_0017354 3300049585 Bacteria 3872
1030 Ga0501069_0332749 3300049585 Bacteria 893
1031 Ga0501069_0977859 3300049585 Bacteria 516
1032 Ga0501070_0013851 3300049586 Bacteria 6793
1033 Ga0501070_0184081 3300049586 Bacteria 1718
1034 Ga0501070_0944779 3300049586 Bacteria 671
1035 Ga0501070_1303878 3300049586 Unclassified 554
1036 Ga0501071_1177198 3300049587 Unclassified 592
1037 Ga0501072_0001288 3300049588 Bacteria 18753
1038 Ga0501073_0099410 3300049589 Bacteria 2020
1039 Ga0501074_0117305 3300049590 Bacteria 1904
1040 Ga0501076_0478579 3300049592 Bacteria 1026
1041 Ga0501079_0111747 3300049741 Bacteria 2123
1042 Ga0501080_0000892 3300049742 Bacteria 24442
1043 Ga0501080_0037995 3300049742 Bacteria 4496
1044 Ga0501083_0006059 3300049744 Bacteria 8565
1045 Ga0501044_0780232 3300049823 Bacteria 836
1046 nmdc:mga03n38_302356_c1 3300050490 Unclassified 859
1047 nmdc:mga05p37_1025570_c1 3300050507 Bacteria 873
1048 nmdc:mga08y16_25535_c1 3300050511 Bacteria 6231
1049 nmdc:mga0n895_1670_c1 3300050512 Bacteria 16756
1050 nmdc:mga0n895_294034_c1 3300050512 Unclassified 1647
1051 nmdc:mga0n895_655801_c1 3300050512 Bacteria 1048
1052 nmdc:mga0rr50_20750_c1 3300050513 Bacteria 4469
1053 nmdc:mga0rr50_561516_c1 3300050513 Bacteria 972
1054 nmdc:mga08x19_534_c1 3300050514 Bacteria 25204
1055 nmdc:mga0a205_445021_c1 3300050515 Unclassified 1156
1056 Ga0495601_0000275 3300053077 Bacteria 27636
1057 Ga0495601_0008713 3300053077 Bacteria 5987
1058 Ga0495601_0013067 3300053077 Bacteria 4990
1059 Ga0495601_0034241 3300053077 Bacteria 3167
1060 Ga0495601_0050954 3300053077 Bacteria 2612
1061 Ga0495601_0191990 3300053077 Bacteria 1335
1062 Ga0495612_0001639 3300053078 Bacteria 9214
1063 Ga0495612_0157862 3300053078 Bacteria 989
1064 Ga0495612_0320397 3300053078 Unclassified 697
1065 Ga0495655_0141731 3300053083 Bacteria 749
1066 Ga0495595_0029535 3300053084 Bacteria 2454
1067 Ga0495595_0032339 3300053084 Bacteria 2356
1068 Ga0495595_0059926 3300053084 Bacteria 1781
1069 Ga0495595_0366164 3300053084 Bacteria 728
1070 Ga0495595_0501460 3300053084 Bacteria 618
1071 Ga0495619_0003160 3300053085 Bacteria 10682
1072 Ga0495619_0008123 3300053085 Bacteria 6642
1073 Ga0495619_0026190 3300053085 Bacteria 3751
1074 Ga0495619_0081911 3300053085 Bacteria 2174
1075 Ga0495619_0115270 3300053085 Bacteria 1839
1076 Ga0495619_0576749 3300053085 Unclassified 771
1077 Ga0495619_0756844 3300053085 Bacteria 659
1078 Ga0500566_0093612 3300053094 Bacteria 1657
1079 Ga0501084_0328382 3300054114 Bacteria 1292
1080 Ga0587113_048470 3300059625 Bacteria 525
1081 Ga0587122_047712 3300059628 Bacteria 548
1082 Ga0587075_144779 3300059644 Unclassified 510
1083 Ga0587114_135536 3300059655 Bacteria 511
1084 Ga0587111_0181311 3300060346 Bacteria 586
1085 Ga0587111_0205363 3300060346 Unclassified 561
1086 Ga0466962_0001252 3300061719 Bacteria 11717
1087 Ga0466962_0014341 3300061719 Bacteria 3819
1088 Ga0466962_0046681 3300061719 Bacteria 2070
1089 Ga0466962_0070582 3300061719 Unclassified 1669
1090 Ga0466962_0079600 3300061719 Bacteria 1566
1091 Ga0466962_0132251 3300061719 Bacteria 1206
1092 Ga0466962_0235317 3300061719 Bacteria 898
1093 Ga0466962_0615554 3300061719 Unclassified 554
1094 Ga0530510_0078335 3300061734 Bacteria 2403

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006048 Ga0075363_100352105 Ga0075363_1003521052 93
2 3300009553 Ga0105249_10566523 Ga0105249_105665232 97
3 3300025961 Ga0207712_10992159 Ga0207712_109921592 97
4 3300005329 Ga0070683_100021983 Ga0070683_1000219832 98
5 3300005329 Ga0070683_100332332 Ga0070683_1003323323 98
6 3300005330 Ga0070690_100394324 Ga0070690_1003943242 98
7 3300005334 Ga0068869_100749878 Ga0068869_1007498782 98
8 3300005337 Ga0070682_100212174 Ga0070682_1002121742 98
9 3300005338 Ga0068868_100125953 Ga0068868_1001259532 98
10 3300005338 Ga0068868_101420324 Ga0068868_1014203242 98
11 3300005340 Ga0070689_100386077 Ga0070689_1003860771 98
12 3300005354 Ga0070675_101408318 Ga0070675_1014083182 98
13 3300005355 Ga0070671_100279396 Ga0070671_1002793962 98
14 3300005364 Ga0070673_100623936 Ga0070673_1006239361 98
15 3300005366 Ga0070659_100562720 Ga0070659_1005627202 98
16 3300005434 Ga0070709_11030388 Ga0070709_110303881 98
17 3300005435 Ga0070714_100652924 Ga0070714_1006529242 98
18 3300005439 Ga0070711_100903416 Ga0070711_1009034162 98
19 3300005440 Ga0070705_101850306 Ga0070705_1018503061 98
20 3300005455 Ga0070663_100536657 Ga0070663_1005366572 98
21 3300005456 Ga0070678_100694726 Ga0070678_1006947262 98
22 3300005456 Ga0070678_101271716 Ga0070678_1012717162 98
23 3300005458 Ga0070681_10716761 Ga0070681_107167612 98
24 3300005459 Ga0068867_100110603 Ga0068867_1001106033 98
25 3300005518 Ga0070699_101147556 Ga0070699_1011475562 98
26 3300005535 Ga0070684_100201362 Ga0070684_1002013623 98
27 3300005547 Ga0070693_100277951 Ga0070693_1002779511 98
28 3300005549 Ga0070704_100700987 Ga0070704_1007009871 98
29 3300005564 Ga0070664_100486334 Ga0070664_1004863342 98
30 3300005614 Ga0068856_100027109 Ga0068856_1000271094 98
31 3300005614 Ga0068856_101153891 Ga0068856_1011538911 98
32 3300005615 Ga0070702_100197513 Ga0070702_1001975131 98
33 3300005617 Ga0068859_101892550 Ga0068859_1018925502 98
34 3300005618 Ga0068864_101400398 Ga0068864_1014003982 98
35 3300005834 Ga0068851_10588691 Ga0068851_105886912 98
36 3300005840 Ga0068870_10146188 Ga0068870_101461882 98
37 3300005841 Ga0068863_100871309 Ga0068863_1008713092 98
38 3300006237 Ga0097621_101272763 Ga0097621_1012727632 98
39 3300006871 Ga0075434_100008073 Ga0075434_1000080736 98
40 3300006914 Ga0075436_100000414 Ga0075436_10000041434 98
41 3300006914 Ga0075436_100506705 Ga0075436_1005067052 98
42 3300006931 Ga0097620_101892718 Ga0097620_1018927182 98
43 3300007076 Ga0075435_100024379 Ga0075435_1000243795 98
44 3300009098 Ga0105245_10125540 Ga0105245_101255403 98
45 3300009098 Ga0105245_10601252 Ga0105245_106012522 98
46 3300009098 Ga0105245_11146643 Ga0105245_111466432 98
47 3300009101 Ga0105247_10565844 Ga0105247_105658442 98
48 3300009176 Ga0105242_12792636 Ga0105242_127926362 98
49 3300009545 Ga0105237_10359809 Ga0105237_103598092 98
50 3300009551 Ga0105238_10149087 Ga0105238_101490873 98
51 3300009551 Ga0105238_11264766 Ga0105238_112647662 98
52 3300010375 Ga0105239_10338305 Ga0105239_103383052 98
53 3300010375 Ga0105239_11257004 Ga0105239_112570042 98
54 3300011119 Ga0105246_10498170 Ga0105246_104981701 98
55 3300011119 Ga0105246_10638103 Ga0105246_106381031 98
56 3300013105 Ga0157369_10267936 Ga0157369_102679363 98
57 3300013296 Ga0157374_10111411 Ga0157374_101114114 98
58 3300013296 Ga0157374_11447452 Ga0157374_114474521 98
59 3300013307 Ga0157372_10633548 Ga0157372_106335482 98
60 3300013307 Ga0157372_11173770 Ga0157372_111737702 98
61 3300014745 Ga0157377_10183641 Ga0157377_101836413 98
62 3300014968 Ga0157379_11880679 Ga0157379_118806791 98
63 3300020069 Ga0197907_10461500 Ga0197907_104615002 98
64 3300020070 Ga0206356_11789295 Ga0206356_117892953 98
65 3300020082 Ga0206353_10914373 Ga0206353_109143732 98
66 3300022467 Ga0224712_10071764 Ga0224712_100717642 98
67 3300025908 Ga0207643_10307168 Ga0207643_103071681 98
68 3300025911 Ga0207654_10434537 Ga0207654_104345371 98
69 3300025911 Ga0207654_11291441 Ga0207654_112914412 98
70 3300025912 Ga0207707_10086041 Ga0207707_100860413 98
71 3300025915 Ga0207693_10757545 Ga0207693_107575452 98
72 3300025915 Ga0207693_10921310 Ga0207693_109213102 98
73 3300025916 Ga0207663_10217378 Ga0207663_102173782 98
74 3300025916 Ga0207663_11074144 Ga0207663_110741442 98
75 3300025924 Ga0207694_10083135 Ga0207694_100831353 98
76 3300025927 Ga0207687_10039659 Ga0207687_100396593 98
77 3300025927 Ga0207687_10354716 Ga0207687_103547162 98
78 3300025927 Ga0207687_10730028 Ga0207687_107300282 98
79 3300025929 Ga0207664_11222614 Ga0207664_112226141 98
80 3300025931 Ga0207644_10511805 Ga0207644_105118052 98
81 3300025932 Ga0207690_10352695 Ga0207690_103526952 98
82 3300025934 Ga0207686_10681625 Ga0207686_106816252 98
83 3300025938 Ga0207704_10947747 Ga0207704_109477472 98
84 3300025944 Ga0207661_10082972 Ga0207661_100829723 98
85 3300025944 Ga0207661_11885971 Ga0207661_118859711 98
86 3300026023 Ga0207677_11084247 Ga0207677_110842471 98
87 3300026041 Ga0207639_10539343 Ga0207639_105393432 98
88 3300026067 Ga0207678_10102549 Ga0207678_101025492 98
89 3300026067 Ga0207678_11501939 Ga0207678_115019392 98
90 3300026078 Ga0207702_10165361 Ga0207702_101653612 98
91 3300026078 Ga0207702_10279925 Ga0207702_102799251 98
92 3300026078 Ga0207702_11085560 Ga0207702_110855601 98
93 3300026095 Ga0207676_11576823 Ga0207676_115768232 98
94 3300026116 Ga0207674_10034379 Ga0207674_100343793 98
95 3300026121 Ga0207683_10252452 Ga0207683_102524523 98
96 3300026121 Ga0207683_11617933 Ga0207683_116179332 98
97 3300028800 Ga0265338_10029352 Ga0265338_100293522 98
98 3300031250 Ga0265331_10108254 Ga0265331_101082542 98
99 3300031251 Ga0265327_10006564 Ga0265327_100065646 98
100 3300035170 Ga0373943_0270295 Ga0373943_0270295_27_326 98
101 3300035725 Ga0373947_0496951 Ga0373947_0496951_374_673 98
102 3300037068 Ga0373925_1291588 Ga0373925_1291588_17_316 98
103 3300044694 Ga0466963_0002419 Ga0466963_0002419_3940_4239 98
104 3300044719 Ga0466971_0051058 Ga0466971_0051058_711_1010 98
105 3300044735 Ga0466968_0110361 Ga0466968_0110361_590_889 98
106 3300044842 Ga0466957_0090534 Ga0466957_0090534_1309_1608 98
107 3300044901 Ga0466960_0005505 Ga0466960_0005505_453_752 98
108 3300044901 Ga0466960_0119577 Ga0466960_0119577_386_685 98
109 3300045836 Ga0466958_0034967 Ga0466958_0034967_1141_1440 98
110 3300045976 Ga0466967_0016513 Ga0466967_0016513_3493_3792 98
111 3300045976 Ga0466967_0153511 Ga0466967_0153511_890_1189 98
112 3300045976 Ga0466967_0233298 Ga0466967_0233298_1226_1525 98
113 3300045976 Ga0466967_0629454 Ga0466967_0629454_465_764 98
114 3300045976 Ga0466967_2327300 Ga0466967_2327300_54_356 98
115 3300046459 Ga0495629_0246577 Ga0495629_0246577_16_315 98
116 3300046461 Ga0495641_0032675 Ga0495641_0032675_925_1224 98
117 3300046473 Ga0495582_0528744 Ga0495582_0528744_213_512 98
118 3300046526 Ga0495666_0312377 Ga0495666_0312377_369_668 98
119 3300046674 Ga0495588_0558312 Ga0495588_0558312_231_530 98
120 3300046681 Ga0495647_0348646 Ga0495647_0348646_243_542 98
121 3300046683 Ga0495658_0038832 Ga0495658_0038832_500_799 98
122 3300046689 Ga0495613_0065038 Ga0495613_0065038_2223_2522 98
123 3300048903 Ga0496100_0001432 Ga0496100_0001432_197_496 98
124 3300048903 Ga0496100_0007313 Ga0496100_0007313_772_1071 98
125 3300048903 Ga0496100_1510666 Ga0496100_1510666_69_365 98
126 3300048904 Ga0496101_0004152 Ga0496101_0004152_7908_8207 98
127 3300048904 Ga0496101_0007006 Ga0496101_0007006_5672_5971 98
128 3300048905 Ga0496102_0011745 Ga0496102_0011745_4873_5172 98
129 3300048905 Ga0496102_0349843 Ga0496102_0349843_50_349 98
130 3300048905 Ga0496102_0485168 Ga0496102_0485168_806_1105 98
131 3300048906 Ga0496103_0190315 Ga0496103_0190315_109_408 98
132 3300048906 Ga0496103_0351687 Ga0496103_0351687_386_685 98
133 3300048907 Ga0496104_0020221 Ga0496104_0020221_3837_4136 98
134 3300048907 Ga0496104_0169409 Ga0496104_0169409_194_493 98
135 3300048907 Ga0496104_0184515 Ga0496104_0184515_1500_1799 98
136 3300048908 Ga0496105_0020574 Ga0496105_0020574_4981_5280 98
137 3300048909 Ga0496106_0000586 Ga0496106_0000586_13541_13840 98
138 3300048909 Ga0496106_0018426 Ga0496106_0018426_834_1133 98
139 3300048910 Ga0496107_0000178 Ga0496107_0000178_19891_20190 98
140 3300048910 Ga0496107_0015869 Ga0496107_0015869_3868_4167 98
141 3300048911 Ga0496108_0050199 Ga0496108_0050199_84_383 98
142 3300048911 Ga0496108_0728972 Ga0496108_0728972_365_664 98
143 3300048911 Ga0496108_1041126 Ga0496108_1041126_64_363 98
144 3300048912 Ga0496109_0023831 Ga0496109_0023831_3147_3446 98
145 3300048912 Ga0496109_0071716 Ga0496109_0071716_1088_1387 98
146 3300048912 Ga0496109_1545898 Ga0496109_1545898_183_482 98
147 3300048914 Ga0496111_0765421 Ga0496111_0765421_340_639 98
148 3300048915 Ga0496112_0052767 Ga0496112_0052767_1220_1519 98
149 3300048916 Ga0496113_0386151 Ga0496113_0386151_668_967 98
150 3300048917 Ga0496114_0003344 Ga0496114_0003344_5590_5889 98
151 3300048917 Ga0496114_0041600 Ga0496114_0041600_3356_3655 98
152 3300048918 Ga0496115_0004846 Ga0496115_0004846_8933_9232 98
153 3300049583 Ga0501067_0020974 Ga0501067_0020974_911_1210 98
154 3300049585 Ga0501069_0004421 Ga0501069_0004421_3461_3760 98
155 3300049585 Ga0501069_0977859 Ga0501069_0977859_18_317 98
156 3300049586 Ga0501070_0944779 Ga0501070_0944779_200_499 98
157 3300049587 Ga0501071_1177198 Ga0501071_1177198_34_333 98
158 3300050512 nmdc:mga0n895_1670_c1 nmdc:mga0n895_1670_c1_9385_9684 98
159 3300050513 nmdc:mga0rr50_20750_c1 nmdc:mga0rr50_20750_c1_3165_3464 98
160 3300050514 nmdc:mga08x19_534_c1 nmdc:mga08x19_534_c1_18262_18561 98
161 3300050515 nmdc:mga0a205_445021_c1 nmdc:mga0a205_445021_c1_625_924 98
162 3300053083 Ga0495655_0141731 Ga0495655_0141731_238_534 98
163 3300061719 Ga0466962_0132251 Ga0466962_0132251_607_906 98
164 3300061734 Ga0530510_0078335 Ga0530510_0078335_1904_2203 98
165 3300003323 rootH1_10182417 rootH1_101824174 99
166 3300005327 Ga0070658_10054511 Ga0070658_100545115 99
167 3300005327 Ga0070658_10182619 Ga0070658_101826192 99
168 3300005329 Ga0070683_100037771 Ga0070683_1000377713 99
169 3300005329 Ga0070683_100058070 Ga0070683_1000580704 99
170 3300005329 Ga0070683_100158239 Ga0070683_1001582392 99
171 3300005329 Ga0070683_100176387 Ga0070683_1001763872 99
172 3300005336 Ga0070680_100100044 Ga0070680_1001000443 99
173 3300005337 Ga0070682_100031764 Ga0070682_1000317642 99
174 3300005337 Ga0070682_100057409 Ga0070682_1000574093 99
175 3300005339 Ga0070660_100004655 Ga0070660_1000046551 99
176 3300005339 Ga0070660_100011588 Ga0070660_1000115884 99
177 3300005339 Ga0070660_100054116 Ga0070660_1000541165 99
178 3300005339 Ga0070660_100268286 Ga0070660_1002682863 99
179 3300005344 Ga0070661_100148351 Ga0070661_1001483512 99
180 3300005344 Ga0070661_100179146 Ga0070661_1001791461 99
181 3300005344 Ga0070661_100988022 Ga0070661_1009880222 99
182 3300005355 Ga0070671_100008449 Ga0070671_1000084494 99
183 3300005366 Ga0070659_100352978 Ga0070659_1003529782 99
184 3300005366 Ga0070659_100663549 Ga0070659_1006635492 99
185 3300005366 Ga0070659_101746678 Ga0070659_1017466781 99
186 3300005434 Ga0070709_10015673 Ga0070709_100156734 99
187 3300005434 Ga0070709_10044135 Ga0070709_100441354 99
188 3300005434 Ga0070709_10227194 Ga0070709_102271942 99
189 3300005435 Ga0070714_100038691 Ga0070714_1000386916 99
190 3300005435 Ga0070714_100042803 Ga0070714_1000428032 99
191 3300005435 Ga0070714_100058761 Ga0070714_1000587611 99
192 3300005435 Ga0070714_100104028 Ga0070714_1001040282 99
193 3300005435 Ga0070714_100363670 Ga0070714_1003636702 99
194 3300005435 Ga0070714_100380543 Ga0070714_1003805433 99
195 3300005435 Ga0070714_100445438 Ga0070714_1004454383 99
196 3300005435 Ga0070714_100514422 Ga0070714_1005144222 99
197 3300005435 Ga0070714_100655966 Ga0070714_1006559662 99
198 3300005435 Ga0070714_102504515 Ga0070714_1025045151 99
199 3300005436 Ga0070713_100001203 Ga0070713_10000120310 99
200 3300005436 Ga0070713_100002241 Ga0070713_1000022414 99
201 3300005436 Ga0070713_100108459 Ga0070713_1001084593 99
202 3300005436 Ga0070713_100333447 Ga0070713_1003334472 99
203 3300005436 Ga0070713_100820882 Ga0070713_1008208823 99
204 3300005436 Ga0070713_101034041 Ga0070713_1010340413 99
205 3300005437 Ga0070710_10029016 Ga0070710_100290162 99
206 3300005438 Ga0070701_10286859 Ga0070701_102868593 99
207 3300005439 Ga0070711_100626229 Ga0070711_1006262292 99
208 3300005439 Ga0070711_101280849 Ga0070711_1012808491 99
209 3300005440 Ga0070705_100182751 Ga0070705_1001827513 99
210 3300005440 Ga0070705_101597235 Ga0070705_1015972351 99
211 3300005445 Ga0070708_100413026 Ga0070708_1004130262 99
212 3300005456 Ga0070678_100113271 Ga0070678_1001132714 99
213 3300005458 Ga0070681_10076535 Ga0070681_100765354 99
214 3300005458 Ga0070681_10170989 Ga0070681_101709894 99
215 3300005458 Ga0070681_10215813 Ga0070681_102158132 99
216 3300005458 Ga0070681_10295237 Ga0070681_102952373 99
217 3300005458 Ga0070681_10464904 Ga0070681_104649042 99
218 3300005467 Ga0070706_100575867 Ga0070706_1005758671 99
219 3300005467 Ga0070706_101437744 Ga0070706_1014377441 99
220 3300005468 Ga0070707_100030113 Ga0070707_1000301136 99
221 3300005468 Ga0070707_100207249 Ga0070707_1002072491 99
222 3300005468 Ga0070707_100270671 Ga0070707_1002706713 99
223 3300005468 Ga0070707_100279985 Ga0070707_1002799853 99
224 3300005471 Ga0070698_100093650 Ga0070698_1000936505 99
225 3300005471 Ga0070698_100099098 Ga0070698_1000990982 99
226 3300005471 Ga0070698_100186057 Ga0070698_1001860573 99
227 3300005518 Ga0070699_100120520 Ga0070699_1001205202 99
228 3300005518 Ga0070699_100490186 Ga0070699_1004901863 99
229 3300005530 Ga0070679_100077669 Ga0070679_1000776692 99
230 3300005530 Ga0070679_100165280 Ga0070679_1001652803 99
231 3300005530 Ga0070679_100363496 Ga0070679_1003634962 99
232 3300005530 Ga0070679_100647073 Ga0070679_1006470732 99
233 3300005535 Ga0070684_100228248 Ga0070684_1002282484 99
234 3300005535 Ga0070684_100282112 Ga0070684_1002821123 99
235 3300005535 Ga0070684_100563308 Ga0070684_1005633082 99
236 3300005535 Ga0070684_100884080 Ga0070684_1008840802 99
237 3300005536 Ga0070697_100648554 Ga0070697_1006485542 99
238 3300005536 Ga0070697_101751406 Ga0070697_1017514061 99
239 3300005545 Ga0070695_100002173 Ga0070695_10000217313 99
240 3300005545 Ga0070695_100367759 Ga0070695_1003677592 99
241 3300005546 Ga0070696_100276356 Ga0070696_1002763563 99
242 3300005547 Ga0070693_100255798 Ga0070693_1002557982 99
243 3300005549 Ga0070704_100023732 Ga0070704_1000237324 99
244 3300005549 Ga0070704_100843591 Ga0070704_1008435912 99
245 3300005549 Ga0070704_101737097 Ga0070704_1017370971 99
246 3300005563 Ga0068855_100040522 Ga0068855_1000405225 99
247 3300005563 Ga0068855_100406343 Ga0068855_1004063433 99
248 3300005577 Ga0068857_100599808 Ga0068857_1005998082 99
249 3300005577 Ga0068857_102189640 Ga0068857_1021896402 99
250 3300005578 Ga0068854_100564760 Ga0068854_1005647601 99
251 3300005614 Ga0068856_100398044 Ga0068856_1003980442 99
252 3300005614 Ga0068856_100614668 Ga0068856_1006146682 99
253 3300005616 Ga0068852_100376413 Ga0068852_1003764131 99
254 3300005616 Ga0068852_102150848 Ga0068852_1021508482 99
255 3300005841 Ga0068863_100523911 Ga0068863_1005239113 99
256 3300005937 Ga0081455_10012981 Ga0081455_100129814 99
257 3300005981 Ga0081538_10016286 Ga0081538_100162867 99
258 3300005985 Ga0081539_10002873 Ga0081539_1000287310 99
259 3300005985 Ga0081539_10192609 Ga0081539_101926092 99
260 3300006028 Ga0070717_10012964 Ga0070717_100129644 99
261 3300006028 Ga0070717_10020908 Ga0070717_100209083 99
262 3300006028 Ga0070717_10023774 Ga0070717_100237746 99
263 3300006028 Ga0070717_10105783 Ga0070717_101057831 99
264 3300006028 Ga0070717_10306021 Ga0070717_103060212 99
265 3300006028 Ga0070717_11573191 Ga0070717_115731912 99
266 3300006163 Ga0070715_10014573 Ga0070715_100145734 99
267 3300006173 Ga0070716_100020680 Ga0070716_1000206803 99
268 3300006173 Ga0070716_100047188 Ga0070716_1000471883 99
269 3300006175 Ga0070712_100174603 Ga0070712_1001746031 99
270 3300006175 Ga0070712_100225115 Ga0070712_1002251152 99
271 3300006175 Ga0070712_100313291 Ga0070712_1003132912 99
272 3300006175 Ga0070712_100332211 Ga0070712_1003322113 99
273 3300006358 Ga0068871_100211151 Ga0068871_1002111513 99
274 3300006358 Ga0068871_100317163 Ga0068871_1003171632 99
275 3300006844 Ga0075428_100523095 Ga0075428_1005230952 99
276 3300006871 Ga0075434_100112032 Ga0075434_1001120324 99
277 3300009093 Ga0105240_10007770 Ga0105240_100077704 99
278 3300009093 Ga0105240_10095737 Ga0105240_100957375 99
279 3300009093 Ga0105240_10299716 Ga0105240_102997163 99
280 3300009093 Ga0105240_10985015 Ga0105240_109850153 99
281 3300009093 Ga0105240_11518419 Ga0105240_115184192 99
282 3300009094 Ga0111539_10025766 Ga0111539_100257665 99
283 3300009094 Ga0111539_10444558 Ga0111539_104445583 99
284 3300009098 Ga0105245_10056221 Ga0105245_100562213 99
285 3300009098 Ga0105245_10586584 Ga0105245_105865843 99
286 3300009101 Ga0105247_10049827 Ga0105247_100498274 99
287 3300009147 Ga0114129_10387450 Ga0114129_103874503 99
288 3300009174 Ga0105241_10232854 Ga0105241_102328543 99
289 3300009174 Ga0105241_11898426 Ga0105241_118984262 99
290 3300009176 Ga0105242_11225859 Ga0105242_112258591 99
291 3300009177 Ga0105248_10066829 Ga0105248_100668294 99
292 3300009177 Ga0105248_11246020 Ga0105248_112460202 99
293 3300009177 Ga0105248_12173912 Ga0105248_121739121 99
294 3300009177 Ga0105248_12731449 Ga0105248_127314491 99
295 3300009545 Ga0105237_10032857 Ga0105237_100328574 99
296 3300009545 Ga0105237_11657521 Ga0105237_116575212 99
297 3300009551 Ga0105238_10041072 Ga0105238_100410724 99
298 3300009551 Ga0105238_10936829 Ga0105238_109368291 99
299 3300009551 Ga0105238_11215201 Ga0105238_112152012 99
300 3300012513 Ga0157326_1085520 Ga0157326_10855202 99
301 3300013100 Ga0157373_10213475 Ga0157373_102134754 99
302 3300013100 Ga0157373_10323680 Ga0157373_103236802 99
303 3300013102 Ga0157371_10233720 Ga0157371_102337201 99
304 3300013102 Ga0157371_10337998 Ga0157371_103379982 99
305 3300013102 Ga0157371_10610075 Ga0157371_106100751 99
306 3300013104 Ga0157370_10012477 Ga0157370_100124777 99
307 3300013104 Ga0157370_10249700 Ga0157370_102497002 99
308 3300013104 Ga0157370_10578765 Ga0157370_105787651 99
309 3300013105 Ga0157369_10044290 Ga0157369_100442906 99
310 3300013105 Ga0157369_10077272 Ga0157369_100772725 99
311 3300013105 Ga0157369_10138744 Ga0157369_101387444 99
312 3300013105 Ga0157369_10707896 Ga0157369_107078963 99
313 3300013105 Ga0157369_11171718 Ga0157369_111717181 99
314 3300013296 Ga0157374_10032819 Ga0157374_100328196 99
315 3300013296 Ga0157374_12277291 Ga0157374_122772912 99
316 3300013306 Ga0163162_10213266 Ga0163162_102132664 99
317 3300013307 Ga0157372_10174552 Ga0157372_101745525 99
318 3300013307 Ga0157372_10250043 Ga0157372_102500434 99
319 3300013307 Ga0157372_10290131 Ga0157372_102901313 99
320 3300013307 Ga0157372_10401669 Ga0157372_104016694 99
321 3300013307 Ga0157372_11282877 Ga0157372_112828771 99
322 3300013307 Ga0157372_12861775 Ga0157372_128617752 99
323 3300013308 Ga0157375_11403085 Ga0157375_114030852 99
324 3300014497 Ga0182008_10002395 Ga0182008_1000239510 99
325 3300014497 Ga0182008_10067351 Ga0182008_100673512 99
326 3300014497 Ga0182008_10233466 Ga0182008_102334661 99
327 3300014497 Ga0182008_10241219 Ga0182008_102412192 99
328 3300014745 Ga0157377_10398077 Ga0157377_103980773 99
329 3300014968 Ga0157379_12206874 Ga0157379_122068742 99
330 3300014969 Ga0157376_10018483 Ga0157376_100184838 99
331 3300014969 Ga0157376_11443710 Ga0157376_114437102 99
332 3300015261 Ga0182006_1007014 Ga0182006_10070143 99
333 3300015261 Ga0182006_1300790 Ga0182006_13007902 99
334 3300015262 Ga0182007_10012095 Ga0182007_100120953 99
335 3300015262 Ga0182007_10310654 Ga0182007_103106541 99
336 3300017792 Ga0163161_10112500 Ga0163161_101125003 99
337 3300020069 Ga0197907_10283293 Ga0197907_102832932 99
338 3300020070 Ga0206356_10864395 Ga0206356_108643952 99
339 3300020070 Ga0206356_10933417 Ga0206356_109334172 99
340 3300020070 Ga0206356_11619042 Ga0206356_116190427 99
341 3300020081 Ga0206354_11139136 Ga0206354_111391363 99
342 3300020081 Ga0206354_11487989 Ga0206354_114879892 99
343 3300020082 Ga0206353_10752732 Ga0206353_107527324 99
344 3300020082 Ga0206353_10953357 Ga0206353_109533577 99
345 3300020610 Ga0154015_1573975 Ga0154015_15739752 99
346 3300021441 Ga0213871_10093261 Ga0213871_100932611 99
347 3300022467 Ga0224712_10003063 Ga0224712_100030636 99
348 3300025898 Ga0207692_10015333 Ga0207692_100153334 99
349 3300025900 Ga0207710_10471995 Ga0207710_104719951 99
350 3300025905 Ga0207685_10000585 Ga0207685_100005852 99
351 3300025906 Ga0207699_10055108 Ga0207699_100551082 99
352 3300025906 Ga0207699_10441744 Ga0207699_104417441 99
353 3300025906 Ga0207699_10477751 Ga0207699_104777512 99
354 3300025909 Ga0207705_10026024 Ga0207705_100260245 99
355 3300025909 Ga0207705_10037406 Ga0207705_100374063 99
356 3300025909 Ga0207705_10039859 Ga0207705_100398593 99
357 3300025909 Ga0207705_10109232 Ga0207705_101092322 99
358 3300025909 Ga0207705_10206687 Ga0207705_102066872 99
359 3300025910 Ga0207684_10485875 Ga0207684_104858752 99
360 3300025910 Ga0207684_10958173 Ga0207684_109581732 99
361 3300025912 Ga0207707_10046974 Ga0207707_100469744 99
362 3300025912 Ga0207707_10086836 Ga0207707_100868364 99
363 3300025912 Ga0207707_10192791 Ga0207707_101927913 99
364 3300025912 Ga0207707_11047522 Ga0207707_110475222 99
365 3300025912 Ga0207707_11387733 Ga0207707_113877331 99
366 3300025913 Ga0207695_10020007 Ga0207695_100200079 99
367 3300025913 Ga0207695_10229159 Ga0207695_102291593 99
368 3300025915 Ga0207693_10002991 Ga0207693_100029917 99
369 3300025915 Ga0207693_10183195 Ga0207693_101831953 99
370 3300025915 Ga0207693_10458463 Ga0207693_104584632 99
371 3300025915 Ga0207693_10655023 Ga0207693_106550232 99
372 3300025916 Ga0207663_10025210 Ga0207663_100252102 99
373 3300025917 Ga0207660_10011588 Ga0207660_100115886 99
374 3300025917 Ga0207660_10065159 Ga0207660_100651591 99
375 3300025917 Ga0207660_10209421 Ga0207660_102094213 99
376 3300025917 Ga0207660_10315776 Ga0207660_103157761 99
377 3300025917 Ga0207660_11699179 Ga0207660_116991791 99
378 3300025919 Ga0207657_10007972 Ga0207657_1000797212 99
379 3300025919 Ga0207657_10011057 Ga0207657_100110579 99
380 3300025919 Ga0207657_10017187 Ga0207657_100171874 99
381 3300025919 Ga0207657_10070513 Ga0207657_100705133 99
382 3300025919 Ga0207657_10338694 Ga0207657_103386943 99
383 3300025920 Ga0207649_10029273 Ga0207649_100292734 99
384 3300025920 Ga0207649_10171989 Ga0207649_101719892 99
385 3300025921 Ga0207652_10153809 Ga0207652_101538092 99
386 3300025921 Ga0207652_10191058 Ga0207652_101910582 99
387 3300025921 Ga0207652_10202188 Ga0207652_102021881 99
388 3300025921 Ga0207652_10500455 Ga0207652_105004553 99
389 3300025921 Ga0207652_10590565 Ga0207652_105905651 99
390 3300025921 Ga0207652_11169981 Ga0207652_111699813 99
391 3300025922 Ga0207646_10215625 Ga0207646_102156251 99
392 3300025922 Ga0207646_10225468 Ga0207646_102254683 99
393 3300025922 Ga0207646_10304218 Ga0207646_103042182 99
394 3300025922 Ga0207646_10441760 Ga0207646_104417602 99
395 3300025922 Ga0207646_10553132 Ga0207646_105531322 99
396 3300025922 Ga0207646_10797825 Ga0207646_107978252 99
397 3300025924 Ga0207694_11460793 Ga0207694_114607932 99
398 3300025927 Ga0207687_10428304 Ga0207687_104283043 99
399 3300025928 Ga0207700_10000002 Ga0207700_10000002165 99
400 3300025928 Ga0207700_10047743 Ga0207700_100477435 99
401 3300025928 Ga0207700_10302606 Ga0207700_103026062 99
402 3300025928 Ga0207700_11206905 Ga0207700_112069052 99
403 3300025928 Ga0207700_11416250 Ga0207700_114162502 99
404 3300025929 Ga0207664_10006174 Ga0207664_100061742 99
405 3300025929 Ga0207664_10032406 Ga0207664_100324063 99
406 3300025929 Ga0207664_10039220 Ga0207664_100392205 99
407 3300025929 Ga0207664_10039805 Ga0207664_100398053 99
408 3300025929 Ga0207664_10048590 Ga0207664_100485904 99
409 3300025929 Ga0207664_10106287 Ga0207664_101062872 99
410 3300025929 Ga0207664_10113318 Ga0207664_101133182 99
411 3300025929 Ga0207664_10127435 Ga0207664_101274353 99
412 3300025929 Ga0207664_10190821 Ga0207664_101908211 99
413 3300025929 Ga0207664_10273944 Ga0207664_102739441 99
414 3300025929 Ga0207664_10293628 Ga0207664_102936283 99
415 3300025929 Ga0207664_10749569 Ga0207664_107495692 99
416 3300025929 Ga0207664_11818597 Ga0207664_118185971 99
417 3300025929 Ga0207664_11975302 Ga0207664_119753021 99
418 3300025931 Ga0207644_10072648 Ga0207644_100726483 99
419 3300025939 Ga0207665_10000336 Ga0207665_1000033619 99
420 3300025939 Ga0207665_10014097 Ga0207665_100140971 99
421 3300025939 Ga0207665_10697408 Ga0207665_106974081 99
422 3300025941 Ga0207711_11931514 Ga0207711_119315141 99
423 3300025944 Ga0207661_10087031 Ga0207661_100870313 99
424 3300025944 Ga0207661_10091855 Ga0207661_100918552 99
425 3300025944 Ga0207661_10322409 Ga0207661_103224093 99
426 3300025944 Ga0207661_10399644 Ga0207661_103996443 99
427 3300025944 Ga0207661_10571805 Ga0207661_105718051 99
428 3300025944 Ga0207661_10801812 Ga0207661_108018121 99
429 3300025949 Ga0207667_10168616 Ga0207667_101686164 99
430 3300025949 Ga0207667_10442639 Ga0207667_104426393 99
431 3300025949 Ga0207667_11408199 Ga0207667_114081991 99
432 3300025961 Ga0207712_10820122 Ga0207712_108201223 99
433 3300025981 Ga0207640_10638152 Ga0207640_106381521 99
434 3300026041 Ga0207639_12032513 Ga0207639_120325132 99
435 3300026078 Ga0207702_10398619 Ga0207702_103986193 99
436 3300026078 Ga0207702_10448189 Ga0207702_104481892 99
437 3300026078 Ga0207702_11402579 Ga0207702_114025792 99
438 3300026095 Ga0207676_10158246 Ga0207676_101582463 99
439 3300026116 Ga0207674_10526597 Ga0207674_105265972 99
440 3300026116 Ga0207674_11905607 Ga0207674_119056072 99
441 3300026121 Ga0207683_10427060 Ga0207683_104270603 99
442 3300026121 Ga0207683_11857800 Ga0207683_118578002 99
443 3300026142 Ga0207698_10066518 Ga0207698_100665181 99
444 3300026142 Ga0207698_10075391 Ga0207698_100753914 99
445 3300027907 Ga0207428_10029986 Ga0207428_100299862 99
446 3300028556 Ga0265337_1068031 Ga0265337_10680312 99
447 3300028563 Ga0265319_1007014 Ga0265319_10070146 99
448 3300028563 Ga0265319_1045523 Ga0265319_10455232 99
449 3300028563 Ga0265319_1065316 Ga0265319_10653162 99
450 3300028563 Ga0265319_1274886 Ga0265319_12748861 99
451 3300028573 Ga0265334_10002797 Ga0265334_100027977 99
452 3300028573 Ga0265334_10032929 Ga0265334_100329294 99
453 3300028573 Ga0265334_10205416 Ga0265334_102054162 99
454 3300028573 Ga0265334_10261808 Ga0265334_102618081 99
455 3300028577 Ga0265318_10000604 Ga0265318_100006047 99
456 3300028577 Ga0265318_10000968 Ga0265318_100009689 99
457 3300028577 Ga0265318_10065658 Ga0265318_100656584 99
458 3300028577 Ga0265318_10129217 Ga0265318_101292172 99
459 3300028653 Ga0265323_10036409 Ga0265323_100364094 99
460 3300028654 Ga0265322_10009234 Ga0265322_100092342 99
461 3300028654 Ga0265322_10128455 Ga0265322_101284552 99
462 3300028654 Ga0265322_10158670 Ga0265322_101586702 99
463 3300028654 Ga0265322_10213306 Ga0265322_102133061 99
464 3300028666 Ga0265336_10018326 Ga0265336_100183263 99
465 3300028666 Ga0265336_10076088 Ga0265336_100760882 99
466 3300028666 Ga0265336_10115943 Ga0265336_101159432 99
467 3300028666 Ga0265336_10174194 Ga0265336_101741941 99
468 3300028666 Ga0265336_10205984 Ga0265336_102059841 99
469 3300028800 Ga0265338_10003462 Ga0265338_100034627 99
470 3300028800 Ga0265338_10005686 Ga0265338_1000568616 99
471 3300028800 Ga0265338_10006184 Ga0265338_1000618414 99
472 3300028800 Ga0265338_10007091 Ga0265338_100070914 99
473 3300028800 Ga0265338_10010810 Ga0265338_100108108 99
474 3300028800 Ga0265338_10014548 Ga0265338_100145485 99
475 3300028800 Ga0265338_10219615 Ga0265338_102196151 99
476 3300028800 Ga0265338_10595353 Ga0265338_105953531 99
477 3300029957 Ga0265324_10080610 Ga0265324_100806102 99
478 3300029957 Ga0265324_10128708 Ga0265324_101287081 99
479 3300031235 Ga0265330_10004102 Ga0265330_100041024 99
480 3300031235 Ga0265330_10516806 Ga0265330_105168061 99
481 3300031238 Ga0265332_10003579 Ga0265332_100035794 99
482 3300031238 Ga0265332_10389918 Ga0265332_103899181 99
483 3300031239 Ga0265328_10003809 Ga0265328_100038094 99
484 3300031240 Ga0265320_10003921 Ga0265320_100039219 99
485 3300031240 Ga0265320_10004476 Ga0265320_100044766 99
486 3300031240 Ga0265320_10051042 Ga0265320_100510423 99
487 3300031241 Ga0265325_10006354 Ga0265325_100063546 99
488 3300031241 Ga0265325_10076428 Ga0265325_100764282 99
489 3300031241 Ga0265325_10110880 Ga0265325_101108803 99
490 3300031242 Ga0265329_10003633 Ga0265329_100036336 99
491 3300031242 Ga0265329_10034868 Ga0265329_100348682 99
492 3300031247 Ga0265340_10005417 Ga0265340_100054176 99
493 3300031249 Ga0265339_10016814 Ga0265339_100168145 99
494 3300031249 Ga0265339_10061903 Ga0265339_100619033 99
495 3300031249 Ga0265339_10413030 Ga0265339_104130302 99
496 3300031250 Ga0265331_10007022 Ga0265331_100070227 99
497 3300031250 Ga0265331_10018747 Ga0265331_100187472 99
498 3300031250 Ga0265331_10129465 Ga0265331_101294652 99
499 3300031250 Ga0265331_10327769 Ga0265331_103277691 99
500 3300031251 Ga0265327_10013358 Ga0265327_100133585 99
501 3300031251 Ga0265327_10024976 Ga0265327_100249764 99
502 3300031251 Ga0265327_10412796 Ga0265327_104127962 99
503 3300031344 Ga0265316_10002341 Ga0265316_1000234119 99
504 3300031344 Ga0265316_10107154 Ga0265316_101071543 99
505 3300031344 Ga0265316_10329194 Ga0265316_103291943 99
506 3300031344 Ga0265316_10971713 Ga0265316_109717131 99
507 3300031595 Ga0265313_10007877 Ga0265313_100078776 99
508 3300031595 Ga0265313_10012894 Ga0265313_100128944 99
509 3300031595 Ga0265313_10013344 Ga0265313_100133444 99
510 3300031595 Ga0265313_10029304 Ga0265313_100293043 99
511 3300031711 Ga0265314_10007984 Ga0265314_100079843 99
512 3300031711 Ga0265314_10025861 Ga0265314_100258614 99
513 3300031711 Ga0265314_10089993 Ga0265314_100899932 99
514 3300031711 Ga0265314_10101987 Ga0265314_101019872 99
515 3300031712 Ga0265342_10005023 Ga0265342_100050237 99
516 3300031712 Ga0265342_10049105 Ga0265342_100491052 99
517 3300031712 Ga0265342_10076530 Ga0265342_100765304 99
518 3300034818 Ga0373950_0076174 Ga0373950_0076174_303_602 99
519 3300035083 Ga0373926_0378313 Ga0373926_0378313_195_494 99
520 3300035114 Ga0373939_0009501 Ga0373939_0009501_1076_1375 99
521 3300035116 Ga0373945_0104171 Ga0373945_0104171_687_986 99
522 3300035117 Ga0373953_0125925 Ga0373953_0125925_39_338 99
523 3300035119 Ga0373956_0071452 Ga0373956_0071452_391_690 99
524 3300035120 Ga0373957_0092945 Ga0373957_0092945_756_1055 99
525 3300035120 Ga0373957_0319511 Ga0373957_0319511_94_393 99
526 3300035120 Ga0373957_0514371 Ga0373957_0514371_184_483 99
527 3300035121 Ga0373960_0022012 Ga0373960_0022012_137_436 99
528 3300035121 Ga0373960_0040923 Ga0373960_0040923_39_338 99
529 3300035121 Ga0373960_0196255 Ga0373960_0196255_319_618 99
530 3300035170 Ga0373943_0000829 Ga0373943_0000829_658_957 99
531 3300035170 Ga0373943_0293523 Ga0373943_0293523_259_558 99
532 3300035172 Ga0373955_0019481 Ga0373955_0019481_1281_1580 99
533 3300035172 Ga0373955_0221916 Ga0373955_0221916_11_310 99
534 3300035172 Ga0373955_0901872 Ga0373955_0901872_197_499 99
535 3300035207 Ga0373942_0071180 Ga0373942_0071180_70_369 99
536 3300035410 Ga0373924_0435236 Ga0373924_0435236_266_565 99
537 3300035691 Ga0373931_0457403 Ga0373931_0457403_444_743 99
538 3300035691 Ga0373931_0458111 Ga0373931_0458111_12_311 99
539 3300035692 Ga0373935_0221248 Ga0373935_0221248_658_957 99
540 3300035695 Ga0373927_0381012 Ga0373927_0381012_428_727 99
541 3300035724 Ga0373933_0036055 Ga0373933_0036055_234_533 99
542 3300035724 Ga0373933_0646094 Ga0373933_0646094_65_364 99
543 3300035724 Ga0373933_1062572 Ga0373933_1062572_61_363 99
544 3300035725 Ga0373947_0000984 Ga0373947_0000984_1977_2276 99
545 3300035725 Ga0373947_0407910 Ga0373947_0407910_323_622 99
546 3300035725 Ga0373947_1226988 Ga0373947_1226988_56_355 99
547 3300036401 Ga0373937_0004827 Ga0373937_0004827_7116_7415 99
548 3300036401 Ga0373937_0015379 Ga0373937_0015379_5744_6043 99
549 3300036401 Ga0373937_0132585 Ga0373937_0132585_387_686 99
550 3300036401 Ga0373937_1418610 Ga0373937_1418610_317_616 99
551 3300037068 Ga0373925_0010018 Ga0373925_0010018_2690_2989 99
552 3300037312 Ga0395899_0016363 Ga0395899_0016363_3702_4001 99
553 3300037312 Ga0395899_0047945 Ga0395899_0047945_451_750 99
554 3300037312 Ga0395899_0161295 Ga0395899_0161295_1168_1467 99
555 3300037418 Ga0395900_0095627 Ga0395900_0095627_1985_2284 99
556 3300037418 Ga0395900_0147160 Ga0395900_0147160_1974_2273 99
557 3300037418 Ga0395900_0300820 Ga0395900_0300820_444_749 99
558 3300037418 Ga0395900_0441507 Ga0395900_0441507_720_1019 99
559 3300037418 Ga0395900_0948931 Ga0395900_0948931_111_410 99
560 3300037418 Ga0395900_1259629 Ga0395900_1259629_237_536 99
561 3300037466 Ga0395898_0029255 Ga0395898_0029255_1562_1861 99
562 3300037466 Ga0395898_0089588 Ga0395898_0089588_1765_2064 99
563 3300037466 Ga0395898_0105649 Ga0395898_0105649_828_1133 99
564 3300037466 Ga0395898_0136846 Ga0395898_0136846_1249_1548 99
565 3300037466 Ga0395898_0303429 Ga0395898_0303429_251_550 99
566 3300037466 Ga0395898_0365992 Ga0395898_0365992_399_698 99
567 3300037466 Ga0395898_0726818 Ga0395898_0726818_15_314 99
568 3300037466 Ga0395898_0821786 Ga0395898_0821786_261_560 99
569 3300037466 Ga0395898_1596162 Ga0395898_1596162_30_329 99
570 3300037466 Ga0395898_1700882 Ga0395898_1700882_67_366 99
571 3300037466 Ga0395898_1729812 Ga0395898_1729812_154_453 99
572 3300037471 Ga0395905_0012643 Ga0395905_0012643_2498_2797 99
573 3300037471 Ga0395905_0020541 Ga0395905_0020541_4793_5092 99
574 3300037471 Ga0395905_0172811 Ga0395905_0172811_869_1174 99
575 3300037471 Ga0395905_1066785 Ga0395905_1066785_21_320 99
576 3300038443 Ga0395901_0085688 Ga0395901_0085688_1765_2064 99
577 3300038443 Ga0395901_0104451 Ga0395901_0104451_944_1243 99
578 3300038443 Ga0395901_0206329 Ga0395901_0206329_1517_1822 99
579 3300038443 Ga0395901_0210507 Ga0395901_0210507_1132_1431 99
580 3300038443 Ga0395901_0311953 Ga0395901_0311953_123_422 99
581 3300038443 Ga0395901_0395880 Ga0395901_0395880_506_805 99
582 3300038443 Ga0395901_0815489 Ga0395901_0815489_85_384 99
583 3300038443 Ga0395901_1030888 Ga0395901_1030888_253_552 99
584 3300038443 Ga0395901_1050423 Ga0395901_1050423_351_650 99
585 3300038996 Ga0242420_092276 Ga0242420_092276_17_316 99
586 3300039437 Ga0436365_0098300 Ga0436365_0098300_46_345 99
587 3300039438 Ga0436360_0759873 Ga0436360_0759873_936_1235 99
588 3300039438 Ga0436360_1273503 Ga0436360_1273503_511_831 99
589 3300039450 Ga0436363_0525738 Ga0436363_0525738_373_672 99
590 3300039453 Ga0436362_1298139 Ga0436362_1298139_89_388 99
591 3300041460 Ga0451802_1315935 Ga0451802_1315935_226_525 99
592 3300042005 Ga0439448_0339757 Ga0439448_0339757_148_447 99
593 3300042146 Ga0450907_089521 Ga0450907_089521_17_316 99
594 3300044656 Ga0466969_0008320 Ga0466969_0008320_1399_1698 99
595 3300044656 Ga0466969_0028314 Ga0466969_0028314_391_690 99
596 3300044656 Ga0466969_0079059 Ga0466969_0079059_1159_1458 99
597 3300044656 Ga0466969_0093558 Ga0466969_0093558_868_1167 99
598 3300044656 Ga0466969_0204172 Ga0466969_0204172_172_471 99
599 3300044683 Ga0466965_0006762 Ga0466965_0006762_4587_4886 99
600 3300044683 Ga0466965_0047491 Ga0466965_0047491_175_474 99
601 3300044683 Ga0466965_0582917 Ga0466965_0582917_188_487 99
602 3300044683 Ga0466965_0624773 Ga0466965_0624773_216_515 99
603 3300044684 Ga0466966_0010121 Ga0466966_0010121_4992_5291 99
604 3300044684 Ga0466966_0027613 Ga0466966_0027613_567_866 99
605 3300044684 Ga0466966_0332827 Ga0466966_0332827_377_676 99
606 3300044684 Ga0466966_0941860 Ga0466966_0941860_40_339 99
607 3300044693 Ga0466961_0002598 Ga0466961_0002598_9044_9343 99
608 3300044693 Ga0466961_0009627 Ga0466961_0009627_406_705 99
609 3300044693 Ga0466961_0011449 Ga0466961_0011449_488_787 99
610 3300044693 Ga0466961_0029655 Ga0466961_0029655_3073_3372 99
611 3300044693 Ga0466961_0305177 Ga0466961_0305177_606_905 99
612 3300044693 Ga0466961_0369298 Ga0466961_0369298_411_737 99
613 3300044693 Ga0466961_0373865 Ga0466961_0373865_41_340 99
614 3300044693 Ga0466961_0723268 Ga0466961_0723268_236_535 99
615 3300044693 Ga0466961_0739063 Ga0466961_0739063_237_536 99
616 3300044694 Ga0466963_0000638 Ga0466963_0000638_3356_3655 99
617 3300044694 Ga0466963_0001960 Ga0466963_0001960_9122_9421 99
618 3300044694 Ga0466963_0002874 Ga0466963_0002874_2644_2943 99
619 3300044694 Ga0466963_0007500 Ga0466963_0007500_595_894 99
620 3300044694 Ga0466963_0008277 Ga0466963_0008277_2035_2334 99
621 3300044694 Ga0466963_0010088 Ga0466963_0010088_1353_1652 99
622 3300044694 Ga0466963_0015895 Ga0466963_0015895_95_394 99
623 3300044694 Ga0466963_0018310 Ga0466963_0018310_3277_3576 99
624 3300044694 Ga0466963_0041043 Ga0466963_0041043_909_1208 99
625 3300044694 Ga0466963_0061838 Ga0466963_0061838_1890_2189 99
626 3300044694 Ga0466963_0074842 Ga0466963_0074842_150_449 99
627 3300044694 Ga0466963_0124604 Ga0466963_0124604_242_541 99
628 3300044694 Ga0466963_0126152 Ga0466963_0126152_1232_1531 99
629 3300044694 Ga0466963_0135344 Ga0466963_0135344_1082_1381 99
630 3300044694 Ga0466963_0305487 Ga0466963_0305487_407_733 99
631 3300044694 Ga0466963_0315279 Ga0466963_0315279_248_547 99
632 3300044694 Ga0466963_0491748 Ga0466963_0491748_313_612 99
633 3300044694 Ga0466963_0702076 Ga0466963_0702076_140_439 99
634 3300044694 Ga0466963_0733865 Ga0466963_0733865_288_587 99
635 3300044694 Ga0466963_1263664 Ga0466963_1263664_19_318 99
636 3300044694 Ga0466963_1285127 Ga0466963_1285127_16_315 99
637 3300044694 Ga0466963_1290516 Ga0466963_1290516_149_448 99
638 3300044706 Ga0466964_0009667 Ga0466964_0009667_1818_2117 99
639 3300044706 Ga0466964_0011996 Ga0466964_0011996_2250_2549 99
640 3300044706 Ga0466964_0012986 Ga0466964_0012986_2281_2580 99
641 3300044706 Ga0466964_0043632 Ga0466964_0043632_1474_1773 99
642 3300044706 Ga0466964_0048436 Ga0466964_0048436_220_519 99
643 3300044706 Ga0466964_0082260 Ga0466964_0082260_481_780 99
644 3300044706 Ga0466964_0125995 Ga0466964_0125995_45_344 99
645 3300044706 Ga0466964_0159160 Ga0466964_0159160_695_994 99
646 3300044712 Ga0453684_0919400 Ga0453684_0919400_76_375 99
647 3300044719 Ga0466971_0003820 Ga0466971_0003820_3228_3527 99
648 3300044719 Ga0466971_0006453 Ga0466971_0006453_481_780 99
649 3300044719 Ga0466971_0009099 Ga0466971_0009099_2153_2452 99
650 3300044719 Ga0466971_0106507 Ga0466971_0106507_251_550 99
651 3300044719 Ga0466971_0197398 Ga0466971_0197398_300_626 99
652 3300044719 Ga0466971_0201894 Ga0466971_0201894_40_339 99
653 3300044719 Ga0466971_0300313 Ga0466971_0300313_228_527 99
654 3300044719 Ga0466971_0530280 Ga0466971_0530280_187_486 99
655 3300044735 Ga0466968_0007699 Ga0466968_0007699_2510_2809 99
656 3300044735 Ga0466968_0007930 Ga0466968_0007930_2043_2342 99
657 3300044735 Ga0466968_0104565 Ga0466968_0104565_733_1032 99
658 3300044735 Ga0466968_0138544 Ga0466968_0138544_56_355 99
659 3300044735 Ga0466968_0235870 Ga0466968_0235870_45_344 99
660 3300044735 Ga0466968_0318970 Ga0466968_0318970_334_633 99
661 3300044765 Ga0466970_0031380 Ga0466970_0031380_781_1080 99
662 3300044765 Ga0466970_0127310 Ga0466970_0127310_928_1227 99
663 3300044765 Ga0466970_0432096 Ga0466970_0432096_323_622 99
664 3300044765 Ga0466970_0837061 Ga0466970_0837061_51_350 99
665 3300044842 Ga0466957_0004248 Ga0466957_0004248_415_714 99
666 3300044842 Ga0466957_0016146 Ga0466957_0016146_3981_4280 99
667 3300044842 Ga0466957_0045674 Ga0466957_0045674_1052_1351 99
668 3300044842 Ga0466957_0046935 Ga0466957_0046935_1043_1342 99
669 3300044842 Ga0466957_0056358 Ga0466957_0056358_483_782 99
670 3300044842 Ga0466957_0065101 Ga0466957_0065101_137_457 99
671 3300044842 Ga0466957_0069326 Ga0466957_0069326_108_407 99
672 3300044842 Ga0466957_0083788 Ga0466957_0083788_288_587 99
673 3300044842 Ga0466957_0130720 Ga0466957_0130720_498_797 99
674 3300044842 Ga0466957_0173250 Ga0466957_0173250_485_784 99
675 3300044842 Ga0466957_0226265 Ga0466957_0226265_132_431 99
676 3300044842 Ga0466957_1314679 Ga0466957_1314679_128_427 99
677 3300044901 Ga0466960_0014667 Ga0466960_0014667_2956_3255 99
678 3300044901 Ga0466960_0034473 Ga0466960_0034473_1216_1515 99
679 3300044901 Ga0466960_0069363 Ga0466960_0069363_1284_1583 99
680 3300044901 Ga0466960_0272081 Ga0466960_0272081_316_615 99
681 3300044901 Ga0466960_1007120 Ga0466960_1007120_164_463 99
682 3300045049 Ga0466959_0003027 Ga0466959_0003027_3235_3534 99
683 3300045049 Ga0466959_0007099 Ga0466959_0007099_966_1265 99
684 3300045049 Ga0466959_0007785 Ga0466959_0007785_4558_4857 99
685 3300045049 Ga0466959_0028569 Ga0466959_0028569_1831_2130 99
686 3300045049 Ga0466959_0045281 Ga0466959_0045281_2088_2387 99
687 3300045049 Ga0466959_0098643 Ga0466959_0098643_1500_1826 99
688 3300045049 Ga0466959_0160810 Ga0466959_0160810_1037_1336 99
689 3300045836 Ga0466958_0005189 Ga0466958_0005189_137_436 99
690 3300045836 Ga0466958_0006933 Ga0466958_0006933_3058_3357 99
691 3300045836 Ga0466958_0007722 Ga0466958_0007722_978_1277 99
692 3300045836 Ga0466958_0013137 Ga0466958_0013137_1030_1329 99
693 3300045836 Ga0466958_0025514 Ga0466958_0025514_605_904 99
694 3300045836 Ga0466958_0041133 Ga0466958_0041133_667_966 99
695 3300045836 Ga0466958_0081052 Ga0466958_0081052_948_1247 99
696 3300045836 Ga0466958_0118993 Ga0466958_0118993_825_1124 99
697 3300045836 Ga0466958_0135384 Ga0466958_0135384_201_500 99
698 3300045836 Ga0466958_0326158 Ga0466958_0326158_383_682 99
699 3300045836 Ga0466958_0930329 Ga0466958_0930329_190_489 99
700 3300045976 Ga0466967_0000179 Ga0466967_0000179_8244_8543 99
701 3300045976 Ga0466967_0001152 Ga0466967_0001152_1915_2214 99
702 3300045976 Ga0466967_0004521 Ga0466967_0004521_1444_1743 99
703 3300045976 Ga0466967_0010503 Ga0466967_0010503_1540_1839 99
704 3300045976 Ga0466967_0010586 Ga0466967_0010586_82_381 99
705 3300045976 Ga0466967_0013317 Ga0466967_0013317_5036_5335 99
706 3300045976 Ga0466967_0014204 Ga0466967_0014204_2892_3191 99
707 3300045976 Ga0466967_0016668 Ga0466967_0016668_1966_2265 99
708 3300045976 Ga0466967_0018352 Ga0466967_0018352_4775_5074 99
709 3300045976 Ga0466967_0027751 Ga0466967_0027751_933_1232 99
710 3300045976 Ga0466967_0031328 Ga0466967_0031328_1563_1862 99
711 3300045976 Ga0466967_0052497 Ga0466967_0052497_1964_2263 99
712 3300045976 Ga0466967_0063760 Ga0466967_0063760_2661_2960 99
713 3300045976 Ga0466967_0080521 Ga0466967_0080521_846_1145 99
714 3300045976 Ga0466967_0083995 Ga0466967_0083995_1814_2134 99
715 3300045976 Ga0466967_0124820 Ga0466967_0124820_1809_2135 99
716 3300045976 Ga0466967_0143030 Ga0466967_0143030_486_785 99
717 3300045976 Ga0466967_0168690 Ga0466967_0168690_1648_1947 99
718 3300045976 Ga0466967_0176788 Ga0466967_0176788_166_465 99
719 3300045976 Ga0466967_0183394 Ga0466967_0183394_330_629 99
720 3300045976 Ga0466967_0188349 Ga0466967_0188349_100_399 99
721 3300045976 Ga0466967_0189269 Ga0466967_0189269_983_1282 99
722 3300045976 Ga0466967_0227190 Ga0466967_0227190_636_935 99
723 3300045976 Ga0466967_0243407 Ga0466967_0243407_562_861 99
724 3300045976 Ga0466967_0327057 Ga0466967_0327057_103_402 99
725 3300045976 Ga0466967_0332887 Ga0466967_0332887_555_854 99
726 3300045976 Ga0466967_0337537 Ga0466967_0337537_1094_1393 99
727 3300045976 Ga0466967_0388249 Ga0466967_0388249_1026_1325 99
728 3300045976 Ga0466967_0595710 Ga0466967_0595710_413_712 99
729 3300045976 Ga0466967_0730565 Ga0466967_0730565_29_328 99
730 3300045976 Ga0466967_0789590 Ga0466967_0789590_117_416 99
731 3300045976 Ga0466967_1000869 Ga0466967_1000869_217_516 99
732 3300045976 Ga0466967_1062852 Ga0466967_1062852_483_782 99
733 3300045976 Ga0466967_1361528 Ga0466967_1361528_15_314 99
734 3300045976 Ga0466967_1439467 Ga0466967_1439467_185_484 99
735 3300045976 Ga0466967_1637288 Ga0466967_1637288_107_406 99
736 3300045976 Ga0466967_2037987 Ga0466967_2037987_47_346 99
737 3300046454 Ga0495592_0000467 Ga0495592_0000467_2083_2382 99
738 3300046454 Ga0495592_0004809 Ga0495592_0004809_2685_2984 99
739 3300046454 Ga0495592_0038526 Ga0495592_0038526_1204_1503 99
740 3300046454 Ga0495592_0524998 Ga0495592_0524998_366_668 99
741 3300046454 Ga0495592_0532538 Ga0495592_0532538_125_424 99
742 3300046455 Ga0495603_0122187 Ga0495603_0122187_451_750 99
743 3300046459 Ga0495629_0024661 Ga0495629_0024661_1420_1719 99
744 3300046459 Ga0495629_0042187 Ga0495629_0042187_898_1197 99
745 3300046459 Ga0495629_0051469 Ga0495629_0051469_1171_1470 99
746 3300046459 Ga0495629_0794009 Ga0495629_0794009_316_615 99
747 3300046461 Ga0495641_0048267 Ga0495641_0048267_658_957 99
748 3300046461 Ga0495641_0065685 Ga0495641_0065685_804_1103 99
749 3300046461 Ga0495641_0100956 Ga0495641_0100956_687_986 99
750 3300046461 Ga0495641_0156768 Ga0495641_0156768_384_683 99
751 3300046461 Ga0495641_0194596 Ga0495641_0194596_211_510 99
752 3300046462 Ga0495651_0000621 Ga0495651_0000621_2617_2916 99
753 3300046462 Ga0495651_0065300 Ga0495651_0065300_1980_2279 99
754 3300046462 Ga0495651_0218634 Ga0495651_0218634_423_722 99
755 3300046462 Ga0495651_0284014 Ga0495651_0284014_446_745 99
756 3300046462 Ga0495651_0475159 Ga0495651_0475159_437_736 99
757 3300046462 Ga0495651_0646106 Ga0495651_0646106_329_628 99
758 3300046462 Ga0495651_0791234 Ga0495651_0791234_87_386 99
759 3300046463 Ga0495653_0071507 Ga0495653_0071507_969_1268 99
760 3300046463 Ga0495653_0088791 Ga0495653_0088791_928_1227 99
761 3300046463 Ga0495653_0148364 Ga0495653_0148364_1178_1477 99
762 3300046463 Ga0495653_0161594 Ga0495653_0161594_88_387 99
763 3300046463 Ga0495653_0226612 Ga0495653_0226612_775_1074 99
764 3300046463 Ga0495653_0321024 Ga0495653_0321024_329_628 99
765 3300046463 Ga0495653_0337587 Ga0495653_0337587_331_630 99
766 3300046463 Ga0495653_0350983 Ga0495653_0350983_346_645 99
767 3300046463 Ga0495653_0759791 Ga0495653_0759791_117_416 99
768 3300046472 Ga0495580_0097510 Ga0495580_0097510_297_596 99
769 3300046473 Ga0495582_0006911 Ga0495582_0006911_531_830 99
770 3300046473 Ga0495582_0018061 Ga0495582_0018061_2688_2987 99
771 3300046473 Ga0495582_0060129 Ga0495582_0060129_643_942 99
772 3300046473 Ga0495582_0121278 Ga0495582_0121278_90_389 99
773 3300046473 Ga0495582_0737679 Ga0495582_0737679_127_426 99
774 3300046475 Ga0495639_0009136 Ga0495639_0009136_1473_1772 99
775 3300046476 Ga0495662_0018780 Ga0495662_0018780_919_1218 99
776 3300046476 Ga0495662_0159618 Ga0495662_0159618_587_886 99
777 3300046476 Ga0495662_0617719 Ga0495662_0617719_78_377 99
778 3300046477 Ga0495664_0089788 Ga0495664_0089788_1394_1693 99
779 3300046477 Ga0495664_0159897 Ga0495664_0159897_1039_1338 99
780 3300046477 Ga0495664_0234408 Ga0495664_0234408_233_532 99
781 3300046477 Ga0495664_0735392 Ga0495664_0735392_263_562 99
782 3300046491 Ga0495584_0654457 Ga0495584_0654457_165_464 99
783 3300046492 Ga0495585_0057908 Ga0495585_0057908_977_1276 99
784 3300046499 Ga0495594_0258448 Ga0495594_0258448_651_950 99
785 3300046511 Ga0495608_0011270 Ga0495608_0011270_3327_3626 99
786 3300046511 Ga0495608_0042449 Ga0495608_0042449_1656_1955 99
787 3300046511 Ga0495608_0062849 Ga0495608_0062849_1132_1431 99
788 3300046511 Ga0495608_0127149 Ga0495608_0127149_109_408 99
789 3300046511 Ga0495608_0616873 Ga0495608_0616873_101_400 99
790 3300046514 Ga0495618_0000514 Ga0495618_0000514_21808_22107 99
791 3300046514 Ga0495618_0025530 Ga0495618_0025530_3237_3536 99
792 3300046514 Ga0495618_0036609 Ga0495618_0036609_1444_1743 99
793 3300046514 Ga0495618_0046686 Ga0495618_0046686_1334_1633 99
794 3300046514 Ga0495618_0110550 Ga0495618_0110550_1195_1494 99
795 3300046514 Ga0495618_0482599 Ga0495618_0482599_202_501 99
796 3300046516 Ga0495628_0000209 Ga0495628_0000209_26374_26673 99
797 3300046516 Ga0495628_0023732 Ga0495628_0023732_298_597 99
798 3300046516 Ga0495628_0154623 Ga0495628_0154623_1337_1636 99
799 3300046516 Ga0495628_0244842 Ga0495628_0244842_266_565 99
800 3300046516 Ga0495628_0351723 Ga0495628_0351723_405_704 99
801 3300046516 Ga0495628_0597604 Ga0495628_0597604_184_486 99
802 3300046517 Ga0495630_0029915 Ga0495630_0029915_166_465 99
803 3300046517 Ga0495630_0032508 Ga0495630_0032508_3574_3873 99
804 3300046517 Ga0495630_0077000 Ga0495630_0077000_640_939 99
805 3300046517 Ga0495630_0113955 Ga0495630_0113955_769_1071 99
806 3300046517 Ga0495630_0153890 Ga0495630_0153890_43_342 99
807 3300046517 Ga0495630_0187855 Ga0495630_0187855_1022_1321 99
808 3300046517 Ga0495630_0449837 Ga0495630_0449837_394_693 99
809 3300046517 Ga0495630_0509571 Ga0495630_0509571_178_477 99
810 3300046517 Ga0495630_1143774 Ga0495630_1143774_111_410 99
811 3300046523 Ga0495644_0255444 Ga0495644_0255444_100_399 99
812 3300046526 Ga0495666_0000649 Ga0495666_0000649_13209_13508 99
813 3300046529 Ga0495652_0001901 Ga0495652_0001901_19970_20269 99
814 3300046529 Ga0495652_0045105 Ga0495652_0045105_82_381 99
815 3300046529 Ga0495652_0068779 Ga0495652_0068779_2286_2588 99
816 3300046529 Ga0495652_0080097 Ga0495652_0080097_1324_1623 99
817 3300046529 Ga0495652_0129406 Ga0495652_0129406_461_760 99
818 3300046529 Ga0495652_0143141 Ga0495652_0143141_1493_1792 99
819 3300046529 Ga0495652_0172940 Ga0495652_0172940_15_314 99
820 3300046529 Ga0495652_0243299 Ga0495652_0243299_466_765 99
821 3300046529 Ga0495652_0276313 Ga0495652_0276313_824_1123 99
822 3300046529 Ga0495652_0550187 Ga0495652_0550187_28_327 99
823 3300046529 Ga0495652_0620493 Ga0495652_0620493_350_649 99
824 3300046529 Ga0495652_0732378 Ga0495652_0732378_63_362 99
825 3300046531 Ga0495665_0375708 Ga0495665_0375708_172_471 99
826 3300046533 Ga0495640_0024570 Ga0495640_0024570_143_442 99
827 3300046533 Ga0495640_0074914 Ga0495640_0074914_1567_1866 99
828 3300046533 Ga0495640_0256326 Ga0495640_0256326_427_726 99
829 3300046533 Ga0495640_0257193 Ga0495640_0257193_477_779 99
830 3300046533 Ga0495640_0883995 Ga0495640_0883995_170_469 99
831 3300046535 Ga0495586_0051724 Ga0495586_0051724_776_1075 99
832 3300046535 Ga0495586_0189050 Ga0495586_0189050_87_386 99
833 3300046535 Ga0495586_0228486 Ga0495586_0228486_31_330 99
834 3300046535 Ga0495586_0293847 Ga0495586_0293847_29_328 99
835 3300046535 Ga0495586_0523725 Ga0495586_0523725_133_432 99
836 3300046535 Ga0495586_0675005 Ga0495586_0675005_262_564 99
837 3300046536 Ga0495587_0000492 Ga0495587_0000492_10946_11245 99
838 3300046536 Ga0495587_0034131 Ga0495587_0034131_1152_1451 99
839 3300046536 Ga0495587_0038267 Ga0495587_0038267_1671_1970 99
840 3300046543 Ga0495645_0000126 Ga0495645_0000126_24501_24800 99
841 3300046543 Ga0495645_0047549 Ga0495645_0047549_2038_2337 99
842 3300046543 Ga0495645_0078324 Ga0495645_0078324_202_501 99
843 3300046543 Ga0495645_0246482 Ga0495645_0246482_777_1076 99
844 3300046559 Ga0495667_0025462 Ga0495667_0025462_3385_3684 99
845 3300046559 Ga0495667_0058958 Ga0495667_0058958_2206_2505 99
846 3300046559 Ga0495667_0069471 Ga0495667_0069471_1917_2216 99
847 3300046559 Ga0495667_0073553 Ga0495667_0073553_422_721 99
848 3300046559 Ga0495667_0077102 Ga0495667_0077102_1778_2077 99
849 3300046559 Ga0495667_0398011 Ga0495667_0398011_58_357 99
850 3300046559 Ga0495667_0753862 Ga0495667_0753862_277_576 99
851 3300046615 Ga0495656_0006189 Ga0495656_0006189_737_1036 99
852 3300046615 Ga0495656_0319665 Ga0495656_0319665_188_487 99
853 3300046642 Ga0495634_0163911 Ga0495634_0163911_891_1190 99
854 3300046642 Ga0495634_0190572 Ga0495634_0190572_50_349 99
855 3300046642 Ga0495634_0248988 Ga0495634_0248988_64_363 99
856 3300046642 Ga0495634_0796533 Ga0495634_0796533_13_312 99
857 3300046663 Ga0495635_0010795 Ga0495635_0010795_3406_3705 99
858 3300046663 Ga0495635_0052818 Ga0495635_0052818_1753_2052 99
859 3300046663 Ga0495635_0054282 Ga0495635_0054282_1649_1948 99
860 3300046663 Ga0495635_0059338 Ga0495635_0059338_1413_1712 99
861 3300046663 Ga0495635_0081459 Ga0495635_0081459_1806_2105 99
862 3300046663 Ga0495635_0131326 Ga0495635_0131326_1270_1569 99
863 3300046663 Ga0495635_0137700 Ga0495635_0137700_82_381 99
864 3300046663 Ga0495635_0156451 Ga0495635_0156451_657_956 99
865 3300046675 Ga0495657_0007470 Ga0495657_0007470_7958_8257 99
866 3300046675 Ga0495657_0007590 Ga0495657_0007590_2468_2767 99
867 3300046675 Ga0495657_0021368 Ga0495657_0021368_2493_2792 99
868 3300046675 Ga0495657_0022121 Ga0495657_0022121_537_836 99
869 3300046678 Ga0495599_0000130 Ga0495599_0000130_24559_24858 99
870 3300046678 Ga0495599_0235459 Ga0495599_0235459_175_474 99
871 3300046678 Ga0495599_0360090 Ga0495599_0360090_491_790 99
872 3300046679 Ga0495623_0000041 Ga0495623_0000041_10222_10521 99
873 3300046679 Ga0495623_0373170 Ga0495623_0373170_47_346 99
874 3300046679 Ga0495623_0424907 Ga0495623_0424907_73_372 99
875 3300046680 Ga0495646_0268246 Ga0495646_0268246_125_424 99
876 3300046680 Ga0495646_0332758 Ga0495646_0332758_439_738 99
877 3300046681 Ga0495647_0005935 Ga0495647_0005935_2555_2854 99
878 3300046681 Ga0495647_0038165 Ga0495647_0038165_1355_1654 99
879 3300046681 Ga0495647_0541745 Ga0495647_0541745_197_496 99
880 3300046683 Ga0495658_0004962 Ga0495658_0004962_5056_5355 99
881 3300046683 Ga0495658_0077855 Ga0495658_0077855_349_648 99
882 3300046683 Ga0495658_0638210 Ga0495658_0638210_240_539 99
883 3300046689 Ga0495613_0004077 Ga0495613_0004077_9203_9502 99
884 3300046689 Ga0495613_0075657 Ga0495613_0075657_1768_2067 99
885 3300046689 Ga0495613_0077256 Ga0495613_0077256_1252_1551 99
886 3300046689 Ga0495613_0083914 Ga0495613_0083914_1393_1692 99
887 3300046689 Ga0495613_0117564 Ga0495613_0117564_200_499 99
888 3300046689 Ga0495613_0395861 Ga0495613_0395861_322_621 99
889 3300046689 Ga0495613_0712973 Ga0495613_0712973_249_548 99
890 3300046689 Ga0495613_0789962 Ga0495613_0789962_198_497 99
891 3300046689 Ga0495613_0798449 Ga0495613_0798449_158_460 99
892 3300046690 Ga0495624_0003577 Ga0495624_0003577_10676_10975 99
893 3300046690 Ga0495624_0032360 Ga0495624_0032360_893_1192 99
894 3300046690 Ga0495624_0050268 Ga0495624_0050268_1449_1748 99
895 3300046690 Ga0495624_0394708 Ga0495624_0394708_466_765 99
896 3300046690 Ga0495624_0627360 Ga0495624_0627360_154_453 99
897 3300046794 Ga0495589_0419934 Ga0495589_0419934_236_535 99
898 3300046809 Ga0495600_0114072 Ga0495600_0114072_1023_1322 99
899 3300046809 Ga0495600_0174744 Ga0495600_0174744_994_1293 99
900 3300046809 Ga0495600_0350087 Ga0495600_0350087_419_718 99
901 3300047315 Ga0495581_0007047 Ga0495581_0007047_5081_5380 99
902 3300047315 Ga0495581_0045247 Ga0495581_0045247_2103_2402 99
903 3300047315 Ga0495581_0612098 Ga0495581_0612098_76_375 99
904 3300047317 Ga0495604_0000167 Ga0495604_0000167_51911_52210 99
905 3300047317 Ga0495604_0561258 Ga0495604_0561258_104_403 99
906 3300047317 Ga0495604_0740947 Ga0495604_0740947_311_610 99
907 3300047319 Ga0495674_0037111 Ga0495674_0037111_2142_2441 99
908 3300047319 Ga0495674_0037491 Ga0495674_0037491_117_416 99
909 3300047319 Ga0495674_0126018 Ga0495674_0126018_1529_1828 99
910 3300047319 Ga0495674_0134915 Ga0495674_0134915_1538_1837 99
911 3300047319 Ga0495674_0141468 Ga0495674_0141468_279_578 99
912 3300047319 Ga0495674_0307582 Ga0495674_0307582_811_1110 99
913 3300047319 Ga0495674_0417003 Ga0495674_0417003_289_588 99
914 3300047319 Ga0495674_0446413 Ga0495674_0446413_728_1027 99
915 3300047319 Ga0495674_0970014 Ga0495674_0970014_338_640 99
916 3300047319 Ga0495674_1082072 Ga0495674_1082072_168_467 99
917 3300047319 Ga0495674_1162632 Ga0495674_1162632_89_388 99
918 3300047321 Ga0495676_0002388 Ga0495676_0002388_1343_1642 99
919 3300047321 Ga0495676_0229986 Ga0495676_0229986_685_984 99
920 3300047321 Ga0495676_0416105 Ga0495676_0416105_132_431 99
921 3300047321 Ga0495676_0750082 Ga0495676_0750082_247_546 99
922 3300047322 Ga0495680_0003097 Ga0495680_0003097_5042_5341 99
923 3300047322 Ga0495680_0023872 Ga0495680_0023872_3030_3329 99
924 3300047322 Ga0495680_0027741 Ga0495680_0027741_4163_4462 99
925 3300047322 Ga0495680_0027979 Ga0495680_0027979_2905_3204 99
926 3300047322 Ga0495680_0033027 Ga0495680_0033027_2356_2655 99
927 3300047322 Ga0495680_0079172 Ga0495680_0079172_1628_1927 99
928 3300047322 Ga0495680_0272241 Ga0495680_0272241_513_812 99
929 3300047322 Ga0495680_0357225 Ga0495680_0357225_448_747 99
930 3300047322 Ga0495680_0454678 Ga0495680_0454678_492_791 99
931 3300047322 Ga0495680_0686863 Ga0495680_0686863_87_386 99
932 3300047444 Ga0495675_0000724 Ga0495675_0000724_15266_15565 99
933 3300047444 Ga0495675_0356176 Ga0495675_0356176_92_391 99
934 3300047471 Ga0495684_0014897 Ga0495684_0014897_3571_3870 99
935 3300047471 Ga0495684_0020918 Ga0495684_0020918_4161_4460 99
936 3300047471 Ga0495684_0026533 Ga0495684_0026533_4142_4441 99
937 3300047471 Ga0495684_0040798 Ga0495684_0040798_1030_1329 99
938 3300047471 Ga0495684_0082568 Ga0495684_0082568_1471_1770 99
939 3300047471 Ga0495684_0104324 Ga0495684_0104324_1815_2114 99
940 3300047471 Ga0495684_0175847 Ga0495684_0175847_204_503 99
941 3300047471 Ga0495684_1002535 Ga0495684_1002535_82_381 99
942 3300047673 Ga0495593_0006002 Ga0495593_0006002_919_1218 99
943 3300047673 Ga0495593_0337721 Ga0495593_0337721_42_341 99
944 3300048088 Ga0495602_0000147 Ga0495602_0000147_40573_40872 99
945 3300048088 Ga0495602_0251666 Ga0495602_0251666_105_404 99
946 3300048089 Ga0495614_0010756 Ga0495614_0010756_995_1294 99
947 3300048089 Ga0495614_0524370 Ga0495614_0524370_76_375 99
948 3300048903 Ga0496100_0014542 Ga0496100_0014542_2821_3120 99
949 3300048903 Ga0496100_0194027 Ga0496100_0194027_770_1069 99
950 3300048903 Ga0496100_1034076 Ga0496100_1034076_179_478 99
951 3300048904 Ga0496101_0015812 Ga0496101_0015812_2784_3083 99
952 3300048904 Ga0496101_0158788 Ga0496101_0158788_1251_1550 99
953 3300048904 Ga0496101_0630182 Ga0496101_0630182_471_770 99
954 3300048904 Ga0496101_0643906 Ga0496101_0643906_103_402 99
955 3300048905 Ga0496102_0002713 Ga0496102_0002713_2102_2428 99
956 3300048905 Ga0496102_0014363 Ga0496102_0014363_3755_4054 99
957 3300048905 Ga0496102_0116347 Ga0496102_0116347_1420_1719 99
958 3300048905 Ga0496102_1703307 Ga0496102_1703307_215_514 99
959 3300048906 Ga0496103_0030216 Ga0496103_0030216_266_565 99
960 3300048906 Ga0496103_0034710 Ga0496103_0034710_185_484 99
961 3300048906 Ga0496103_0071000 Ga0496103_0071000_936_1262 99
962 3300048907 Ga0496104_0078038 Ga0496104_0078038_468_767 99
963 3300048907 Ga0496104_0104879 Ga0496104_0104879_840_1139 99
964 3300048907 Ga0496104_0113105 Ga0496104_0113105_2260_2559 99
965 3300048907 Ga0496104_0157942 Ga0496104_0157942_1680_1979 99
966 3300048907 Ga0496104_0161795 Ga0496104_0161795_1010_1309 99
967 3300048907 Ga0496104_0325595 Ga0496104_0325595_870_1169 99
968 3300048907 Ga0496104_0468114 Ga0496104_0468114_803_1102 99
969 3300048907 Ga0496104_0520879 Ga0496104_0520879_671_970 99
970 3300048907 Ga0496104_1122189 Ga0496104_1122189_25_324 99
971 3300048907 Ga0496104_1663280 Ga0496104_1663280_60_362 99
972 3300048908 Ga0496105_0032718 Ga0496105_0032718_1291_1590 99
973 3300048908 Ga0496105_0087793 Ga0496105_0087793_1967_2266 99
974 3300048908 Ga0496105_0255319 Ga0496105_0255319_913_1212 99
975 3300048908 Ga0496105_0393485 Ga0496105_0393485_498_797 99
976 3300048908 Ga0496105_1040315 Ga0496105_1040315_107_406 99
977 3300048908 Ga0496105_1222188 Ga0496105_1222188_59_358 99
978 3300048909 Ga0496106_0005920 Ga0496106_0005920_2484_2783 99
979 3300048909 Ga0496106_0392785 Ga0496106_0392785_57_356 99
980 3300048910 Ga0496107_0001702 Ga0496107_0001702_11523_11822 99
981 3300048910 Ga0496107_0022441 Ga0496107_0022441_2711_3010 99
982 3300048910 Ga0496107_0033804 Ga0496107_0033804_2903_3202 99
983 3300048910 Ga0496107_0454106 Ga0496107_0454106_498_797 99
984 3300048911 Ga0496108_0034028 Ga0496108_0034028_3482_3781 99
985 3300048911 Ga0496108_0062684 Ga0496108_0062684_2218_2517 99
986 3300048911 Ga0496108_0103999 Ga0496108_0103999_1097_1396 99
987 3300048911 Ga0496108_0562960 Ga0496108_0562960_413_712 99
988 3300048911 Ga0496108_0806035 Ga0496108_0806035_421_723 99
989 3300048911 Ga0496108_1366947 Ga0496108_1366947_201_500 99
990 3300048912 Ga0496109_0034023 Ga0496109_0034023_2234_2533 99
991 3300048912 Ga0496109_0060193 Ga0496109_0060193_1770_2069 99
992 3300048912 Ga0496109_0067859 Ga0496109_0067859_120_419 99
993 3300048912 Ga0496109_0101168 Ga0496109_0101168_618_917 99
994 3300048912 Ga0496109_0414694 Ga0496109_0414694_282_581 99
995 3300048912 Ga0496109_0992911 Ga0496109_0992911_304_603 99
996 3300048912 Ga0496109_1689725 Ga0496109_1689725_180_479 99
997 3300048913 Ga0496110_0012051 Ga0496110_0012051_5821_6120 99
998 3300048913 Ga0496110_0019384 Ga0496110_0019384_3464_3763 99
999 3300048913 Ga0496110_0648594 Ga0496110_0648594_20_319 99
1000 3300048913 Ga0496110_1566194 Ga0496110_1566194_72_371 99
1001 3300048914 Ga0496111_0006770 Ga0496111_0006770_139_438 99
1002 3300048914 Ga0496111_0028995 Ga0496111_0028995_1802_2101 99
1003 3300048914 Ga0496111_0070656 Ga0496111_0070656_1936_2235 99
1004 3300048914 Ga0496111_0163351 Ga0496111_0163351_355_654 99
1005 3300048914 Ga0496111_0460116 Ga0496111_0460116_297_596 99
1006 3300048915 Ga0496112_0002974 Ga0496112_0002974_10069_10389 99
1007 3300048915 Ga0496112_0009862 Ga0496112_0009862_5561_5860 99
1008 3300048915 Ga0496112_0058651 Ga0496112_0058651_138_437 99
1009 3300048915 Ga0496112_0127224 Ga0496112_0127224_2096_2395 99
1010 3300048915 Ga0496112_0193892 Ga0496112_0193892_459_758 99
1011 3300048915 Ga0496112_0220626 Ga0496112_0220626_1483_1782 99
1012 3300048915 Ga0496112_0503077 Ga0496112_0503077_131_430 99
1013 3300048915 Ga0496112_0839333 Ga0496112_0839333_52_351 99
1014 3300048915 Ga0496112_1313235 Ga0496112_1313235_21_320 99
1015 3300048915 Ga0496112_1707767 Ga0496112_1707767_48_524 99
1016 3300048916 Ga0496113_0177054 Ga0496113_0177054_1131_1430 99
1017 3300048916 Ga0496113_0230776 Ga0496113_0230776_924_1223 99
1018 3300048916 Ga0496113_0231059 Ga0496113_0231059_711_1010 99
1019 3300048916 Ga0496113_0242879 Ga0496113_0242879_209_508 99
1020 3300048916 Ga0496113_0324821 Ga0496113_0324821_900_1199 99
1021 3300048916 Ga0496113_0514836 Ga0496113_0514836_144_443 99
1022 3300048916 Ga0496113_0537012 Ga0496113_0537012_605_904 99
1023 3300048916 Ga0496113_0548728 Ga0496113_0548728_146_466 99
1024 3300048917 Ga0496114_0041653 Ga0496114_0041653_2319_2618 99
1025 3300048917 Ga0496114_0049600 Ga0496114_0049600_2079_2378 99
1026 3300048917 Ga0496114_0049741 Ga0496114_0049741_1476_1775 99
1027 3300048917 Ga0496114_0317209 Ga0496114_0317209_1037_1336 99
1028 3300048917 Ga0496114_1531768 Ga0496114_1531768_22_321 99
1029 3300048918 Ga0496115_0019193 Ga0496115_0019193_4272_4571 99
1030 3300048918 Ga0496115_0178180 Ga0496115_0178180_195_494 99
1031 3300048918 Ga0496115_0235723 Ga0496115_0235723_662_961 99
1032 3300049571 Ga0501034_0101789 Ga0501034_0101789_1329_1628 99
1033 3300049580 Ga0501046_0700966 Ga0501046_0700966_130_429 99
1034 3300049581 Ga0501047_0359030 Ga0501047_0359030_453_752 99
1035 3300049583 Ga0501067_0020546 Ga0501067_0020546_1828_2127 99
1036 3300049583 Ga0501067_0044763 Ga0501067_0044763_2109_2408 99
1037 3300049583 Ga0501067_0331713 Ga0501067_0331713_250_549 99
1038 3300049583 Ga0501067_0802267 Ga0501067_0802267_134_433 99
1039 3300049585 Ga0501069_0017354 Ga0501069_0017354_2191_2490 99
1040 3300049585 Ga0501069_0332749 Ga0501069_0332749_40_339 99
1041 3300049586 Ga0501070_0013851 Ga0501070_0013851_5835_6134 99
1042 3300049586 Ga0501070_0184081 Ga0501070_0184081_562_861 99
1043 3300049586 Ga0501070_1303878 Ga0501070_1303878_43_342 99
1044 3300049588 Ga0501072_0001288 Ga0501072_0001288_6877_7176 99
1045 3300049589 Ga0501073_0099410 Ga0501073_0099410_1247_1546 99
1046 3300049590 Ga0501074_0117305 Ga0501074_0117305_568_867 99
1047 3300049592 Ga0501076_0478579 Ga0501076_0478579_508_807 99
1048 3300049741 Ga0501079_0111747 Ga0501079_0111747_1136_1435 99
1049 3300049742 Ga0501080_0000892 Ga0501080_0000892_5109_5408 99
1050 3300049742 Ga0501080_0037995 Ga0501080_0037995_704_1003 99
1051 3300049744 Ga0501083_0006059 Ga0501083_0006059_5890_6189 99
1052 3300049823 Ga0501044_0780232 Ga0501044_0780232_45_344 99
1053 3300050490 nmdc:mga03n38_302356_c1 nmdc:mga03n38_302356_c1_153_452 99
1054 3300050507 nmdc:mga05p37_1025570_c1 nmdc:mga05p37_1025570_c1_548_847 99
1055 3300050511 nmdc:mga08y16_25535_c1 nmdc:mga08y16_25535_c1_2270_2569 99
1056 3300050512 nmdc:mga0n895_294034_c1 nmdc:mga0n895_294034_c1_177_476 99
1057 3300050512 nmdc:mga0n895_655801_c1 nmdc:mga0n895_655801_c1_316_615 99
1058 3300050513 nmdc:mga0rr50_561516_c1 nmdc:mga0rr50_561516_c1_90_389 99
1059 3300053077 Ga0495601_0000275 Ga0495601_0000275_3025_3324 99
1060 3300053077 Ga0495601_0008713 Ga0495601_0008713_24_323 99
1061 3300053077 Ga0495601_0013067 Ga0495601_0013067_4594_4893 99
1062 3300053077 Ga0495601_0034241 Ga0495601_0034241_2809_3108 99
1063 3300053077 Ga0495601_0050954 Ga0495601_0050954_286_585 99
1064 3300053077 Ga0495601_0191990 Ga0495601_0191990_786_1085 99
1065 3300053078 Ga0495612_0001639 Ga0495612_0001639_5338_5637 99
1066 3300053078 Ga0495612_0157862 Ga0495612_0157862_462_761 99
1067 3300053078 Ga0495612_0320397 Ga0495612_0320397_348_647 99
1068 3300053084 Ga0495595_0029535 Ga0495595_0029535_568_867 99
1069 3300053084 Ga0495595_0032339 Ga0495595_0032339_1804_2103 99
1070 3300053084 Ga0495595_0059926 Ga0495595_0059926_986_1288 99
1071 3300053084 Ga0495595_0366164 Ga0495595_0366164_351_650 99
1072 3300053084 Ga0495595_0501460 Ga0495595_0501460_184_483 99
1073 3300053085 Ga0495619_0003160 Ga0495619_0003160_8580_8879 99
1074 3300053085 Ga0495619_0008123 Ga0495619_0008123_4421_4720 99
1075 3300053085 Ga0495619_0026190 Ga0495619_0026190_2183_2482 99
1076 3300053085 Ga0495619_0081911 Ga0495619_0081911_548_847 99
1077 3300053085 Ga0495619_0115270 Ga0495619_0115270_224_523 99
1078 3300053085 Ga0495619_0576749 Ga0495619_0576749_263_562 99
1079 3300053085 Ga0495619_0756844 Ga0495619_0756844_43_342 99
1080 3300053094 Ga0500566_0093612 Ga0500566_0093612_626_925 99
1081 3300054114 Ga0501084_0328382 Ga0501084_0328382_635_934 99
1082 3300059625 Ga0587113_048470 Ga0587113_048470_166_465 99
1083 3300059628 Ga0587122_047712 Ga0587122_047712_79_378 99
1084 3300059644 Ga0587075_144779 Ga0587075_144779_156_455 99
1085 3300059655 Ga0587114_135536 Ga0587114_135536_143_442 99
1086 3300060346 Ga0587111_0181311 Ga0587111_0181311_151_450 99
1087 3300060346 Ga0587111_0205363 Ga0587111_0205363_116_415 99
1088 3300061719 Ga0466962_0001252 Ga0466962_0001252_6045_6344 99
1089 3300061719 Ga0466962_0014341 Ga0466962_0014341_919_1218 99
1090 3300061719 Ga0466962_0046681 Ga0466962_0046681_664_963 99
1091 3300061719 Ga0466962_0070582 Ga0466962_0070582_337_663 99
1092 3300061719 Ga0466962_0079600 Ga0466962_0079600_29_328 99
1093 3300061719 Ga0466962_0235317 Ga0466962_0235317_311_610 99
1094 3300061719 Ga0466962_0615554 Ga0466962_0615554_158_457 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

6

81

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.8803 5 92
1wcj-assembly1.cif.gz_A conserved hypothetical protein tm0487 from thermotoga maritima 0.8701 2 97
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.8651 5 97
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.8537 4 99
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.8448 5 92
ID Description Score Start End Superfamily
af_Q0JJS8_71_163_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9195 4 81 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9057 13 97 3.30.300.130
af_Q8II78_18_117_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9033 4 81 3.30.300.130
1wcjA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8701 2 97 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8674 13 97 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A1Q7PWA1-F1-model_v4 MIP18 family-like domain-containing protein 0.9789 1 76
AF-A0A3N5X0N5-F1-model_v4 MRP family ATP-binding protein 0.9779 1 77 GO:0005524
GO:0016226
GO:0046872
GO:0051539
GO:0140663
AF-A0A352L083-F1-model_v4 MIP18 family-like domain-containing protein 0.9754 1 79
AF-A0A538EI59-F1-model_v4 Metal-sulfur cluster assembly factor 0.974 1 76
AF-A0A7C5YHH7-F1-model_v4 Iron-sulfur cluster carrier protein 0.9713 2 78 GO:0005524
GO:0016226
GO:0016887
GO:0046872
GO:0051539
GO:0140663

Feature Viewer

pLDDT pTM Quality
84.4 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map