F489934
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1094 | 485 | 2188 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300003659|JGI25404J52841_10007089|JGI25404J52841_100070892 |
| Length | 348 |
| Sequence | VTAIRSVVLGCGSYLPQKVLTNAELAARIDTSDEWIVQRTGIRQRHIAADDEFTSHLGVNAARAALAHAGIDAQSIDLIVVATSTPDNTFPATAVAIQNALGITHGAAFDLQAVCSGFIFAMATADNFLRSGAYKRALVIGAETFSRILDWNDRTTCVLFGDGAGAVVLEAQEQPGGTTDRGILTSHLRSDGRHQSKLYVDGGPGSTKTVGHLKMEGREVFKHAVGMVTDVIVDAFKATGTSVEDIDWFIPHQANRRIIDATAHKLHLAPEKVVLTVDQHGNTSAASIPLALCVAVKXGRVKKGDLXMLEAMGGGFTWGSVLLRWXVWHKDFYAKYKCVFMLLHDARC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 94 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 95 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 210 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 225 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 226 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 227 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 229 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 234 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 247 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 248 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 249 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 250 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 253 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 254 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 255 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 256 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 257 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 258 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 333 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 334 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 335 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 336 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 337 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 338 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 339 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 370 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 371 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 374 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 376 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 377 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 381 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 387 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 388 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 390 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 391 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 392 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 393 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 394 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 396 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 397 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 398 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 399 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 400 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 401 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 402 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 403 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 404 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 405 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 407 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 409 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 410 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 411 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 413 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 414 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 415 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 416 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 418 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 420 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 421 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 422 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 423 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 424 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 425 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 426 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 427 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 428 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 429 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 430 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 431 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 432 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 433 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 434 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 435 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 436 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 437 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 438 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 439 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 440 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 441 | 2791355199 | |||
| 442 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 443 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 444 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 445 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 446 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 447 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 448 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 449 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 450 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 451 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 452 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 453 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 454 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 455 | 2904699407 | |||
| 456 | 2906610324 | |||
| 457 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 458 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 459 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 460 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 461 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 462 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 463 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 464 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 465 | 2922425934 | |||
| 466 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 467 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 468 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 469 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 470 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 471 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 472 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 473 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 474 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 475 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 476 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 477 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 478 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 479 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 480 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 481 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 482 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 483 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 484 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 485 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.13 |
| Metatranscriptomes | 0.09 |
| Isolates | 5.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.96 |
| Nodule | 4.66 |
| Rhizoplane | 4.57 |
| Rhizosphere | 73.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10007089 | 3300003659 | Bacteria | 2363 |
| 2 | JGI24740J21852_10006297 | 3300001979 | Bacteria | 4928 |
| 3 | JGI24738J21930_10011139 | 3300002075 | Bacteria | 1985 |
| 4 | JGI25406J46586_10000006 | 3300003203 | Bacteria | 114937 |
| 5 | JGI25406J46586_10015653 | 3300003203 | Bacteria | 3191 |
| 6 | JGI25153J46596_10004068 | 3300003215 | Bacteria | 7963 |
| 7 | rootH1_10137999 | 3300003323 | Bacteria | 1607 |
| 8 | JGI25404J52841_10000633 | 3300003659 | Bacteria | 5323 |
| 9 | JGI25404J52841_10009381 | 3300003659 | Bacteria | 2092 |
| 10 | Ga0055526_1000468 | 3300003771 | Bacteria | 32069 |
| 11 | Ga0055524_1000352 | 3300003775 | Bacteria | 41872 |
| 12 | Ga0065165_1000046 | 3300005262 | Bacteria | 198873 |
| 13 | Ga0070658_10025139 | 3300005327 | Bacteria | 4774 |
| 14 | Ga0070658_10129968 | 3300005327 | Bacteria | 2098 |
| 15 | Ga0070658_10338376 | 3300005327 | Bacteria | 1287 |
| 16 | Ga0070658_10396321 | 3300005327 | Bacteria | 1185 |
| 17 | Ga0070676_10010147 | 3300005328 | Bacteria | 5105 |
| 18 | Ga0070676_10047040 | 3300005328 | Bacteria | 2518 |
| 19 | Ga0070683_100053161 | 3300005329 | Bacteria | 3753 |
| 20 | Ga0070683_100095305 | 3300005329 | Bacteria | 2798 |
| 21 | Ga0070683_100241102 | 3300005329 | Bacteria | 1719 |
| 22 | Ga0070690_100029843 | 3300005330 | Bacteria | 3386 |
| 23 | Ga0070690_100096123 | 3300005330 | Bacteria | 1957 |
| 24 | Ga0070670_100006838 | 3300005331 | Bacteria | 9664 |
| 25 | Ga0070670_100177228 | 3300005331 | Bacteria | 1850 |
| 26 | Ga0070677_10002482 | 3300005333 | Bacteria | 5900 |
| 27 | Ga0068869_100002596 | 3300005334 | Bacteria | 10912 |
| 28 | Ga0068869_100004697 | 3300005334 | Bacteria | 8524 |
| 29 | Ga0068869_100206651 | 3300005334 | Bacteria | 1551 |
| 30 | Ga0068869_100249388 | 3300005334 | Bacteria | 1417 |
| 31 | Ga0070666_10063577 | 3300005335 | Bacteria | 2502 |
| 32 | Ga0070680_100054413 | 3300005336 | Bacteria | 3268 |
| 33 | Ga0070680_100063343 | 3300005336 | Bacteria | 3029 |
| 34 | Ga0070680_100328225 | 3300005336 | Bacteria | 1299 |
| 35 | Ga0070682_100172467 | 3300005337 | Bacteria | 1504 |
| 36 | Ga0068868_100075697 | 3300005338 | Bacteria | 2690 |
| 37 | Ga0068868_100089024 | 3300005338 | Bacteria | 2485 |
| 38 | Ga0068868_100386282 | 3300005338 | Bacteria | 1205 |
| 39 | Ga0070660_100003180 | 3300005339 | Bacteria | 11282 |
| 40 | Ga0070689_100071264 | 3300005340 | Bacteria | 2715 |
| 41 | Ga0070661_100336523 | 3300005344 | Bacteria | 1181 |
| 42 | Ga0070668_100007129 | 3300005347 | Bacteria | 8283 |
| 43 | Ga0070668_100010143 | 3300005347 | Bacteria | 6983 |
| 44 | Ga0070668_100018023 | 3300005347 | Bacteria | 5297 |
| 45 | Ga0070668_100045066 | 3300005347 | Bacteria | 3384 |
| 46 | Ga0070668_100188945 | 3300005347 | Bacteria | 1686 |
| 47 | Ga0070669_100009649 | 3300005353 | Bacteria | 6875 |
| 48 | Ga0070675_100007819 | 3300005354 | Bacteria | 8286 |
| 49 | Ga0070675_100086448 | 3300005354 | Bacteria | 2621 |
| 50 | Ga0070671_100005455 | 3300005355 | Bacteria | 10154 |
| 51 | Ga0070671_100013034 | 3300005355 | Bacteria | 6701 |
| 52 | Ga0070671_100111160 | 3300005355 | Bacteria | 2302 |
| 53 | Ga0070671_100231194 | 3300005355 | Bacteria | 1569 |
| 54 | Ga0070674_100003800 | 3300005356 | Bacteria | 8533 |
| 55 | Ga0070674_100034126 | 3300005356 | Bacteria | 3395 |
| 56 | Ga0070673_100010465 | 3300005364 | Bacteria | 6281 |
| 57 | Ga0070673_100124435 | 3300005364 | Bacteria | 2155 |
| 58 | Ga0070688_100005381 | 3300005365 | Bacteria | 6735 |
| 59 | Ga0070659_100011346 | 3300005366 | Bacteria | 6589 |
| 60 | Ga0070667_100006047 | 3300005367 | Bacteria | 10053 |
| 61 | Ga0070667_100006908 | 3300005367 | Bacteria | 9429 |
| 62 | Ga0070667_100103359 | 3300005367 | Bacteria | 2463 |
| 63 | Ga0070709_10000640 | 3300005434 | Bacteria | 19980 |
| 64 | Ga0070709_10000814 | 3300005434 | Bacteria | 17403 |
| 65 | Ga0070709_10011971 | 3300005434 | Bacteria | 4848 |
| 66 | Ga0070709_10023138 | 3300005434 | Bacteria | 3645 |
| 67 | Ga0070709_10034707 | 3300005434 | Bacteria | 3060 |
| 68 | Ga0070714_100001978 | 3300005435 | Bacteria | 14970 |
| 69 | Ga0070714_100018170 | 3300005435 | Bacteria | 5705 |
| 70 | Ga0070714_100066721 | 3300005435 | Bacteria | 3101 |
| 71 | Ga0070714_100070911 | 3300005435 | Bacteria | 3012 |
| 72 | Ga0070714_100195923 | 3300005435 | Bacteria | 1846 |
| 73 | Ga0070713_100001376 | 3300005436 | Bacteria | 15569 |
| 74 | Ga0070713_100005011 | 3300005436 | Bacteria | 8995 |
| 75 | Ga0070713_100006728 | 3300005436 | Bacteria | 8004 |
| 76 | Ga0070713_100037946 | 3300005436 | Bacteria | 3899 |
| 77 | Ga0070710_10000766 | 3300005437 | Bacteria | 15325 |
| 78 | Ga0070710_10002013 | 3300005437 | Bacteria | 9610 |
| 79 | Ga0070710_10005543 | 3300005437 | Bacteria | 6006 |
| 80 | Ga0070711_100007282 | 3300005439 | Bacteria | 6725 |
| 81 | Ga0070711_100014164 | 3300005439 | Bacteria | 5020 |
| 82 | Ga0070711_100015664 | 3300005439 | Bacteria | 4799 |
| 83 | Ga0070711_100016788 | 3300005439 | Bacteria | 4653 |
| 84 | Ga0070705_100008967 | 3300005440 | Bacteria | 4962 |
| 85 | Ga0070705_100198714 | 3300005440 | Bacteria | 1373 |
| 86 | Ga0070700_100166732 | 3300005441 | Bacteria | 1522 |
| 87 | Ga0070700_100194139 | 3300005441 | Bacteria | 1422 |
| 88 | Ga0070700_100279113 | 3300005441 | Bacteria | 1210 |
| 89 | Ga0070694_100190348 | 3300005444 | Bacteria | 1523 |
| 90 | Ga0070708_100102480 | 3300005445 | Bacteria | 2622 |
| 91 | Ga0070663_100022618 | 3300005455 | Bacteria | 4206 |
| 92 | Ga0070663_100064606 | 3300005455 | Bacteria | 2646 |
| 93 | Ga0070663_100168409 | 3300005455 | Bacteria | 1691 |
| 94 | Ga0070663_100222792 | 3300005455 | Bacteria | 1481 |
| 95 | Ga0070678_100044935 | 3300005456 | Bacteria | 3157 |
| 96 | Ga0070678_100064693 | 3300005456 | Bacteria | 2711 |
| 97 | Ga0070678_100107123 | 3300005456 | Bacteria | 2179 |
| 98 | Ga0070678_100128606 | 3300005456 | Bacteria | 2009 |
| 99 | Ga0070678_100153857 | 3300005456 | Bacteria | 1856 |
| 100 | Ga0070678_100251757 | 3300005456 | Bacteria | 1481 |
| 101 | Ga0070662_100087302 | 3300005457 | Bacteria | 2335 |
| 102 | Ga0070681_10025556 | 3300005458 | Bacteria | 5940 |
| 103 | Ga0070681_10038316 | 3300005458 | Bacteria | 4806 |
| 104 | Ga0070681_10081622 | 3300005458 | Bacteria | 3189 |
| 105 | Ga0070681_10162290 | 3300005458 | Bacteria | 2159 |
| 106 | Ga0070681_10177870 | 3300005458 | Bacteria | 2049 |
| 107 | Ga0070681_10203329 | 3300005458 | Bacteria | 1898 |
| 108 | Ga0070681_10341650 | 3300005458 | Bacteria | 1407 |
| 109 | Ga0068867_100005228 | 3300005459 | Bacteria | 9159 |
| 110 | Ga0068867_100062386 | 3300005459 | Bacteria | 2769 |
| 111 | Ga0068867_100087556 | 3300005459 | Bacteria | 2358 |
| 112 | Ga0070698_100009493 | 3300005471 | Bacteria | 10421 |
| 113 | Ga0070679_100014960 | 3300005530 | Bacteria | 7454 |
| 114 | Ga0070679_100030520 | 3300005530 | Bacteria | 5321 |
| 115 | Ga0070684_100019257 | 3300005535 | Bacteria | 5643 |
| 116 | Ga0070684_100031500 | 3300005535 | Bacteria | 4515 |
| 117 | Ga0070684_100096349 | 3300005535 | Bacteria | 2637 |
| 118 | Ga0068853_100006610 | 3300005539 | Bacteria | 9230 |
| 119 | Ga0068853_100020640 | 3300005539 | Bacteria | 5478 |
| 120 | Ga0068853_100105016 | 3300005539 | Bacteria | 2502 |
| 121 | Ga0068853_100197342 | 3300005539 | Bacteria | 1831 |
| 122 | Ga0070672_100091381 | 3300005543 | Bacteria | 2456 |
| 123 | Ga0070672_100189360 | 3300005543 | Bacteria | 1717 |
| 124 | Ga0070672_100209703 | 3300005543 | Bacteria | 1631 |
| 125 | Ga0070672_100319012 | 3300005543 | Bacteria | 1321 |
| 126 | Ga0070696_100064559 | 3300005546 | Bacteria | 2565 |
| 127 | Ga0070665_100008939 | 3300005548 | Bacteria | 10151 |
| 128 | Ga0070665_100013374 | 3300005548 | Bacteria | 8260 |
| 129 | Ga0070665_100057794 | 3300005548 | Bacteria | 3889 |
| 130 | Ga0070665_100094750 | 3300005548 | Bacteria | 2990 |
| 131 | Ga0070665_100214588 | 3300005548 | Bacteria | 1925 |
| 132 | Ga0070665_100587646 | 3300005548 | Bacteria | 1126 |
| 133 | Ga0070704_100172316 | 3300005549 | Bacteria | 1722 |
| 134 | Ga0068855_100035310 | 3300005563 | Bacteria | 5955 |
| 135 | Ga0068855_100036199 | 3300005563 | Bacteria | 5877 |
| 136 | Ga0068855_100052296 | 3300005563 | Bacteria | 4809 |
| 137 | Ga0068855_100096063 | 3300005563 | Bacteria | 3415 |
| 138 | Ga0068855_100206739 | 3300005563 | Bacteria | 2208 |
| 139 | Ga0068855_100241389 | 3300005563 | Bacteria | 2019 |
| 140 | Ga0068855_100278723 | 3300005563 | Bacteria | 1857 |
| 141 | Ga0068855_100704865 | 3300005563 | Bacteria | 1080 |
| 142 | Ga0070664_100132245 | 3300005564 | Bacteria | 2192 |
| 143 | Ga0070664_100137999 | 3300005564 | Bacteria | 2145 |
| 144 | Ga0068857_100004656 | 3300005577 | Bacteria | 11621 |
| 145 | Ga0068857_100015427 | 3300005577 | Bacteria | 6671 |
| 146 | Ga0068857_100037534 | 3300005577 | Bacteria | 4292 |
| 147 | Ga0068857_100046999 | 3300005577 | Bacteria | 3831 |
| 148 | Ga0068857_100068681 | 3300005577 | Bacteria | 3154 |
| 149 | Ga0068857_100071936 | 3300005577 | Bacteria | 3082 |
| 150 | Ga0068857_100151174 | 3300005577 | Bacteria | 2103 |
| 151 | Ga0068854_100003076 | 3300005578 | Bacteria | 10391 |
| 152 | Ga0068854_100079434 | 3300005578 | Bacteria | 2418 |
| 153 | Ga0068854_100080953 | 3300005578 | Bacteria | 2397 |
| 154 | Ga0068854_100090422 | 3300005578 | Bacteria | 2276 |
| 155 | Ga0068854_100146703 | 3300005578 | Bacteria | 1816 |
| 156 | Ga0068856_100002728 | 3300005614 | Bacteria | 18074 |
| 157 | Ga0068856_100009830 | 3300005614 | Bacteria | 9291 |
| 158 | Ga0068856_100321564 | 3300005614 | Bacteria | 1564 |
| 159 | Ga0070702_100127289 | 3300005615 | Bacteria | 1603 |
| 160 | Ga0070702_100179647 | 3300005615 | Bacteria | 1384 |
| 161 | Ga0068852_100002660 | 3300005616 | Bacteria | 12353 |
| 162 | Ga0068852_100019989 | 3300005616 | Bacteria | 5317 |
| 163 | Ga0068852_100053086 | 3300005616 | Bacteria | 3487 |
| 164 | Ga0068852_100241503 | 3300005616 | Bacteria | 1726 |
| 165 | Ga0068859_100008168 | 3300005617 | Bacteria | 10619 |
| 166 | Ga0068859_100078169 | 3300005617 | Bacteria | 3349 |
| 167 | Ga0068859_100084702 | 3300005617 | Bacteria | 3215 |
| 168 | Ga0068859_100120910 | 3300005617 | Bacteria | 2685 |
| 169 | Ga0068864_100000456 | 3300005618 | Bacteria | 35356 |
| 170 | Ga0068864_100010237 | 3300005618 | Bacteria | 7744 |
| 171 | Ga0068864_100081773 | 3300005618 | Bacteria | 2832 |
| 172 | Ga0068864_100141492 | 3300005618 | Bacteria | 2170 |
| 173 | Ga0068866_10082316 | 3300005718 | Bacteria | 1731 |
| 174 | Ga0068866_10095923 | 3300005718 | Bacteria | 1625 |
| 175 | Ga0068866_10104077 | 3300005718 | Bacteria | 1571 |
| 176 | Ga0068861_100009658 | 3300005719 | Bacteria | 6664 |
| 177 | Ga0068851_10002062 | 3300005834 | Bacteria | 8852 |
| 178 | Ga0068851_10005576 | 3300005834 | Bacteria | 5709 |
| 179 | Ga0068870_10008724 | 3300005840 | Bacteria | 4571 |
| 180 | Ga0068863_100100035 | 3300005841 | Bacteria | 2756 |
| 181 | Ga0068863_100162305 | 3300005841 | Bacteria | 2141 |
| 182 | Ga0068858_100008910 | 3300005842 | Bacteria | 9618 |
| 183 | Ga0068858_100145418 | 3300005842 | Bacteria | 2226 |
| 184 | Ga0068858_100153569 | 3300005842 | Bacteria | 2165 |
| 185 | Ga0068858_100163523 | 3300005842 | Bacteria | 2096 |
| 186 | Ga0068858_100259178 | 3300005842 | Bacteria | 1653 |
| 187 | Ga0068858_100282784 | 3300005842 | Bacteria | 1580 |
| 188 | Ga0068860_100000058 | 3300005843 | Bacteria | 197181 |
| 189 | Ga0068860_100008086 | 3300005843 | Bacteria | 10474 |
| 190 | Ga0068860_100011681 | 3300005843 | Bacteria | 8657 |
| 191 | Ga0068860_100018455 | 3300005843 | Bacteria | 6785 |
| 192 | Ga0068860_100031752 | 3300005843 | Bacteria | 5078 |
| 193 | Ga0068862_100008392 | 3300005844 | Bacteria | 8549 |
| 194 | Ga0068862_100031093 | 3300005844 | Bacteria | 4503 |
| 195 | Ga0068862_100035873 | 3300005844 | Bacteria | 4201 |
| 196 | Ga0068862_100081154 | 3300005844 | Bacteria | 2813 |
| 197 | Ga0081455_10001410 | 3300005937 | Bacteria | 29737 |
| 198 | Ga0081455_10001781 | 3300005937 | Bacteria | 26018 |
| 199 | Ga0081455_10004929 | 3300005937 | Bacteria | 14767 |
| 200 | Ga0081455_10032437 | 3300005937 | Bacteria | 4706 |
| 201 | Ga0081455_10036644 | 3300005937 | Bacteria | 4364 |
| 202 | Ga0081455_10098761 | 3300005937 | Bacteria | 2350 |
| 203 | Ga0081540_1002699 | 3300005983 | Bacteria | 14438 |
| 204 | Ga0081540_1003795 | 3300005983 | Bacteria | 11825 |
| 205 | Ga0081540_1005283 | 3300005983 | Bacteria | 9665 |
| 206 | Ga0081540_1005851 | 3300005983 | Bacteria | 9093 |
| 207 | Ga0081540_1008346 | 3300005983 | Bacteria | 7242 |
| 208 | Ga0081540_1010920 | 3300005983 | Bacteria | 6099 |
| 209 | Ga0081540_1022377 | 3300005983 | Bacteria | 3733 |
| 210 | Ga0081540_1026189 | 3300005983 | Bacteria | 3336 |
| 211 | Ga0081539_10000176 | 3300005985 | Bacteria | 150292 |
| 212 | Ga0081539_10000231 | 3300005985 | Bacteria | 131197 |
| 213 | Ga0081539_10024164 | 3300005985 | Bacteria | 3953 |
| 214 | Ga0081539_10047543 | 3300005985 | Bacteria | 2449 |
| 215 | Ga0081539_10104293 | 3300005985 | Bacteria | 1439 |
| 216 | Ga0070717_10003916 | 3300006028 | Bacteria | 10717 |
| 217 | Ga0070717_10038425 | 3300006028 | Bacteria | 3891 |
| 218 | Ga0070717_10134968 | 3300006028 | Bacteria | 2124 |
| 219 | Ga0070717_10197111 | 3300006028 | Bacteria | 1762 |
| 220 | Ga0075365_10004977 | 3300006038 | Bacteria | 7115 |
| 221 | Ga0075365_10069918 | 3300006038 | Bacteria | 2360 |
| 222 | Ga0075365_10130601 | 3300006038 | Bacteria | 1738 |
| 223 | Ga0075365_10139751 | 3300006038 | Bacteria | 1681 |
| 224 | Ga0075365_10155593 | 3300006038 | Bacteria | 1591 |
| 225 | Ga0075368_10009652 | 3300006042 | Bacteria | 3475 |
| 226 | Ga0075368_10029354 | 3300006042 | Bacteria | 2126 |
| 227 | Ga0075363_100009297 | 3300006048 | Bacteria | 4617 |
| 228 | Ga0075363_100066488 | 3300006048 | Bacteria | 1951 |
| 229 | Ga0075364_10023373 | 3300006051 | Bacteria | 3914 |
| 230 | Ga0070715_10001403 | 3300006163 | Bacteria | 6964 |
| 231 | Ga0070716_100004448 | 3300006173 | Bacteria | 6701 |
| 232 | Ga0070716_100008376 | 3300006173 | Bacteria | 5130 |
| 233 | Ga0070712_100087828 | 3300006175 | Bacteria | 2270 |
| 234 | Ga0075367_10002730 | 3300006178 | Bacteria | 8160 |
| 235 | Ga0075367_10064108 | 3300006178 | Bacteria | 2197 |
| 236 | Ga0075367_10081152 | 3300006178 | Bacteria | 1962 |
| 237 | Ga0075369_10110703 | 3300006186 | Bacteria | 1237 |
| 238 | Ga0075369_10111356 | 3300006186 | Bacteria | 1234 |
| 239 | Ga0097621_100004460 | 3300006237 | Bacteria | 9751 |
| 240 | Ga0097621_100029361 | 3300006237 | Bacteria | 4342 |
| 241 | Ga0075370_10017240 | 3300006353 | Bacteria | 3900 |
| 242 | Ga0075370_10019215 | 3300006353 | Bacteria | 3719 |
| 243 | Ga0075370_10033797 | 3300006353 | Bacteria | 2864 |
| 244 | Ga0068871_100004954 | 3300006358 | Bacteria | 9303 |
| 245 | Ga0068871_100050314 | 3300006358 | Bacteria | 3371 |
| 246 | Ga0068871_100053398 | 3300006358 | Bacteria | 3275 |
| 247 | Ga0068871_100195862 | 3300006358 | Bacteria | 1742 |
| 248 | Ga0075428_100102576 | 3300006844 | Bacteria | 3119 |
| 249 | Ga0075428_100177503 | 3300006844 | Bacteria | 2306 |
| 250 | Ga0075434_100381276 | 3300006871 | Bacteria | 1431 |
| 251 | Ga0075429_100327768 | 3300006880 | Bacteria | 1340 |
| 252 | Ga0068865_100059567 | 3300006881 | Bacteria | 2671 |
| 253 | Ga0097620_100008167 | 3300006931 | Bacteria | 10619 |
| 254 | Ga0097620_100078169 | 3300006931 | Bacteria | 3349 |
| 255 | Ga0097620_100084701 | 3300006931 | Bacteria | 3215 |
| 256 | Ga0097620_100120911 | 3300006931 | Bacteria | 2685 |
| 257 | Ga0099825_1025547 | 3300006941 | Bacteria | 3272 |
| 258 | Ga0099824_1010180 | 3300006942 | Bacteria | 11239 |
| 259 | Ga0099824_1013426 | 3300006942 | Bacteria | 8507 |
| 260 | Ga0099822_1000628 | 3300006943 | Bacteria | 34929 |
| 261 | Ga0099794_10094286 | 3300007265 | Bacteria | 1488 |
| 262 | Ga0099795_10012210 | 3300007788 | Bacteria | 2597 |
| 263 | Ga0105240_10016661 | 3300009093 | Bacteria | 9941 |
| 264 | Ga0105240_10029346 | 3300009093 | Bacteria | 7168 |
| 265 | Ga0105240_10086998 | 3300009093 | Bacteria | 3827 |
| 266 | Ga0105240_10097952 | 3300009093 | Bacteria | 3573 |
| 267 | Ga0105240_10176195 | 3300009093 | Bacteria | 2528 |
| 268 | Ga0105240_10277106 | 3300009093 | Bacteria | 1928 |
| 269 | Ga0105245_10050419 | 3300009098 | Bacteria | 3731 |
| 270 | Ga0105245_10152141 | 3300009098 | Bacteria | 2189 |
| 271 | Ga0105245_10169370 | 3300009098 | Bacteria | 2079 |
| 272 | Ga0105247_10016073 | 3300009101 | Bacteria | 4483 |
| 273 | Ga0105247_10068517 | 3300009101 | Bacteria | 2212 |
| 274 | Ga0105243_10286050 | 3300009148 | Bacteria | 1487 |
| 275 | Ga0105241_10009864 | 3300009174 | Bacteria | 7018 |
| 276 | Ga0105248_10007225 | 3300009177 | Bacteria | 12184 |
| 277 | Ga0105248_10016076 | 3300009177 | Bacteria | 8237 |
| 278 | Ga0105248_10132713 | 3300009177 | Bacteria | 2810 |
| 279 | Ga0105248_10432588 | 3300009177 | Bacteria | 1482 |
| 280 | Ga0105237_10067725 | 3300009545 | Bacteria | 3564 |
| 281 | Ga0105237_10113083 | 3300009545 | Bacteria | 2707 |
| 282 | Ga0105237_10181565 | 3300009545 | Bacteria | 2104 |
| 283 | Ga0105237_10274069 | 3300009545 | Bacteria | 1690 |
| 284 | Ga0105237_10327854 | 3300009545 | Bacteria | 1535 |
| 285 | Ga0105238_10002811 | 3300009551 | Bacteria | 17365 |
| 286 | Ga0105238_10012890 | 3300009551 | Bacteria | 8437 |
| 287 | Ga0105238_10029984 | 3300009551 | Bacteria | 5537 |
| 288 | Ga0105238_10065071 | 3300009551 | Bacteria | 3647 |
| 289 | Ga0105238_10089082 | 3300009551 | Bacteria | 3073 |
| 290 | Ga0105238_10171113 | 3300009551 | Bacteria | 2148 |
| 291 | Ga0105238_10444266 | 3300009551 | Bacteria | 1293 |
| 292 | Ga0105249_10015186 | 3300009553 | Bacteria | 6815 |
| 293 | Ga0105239_10024336 | 3300010375 | Bacteria | 6671 |
| 294 | Ga0105239_10042814 | 3300010375 | Bacteria | 4962 |
| 295 | Ga0105239_10062251 | 3300010375 | Bacteria | 4095 |
| 296 | Ga0105239_10065172 | 3300010375 | Bacteria | 4000 |
| 297 | Ga0105239_10117512 | 3300010375 | Bacteria | 2951 |
| 298 | Ga0105239_10161443 | 3300010375 | Bacteria | 2503 |
| 299 | Ga0105239_10189484 | 3300010375 | Bacteria | 2302 |
| 300 | Ga0105246_10131919 | 3300011119 | Bacteria | 1867 |
| 301 | Ga0105246_10147927 | 3300011119 | Bacteria | 1775 |
| 302 | Ga0157373_10008811 | 3300013100 | Bacteria | 7474 |
| 303 | Ga0157371_10005809 | 3300013102 | Bacteria | 10324 |
| 304 | Ga0157370_10005379 | 3300013104 | Bacteria | 14376 |
| 305 | Ga0157370_10038788 | 3300013104 | Bacteria | 4607 |
| 306 | Ga0157370_10477146 | 3300013104 | Bacteria | 1146 |
| 307 | Ga0157369_10004098 | 3300013105 | Bacteria | 17262 |
| 308 | Ga0157369_10080589 | 3300013105 | Bacteria | 3485 |
| 309 | Ga0157369_10088852 | 3300013105 | Bacteria | 3299 |
| 310 | Ga0157369_10096347 | 3300013105 | Bacteria | 3157 |
| 311 | Ga0171462_1011 | 3300013250 | Bacteria | 229282 |
| 312 | Ga0157374_10195235 | 3300013296 | Bacteria | 1981 |
| 313 | Ga0157374_10287723 | 3300013296 | Bacteria | 1623 |
| 314 | Ga0157374_10693692 | 3300013296 | Bacteria | 1031 |
| 315 | Ga0157378_10016765 | 3300013297 | Bacteria | 6419 |
| 316 | Ga0157378_10086750 | 3300013297 | Bacteria | 2838 |
| 317 | Ga0157378_10160370 | 3300013297 | Bacteria | 2103 |
| 318 | Ga0163162_10023700 | 3300013306 | Bacteria | 6058 |
| 319 | Ga0163162_10035737 | 3300013306 | Bacteria | 4950 |
| 320 | Ga0163162_10132258 | 3300013306 | Bacteria | 2604 |
| 321 | Ga0157375_10009213 | 3300013308 | Bacteria | 8658 |
| 322 | Ga0157375_10009300 | 3300013308 | Bacteria | 8625 |
| 323 | Ga0157375_10010588 | 3300013308 | Bacteria | 8119 |
| 324 | Ga0157375_10075444 | 3300013308 | Bacteria | 3396 |
| 325 | Ga0163163_10011827 | 3300014325 | Bacteria | 7936 |
| 326 | Ga0163163_10060169 | 3300014325 | Bacteria | 3760 |
| 327 | Ga0163163_10070835 | 3300014325 | Bacteria | 3473 |
| 328 | Ga0163163_10119522 | 3300014325 | Bacteria | 2668 |
| 329 | Ga0163163_10248806 | 3300014325 | Bacteria | 1828 |
| 330 | Ga0163163_10557719 | 3300014325 | Bacteria | 1208 |
| 331 | Ga0157380_10018325 | 3300014326 | Bacteria | 5195 |
| 332 | Ga0157377_10112587 | 3300014745 | Bacteria | 1638 |
| 333 | Ga0157379_10000246 | 3300014968 | Bacteria | 42489 |
| 334 | Ga0157379_10059933 | 3300014968 | Bacteria | 3403 |
| 335 | Ga0157376_10006054 | 3300014969 | Bacteria | 8505 |
| 336 | Ga0157376_10009356 | 3300014969 | Bacteria | 7120 |
| 337 | Ga0157376_10024704 | 3300014969 | Bacteria | 4723 |
| 338 | Ga0157376_10039678 | 3300014969 | Bacteria | 3842 |
| 339 | Ga0157376_10352139 | 3300014969 | Bacteria | 1409 |
| 340 | Ga0157376_10369338 | 3300014969 | Bacteria | 1378 |
| 341 | Ga0163161_10019421 | 3300017792 | Bacteria | 4768 |
| 342 | Ga0206353_11365297 | 3300020082 | Bacteria | 2655 |
| 343 | Ga0213874_10002910 | 3300021377 | Bacteria | 3735 |
| 344 | Ga0213876_10015796 | 3300021384 | Bacteria | 3995 |
| 345 | Ga0213876_10042552 | 3300021384 | Bacteria | 2400 |
| 346 | Ga0213876_10091555 | 3300021384 | Bacteria | 1610 |
| 347 | Ga0213875_10007779 | 3300021388 | Bacteria | 5509 |
| 348 | Ga0209677_101611 | 3300025253 | Bacteria | 9518 |
| 349 | Ga0209233_1006049 | 3300025261 | Bacteria | 3943 |
| 350 | Ga0209130_1000703 | 3300025284 | Bacteria | 29959 |
| 351 | Ga0209675_1001330 | 3300025291 | Bacteria | 14616 |
| 352 | Ga0209025_1000016 | 3300025294 | Bacteria | 770739 |
| 353 | Ga0209025_1002211 | 3300025294 | Bacteria | 21463 |
| 354 | Ga0209564_1000023 | 3300025295 | Bacteria | 555102 |
| 355 | Ga0209564_1000035 | 3300025295 | Bacteria | 442446 |
| 356 | Ga0209564_1008909 | 3300025295 | Bacteria | 4870 |
| 357 | Ga0209758_1004676 | 3300025297 | Bacteria | 11193 |
| 358 | Ga0209758_1014026 | 3300025297 | Bacteria | 4307 |
| 359 | Ga0209256_1000025 | 3300025299 | Bacteria | 442449 |
| 360 | Ga0207656_10020136 | 3300025321 | Bacteria | 2648 |
| 361 | Ga0207682_10000600 | 3300025893 | Bacteria | 16720 |
| 362 | Ga0207692_10001752 | 3300025898 | Bacteria | 8233 |
| 363 | Ga0207692_10003198 | 3300025898 | Bacteria | 6365 |
| 364 | Ga0207692_10064878 | 3300025898 | Bacteria | 1903 |
| 365 | Ga0207692_10187102 | 3300025898 | Bacteria | 1210 |
| 366 | Ga0207710_10016038 | 3300025900 | Bacteria | 3170 |
| 367 | Ga0207710_10036693 | 3300025900 | Bacteria | 2162 |
| 368 | Ga0207688_10030116 | 3300025901 | Bacteria | 2992 |
| 369 | Ga0207688_10071462 | 3300025901 | Bacteria | 1970 |
| 370 | Ga0207688_10099593 | 3300025901 | Bacteria | 1677 |
| 371 | Ga0207680_10090058 | 3300025903 | Bacteria | 1949 |
| 372 | Ga0207680_10090388 | 3300025903 | Bacteria | 1946 |
| 373 | Ga0207680_10097460 | 3300025903 | Bacteria | 1883 |
| 374 | Ga0207647_10011930 | 3300025904 | Bacteria | 6068 |
| 375 | Ga0207647_10068496 | 3300025904 | Bacteria | 2148 |
| 376 | Ga0207685_10003885 | 3300025905 | Bacteria | 3705 |
| 377 | Ga0207699_10007628 | 3300025906 | Bacteria | 5298 |
| 378 | Ga0207699_10015007 | 3300025906 | Bacteria | 4013 |
| 379 | Ga0207699_10080507 | 3300025906 | Bacteria | 2018 |
| 380 | Ga0207645_10004697 | 3300025907 | Bacteria | 10049 |
| 381 | Ga0207645_10031672 | 3300025907 | Bacteria | 3402 |
| 382 | Ga0207645_10047170 | 3300025907 | Bacteria | 2751 |
| 383 | Ga0207643_10025397 | 3300025908 | Bacteria | 3274 |
| 384 | Ga0207684_10450348 | 3300025910 | Bacteria | 1105 |
| 385 | Ga0207654_10000968 | 3300025911 | Bacteria | 15767 |
| 386 | Ga0207654_10004279 | 3300025911 | Bacteria | 7204 |
| 387 | Ga0207707_10004344 | 3300025912 | Bacteria | 12544 |
| 388 | Ga0207707_10103544 | 3300025912 | Bacteria | 2488 |
| 389 | Ga0207707_10181771 | 3300025912 | Bacteria | 1836 |
| 390 | Ga0207695_10003702 | 3300025913 | Bacteria | 21304 |
| 391 | Ga0207695_10015923 | 3300025913 | Bacteria | 8830 |
| 392 | Ga0207671_10024084 | 3300025914 | Bacteria | 4582 |
| 393 | Ga0207671_10061368 | 3300025914 | Bacteria | 2789 |
| 394 | Ga0207671_10202458 | 3300025914 | Bacteria | 1551 |
| 395 | Ga0207693_10003588 | 3300025915 | Bacteria | 13253 |
| 396 | Ga0207693_10019182 | 3300025915 | Bacteria | 5442 |
| 397 | Ga0207693_10040712 | 3300025915 | Bacteria | 3659 |
| 398 | Ga0207693_10049803 | 3300025915 | Bacteria | 3289 |
| 399 | Ga0207693_10077009 | 3300025915 | Bacteria | 2612 |
| 400 | Ga0207663_10002056 | 3300025916 | Bacteria | 9591 |
| 401 | Ga0207663_10006350 | 3300025916 | Bacteria | 6042 |
| 402 | Ga0207663_10061932 | 3300025916 | Bacteria | 2376 |
| 403 | Ga0207660_10002460 | 3300025917 | Bacteria | 12166 |
| 404 | Ga0207660_10012121 | 3300025917 | Bacteria | 5635 |
| 405 | Ga0207660_10087859 | 3300025917 | Bacteria | 2298 |
| 406 | Ga0207660_10205573 | 3300025917 | Bacteria | 1540 |
| 407 | Ga0207657_10000297 | 3300025919 | Bacteria | 52991 |
| 408 | Ga0207657_10002222 | 3300025919 | Bacteria | 21059 |
| 409 | Ga0207657_10030755 | 3300025919 | Bacteria | 4868 |
| 410 | Ga0207649_10305383 | 3300025920 | Bacteria | 1165 |
| 411 | Ga0207652_10010300 | 3300025921 | Bacteria | 7526 |
| 412 | Ga0207652_10015488 | 3300025921 | Bacteria | 6199 |
| 413 | Ga0207652_10016438 | 3300025921 | Bacteria | 6042 |
| 414 | Ga0207694_10001639 | 3300025924 | Bacteria | 18837 |
| 415 | Ga0207694_10008346 | 3300025924 | Bacteria | 7829 |
| 416 | Ga0207694_10046702 | 3300025924 | Bacteria | 3347 |
| 417 | Ga0207694_10083288 | 3300025924 | Bacteria | 2515 |
| 418 | Ga0207694_10123866 | 3300025924 | Bacteria | 2066 |
| 419 | Ga0207650_10004702 | 3300025925 | Bacteria | 9329 |
| 420 | Ga0207650_10139069 | 3300025925 | Bacteria | 1908 |
| 421 | Ga0207659_10048551 | 3300025926 | Bacteria | 3007 |
| 422 | Ga0207659_10191695 | 3300025926 | Bacteria | 1627 |
| 423 | Ga0207687_10084525 | 3300025927 | Bacteria | 2300 |
| 424 | Ga0207687_10115219 | 3300025927 | Bacteria | 2002 |
| 425 | Ga0207700_10008958 | 3300025928 | Bacteria | 6230 |
| 426 | Ga0207700_10039853 | 3300025928 | Bacteria | 3424 |
| 427 | Ga0207700_10042207 | 3300025928 | Bacteria | 3342 |
| 428 | Ga0207664_10010987 | 3300025929 | Bacteria | 6411 |
| 429 | Ga0207664_10019635 | 3300025929 | Bacteria | 4999 |
| 430 | Ga0207664_10056781 | 3300025929 | Bacteria | 3110 |
| 431 | Ga0207664_10068217 | 3300025929 | Bacteria | 2856 |
| 432 | Ga0207664_10079285 | 3300025929 | Bacteria | 2665 |
| 433 | Ga0207664_10100081 | 3300025929 | Bacteria | 2393 |
| 434 | Ga0207644_10006040 | 3300025931 | Bacteria | 7896 |
| 435 | Ga0207644_10041918 | 3300025931 | Bacteria | 3240 |
| 436 | Ga0207644_10085093 | 3300025931 | Bacteria | 2345 |
| 437 | Ga0207644_10109970 | 3300025931 | Bacteria | 2083 |
| 438 | Ga0207644_10231263 | 3300025931 | Bacteria | 1469 |
| 439 | Ga0207644_10234208 | 3300025931 | Bacteria | 1460 |
| 440 | Ga0207690_10010823 | 3300025932 | Bacteria | 5436 |
| 441 | Ga0207690_10039340 | 3300025932 | Bacteria | 3085 |
| 442 | Ga0207690_10092175 | 3300025932 | Bacteria | 2143 |
| 443 | Ga0207706_10154343 | 3300025933 | Bacteria | 2020 |
| 444 | Ga0207706_10283039 | 3300025933 | Bacteria | 1446 |
| 445 | Ga0207669_10031192 | 3300025937 | Bacteria | 2974 |
| 446 | Ga0207669_10049642 | 3300025937 | Bacteria | 2502 |
| 447 | Ga0207704_10055882 | 3300025938 | Bacteria | 2415 |
| 448 | Ga0207704_10083959 | 3300025938 | Bacteria | 2069 |
| 449 | Ga0207704_10105001 | 3300025938 | Bacteria | 1894 |
| 450 | Ga0207665_10000769 | 3300025939 | Bacteria | 21572 |
| 451 | Ga0207665_10012564 | 3300025939 | Bacteria | 5564 |
| 452 | Ga0207665_10089156 | 3300025939 | Bacteria | 2136 |
| 453 | Ga0207665_10167911 | 3300025939 | Bacteria | 1583 |
| 454 | Ga0207691_10008356 | 3300025940 | Bacteria | 9945 |
| 455 | Ga0207691_10066113 | 3300025940 | Bacteria | 3272 |
| 456 | Ga0207691_10086468 | 3300025940 | Bacteria | 2813 |
| 457 | Ga0207711_10021208 | 3300025941 | Bacteria | 5426 |
| 458 | Ga0207711_10043099 | 3300025941 | Bacteria | 3847 |
| 459 | Ga0207711_10259611 | 3300025941 | Bacteria | 1596 |
| 460 | Ga0207711_10286625 | 3300025941 | Bacteria | 1517 |
| 461 | Ga0207689_10001032 | 3300025942 | Bacteria | 26745 |
| 462 | Ga0207689_10002117 | 3300025942 | Bacteria | 18668 |
| 463 | Ga0207689_10065242 | 3300025942 | Bacteria | 2995 |
| 464 | Ga0207661_10017104 | 3300025944 | Bacteria | 5358 |
| 465 | Ga0207661_10018752 | 3300025944 | Bacteria | 5146 |
| 466 | Ga0207661_10036158 | 3300025944 | Bacteria | 3853 |
| 467 | Ga0207679_10102626 | 3300025945 | Bacteria | 2240 |
| 468 | Ga0207679_10140197 | 3300025945 | Bacteria | 1953 |
| 469 | Ga0207679_10193460 | 3300025945 | Bacteria | 1693 |
| 470 | Ga0207679_10312573 | 3300025945 | Bacteria | 1358 |
| 471 | Ga0207667_10000695 | 3300025949 | Bacteria | 43623 |
| 472 | Ga0207667_10045339 | 3300025949 | Bacteria | 4657 |
| 473 | Ga0207667_10078040 | 3300025949 | Bacteria | 3433 |
| 474 | Ga0207667_10090833 | 3300025949 | Bacteria | 3156 |
| 475 | Ga0207667_10102682 | 3300025949 | Bacteria | 2949 |
| 476 | Ga0207667_10103927 | 3300025949 | Bacteria | 2930 |
| 477 | Ga0207651_10004079 | 3300025960 | Bacteria | 7281 |
| 478 | Ga0207651_10107656 | 3300025960 | Bacteria | 2084 |
| 479 | Ga0207712_10020564 | 3300025961 | Bacteria | 4324 |
| 480 | Ga0207712_10109912 | 3300025961 | Bacteria | 2066 |
| 481 | Ga0207668_10002227 | 3300025972 | Bacteria | 11308 |
| 482 | Ga0207668_10043366 | 3300025972 | Bacteria | 3052 |
| 483 | Ga0207668_10084965 | 3300025972 | Bacteria | 2307 |
| 484 | Ga0207668_10299720 | 3300025972 | Bacteria | 1326 |
| 485 | Ga0207640_10019508 | 3300025981 | Bacteria | 4007 |
| 486 | Ga0207640_10053481 | 3300025981 | Bacteria | 2636 |
| 487 | Ga0207640_10157753 | 3300025981 | Bacteria | 1675 |
| 488 | Ga0207658_10004931 | 3300025986 | Bacteria | 9207 |
| 489 | Ga0207658_10038002 | 3300025986 | Bacteria | 3465 |
| 490 | Ga0207658_10088674 | 3300025986 | Bacteria | 2392 |
| 491 | Ga0207658_10091307 | 3300025986 | Bacteria | 2362 |
| 492 | Ga0207677_10018849 | 3300026023 | Bacteria | 4153 |
| 493 | Ga0207677_10027954 | 3300026023 | Bacteria | 3561 |
| 494 | Ga0207677_10046392 | 3300026023 | Bacteria | 2909 |
| 495 | Ga0207677_10169547 | 3300026023 | Bacteria | 1705 |
| 496 | Ga0207677_10191917 | 3300026023 | Bacteria | 1616 |
| 497 | Ga0207677_10242241 | 3300026023 | Bacteria | 1460 |
| 498 | Ga0207677_10257000 | 3300026023 | Bacteria | 1422 |
| 499 | Ga0207703_10007505 | 3300026035 | Bacteria | 8656 |
| 500 | Ga0207703_10124736 | 3300026035 | Bacteria | 2215 |
| 501 | Ga0207639_10006291 | 3300026041 | Bacteria | 8064 |
| 502 | Ga0207639_10366357 | 3300026041 | Bacteria | 1291 |
| 503 | Ga0207678_10003850 | 3300026067 | Bacteria | 13493 |
| 504 | Ga0207678_10076204 | 3300026067 | Bacteria | 2873 |
| 505 | Ga0207678_10103157 | 3300026067 | Bacteria | 2435 |
| 506 | Ga0207678_10104869 | 3300026067 | Bacteria | 2412 |
| 507 | Ga0207678_10114463 | 3300026067 | Bacteria | 2301 |
| 508 | Ga0207678_10126265 | 3300026067 | Bacteria | 2182 |
| 509 | Ga0207678_10189349 | 3300026067 | Bacteria | 1758 |
| 510 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 511 | Ga0207702_10000178 | 3300026078 | Bacteria | 76683 |
| 512 | Ga0207702_10076553 | 3300026078 | Bacteria | 2892 |
| 513 | Ga0207702_10270508 | 3300026078 | Bacteria | 1603 |
| 514 | Ga0207702_10357095 | 3300026078 | Bacteria | 1400 |
| 515 | Ga0207641_10013613 | 3300026088 | Bacteria | 6671 |
| 516 | Ga0207641_10078085 | 3300026088 | Bacteria | 2867 |
| 517 | Ga0207641_10088791 | 3300026088 | Bacteria | 2700 |
| 518 | Ga0207648_10004696 | 3300026089 | Bacteria | 13969 |
| 519 | Ga0207648_10013227 | 3300026089 | Bacteria | 7688 |
| 520 | Ga0207648_10050348 | 3300026089 | Bacteria | 3642 |
| 521 | Ga0207648_10208020 | 3300026089 | Bacteria | 1736 |
| 522 | Ga0207648_10594117 | 3300026089 | Bacteria | 1020 |
| 523 | Ga0207676_10001747 | 3300026095 | Bacteria | 15971 |
| 524 | Ga0207676_10007631 | 3300026095 | Bacteria | 7679 |
| 525 | Ga0207676_10030686 | 3300026095 | Bacteria | 4037 |
| 526 | Ga0207676_10069332 | 3300026095 | Bacteria | 2823 |
| 527 | Ga0207674_10000396 | 3300026116 | Bacteria | 56376 |
| 528 | Ga0207674_10034959 | 3300026116 | Bacteria | 5248 |
| 529 | Ga0207674_10042203 | 3300026116 | Bacteria | 4713 |
| 530 | Ga0207674_10143664 | 3300026116 | Bacteria | 2345 |
| 531 | Ga0207674_10347269 | 3300026116 | Bacteria | 1434 |
| 532 | Ga0207675_100017442 | 3300026118 | Bacteria | 6702 |
| 533 | Ga0207675_100047402 | 3300026118 | Bacteria | 4012 |
| 534 | Ga0207675_100085004 | 3300026118 | Bacteria | 2969 |
| 535 | Ga0207675_100198107 | 3300026118 | Bacteria | 1928 |
| 536 | Ga0207675_100517029 | 3300026118 | Bacteria | 1190 |
| 537 | Ga0207683_10006461 | 3300026121 | Bacteria | 10034 |
| 538 | Ga0207683_10012473 | 3300026121 | Bacteria | 7251 |
| 539 | Ga0207683_10069174 | 3300026121 | Bacteria | 3118 |
| 540 | Ga0207683_10069873 | 3300026121 | Bacteria | 3102 |
| 541 | Ga0207683_10082355 | 3300026121 | Bacteria | 2859 |
| 542 | Ga0207683_10125511 | 3300026121 | Bacteria | 2306 |
| 543 | Ga0207683_10251250 | 3300026121 | Bacteria | 1614 |
| 544 | Ga0207683_10285121 | 3300026121 | Bacteria | 1510 |
| 545 | Ga0207698_10017296 | 3300026142 | Bacteria | 4888 |
| 546 | Ga0207698_10033941 | 3300026142 | Bacteria | 3713 |
| 547 | Ga0207698_10098832 | 3300026142 | Bacteria | 2412 |
| 548 | Ga0207698_10149306 | 3300026142 | Bacteria | 2026 |
| 549 | Ga0207698_10403756 | 3300026142 | Bacteria | 1307 |
| 550 | Ga0207698_10419125 | 3300026142 | Bacteria | 1284 |
| 551 | Ga0209589_1000023 | 3300027357 | Bacteria | 177856 |
| 552 | Ga0209489_100032 | 3300027361 | Bacteria | 177856 |
| 553 | Ga0209700_100040 | 3300027363 | Bacteria | 177856 |
| 554 | Ga0209179_1001602 | 3300027512 | Bacteria | 2833 |
| 555 | Ga0209813_10000922 | 3300027866 | Bacteria | 6610 |
| 556 | Ga0268266_10003342 | 3300028379 | Bacteria | 16063 |
| 557 | Ga0268266_10006607 | 3300028379 | Bacteria | 10586 |
| 558 | Ga0268266_10009629 | 3300028379 | Bacteria | 8496 |
| 559 | Ga0268266_10057820 | 3300028379 | Bacteria | 3337 |
| 560 | Ga0268266_10104298 | 3300028379 | Bacteria | 2503 |
| 561 | Ga0268266_10251779 | 3300028379 | Bacteria | 1634 |
| 562 | Ga0268265_10012963 | 3300028380 | Bacteria | 5660 |
| 563 | Ga0268265_10015854 | 3300028380 | Bacteria | 5168 |
| 564 | Ga0268265_10061792 | 3300028380 | Bacteria | 2876 |
| 565 | Ga0268265_10087123 | 3300028380 | Bacteria | 2484 |
| 566 | Ga0268265_10137183 | 3300028380 | Bacteria | 2042 |
| 567 | Ga0268264_10000022 | 3300028381 | Bacteria | 476624 |
| 568 | Ga0268264_10005591 | 3300028381 | Bacteria | 10650 |
| 569 | Ga0268264_10059201 | 3300028381 | Bacteria | 3209 |
| 570 | Ga0268264_10089122 | 3300028381 | Bacteria | 2656 |
| 571 | Ga0268264_10483887 | 3300028381 | Bacteria | 1204 |
| 572 | Ga0265336_10004089 | 3300028666 | Bacteria | 5558 |
| 573 | Ga0307517_10005009 | 3300028786 | Bacteria | 20143 |
| 574 | Ga0307515_10051754 | 3300028794 | Bacteria | 6112 |
| 575 | Ga0265338_10003088 | 3300028800 | Bacteria | 23887 |
| 576 | Ga0265324_10024421 | 3300029957 | Bacteria | 2146 |
| 577 | Ga0265330_10005670 | 3300031235 | Bacteria | 6209 |
| 578 | Ga0265332_10000824 | 3300031238 | Bacteria | 18837 |
| 579 | Ga0265328_10004314 | 3300031239 | Bacteria | 6181 |
| 580 | Ga0265325_10072205 | 3300031241 | Bacteria | 1730 |
| 581 | Ga0265339_10004830 | 3300031249 | Bacteria | 9111 |
| 582 | Ga0265331_10000237 | 3300031250 | Bacteria | 66600 |
| 583 | Ga0265331_10000305 | 3300031250 | Bacteria | 53782 |
| 584 | Ga0265327_10000458 | 3300031251 | Bacteria | 73095 |
| 585 | Ga0265327_10000517 | 3300031251 | Bacteria | 66613 |
| 586 | Ga0265327_10004446 | 3300031251 | Bacteria | 12401 |
| 587 | Ga0307509_10085539 | 3300031507 | Bacteria | 3245 |
| 588 | Ga0307408_100185278 | 3300031548 | Bacteria | 1673 |
| 589 | Ga0307508_10000009 | 3300031616 | Bacteria | 256966 |
| 590 | Ga0307508_10054636 | 3300031616 | Bacteria | 3540 |
| 591 | Ga0307508_10099280 | 3300031616 | Bacteria | 2505 |
| 592 | Ga0265314_10068903 | 3300031711 | Bacteria | 2376 |
| 593 | Ga0265314_10131972 | 3300031711 | Bacteria | 1557 |
| 594 | Ga0265342_10005456 | 3300031712 | Bacteria | 9684 |
| 595 | Ga0265342_10031924 | 3300031712 | Bacteria | 3251 |
| 596 | Ga0307516_10029403 | 3300031730 | Bacteria | 5556 |
| 597 | Ga0307516_10100895 | 3300031730 | Bacteria | 2702 |
| 598 | Ga0307516_10335265 | 3300031730 | Bacteria | 1180 |
| 599 | Ga0307410_10195367 | 3300031852 | Bacteria | 1541 |
| 600 | Ga0307406_10068657 | 3300031901 | Bacteria | 2315 |
| 601 | Ga0307409_100244992 | 3300031995 | Bacteria | 1634 |
| 602 | Ga0307416_100291661 | 3300032002 | Bacteria | 1615 |
| 603 | Ga0307415_100091229 | 3300032126 | Bacteria | 2206 |
| 604 | Ga0307415_100130845 | 3300032126 | Bacteria | 1899 |
| 605 | Ga0307510_10021690 | 3300033180 | Bacteria | 7481 |
| 606 | Ga0307510_10044918 | 3300033180 | Bacteria | 4778 |
| 607 | Ga0307510_10123424 | 3300033180 | Bacteria | 2287 |
| 608 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 609 | Ga0373926_0016472 | 3300035083 | Bacteria | 2529 |
| 610 | Ga0373944_0026414 | 3300035089 | Bacteria | 1715 |
| 611 | Ga0373952_0021323 | 3300035092 | Bacteria | 1367 |
| 612 | Ga0373923_0005783 | 3300035111 | Bacteria | 4222 |
| 613 | Ga0373936_0007012 | 3300035113 | Bacteria | 4241 |
| 614 | Ga0373936_0011048 | 3300035113 | Bacteria | 3413 |
| 615 | Ga0373936_0027480 | 3300035113 | Bacteria | 2232 |
| 616 | Ga0373936_0028088 | 3300035113 | Bacteria | 2210 |
| 617 | Ga0373953_0010957 | 3300035117 | Bacteria | 3169 |
| 618 | Ga0373954_0035950 | 3300035118 | Bacteria | 2298 |
| 619 | Ga0373954_0039781 | 3300035118 | Bacteria | 2189 |
| 620 | Ga0373954_0104514 | 3300035118 | Bacteria | 1367 |
| 621 | Ga0373957_0005054 | 3300035120 | Bacteria | 4071 |
| 622 | Ga0373943_0016066 | 3300035170 | Bacteria | 3409 |
| 623 | Ga0373943_0039078 | 3300035170 | Bacteria | 2284 |
| 624 | Ga0373946_0129214 | 3300035171 | Bacteria | 1161 |
| 625 | Ga0373955_0104290 | 3300035172 | Bacteria | 1631 |
| 626 | Ga0373935_0003830 | 3300035692 | Bacteria | 8772 |
| 627 | Ga0373935_0231081 | 3300035692 | Bacteria | 1288 |
| 628 | Ga0373927_0020885 | 3300035695 | Bacteria | 4291 |
| 629 | Ga0373927_0039408 | 3300035695 | Bacteria | 3067 |
| 630 | Ga0373927_0113654 | 3300035695 | Bacteria | 1764 |
| 631 | Ga0373927_0149777 | 3300035695 | Bacteria | 1528 |
| 632 | Ga0373933_0000781 | 3300035724 | Bacteria | 19421 |
| 633 | Ga0373933_0016755 | 3300035724 | Bacteria | 4104 |
| 634 | Ga0373933_0034746 | 3300035724 | Bacteria | 2940 |
| 635 | Ga0373947_0005936 | 3300035725 | Bacteria | 7117 |
| 636 | Ga0373947_0012802 | 3300035725 | Bacteria | 4808 |
| 637 | Ga0373947_0031330 | 3300035725 | Bacteria | 3129 |
| 638 | Ga0373937_0011582 | 3300036401 | Bacteria | 7742 |
| 639 | Ga0373937_0037854 | 3300036401 | Bacteria | 4396 |
| 640 | Ga0373937_0073229 | 3300036401 | Bacteria | 3160 |
| 641 | Ga0373937_0088438 | 3300036401 | Bacteria | 2868 |
| 642 | Ga0373937_0116609 | 3300036401 | Unclassified | 2487 |
| 643 | Ga0395900_0093574 | 3300037418 | Bacteria | 3087 |
| 644 | Ga0395900_0360796 | 3300037418 | Bacteria | 1424 |
| 645 | Ga0395898_0028162 | 3300037466 | Bacteria | 5634 |
| 646 | Ga0395898_0068252 | 3300037466 | Bacteria | 3440 |
| 647 | Ga0395898_0121911 | 3300037466 | Bacteria | 2498 |
| 648 | Ga0395898_0152454 | 3300037466 | Bacteria | 2211 |
| 649 | Ga0436364_0059037 | 3300037853 | Bacteria | 1106 |
| 650 | Ga0436364_0693921 | 3300037853 | Bacteria | 5729 |
| 651 | Ga0395901_0010512 | 3300038443 | Bacteria | 9373 |
| 652 | Ga0395901_0041679 | 3300038443 | Bacteria | 4759 |
| 653 | Ga0395901_0154216 | 3300038443 | Bacteria | 2413 |
| 654 | Ga0400484_03261 | 3300038725 | Bacteria | 37196 |
| 655 | Ga0400484_43122 | 3300038725 | Bacteria | 3224 |
| 656 | Ga0400490_20091 | 3300038726 | Bacteria | 9857 |
| 657 | Ga0400491_10244 | 3300038727 | Bacteria | 3893 |
| 658 | Ga0400486_00975 | 3300038742 | Bacteria | 3104 |
| 659 | Ga0400487_15725 | 3300039110 | Bacteria | 1480 |
| 660 | Ga0400487_27362 | 3300039110 | Bacteria | 16177 |
| 661 | Ga0436365_0189813 | 3300039437 | Bacteria | 1134 |
| 662 | Ga0436365_0336775 | 3300039437 | Bacteria | 3612 |
| 663 | Ga0436365_0484561 | 3300039437 | Bacteria | 5768 |
| 664 | Ga0436365_0541977 | 3300039437 | Bacteria | 1735 |
| 665 | Ga0436365_1003039 | 3300039437 | Bacteria | 1777 |
| 666 | Ga0436360_0083451 | 3300039438 | Bacteria | 2005 |
| 667 | Ga0436361_0708810 | 3300039447 | Bacteria | 1820 |
| 668 | Ga0436361_1057156 | 3300039447 | Bacteria | 4137 |
| 669 | Ga0436363_0149962 | 3300039450 | Bacteria | 1076 |
| 670 | Ga0436363_1293231 | 3300039450 | Bacteria | 9037 |
| 671 | Ga0436363_1512041 | 3300039450 | Bacteria | 5904 |
| 672 | Ga0436362_0094827 | 3300039453 | Bacteria | 2097 |
| 673 | Ga0451841_0161589 | 3300041498 | Bacteria | 1514 |
| 674 | Ga0439445_0036880 | 3300042004 | Bacteria | 1288 |
| 675 | Ga0466972_0132607 | 3300044658 | Bacteria | 1173 |
| 676 | Ga0466959_0091013 | 3300045049 | Bacteria | 2191 |
| 677 | Ga0466959_0121103 | 3300045049 | Bacteria | 1860 |
| 678 | Ga0466967_0031972 | 3300045976 | Bacteria | 4438 |
| 679 | Ga0495603_0015905 | 3300046455 | Bacteria | 4548 |
| 680 | Ga0495603_0016623 | 3300046455 | Bacteria | 4452 |
| 681 | Ga0495629_0000083 | 3300046459 | Bacteria | 83715 |
| 682 | Ga0495629_0043397 | 3300046459 | Bacteria | 3157 |
| 683 | Ga0495629_0070518 | 3300046459 | Bacteria | 2438 |
| 684 | Ga0495641_0008459 | 3300046461 | Bacteria | 6269 |
| 685 | Ga0495651_0015048 | 3300046462 | Bacteria | 5979 |
| 686 | Ga0495651_0180024 | 3300046462 | Bacteria | 1497 |
| 687 | Ga0495651_0229996 | 3300046462 | Bacteria | 1278 |
| 688 | Ga0495653_0038786 | 3300046463 | Bacteria | 3737 |
| 689 | Ga0495650_0048232 | 3300046471 | Bacteria | 1777 |
| 690 | Ga0495580_0001769 | 3300046472 | Bacteria | 18986 |
| 691 | Ga0495580_0035790 | 3300046472 | Bacteria | 3569 |
| 692 | Ga0495582_0000206 | 3300046473 | Bacteria | 32664 |
| 693 | Ga0495582_0038376 | 3300046473 | Bacteria | 2636 |
| 694 | Ga0495639_0000167 | 3300046475 | Bacteria | 34509 |
| 695 | Ga0495639_0147949 | 3300046475 | Bacteria | 1132 |
| 696 | Ga0495662_0000457 | 3300046476 | Bacteria | 18414 |
| 697 | Ga0495662_0106280 | 3300046476 | Bacteria | 1374 |
| 698 | Ga0495664_0003502 | 3300046477 | Bacteria | 8549 |
| 699 | Ga0495664_0023653 | 3300046477 | Bacteria | 3566 |
| 700 | Ga0495594_0000838 | 3300046499 | Bacteria | 15872 |
| 701 | Ga0495596_0035514 | 3300046500 | Bacteria | 1976 |
| 702 | Ga0495606_0013130 | 3300046507 | Bacteria | 6575 |
| 703 | Ga0495606_0111919 | 3300046507 | Bacteria | 1646 |
| 704 | Ga0495610_0059184 | 3300046512 | Bacteria | 1830 |
| 705 | Ga0495618_0014131 | 3300046514 | Bacteria | 4861 |
| 706 | Ga0495618_0052279 | 3300046514 | Bacteria | 2582 |
| 707 | Ga0495628_0045817 | 3300046516 | Bacteria | 3475 |
| 708 | Ga0495630_0053174 | 3300046517 | Bacteria | 3032 |
| 709 | Ga0495632_0084116 | 3300046519 | Bacteria | 1514 |
| 710 | Ga0495632_0091564 | 3300046519 | Bacteria | 1441 |
| 711 | Ga0495648_0000160 | 3300046524 | Bacteria | 80523 |
| 712 | Ga0495648_0001196 | 3300046524 | Bacteria | 25992 |
| 713 | Ga0495666_0029252 | 3300046526 | Bacteria | 2711 |
| 714 | Ga0495666_0098796 | 3300046526 | Bacteria | 1376 |
| 715 | Ga0495652_0071311 | 3300046529 | Bacteria | 2900 |
| 716 | Ga0495665_0000399 | 3300046531 | Bacteria | 22087 |
| 717 | Ga0495665_0017095 | 3300046531 | Bacteria | 3902 |
| 718 | Ga0495640_0006041 | 3300046533 | Bacteria | 9605 |
| 719 | Ga0495640_0022858 | 3300046533 | Bacteria | 4565 |
| 720 | Ga0495640_0121299 | 3300046533 | Bacteria | 1699 |
| 721 | Ga0495587_0049159 | 3300046536 | Bacteria | 2496 |
| 722 | Ga0495645_0127101 | 3300046543 | Bacteria | 1790 |
| 723 | Ga0495667_0009670 | 3300046559 | Bacteria | 6536 |
| 724 | Ga0495667_0025334 | 3300046559 | Bacteria | 3997 |
| 725 | Ga0495667_0157758 | 3300046559 | Bacteria | 1460 |
| 726 | Ga0495656_0049430 | 3300046615 | Bacteria | 1791 |
| 727 | Ga0495668_0143725 | 3300046616 | Bacteria | 1306 |
| 728 | Ga0495634_0049262 | 3300046642 | Bacteria | 2833 |
| 729 | Ga0495625_0267779 | 3300046660 | Bacteria | 1104 |
| 730 | Ga0495635_0001363 | 3300046663 | Bacteria | 16259 |
| 731 | Ga0495635_0030361 | 3300046663 | Bacteria | 3756 |
| 732 | Ga0495588_0150158 | 3300046674 | Bacteria | 1232 |
| 733 | Ga0495657_0018064 | 3300046675 | Bacteria | 5111 |
| 734 | Ga0495657_0041184 | 3300046675 | Bacteria | 3164 |
| 735 | Ga0495599_0009520 | 3300046678 | Bacteria | 5941 |
| 736 | Ga0495599_0096181 | 3300046678 | Bacteria | 1847 |
| 737 | Ga0495623_0055361 | 3300046679 | Bacteria | 2500 |
| 738 | Ga0495623_0144693 | 3300046679 | Bacteria | 1411 |
| 739 | Ga0495623_0163188 | 3300046679 | Bacteria | 1308 |
| 740 | Ga0495646_0007314 | 3300046680 | Bacteria | 7014 |
| 741 | Ga0495646_0015020 | 3300046680 | Bacteria | 4918 |
| 742 | Ga0495658_0003680 | 3300046683 | Bacteria | 7585 |
| 743 | Ga0495658_0034618 | 3300046683 | Bacteria | 2772 |
| 744 | Ga0495658_0121531 | 3300046683 | Bacteria | 1580 |
| 745 | Ga0495658_0152549 | 3300046683 | Bacteria | 1420 |
| 746 | Ga0495669_0023373 | 3300046684 | Bacteria | 2690 |
| 747 | Ga0495613_0002852 | 3300046689 | Bacteria | 12940 |
| 748 | Ga0495613_0161412 | 3300046689 | Bacteria | 1594 |
| 749 | Ga0495624_0000096 | 3300046690 | Bacteria | 59307 |
| 750 | Ga0495670_0092353 | 3300046691 | Bacteria | 1550 |
| 751 | Ga0495600_0079852 | 3300046809 | Bacteria | 2135 |
| 752 | Ga0495581_0000311 | 3300047315 | Bacteria | 23901 |
| 753 | Ga0495581_0027251 | 3300047315 | Bacteria | 3313 |
| 754 | Ga0495604_0022802 | 3300047317 | Bacteria | 4997 |
| 755 | Ga0495674_0050857 | 3300047319 | Bacteria | 3655 |
| 756 | Ga0495674_0183913 | 3300047319 | Bacteria | 1739 |
| 757 | Ga0495672_0009354 | 3300047320 | Bacteria | 7110 |
| 758 | Ga0495672_0015084 | 3300047320 | Bacteria | 5259 |
| 759 | Ga0495672_0017739 | 3300047320 | Bacteria | 4750 |
| 760 | Ga0495672_0055917 | 3300047320 | Bacteria | 2300 |
| 761 | Ga0495672_0104877 | 3300047320 | Bacteria | 1526 |
| 762 | Ga0495676_0291284 | 3300047321 | Bacteria | 1103 |
| 763 | Ga0495680_0040520 | 3300047322 | Bacteria | 3710 |
| 764 | Ga0495675_0008762 | 3300047444 | Bacteria | 6280 |
| 765 | Ga0495673_0074239 | 3300047469 | Bacteria | 1423 |
| 766 | Ga0495681_0143834 | 3300047470 | Bacteria | 1005 |
| 767 | Ga0495684_0015876 | 3300047471 | Bacteria | 5798 |
| 768 | Ga0495684_0035422 | 3300047471 | Bacteria | 3828 |
| 769 | Ga0495614_0021984 | 3300048089 | Bacteria | 2754 |
| 770 | Ga0495615_0045850 | 3300048090 | Bacteria | 1109 |
| 771 | Ga0496100_0190959 | 3300048903 | Bacteria | 1487 |
| 772 | Ga0496101_0029223 | 3300048904 | Bacteria | 3855 |
| 773 | Ga0496102_0001926 | 3300048905 | Bacteria | 17867 |
| 774 | Ga0496102_0040079 | 3300048905 | Bacteria | 4236 |
| 775 | Ga0496102_0116650 | 3300048905 | Bacteria | 2491 |
| 776 | Ga0496102_0149692 | 3300048905 | Bacteria | 2192 |
| 777 | Ga0496102_0492695 | 3300048905 | Bacteria | 1147 |
| 778 | Ga0496103_0065835 | 3300048906 | Bacteria | 2261 |
| 779 | Ga0496103_0268480 | 3300048906 | Bacteria | 1097 |
| 780 | Ga0496104_0016935 | 3300048907 | Bacteria | 6630 |
| 781 | Ga0496104_0050836 | 3300048907 | Bacteria | 3911 |
| 782 | Ga0496105_0014383 | 3300048908 | Bacteria | 6298 |
| 783 | Ga0496106_0007840 | 3300048909 | Bacteria | 7905 |
| 784 | Ga0496106_0015567 | 3300048909 | Bacteria | 5625 |
| 785 | Ga0496106_0189353 | 3300048909 | Bacteria | 1635 |
| 786 | Ga0496106_0369476 | 3300048909 | Bacteria | 1152 |
| 787 | Ga0496107_0014875 | 3300048910 | Bacteria | 5449 |
| 788 | Ga0496107_0028174 | 3300048910 | Bacteria | 3991 |
| 789 | Ga0496107_0117834 | 3300048910 | Bacteria | 1955 |
| 790 | Ga0496108_0017540 | 3300048911 | Bacteria | 5858 |
| 791 | Ga0496108_0062659 | 3300048911 | Bacteria | 3131 |
| 792 | Ga0496108_0503076 | 3300048911 | Bacteria | 1058 |
| 793 | Ga0496109_0048435 | 3300048912 | Bacteria | 3867 |
| 794 | Ga0496109_0138834 | 3300048912 | Bacteria | 2272 |
| 795 | Ga0496109_0162539 | 3300048912 | Bacteria | 2092 |
| 796 | Ga0496109_0182096 | 3300048912 | Bacteria | 1973 |
| 797 | Ga0496110_0020916 | 3300048913 | Bacteria | 5528 |
| 798 | Ga0496110_0105745 | 3300048913 | Bacteria | 2525 |
| 799 | Ga0496110_0193606 | 3300048913 | Bacteria | 1846 |
| 800 | Ga0496110_0331119 | 3300048913 | Bacteria | 1387 |
| 801 | Ga0496111_0029215 | 3300048914 | Bacteria | 3914 |
| 802 | Ga0496111_0063294 | 3300048914 | Bacteria | 2683 |
| 803 | Ga0496112_0000079 | 3300048915 | Bacteria | 64101 |
| 804 | Ga0496112_0017117 | 3300048915 | Bacteria | 6805 |
| 805 | Ga0496112_0041980 | 3300048915 | Bacteria | 4475 |
| 806 | Ga0496112_0078172 | 3300048915 | Bacteria | 3272 |
| 807 | Ga0496112_0183955 | 3300048915 | Bacteria | 2053 |
| 808 | Ga0496113_0008709 | 3300048916 | Bacteria | 6624 |
| 809 | Ga0496113_0009465 | 3300048916 | Bacteria | 6391 |
| 810 | Ga0496113_0014956 | 3300048916 | Bacteria | 5313 |
| 811 | Ga0496113_0033288 | 3300048916 | Bacteria | 3752 |
| 812 | Ga0496113_0171594 | 3300048916 | Bacteria | 1718 |
| 813 | Ga0496114_0025447 | 3300048917 | Bacteria | 4838 |
| 814 | Ga0496114_0124677 | 3300048917 | Bacteria | 2219 |
| 815 | Ga0496114_0187265 | 3300048917 | Bacteria | 1809 |
| 816 | Ga0496115_0032477 | 3300048918 | Bacteria | 4117 |
| 817 | Ga0496115_0036116 | 3300048918 | Bacteria | 3911 |
| 818 | Ga0496115_0120255 | 3300048918 | Bacteria | 2161 |
| 819 | Ga0496115_0381964 | 3300048918 | Bacteria | 1145 |
| 820 | Ga0496117_0014455 | 3300048920 | Bacteria | 6799 |
| 821 | Ga0496118_0023890 | 3300048921 | Bacteria | 5293 |
| 822 | Ga0496118_0033952 | 3300048921 | Bacteria | 4174 |
| 823 | Ga0496119_0001067 | 3300048922 | Bacteria | 34838 |
| 824 | Ga0496119_0045578 | 3300048922 | Bacteria | 2747 |
| 825 | Ga0496121_0000495 | 3300048924 | Bacteria | 75339 |
| 826 | Ga0496121_0026710 | 3300048924 | Bacteria | 5427 |
| 827 | Ga0496121_0045260 | 3300048924 | Bacteria | 3783 |
| 828 | Ga0496121_0082038 | 3300048924 | Bacteria | 2550 |
| 829 | Ga0496121_0088366 | 3300048924 | Bacteria | 2430 |
| 830 | Ga0496121_0118639 | 3300048924 | Bacteria | 2002 |
| 831 | Ga0496121_0133274 | 3300048924 | Bacteria | 1855 |
| 832 | Ga0496122_0002451 | 3300048925 | Bacteria | 26250 |
| 833 | Ga0496122_0091580 | 3300048925 | Bacteria | 2070 |
| 834 | Ga0496123_0002729 | 3300048926 | Bacteria | 21168 |
| 835 | Ga0496123_0018019 | 3300048926 | Bacteria | 5649 |
| 836 | Ga0496123_0120012 | 3300048926 | Bacteria | 1482 |
| 837 | Ga0496124_0032050 | 3300048927 | Bacteria | 4648 |
| 838 | Ga0496125_0000756 | 3300048928 | Bacteria | 52960 |
| 839 | Ga0496125_0062680 | 3300048928 | Bacteria | 2971 |
| 840 | Ga0496125_0076405 | 3300048928 | Bacteria | 2586 |
| 841 | Ga0496125_0086468 | 3300048928 | Bacteria | 2371 |
| 842 | Ga0496126_0003586 | 3300048929 | Bacteria | 19458 |
| 843 | Ga0496126_0016488 | 3300048929 | Bacteria | 7383 |
| 844 | Ga0496126_0026376 | 3300048929 | Bacteria | 5572 |
| 845 | Ga0496126_0028995 | 3300048929 | Bacteria | 5263 |
| 846 | Ga0496126_0033722 | 3300048929 | Bacteria | 4815 |
| 847 | Ga0496126_0036229 | 3300048929 | Bacteria | 4615 |
| 848 | Ga0496126_0036387 | 3300048929 | Bacteria | 4603 |
| 849 | Ga0496126_0042356 | 3300048929 | Bacteria | 4206 |
| 850 | Ga0496126_0046139 | 3300048929 | Bacteria | 4000 |
| 851 | Ga0496126_0061695 | 3300048929 | Bacteria | 3367 |
| 852 | Ga0496126_0073591 | 3300048929 | Bacteria | 3037 |
| 853 | Ga0496126_0079278 | 3300048929 | Bacteria | 2907 |
| 854 | Ga0496126_0135859 | 3300048929 | Bacteria | 2121 |
| 855 | Ga0496126_0246358 | 3300048929 | Bacteria | 1491 |
| 856 | Ga0496126_0369530 | 3300048929 | Bacteria | 1170 |
| 857 | Ga0501031_0019410 | 3300049568 | Bacteria | 4429 |
| 858 | Ga0501031_0021878 | 3300049568 | Bacteria | 4166 |
| 859 | Ga0501031_0030985 | 3300049568 | Bacteria | 3489 |
| 860 | Ga0501031_0130669 | 3300049568 | Bacteria | 1641 |
| 861 | Ga0501032_0000333 | 3300049569 | Bacteria | 39401 |
| 862 | Ga0501032_0018351 | 3300049569 | Bacteria | 4902 |
| 863 | Ga0501032_0054042 | 3300049569 | Bacteria | 2703 |
| 864 | Ga0501032_0076934 | 3300049569 | Bacteria | 2221 |
| 865 | Ga0501032_0133646 | 3300049569 | Bacteria | 1636 |
| 866 | Ga0501033_0000313 | 3300049570 | Bacteria | 45940 |
| 867 | Ga0501033_0001956 | 3300049570 | Bacteria | 17932 |
| 868 | Ga0501033_0013274 | 3300049570 | Bacteria | 6277 |
| 869 | Ga0501033_0041454 | 3300049570 | Bacteria | 3435 |
| 870 | Ga0501033_0149987 | 3300049570 | Bacteria | 1682 |
| 871 | Ga0501033_0186400 | 3300049570 | Bacteria | 1486 |
| 872 | Ga0501033_0194193 | 3300049570 | Bacteria | 1452 |
| 873 | Ga0501034_0000232 | 3300049571 | Bacteria | 103995 |
| 874 | Ga0501034_0069629 | 3300049571 | Bacteria | 3529 |
| 875 | Ga0501034_0102117 | 3300049571 | Bacteria | 2861 |
| 876 | Ga0501034_0164700 | 3300049571 | Bacteria | 2186 |
| 877 | Ga0501034_0298259 | 3300049571 | Bacteria | 1549 |
| 878 | Ga0501036_0000032 | 3300049572 | Bacteria | 91370 |
| 879 | Ga0501036_0091635 | 3300049572 | Bacteria | 2567 |
| 880 | Ga0501036_0092462 | 3300049572 | Bacteria | 2555 |
| 881 | Ga0501036_0195628 | 3300049572 | Bacteria | 1701 |
| 882 | Ga0501036_0200944 | 3300049572 | Bacteria | 1676 |
| 883 | Ga0501037_0000505 | 3300049573 | Bacteria | 31438 |
| 884 | Ga0501037_0004799 | 3300049573 | Bacteria | 9829 |
| 885 | Ga0501037_0079717 | 3300049573 | Bacteria | 2376 |
| 886 | Ga0501037_0149999 | 3300049573 | Bacteria | 1666 |
| 887 | Ga0501038_0000112 | 3300049574 | Bacteria | 68326 |
| 888 | Ga0501038_0008822 | 3300049574 | Bacteria | 9248 |
| 889 | Ga0501038_0013084 | 3300049574 | Bacteria | 7569 |
| 890 | Ga0501038_0042838 | 3300049574 | Bacteria | 3941 |
| 891 | Ga0501038_0173627 | 3300049574 | Bacteria | 1743 |
| 892 | Ga0501038_0310963 | 3300049574 | Bacteria | 1234 |
| 893 | Ga0501039_0000078 | 3300049575 | Bacteria | 73768 |
| 894 | Ga0501039_0018886 | 3300049575 | Bacteria | 5293 |
| 895 | Ga0501042_0058150 | 3300049578 | Bacteria | 2759 |
| 896 | Ga0501043_0000220 | 3300049579 | Bacteria | 51696 |
| 897 | Ga0501043_0014699 | 3300049579 | Bacteria | 6128 |
| 898 | Ga0501043_0033825 | 3300049579 | Bacteria | 4022 |
| 899 | Ga0501043_0093896 | 3300049579 | Bacteria | 2358 |
| 900 | Ga0501043_0131001 | 3300049579 | Bacteria | 1965 |
| 901 | Ga0501046_0000176 | 3300049580 | Bacteria | 65273 |
| 902 | Ga0501046_0096951 | 3300049580 | Bacteria | 2265 |
| 903 | Ga0501047_0000085 | 3300049581 | Bacteria | 118617 |
| 904 | Ga0501047_0027577 | 3300049581 | Bacteria | 5471 |
| 905 | Ga0501047_0029059 | 3300049581 | Bacteria | 5332 |
| 906 | Ga0501048_0000246 | 3300049582 | Bacteria | 36139 |
| 907 | Ga0501067_0002027 | 3300049583 | Bacteria | 11170 |
| 908 | Ga0501067_0034038 | 3300049583 | Bacteria | 2827 |
| 909 | Ga0501068_0011114 | 3300049584 | Bacteria | 5070 |
| 910 | Ga0501070_0012856 | 3300049586 | Bacteria | 7053 |
| 911 | Ga0501070_0069456 | 3300049586 | Bacteria | 2916 |
| 912 | Ga0501070_0111162 | 3300049586 | Bacteria | 2264 |
| 913 | Ga0501072_0012237 | 3300049588 | Bacteria | 6557 |
| 914 | Ga0501072_0099188 | 3300049588 | Bacteria | 2315 |
| 915 | Ga0501073_0000026 | 3300049589 | Bacteria | 124358 |
| 916 | Ga0501073_0033655 | 3300049589 | Bacteria | 3648 |
| 917 | Ga0501074_0000191 | 3300049590 | Bacteria | 33363 |
| 918 | Ga0501074_0025625 | 3300049590 | Bacteria | 4280 |
| 919 | Ga0501074_0036410 | 3300049590 | Bacteria | 3564 |
| 920 | Ga0501075_0157735 | 3300049591 | Bacteria | 1731 |
| 921 | Ga0501077_0124227 | 3300049593 | Bacteria | 1636 |
| 922 | Ga0501079_0093595 | 3300049741 | Bacteria | 2328 |
| 923 | Ga0501079_0270421 | 3300049741 | Bacteria | 1328 |
| 924 | Ga0501080_0002583 | 3300049742 | Bacteria | 15858 |
| 925 | Ga0501080_0013807 | 3300049742 | Bacteria | 7435 |
| 926 | Ga0501080_0083779 | 3300049742 | Bacteria | 2962 |
| 927 | Ga0501081_0217773 | 3300049743 | Bacteria | 1388 |
| 928 | Ga0501083_0003196 | 3300049744 | Bacteria | 11410 |
| 929 | Ga0501083_0012664 | 3300049744 | Bacteria | 5902 |
| 930 | Ga0501035_0000760 | 3300049822 | Bacteria | 34705 |
| 931 | Ga0501035_0059715 | 3300049822 | Bacteria | 3396 |
| 932 | Ga0501035_0127352 | 3300049822 | Bacteria | 2222 |
| 933 | Ga0501035_0171271 | 3300049822 | Bacteria | 1875 |
| 934 | Ga0501035_0176718 | 3300049822 | Bacteria | 1841 |
| 935 | Ga0501035_0325160 | 3300049822 | Bacteria | 1291 |
| 936 | Ga0501035_0439292 | 3300049822 | Bacteria | 1081 |
| 937 | Ga0501035_0441765 | 3300049822 | Bacteria | 1077 |
| 938 | Ga0501035_0484716 | 3300049822 | Bacteria | 1019 |
| 939 | Ga0501044_0000061 | 3300049823 | Bacteria | 133207 |
| 940 | Ga0501044_0025310 | 3300049823 | Bacteria | 6289 |
| 941 | Ga0501044_0043287 | 3300049823 | Bacteria | 4678 |
| 942 | Ga0501044_0097109 | 3300049823 | Bacteria | 2968 |
| 943 | Ga0501044_0134259 | 3300049823 | Bacteria | 2467 |
| 944 | Ga0501044_0193327 | 3300049823 | Bacteria | 1996 |
| 945 | Ga0501044_0248997 | 3300049823 | Bacteria | 1718 |
| 946 | Ga0501045_0026450 | 3300049824 | Bacteria | 4174 |
| 947 | nmdc:mga03683_18061_c1 | 3300050489 | Bacteria | 2677 |
| 948 | nmdc:mga03n38_11230_c1 | 3300050490 | Bacteria | 3328 |
| 949 | nmdc:mga03n38_832_c1 | 3300050490 | Bacteria | 8253 |
| 950 | nmdc:mga00v17_39956_c1 | 3300050491 | Bacteria | 2812 |
| 951 | nmdc:mga00v17_56350_c1 | 3300050491 | Bacteria | 2403 |
| 952 | nmdc:mga0yw44_68398_c1 | 3300050492 | Bacteria | 2197 |
| 953 | nmdc:mga0yw44_75400_c1 | 3300050492 | Bacteria | 2103 |
| 954 | nmdc:mga0yw44_9913_c1 | 3300050492 | Bacteria | 4842 |
| 955 | nmdc:mga0k408_145364_c1 | 3300050493 | Bacteria | 1411 |
| 956 | nmdc:mga06z11_162667_c1 | 3300050494 | Bacteria | 1277 |
| 957 | nmdc:mga06z11_47538_c1 | 3300050494 | Bacteria | 2180 |
| 958 | nmdc:mga06z11_6009_c1 | 3300050494 | Bacteria | 4907 |
| 959 | nmdc:mga04h51_27178_c1 | 3300050495 | Bacteria | 1776 |
| 960 | nmdc:mga07m45_103305_c1 | 3300050496 | Bacteria | 1638 |
| 961 | nmdc:mga07m45_38380_c1 | 3300050496 | Bacteria | 2672 |
| 962 | nmdc:mga07m45_59268_c1 | 3300050496 | Bacteria | 2166 |
| 963 | nmdc:mga07m45_7096_c1 | 3300050496 | Bacteria | 5705 |
| 964 | nmdc:mga08y16_141983_c1 | 3300050511 | Bacteria | 2496 |
| 965 | nmdc:mga08y16_155436_c1 | 3300050511 | Bacteria | 2377 |
| 966 | nmdc:mga08y16_258555_c1 | 3300050511 | Bacteria | 1798 |
| 967 | nmdc:mga0n895_321283_c1 | 3300050512 | Bacteria | 1569 |
| 968 | nmdc:mga0rr50_67594_c1 | 3300050513 | Bacteria | 2715 |
| 969 | nmdc:mga0rr50_84510_c1 | 3300050513 | Bacteria | 2457 |
| 970 | nmdc:mga0sz30_27184_c1 | 3300050516 | Bacteria | 2349 |
| 971 | Ga0495601_0108159 | 3300053077 | Bacteria | 1799 |
| 972 | Ga0495601_0119060 | 3300053077 | Bacteria | 1714 |
| 973 | Ga0495612_0091884 | 3300053078 | Bacteria | 1286 |
| 974 | Ga0495612_0103586 | 3300053078 | Bacteria | 1213 |
| 975 | Ga0495655_0020140 | 3300053083 | Bacteria | 1492 |
| 976 | Ga0495595_0015234 | 3300053084 | Bacteria | 3276 |
| 977 | Ga0495619_0033009 | 3300053085 | Bacteria | 3360 |
| 978 | Ga0495619_0033668 | 3300053085 | Bacteria | 3328 |
| 979 | Ga0500583_0023142 | 3300053092 | Bacteria | 2614 |
| 980 | Ga0500651_0022399 | 3300053093 | Bacteria | 3945 |
| 981 | Ga0500566_0000038 | 3300053094 | Bacteria | 66925 |
| 982 | Ga0500640_000048 | 3300053095 | Bacteria | 18246 |
| 983 | Ga0500641_0016051 | 3300053096 | Bacteria | 2785 |
| 984 | Ga0500641_0056051 | 3300053096 | Bacteria | 1632 |
| 985 | Ga0500650_0130967 | 3300053098 | Bacteria | 1166 |
| 986 | Ga0500554_004657 | 3300053102 | Bacteria | 2925 |
| 987 | Ga0500556_0000018 | 3300053104 | Bacteria | 188459 |
| 988 | Ga0500556_0025875 | 3300053104 | Bacteria | 1944 |
| 989 | Ga0500572_000010 | 3300053111 | Bacteria | 67071 |
| 990 | Ga0500572_000687 | 3300053111 | Bacteria | 11057 |
| 991 | Ga0500594_0023556 | 3300053118 | Bacteria | 1562 |
| 992 | Ga0500595_000143 | 3300053119 | Bacteria | 46542 |
| 993 | Ga0500595_002817 | 3300053119 | Bacteria | 8362 |
| 994 | Ga0500595_007196 | 3300053119 | Bacteria | 4638 |
| 995 | Ga0500595_038700 | 3300053119 | Bacteria | 1548 |
| 996 | Ga0500614_001505 | 3300053123 | Bacteria | 5555 |
| 997 | Ga0500642_0016098 | 3300053130 | Bacteria | 2831 |
| 998 | Ga0500652_001910 | 3300053131 | Bacteria | 6276 |
| 999 | Ga0500559_0000554 | 3300053136 | Bacteria | 25892 |
| 1000 | Ga0500559_0002882 | 3300053136 | Bacteria | 8672 |
| 1001 | Ga0500568_0001566 | 3300053139 | Bacteria | 14459 |
| 1002 | Ga0500577_0000336 | 3300053142 | Bacteria | 12140 |
| 1003 | Ga0500590_034029 | 3300053148 | Bacteria | 2639 |
| 1004 | Ga0500603_001182 | 3300053150 | Bacteria | 6053 |
| 1005 | Ga0500603_003083 | 3300053150 | Bacteria | 3597 |
| 1006 | Ga0500603_044415 | 3300053150 | Bacteria | 1196 |
| 1007 | Ga0500616_0000139 | 3300053153 | Bacteria | 123841 |
| 1008 | Ga0500622_0005549 | 3300053156 | Bacteria | 7544 |
| 1009 | Ga0500627_0078587 | 3300053158 | Bacteria | 1468 |
| 1010 | Ga0500630_001647 | 3300053159 | Bacteria | 10690 |
| 1011 | Ga0500638_006620 | 3300053162 | Bacteria | 4764 |
| 1012 | Ga0500639_000034 | 3300053163 | Bacteria | 66994 |
| 1013 | Ga0500636_0004113 | 3300053177 | Bacteria | 8223 |
| 1014 | Ga0500636_0005212 | 3300053177 | Bacteria | 7396 |
| 1015 | Ga0500636_0101086 | 3300053177 | Bacteria | 1639 |
| 1016 | Ga0500636_0189629 | 3300053177 | Bacteria | 1096 |
| 1017 | Ga0500637_0007438 | 3300053178 | Bacteria | 5475 |
| 1018 | Ga0500637_0033915 | 3300053178 | Bacteria | 2853 |
| 1019 | Ga0500637_0063815 | 3300053178 | Bacteria | 2112 |
| 1020 | Ga0500645_013191 | 3300053730 | Bacteria | 2658 |
| 1021 | Ga0500596_000711 | 3300053735 | Bacteria | 6504 |
| 1022 | Ga0500601_005398 | 3300053737 | Bacteria | 1398 |
| 1023 | Ga0501084_0061256 | 3300054114 | Bacteria | 3150 |
| 1024 | Ga0500661_000428 | 3300055283 | Bacteria | 7774 |
| 1025 | Ga0501082_0005939 | 3300060353 | Bacteria | 10588 |
| 1026 | Ga0501082_0097270 | 3300060353 | Bacteria | 2544 |
| 1027 | Ga0501082_0148028 | 3300060353 | Bacteria | 2039 |
| 1028 | 2509147206 | 2508501128 | Bacteria | 8613869 |
| 1029 | 2513656578 | 2513237096 | Bacteria | 8722461 |
| 1030 | 2513672366 | 2513237098 | Bacteria | 9902361 |
| 1031 | 2513691759 | 2513237101 | Bacteria | 7952346 |
| 1032 | 2513717519 | 2513237104 | Bacteria | 10034502 |
| 1033 | 2513859535 | 2513237137 | Bacteria | 9558895 |
| 1034 | 2513889276 | 2513237141 | Bacteria | 8496279 |
| 1035 | 2513917763 | 2513237145 | Bacteria | 8979722 |
| 1036 | 2513925781 | 2513237146 | Bacteria | 7166346 |
| 1037 | 2517893165 | 2517572143 | Bacteria | 9484767 |
| 1038 | 2524466829 | 2524023210 | Bacteria | 9029266 |
| 1039 | 2524537284 | 2524023228 | Bacteria | 10118060 |
| 1040 | 2545675516 | 2545555834 | Bacteria | 8130841 |
| 1041 | 2599418513 | 2599185170 | Bacteria | 7295545 |
| 1042 | 2644728282 | 2643221733 | Bacteria | 5690728 |
| 1043 | 2644746683 | 2643221736 | Bacteria | 6608466 |
| 1044 | 2671117799 | 2667528175 | Bacteria | 7532676 |
| 1045 | 2723845831 | 2721755755 | Bacteria | 8322773 |
| 1046 | 2728754600 | 2728368998 | Bacteria | 8720350 |
| 1047 | 2774868575 | 2773857925 | Bacteria | 6472445 |
| 1048 | 2776260387 | 2775506901 | Bacteria | 9631051 |
| 1049 | 2793069967 | 2791355197 | Bacteria | 8420563 |
| 1050 | 2793077177 | |||
| 1051 | 2838037789 | 2838035591 | Bacteria | 7166484 |
| 1052 | 2838662802 | 2838661181 | Bacteria | 7385261 |
| 1053 | 2874609523 | 2874604998 | Bacteria | 7834745 |
| 1054 | 2876810978 | 2876808645 | Bacteria | 8824342 |
| 1055 | 2879115703 | 2879110137 | Bacteria | 8907982 |
| 1056 | 2882460349 | 2882456835 | Bacteria | 6863978 |
| 1057 | 2884300190 | 2884298095 | Bacteria | 3823049 |
| 1058 | 2885374757 | 2885374607 | Bacteria | 8927485 |
| 1059 | 2885391709 | 2885383462 | Bacteria | 9473874 |
| 1060 | 2889040672 | 2889033259 | Bacteria | 9099371 |
| 1061 | 2894240583 | 2894232714 | Bacteria | 8834183 |
| 1062 | 2903777836 | 2903768456 | Bacteria | 9749579 |
| 1063 | 2904696497 | 2904690495 | Bacteria | 9412302 |
| 1064 | 2904702043 | |||
| 1065 | 2906617627 | |||
| 1066 | 2906640880 | 2906635258 | Bacteria | 8601019 |
| 1067 | 2906667859 | 2906660503 | Bacteria | 8595048 |
| 1068 | 2908743556 | 2908739725 | Bacteria | 8628932 |
| 1069 | 2908760348 | 2908756301 | Bacteria | 8864324 |
| 1070 | 2917700748 | 2917699015 | Bacteria | 7043791 |
| 1071 | 2919454675 | 2919450847 | Bacteria | 5631160 |
| 1072 | 2922367774 | 2922361189 | Bacteria | 7436256 |
| 1073 | 2922392323 | 2922386360 | Bacteria | 7017218 |
| 1074 | 2922429323 | |||
| 1075 | 2935634102 | 2935630451 | Bacteria | 8169952 |
| 1076 | 2941510993 | 2941507105 | Bacteria | 8166816 |
| 1077 | 2941518377 | 2941515067 | Bacteria | 8166720 |
| 1078 | 2941527360 | 2941523033 | Bacteria | 8169134 |
| 1079 | 3003669126 | 3003665799 | Bacteria | 7279786 |
| 1080 | 3005479491 | 3005474847 | Bacteria | 9259049 |
| 1081 | 641646326 | 641522639 | Bacteria | 7737025 |
| 1082 | 643604627 | 643348564 | Bacteria | 8839022 |
| 1083 | 8001849630 | 8001845381 | Bacteria | 5804942 |
| 1084 | 8006941657 | 8006933436 | Bacteria | 10410654 |
| 1085 | 8006971954 | 8006964411 | Bacteria | 8966052 |
| 1086 | 8006981367 | 8006973647 | Bacteria | 10679141 |
| 1087 | 8006990367 | 8006984368 | Bacteria | 9651211 |
| 1088 | 8006996411 | 8006994254 | Bacteria | 8309700 |
| 1089 | 8019557571 | 8019555841 | Bacteria | 9642137 |
| 1090 | 8019567727 | 8019565922 | Bacteria | 9639779 |
| 1091 | 8056674658 | 8056673599 | Bacteria | 7871253 |
| 1092 | 8056688546 | 8056681323 | Bacteria | 8472857 |
| 1093 | 8056690247 | 8056689827 | Bacteria | 6712655 |
| 1094 | 8057535262 | 8057529695 | Bacteria | 6306553 |
| 1095 | JGI25404J52841_10007089 | |||
| 1096 | JGI24740J21852_10006297 | |||
| 1097 | JGI24738J21930_10011139 | |||
| 1098 | JGI25406J46586_10000006 | |||
| 1099 | JGI25406J46586_10015653 | |||
| 1100 | JGI25153J46596_10004068 | |||
| 1101 | rootH1_10137999 | |||
| 1102 | JGI25404J52841_10000633 | |||
| 1103 | JGI25404J52841_10009381 | |||
| 1104 | Ga0055526_1000468 | |||
| 1105 | Ga0055524_1000352 | |||
| 1106 | Ga0065165_1000046 | |||
| 1107 | Ga0070658_10025139 | |||
| 1108 | Ga0070658_10129968 | |||
| 1109 | Ga0070658_10338376 | |||
| 1110 | Ga0070658_10396321 | |||
| 1111 | Ga0070676_10010147 | |||
| 1112 | Ga0070676_10047040 | |||
| 1113 | Ga0070683_100053161 | |||
| 1114 | Ga0070683_100095305 | |||
| 1115 | Ga0070683_100241102 | |||
| 1116 | Ga0070690_100029843 | |||
| 1117 | Ga0070690_100096123 | |||
| 1118 | Ga0070670_100006838 | |||
| 1119 | Ga0070670_100177228 | |||
| 1120 | Ga0070677_10002482 | |||
| 1121 | Ga0068869_100002596 | |||
| 1122 | Ga0068869_100004697 | |||
| 1123 | Ga0068869_100206651 | |||
| 1124 | Ga0068869_100249388 | |||
| 1125 | Ga0070666_10063577 | |||
| 1126 | Ga0070680_100054413 | |||
| 1127 | Ga0070680_100063343 | |||
| 1128 | Ga0070680_100328225 | |||
| 1129 | Ga0070682_100172467 | |||
| 1130 | Ga0068868_100075697 | |||
| 1131 | Ga0068868_100089024 | |||
| 1132 | Ga0068868_100386282 | |||
| 1133 | Ga0070660_100003180 | |||
| 1134 | Ga0070689_100071264 | |||
| 1135 | Ga0070661_100336523 | |||
| 1136 | Ga0070668_100007129 | |||
| 1137 | Ga0070668_100010143 | |||
| 1138 | Ga0070668_100018023 | |||
| 1139 | Ga0070668_100045066 | |||
| 1140 | Ga0070668_100188945 | |||
| 1141 | Ga0070669_100009649 | |||
| 1142 | Ga0070675_100007819 | |||
| 1143 | Ga0070675_100086448 | |||
| 1144 | Ga0070671_100005455 | |||
| 1145 | Ga0070671_100013034 | |||
| 1146 | Ga0070671_100111160 | |||
| 1147 | Ga0070671_100231194 | |||
| 1148 | Ga0070674_100003800 | |||
| 1149 | Ga0070674_100034126 | |||
| 1150 | Ga0070673_100010465 | |||
| 1151 | Ga0070673_100124435 | |||
| 1152 | Ga0070688_100005381 | |||
| 1153 | Ga0070659_100011346 | |||
| 1154 | Ga0070667_100006047 | |||
| 1155 | Ga0070667_100006908 | |||
| 1156 | Ga0070667_100103359 | |||
| 1157 | Ga0070709_10000640 | |||
| 1158 | Ga0070709_10000814 | |||
| 1159 | Ga0070709_10011971 | |||
| 1160 | Ga0070709_10023138 | |||
| 1161 | Ga0070709_10034707 | |||
| 1162 | Ga0070714_100001978 | |||
| 1163 | Ga0070714_100018170 | |||
| 1164 | Ga0070714_100066721 | |||
| 1165 | Ga0070714_100070911 | |||
| 1166 | Ga0070714_100195923 | |||
| 1167 | Ga0070713_100001376 | |||
| 1168 | Ga0070713_100005011 | |||
| 1169 | Ga0070713_100006728 | |||
| 1170 | Ga0070713_100037946 | |||
| 1171 | Ga0070710_10000766 | |||
| 1172 | Ga0070710_10002013 | |||
| 1173 | Ga0070710_10005543 | |||
| 1174 | Ga0070711_100007282 | |||
| 1175 | Ga0070711_100014164 | |||
| 1176 | Ga0070711_100015664 | |||
| 1177 | Ga0070711_100016788 | |||
| 1178 | Ga0070705_100008967 | |||
| 1179 | Ga0070705_100198714 | |||
| 1180 | Ga0070700_100166732 | |||
| 1181 | Ga0070700_100194139 | |||
| 1182 | Ga0070700_100279113 | |||
| 1183 | Ga0070694_100190348 | |||
| 1184 | Ga0070708_100102480 | |||
| 1185 | Ga0070663_100022618 | |||
| 1186 | Ga0070663_100064606 | |||
| 1187 | Ga0070663_100168409 | |||
| 1188 | Ga0070663_100222792 | |||
| 1189 | Ga0070678_100044935 | |||
| 1190 | Ga0070678_100064693 | |||
| 1191 | Ga0070678_100107123 | |||
| 1192 | Ga0070678_100128606 | |||
| 1193 | Ga0070678_100153857 | |||
| 1194 | Ga0070678_100251757 | |||
| 1195 | Ga0070662_100087302 | |||
| 1196 | Ga0070681_10025556 | |||
| 1197 | Ga0070681_10038316 | |||
| 1198 | Ga0070681_10081622 | |||
| 1199 | Ga0070681_10162290 | |||
| 1200 | Ga0070681_10177870 | |||
| 1201 | Ga0070681_10203329 | |||
| 1202 | Ga0070681_10341650 | |||
| 1203 | Ga0068867_100005228 | |||
| 1204 | Ga0068867_100062386 | |||
| 1205 | Ga0068867_100087556 | |||
| 1206 | Ga0070698_100009493 | |||
| 1207 | Ga0070679_100014960 | |||
| 1208 | Ga0070679_100030520 | |||
| 1209 | Ga0070684_100019257 | |||
| 1210 | Ga0070684_100031500 | |||
| 1211 | Ga0070684_100096349 | |||
| 1212 | Ga0068853_100006610 | |||
| 1213 | Ga0068853_100020640 | |||
| 1214 | Ga0068853_100105016 | |||
| 1215 | Ga0068853_100197342 | |||
| 1216 | Ga0070672_100091381 | |||
| 1217 | Ga0070672_100189360 | |||
| 1218 | Ga0070672_100209703 | |||
| 1219 | Ga0070672_100319012 | |||
| 1220 | Ga0070696_100064559 | |||
| 1221 | Ga0070665_100008939 | |||
| 1222 | Ga0070665_100013374 | |||
| 1223 | Ga0070665_100057794 | |||
| 1224 | Ga0070665_100094750 | |||
| 1225 | Ga0070665_100214588 | |||
| 1226 | Ga0070665_100587646 | |||
| 1227 | Ga0070704_100172316 | |||
| 1228 | Ga0068855_100035310 | |||
| 1229 | Ga0068855_100036199 | |||
| 1230 | Ga0068855_100052296 | |||
| 1231 | Ga0068855_100096063 | |||
| 1232 | Ga0068855_100206739 | |||
| 1233 | Ga0068855_100241389 | |||
| 1234 | Ga0068855_100278723 | |||
| 1235 | Ga0068855_100704865 | |||
| 1236 | Ga0070664_100132245 | |||
| 1237 | Ga0070664_100137999 | |||
| 1238 | Ga0068857_100004656 | |||
| 1239 | Ga0068857_100015427 | |||
| 1240 | Ga0068857_100037534 | |||
| 1241 | Ga0068857_100046999 | |||
| 1242 | Ga0068857_100068681 | |||
| 1243 | Ga0068857_100071936 | |||
| 1244 | Ga0068857_100151174 | |||
| 1245 | Ga0068854_100003076 | |||
| 1246 | Ga0068854_100079434 | |||
| 1247 | Ga0068854_100080953 | |||
| 1248 | Ga0068854_100090422 | |||
| 1249 | Ga0068854_100146703 | |||
| 1250 | Ga0068856_100002728 | |||
| 1251 | Ga0068856_100009830 | |||
| 1252 | Ga0068856_100321564 | |||
| 1253 | Ga0070702_100127289 | |||
| 1254 | Ga0070702_100179647 | |||
| 1255 | Ga0068852_100002660 | |||
| 1256 | Ga0068852_100019989 | |||
| 1257 | Ga0068852_100053086 | |||
| 1258 | Ga0068852_100241503 | |||
| 1259 | Ga0068859_100008168 | |||
| 1260 | Ga0068859_100078169 | |||
| 1261 | Ga0068859_100084702 | |||
| 1262 | Ga0068859_100120910 | |||
| 1263 | Ga0068864_100000456 | |||
| 1264 | Ga0068864_100010237 | |||
| 1265 | Ga0068864_100081773 | |||
| 1266 | Ga0068864_100141492 | |||
| 1267 | Ga0068866_10082316 | |||
| 1268 | Ga0068866_10095923 | |||
| 1269 | Ga0068866_10104077 | |||
| 1270 | Ga0068861_100009658 | |||
| 1271 | Ga0068851_10002062 | |||
| 1272 | Ga0068851_10005576 | |||
| 1273 | Ga0068870_10008724 | |||
| 1274 | Ga0068863_100100035 | |||
| 1275 | Ga0068863_100162305 | |||
| 1276 | Ga0068858_100008910 | |||
| 1277 | Ga0068858_100145418 | |||
| 1278 | Ga0068858_100153569 | |||
| 1279 | Ga0068858_100163523 | |||
| 1280 | Ga0068858_100259178 | |||
| 1281 | Ga0068858_100282784 | |||
| 1282 | Ga0068860_100000058 | |||
| 1283 | Ga0068860_100008086 | |||
| 1284 | Ga0068860_100011681 | |||
| 1285 | Ga0068860_100018455 | |||
| 1286 | Ga0068860_100031752 | |||
| 1287 | Ga0068862_100008392 | |||
| 1288 | Ga0068862_100031093 | |||
| 1289 | Ga0068862_100035873 | |||
| 1290 | Ga0068862_100081154 | |||
| 1291 | Ga0081455_10001410 | |||
| 1292 | Ga0081455_10001781 | |||
| 1293 | Ga0081455_10004929 | |||
| 1294 | Ga0081455_10032437 | |||
| 1295 | Ga0081455_10036644 | |||
| 1296 | Ga0081455_10098761 | |||
| 1297 | Ga0081540_1002699 | |||
| 1298 | Ga0081540_1003795 | |||
| 1299 | Ga0081540_1005283 | |||
| 1300 | Ga0081540_1005851 | |||
| 1301 | Ga0081540_1008346 | |||
| 1302 | Ga0081540_1010920 | |||
| 1303 | Ga0081540_1022377 | |||
| 1304 | Ga0081540_1026189 | |||
| 1305 | Ga0081539_10000176 | |||
| 1306 | Ga0081539_10000231 | |||
| 1307 | Ga0081539_10024164 | |||
| 1308 | Ga0081539_10047543 | |||
| 1309 | Ga0081539_10104293 | |||
| 1310 | Ga0070717_10003916 | |||
| 1311 | Ga0070717_10038425 | |||
| 1312 | Ga0070717_10134968 | |||
| 1313 | Ga0070717_10197111 | |||
| 1314 | Ga0075365_10004977 | |||
| 1315 | Ga0075365_10069918 | |||
| 1316 | Ga0075365_10130601 | |||
| 1317 | Ga0075365_10139751 | |||
| 1318 | Ga0075365_10155593 | |||
| 1319 | Ga0075368_10009652 | |||
| 1320 | Ga0075368_10029354 | |||
| 1321 | Ga0075363_100009297 | |||
| 1322 | Ga0075363_100066488 | |||
| 1323 | Ga0075364_10023373 | |||
| 1324 | Ga0070715_10001403 | |||
| 1325 | Ga0070716_100004448 | |||
| 1326 | Ga0070716_100008376 | |||
| 1327 | Ga0070712_100087828 | |||
| 1328 | Ga0075367_10002730 | |||
| 1329 | Ga0075367_10064108 | |||
| 1330 | Ga0075367_10081152 | |||
| 1331 | Ga0075369_10110703 | |||
| 1332 | Ga0075369_10111356 | |||
| 1333 | Ga0097621_100004460 | |||
| 1334 | Ga0097621_100029361 | |||
| 1335 | Ga0075370_10017240 | |||
| 1336 | Ga0075370_10019215 | |||
| 1337 | Ga0075370_10033797 | |||
| 1338 | Ga0068871_100004954 | |||
| 1339 | Ga0068871_100050314 | |||
| 1340 | Ga0068871_100053398 | |||
| 1341 | Ga0068871_100195862 | |||
| 1342 | Ga0075428_100102576 | |||
| 1343 | Ga0075428_100177503 | |||
| 1344 | Ga0075434_100381276 | |||
| 1345 | Ga0075429_100327768 | |||
| 1346 | Ga0068865_100059567 | |||
| 1347 | Ga0097620_100008167 | |||
| 1348 | Ga0097620_100078169 | |||
| 1349 | Ga0097620_100084701 | |||
| 1350 | Ga0097620_100120911 | |||
| 1351 | Ga0099825_1025547 | |||
| 1352 | Ga0099824_1010180 | |||
| 1353 | Ga0099824_1013426 | |||
| 1354 | Ga0099822_1000628 | |||
| 1355 | Ga0099794_10094286 | |||
| 1356 | Ga0099795_10012210 | |||
| 1357 | Ga0105240_10016661 | |||
| 1358 | Ga0105240_10029346 | |||
| 1359 | Ga0105240_10086998 | |||
| 1360 | Ga0105240_10097952 | |||
| 1361 | Ga0105240_10176195 | |||
| 1362 | Ga0105240_10277106 | |||
| 1363 | Ga0105245_10050419 | |||
| 1364 | Ga0105245_10152141 | |||
| 1365 | Ga0105245_10169370 | |||
| 1366 | Ga0105247_10016073 | |||
| 1367 | Ga0105247_10068517 | |||
| 1368 | Ga0105243_10286050 | |||
| 1369 | Ga0105241_10009864 | |||
| 1370 | Ga0105248_10007225 | |||
| 1371 | Ga0105248_10016076 | |||
| 1372 | Ga0105248_10132713 | |||
| 1373 | Ga0105248_10432588 | |||
| 1374 | Ga0105237_10067725 | |||
| 1375 | Ga0105237_10113083 | |||
| 1376 | Ga0105237_10181565 | |||
| 1377 | Ga0105237_10274069 | |||
| 1378 | Ga0105237_10327854 | |||
| 1379 | Ga0105238_10002811 | |||
| 1380 | Ga0105238_10012890 | |||
| 1381 | Ga0105238_10029984 | |||
| 1382 | Ga0105238_10065071 | |||
| 1383 | Ga0105238_10089082 | |||
| 1384 | Ga0105238_10171113 | |||
| 1385 | Ga0105238_10444266 | |||
| 1386 | Ga0105249_10015186 | |||
| 1387 | Ga0105239_10024336 | |||
| 1388 | Ga0105239_10042814 | |||
| 1389 | Ga0105239_10062251 | |||
| 1390 | Ga0105239_10065172 | |||
| 1391 | Ga0105239_10117512 | |||
| 1392 | Ga0105239_10161443 | |||
| 1393 | Ga0105239_10189484 | |||
| 1394 | Ga0105246_10131919 | |||
| 1395 | Ga0105246_10147927 | |||
| 1396 | Ga0157373_10008811 | |||
| 1397 | Ga0157371_10005809 | |||
| 1398 | Ga0157370_10005379 | |||
| 1399 | Ga0157370_10038788 | |||
| 1400 | Ga0157370_10477146 | |||
| 1401 | Ga0157369_10004098 | |||
| 1402 | Ga0157369_10080589 | |||
| 1403 | Ga0157369_10088852 | |||
| 1404 | Ga0157369_10096347 | |||
| 1405 | Ga0171462_1011 | |||
| 1406 | Ga0157374_10195235 | |||
| 1407 | Ga0157374_10287723 | |||
| 1408 | Ga0157374_10693692 | |||
| 1409 | Ga0157378_10016765 | |||
| 1410 | Ga0157378_10086750 | |||
| 1411 | Ga0157378_10160370 | |||
| 1412 | Ga0163162_10023700 | |||
| 1413 | Ga0163162_10035737 | |||
| 1414 | Ga0163162_10132258 | |||
| 1415 | Ga0157375_10009213 | |||
| 1416 | Ga0157375_10009300 | |||
| 1417 | Ga0157375_10010588 | |||
| 1418 | Ga0157375_10075444 | |||
| 1419 | Ga0163163_10011827 | |||
| 1420 | Ga0163163_10060169 | |||
| 1421 | Ga0163163_10070835 | |||
| 1422 | Ga0163163_10119522 | |||
| 1423 | Ga0163163_10248806 | |||
| 1424 | Ga0163163_10557719 | |||
| 1425 | Ga0157380_10018325 | |||
| 1426 | Ga0157377_10112587 | |||
| 1427 | Ga0157379_10000246 | |||
| 1428 | Ga0157379_10059933 | |||
| 1429 | Ga0157376_10006054 | |||
| 1430 | Ga0157376_10009356 | |||
| 1431 | Ga0157376_10024704 | |||
| 1432 | Ga0157376_10039678 | |||
| 1433 | Ga0157376_10352139 | |||
| 1434 | Ga0157376_10369338 | |||
| 1435 | Ga0163161_10019421 | |||
| 1436 | Ga0206353_11365297 | |||
| 1437 | Ga0213874_10002910 | |||
| 1438 | Ga0213876_10015796 | |||
| 1439 | Ga0213876_10042552 | |||
| 1440 | Ga0213876_10091555 | |||
| 1441 | Ga0213875_10007779 | |||
| 1442 | Ga0209677_101611 | |||
| 1443 | Ga0209233_1006049 | |||
| 1444 | Ga0209130_1000703 | |||
| 1445 | Ga0209675_1001330 | |||
| 1446 | Ga0209025_1000016 | |||
| 1447 | Ga0209025_1002211 | |||
| 1448 | Ga0209564_1000023 | |||
| 1449 | Ga0209564_1000035 | |||
| 1450 | Ga0209564_1008909 | |||
| 1451 | Ga0209758_1004676 | |||
| 1452 | Ga0209758_1014026 | |||
| 1453 | Ga0209256_1000025 | |||
| 1454 | Ga0207656_10020136 | |||
| 1455 | Ga0207682_10000600 | |||
| 1456 | Ga0207692_10001752 | |||
| 1457 | Ga0207692_10003198 | |||
| 1458 | Ga0207692_10064878 | |||
| 1459 | Ga0207692_10187102 | |||
| 1460 | Ga0207710_10016038 | |||
| 1461 | Ga0207710_10036693 | |||
| 1462 | Ga0207688_10030116 | |||
| 1463 | Ga0207688_10071462 | |||
| 1464 | Ga0207688_10099593 | |||
| 1465 | Ga0207680_10090058 | |||
| 1466 | Ga0207680_10090388 | |||
| 1467 | Ga0207680_10097460 | |||
| 1468 | Ga0207647_10011930 | |||
| 1469 | Ga0207647_10068496 | |||
| 1470 | Ga0207685_10003885 | |||
| 1471 | Ga0207699_10007628 | |||
| 1472 | Ga0207699_10015007 | |||
| 1473 | Ga0207699_10080507 | |||
| 1474 | Ga0207645_10004697 | |||
| 1475 | Ga0207645_10031672 | |||
| 1476 | Ga0207645_10047170 | |||
| 1477 | Ga0207643_10025397 | |||
| 1478 | Ga0207684_10450348 | |||
| 1479 | Ga0207654_10000968 | |||
| 1480 | Ga0207654_10004279 | |||
| 1481 | Ga0207707_10004344 | |||
| 1482 | Ga0207707_10103544 | |||
| 1483 | Ga0207707_10181771 | |||
| 1484 | Ga0207695_10003702 | |||
| 1485 | Ga0207695_10015923 | |||
| 1486 | Ga0207671_10024084 | |||
| 1487 | Ga0207671_10061368 | |||
| 1488 | Ga0207671_10202458 | |||
| 1489 | Ga0207693_10003588 | |||
| 1490 | Ga0207693_10019182 | |||
| 1491 | Ga0207693_10040712 | |||
| 1492 | Ga0207693_10049803 | |||
| 1493 | Ga0207693_10077009 | |||
| 1494 | Ga0207663_10002056 | |||
| 1495 | Ga0207663_10006350 | |||
| 1496 | Ga0207663_10061932 | |||
| 1497 | Ga0207660_10002460 | |||
| 1498 | Ga0207660_10012121 | |||
| 1499 | Ga0207660_10087859 | |||
| 1500 | Ga0207660_10205573 | |||
| 1501 | Ga0207657_10000297 | |||
| 1502 | Ga0207657_10002222 | |||
| 1503 | Ga0207657_10030755 | |||
| 1504 | Ga0207649_10305383 | |||
| 1505 | Ga0207652_10010300 | |||
| 1506 | Ga0207652_10015488 | |||
| 1507 | Ga0207652_10016438 | |||
| 1508 | Ga0207694_10001639 | |||
| 1509 | Ga0207694_10008346 | |||
| 1510 | Ga0207694_10046702 | |||
| 1511 | Ga0207694_10083288 | |||
| 1512 | Ga0207694_10123866 | |||
| 1513 | Ga0207650_10004702 | |||
| 1514 | Ga0207650_10139069 | |||
| 1515 | Ga0207659_10048551 | |||
| 1516 | Ga0207659_10191695 | |||
| 1517 | Ga0207687_10084525 | |||
| 1518 | Ga0207687_10115219 | |||
| 1519 | Ga0207700_10008958 | |||
| 1520 | Ga0207700_10039853 | |||
| 1521 | Ga0207700_10042207 | |||
| 1522 | Ga0207664_10010987 | |||
| 1523 | Ga0207664_10019635 | |||
| 1524 | Ga0207664_10056781 | |||
| 1525 | Ga0207664_10068217 | |||
| 1526 | Ga0207664_10079285 | |||
| 1527 | Ga0207664_10100081 | |||
| 1528 | Ga0207644_10006040 | |||
| 1529 | Ga0207644_10041918 | |||
| 1530 | Ga0207644_10085093 | |||
| 1531 | Ga0207644_10109970 | |||
| 1532 | Ga0207644_10231263 | |||
| 1533 | Ga0207644_10234208 | |||
| 1534 | Ga0207690_10010823 | |||
| 1535 | Ga0207690_10039340 | |||
| 1536 | Ga0207690_10092175 | |||
| 1537 | Ga0207706_10154343 | |||
| 1538 | Ga0207706_10283039 | |||
| 1539 | Ga0207669_10031192 | |||
| 1540 | Ga0207669_10049642 | |||
| 1541 | Ga0207704_10055882 | |||
| 1542 | Ga0207704_10083959 | |||
| 1543 | Ga0207704_10105001 | |||
| 1544 | Ga0207665_10000769 | |||
| 1545 | Ga0207665_10012564 | |||
| 1546 | Ga0207665_10089156 | |||
| 1547 | Ga0207665_10167911 | |||
| 1548 | Ga0207691_10008356 | |||
| 1549 | Ga0207691_10066113 | |||
| 1550 | Ga0207691_10086468 | |||
| 1551 | Ga0207711_10021208 | |||
| 1552 | Ga0207711_10043099 | |||
| 1553 | Ga0207711_10259611 | |||
| 1554 | Ga0207711_10286625 | |||
| 1555 | Ga0207689_10001032 | |||
| 1556 | Ga0207689_10002117 | |||
| 1557 | Ga0207689_10065242 | |||
| 1558 | Ga0207661_10017104 | |||
| 1559 | Ga0207661_10018752 | |||
| 1560 | Ga0207661_10036158 | |||
| 1561 | Ga0207679_10102626 | |||
| 1562 | Ga0207679_10140197 | |||
| 1563 | Ga0207679_10193460 | |||
| 1564 | Ga0207679_10312573 | |||
| 1565 | Ga0207667_10000695 | |||
| 1566 | Ga0207667_10045339 | |||
| 1567 | Ga0207667_10078040 | |||
| 1568 | Ga0207667_10090833 | |||
| 1569 | Ga0207667_10102682 | |||
| 1570 | Ga0207667_10103927 | |||
| 1571 | Ga0207651_10004079 | |||
| 1572 | Ga0207651_10107656 | |||
| 1573 | Ga0207712_10020564 | |||
| 1574 | Ga0207712_10109912 | |||
| 1575 | Ga0207668_10002227 | |||
| 1576 | Ga0207668_10043366 | |||
| 1577 | Ga0207668_10084965 | |||
| 1578 | Ga0207668_10299720 | |||
| 1579 | Ga0207640_10019508 | |||
| 1580 | Ga0207640_10053481 | |||
| 1581 | Ga0207640_10157753 | |||
| 1582 | Ga0207658_10004931 | |||
| 1583 | Ga0207658_10038002 | |||
| 1584 | Ga0207658_10088674 | |||
| 1585 | Ga0207658_10091307 | |||
| 1586 | Ga0207677_10018849 | |||
| 1587 | Ga0207677_10027954 | |||
| 1588 | Ga0207677_10046392 | |||
| 1589 | Ga0207677_10169547 | |||
| 1590 | Ga0207677_10191917 | |||
| 1591 | Ga0207677_10242241 | |||
| 1592 | Ga0207677_10257000 | |||
| 1593 | Ga0207703_10007505 | |||
| 1594 | Ga0207703_10124736 | |||
| 1595 | Ga0207639_10006291 | |||
| 1596 | Ga0207639_10366357 | |||
| 1597 | Ga0207678_10003850 | |||
| 1598 | Ga0207678_10076204 | |||
| 1599 | Ga0207678_10103157 | |||
| 1600 | Ga0207678_10104869 | |||
| 1601 | Ga0207678_10114463 | |||
| 1602 | Ga0207678_10126265 | |||
| 1603 | Ga0207678_10189349 | |||
| 1604 | Ga0207702_10000005 | |||
| 1605 | Ga0207702_10000178 | |||
| 1606 | Ga0207702_10076553 | |||
| 1607 | Ga0207702_10270508 | |||
| 1608 | Ga0207702_10357095 | |||
| 1609 | Ga0207641_10013613 | |||
| 1610 | Ga0207641_10078085 | |||
| 1611 | Ga0207641_10088791 | |||
| 1612 | Ga0207648_10004696 | |||
| 1613 | Ga0207648_10013227 | |||
| 1614 | Ga0207648_10050348 | |||
| 1615 | Ga0207648_10208020 | |||
| 1616 | Ga0207648_10594117 | |||
| 1617 | Ga0207676_10001747 | |||
| 1618 | Ga0207676_10007631 | |||
| 1619 | Ga0207676_10030686 | |||
| 1620 | Ga0207676_10069332 | |||
| 1621 | Ga0207674_10000396 | |||
| 1622 | Ga0207674_10034959 | |||
| 1623 | Ga0207674_10042203 | |||
| 1624 | Ga0207674_10143664 | |||
| 1625 | Ga0207674_10347269 | |||
| 1626 | Ga0207675_100017442 | |||
| 1627 | Ga0207675_100047402 | |||
| 1628 | Ga0207675_100085004 | |||
| 1629 | Ga0207675_100198107 | |||
| 1630 | Ga0207675_100517029 | |||
| 1631 | Ga0207683_10006461 | |||
| 1632 | Ga0207683_10012473 | |||
| 1633 | Ga0207683_10069174 | |||
| 1634 | Ga0207683_10069873 | |||
| 1635 | Ga0207683_10082355 | |||
| 1636 | Ga0207683_10125511 | |||
| 1637 | Ga0207683_10251250 | |||
| 1638 | Ga0207683_10285121 | |||
| 1639 | Ga0207698_10017296 | |||
| 1640 | Ga0207698_10033941 | |||
| 1641 | Ga0207698_10098832 | |||
| 1642 | Ga0207698_10149306 | |||
| 1643 | Ga0207698_10403756 | |||
| 1644 | Ga0207698_10419125 | |||
| 1645 | Ga0209589_1000023 | |||
| 1646 | Ga0209489_100032 | |||
| 1647 | Ga0209700_100040 | |||
| 1648 | Ga0209179_1001602 | |||
| 1649 | Ga0209813_10000922 | |||
| 1650 | Ga0268266_10003342 | |||
| 1651 | Ga0268266_10006607 | |||
| 1652 | Ga0268266_10009629 | |||
| 1653 | Ga0268266_10057820 | |||
| 1654 | Ga0268266_10104298 | |||
| 1655 | Ga0268266_10251779 | |||
| 1656 | Ga0268265_10012963 | |||
| 1657 | Ga0268265_10015854 | |||
| 1658 | Ga0268265_10061792 | |||
| 1659 | Ga0268265_10087123 | |||
| 1660 | Ga0268265_10137183 | |||
| 1661 | Ga0268264_10000022 | |||
| 1662 | Ga0268264_10005591 | |||
| 1663 | Ga0268264_10059201 | |||
| 1664 | Ga0268264_10089122 | |||
| 1665 | Ga0268264_10483887 | |||
| 1666 | Ga0265336_10004089 | |||
| 1667 | Ga0307517_10005009 | |||
| 1668 | Ga0307515_10051754 | |||
| 1669 | Ga0265338_10003088 | |||
| 1670 | Ga0265324_10024421 | |||
| 1671 | Ga0265330_10005670 | |||
| 1672 | Ga0265332_10000824 | |||
| 1673 | Ga0265328_10004314 | |||
| 1674 | Ga0265325_10072205 | |||
| 1675 | Ga0265339_10004830 | |||
| 1676 | Ga0265331_10000237 | |||
| 1677 | Ga0265331_10000305 | |||
| 1678 | Ga0265327_10000458 | |||
| 1679 | Ga0265327_10000517 | |||
| 1680 | Ga0265327_10004446 | |||
| 1681 | Ga0307509_10085539 | |||
| 1682 | Ga0307408_100185278 | |||
| 1683 | Ga0307508_10000009 | |||
| 1684 | Ga0307508_10054636 | |||
| 1685 | Ga0307508_10099280 | |||
| 1686 | Ga0265314_10068903 | |||
| 1687 | Ga0265314_10131972 | |||
| 1688 | Ga0265342_10005456 | |||
| 1689 | Ga0265342_10031924 | |||
| 1690 | Ga0307516_10029403 | |||
| 1691 | Ga0307516_10100895 | |||
| 1692 | Ga0307516_10335265 | |||
| 1693 | Ga0307410_10195367 | |||
| 1694 | Ga0307406_10068657 | |||
| 1695 | Ga0307409_100244992 | |||
| 1696 | Ga0307416_100291661 | |||
| 1697 | Ga0307415_100091229 | |||
| 1698 | Ga0307415_100130845 | |||
| 1699 | Ga0307510_10021690 | |||
| 1700 | Ga0307510_10044918 | |||
| 1701 | Ga0307510_10123424 | |||
| 1702 | Ga0315911_1000001 | |||
| 1703 | Ga0373926_0016472 | |||
| 1704 | Ga0373944_0026414 | |||
| 1705 | Ga0373952_0021323 | |||
| 1706 | Ga0373923_0005783 | |||
| 1707 | Ga0373936_0007012 | |||
| 1708 | Ga0373936_0011048 | |||
| 1709 | Ga0373936_0027480 | |||
| 1710 | Ga0373936_0028088 | |||
| 1711 | Ga0373953_0010957 | |||
| 1712 | Ga0373954_0035950 | |||
| 1713 | Ga0373954_0039781 | |||
| 1714 | Ga0373954_0104514 | |||
| 1715 | Ga0373957_0005054 | |||
| 1716 | Ga0373943_0016066 | |||
| 1717 | Ga0373943_0039078 | |||
| 1718 | Ga0373946_0129214 | |||
| 1719 | Ga0373955_0104290 | |||
| 1720 | Ga0373935_0003830 | |||
| 1721 | Ga0373935_0231081 | |||
| 1722 | Ga0373927_0020885 | |||
| 1723 | Ga0373927_0039408 | |||
| 1724 | Ga0373927_0113654 | |||
| 1725 | Ga0373927_0149777 | |||
| 1726 | Ga0373933_0000781 | |||
| 1727 | Ga0373933_0016755 | |||
| 1728 | Ga0373933_0034746 | |||
| 1729 | Ga0373947_0005936 | |||
| 1730 | Ga0373947_0012802 | |||
| 1731 | Ga0373947_0031330 | |||
| 1732 | Ga0373937_0011582 | |||
| 1733 | Ga0373937_0037854 | |||
| 1734 | Ga0373937_0073229 | |||
| 1735 | Ga0373937_0088438 | |||
| 1736 | Ga0373937_0116609 | |||
| 1737 | Ga0395900_0093574 | |||
| 1738 | Ga0395900_0360796 | |||
| 1739 | Ga0395898_0028162 | |||
| 1740 | Ga0395898_0068252 | |||
| 1741 | Ga0395898_0121911 | |||
| 1742 | Ga0395898_0152454 | |||
| 1743 | Ga0436364_0059037 | |||
| 1744 | Ga0436364_0693921 | |||
| 1745 | Ga0395901_0010512 | |||
| 1746 | Ga0395901_0041679 | |||
| 1747 | Ga0395901_0154216 | |||
| 1748 | Ga0400484_03261 | |||
| 1749 | Ga0400484_43122 | |||
| 1750 | Ga0400490_20091 | |||
| 1751 | Ga0400491_10244 | |||
| 1752 | Ga0400486_00975 | |||
| 1753 | Ga0400487_15725 | |||
| 1754 | Ga0400487_27362 | |||
| 1755 | Ga0436365_0189813 | |||
| 1756 | Ga0436365_0336775 | |||
| 1757 | Ga0436365_0484561 | |||
| 1758 | Ga0436365_0541977 | |||
| 1759 | Ga0436365_1003039 | |||
| 1760 | Ga0436360_0083451 | |||
| 1761 | Ga0436361_0708810 | |||
| 1762 | Ga0436361_1057156 | |||
| 1763 | Ga0436363_0149962 | |||
| 1764 | Ga0436363_1293231 | |||
| 1765 | Ga0436363_1512041 | |||
| 1766 | Ga0436362_0094827 | |||
| 1767 | Ga0451841_0161589 | |||
| 1768 | Ga0439445_0036880 | |||
| 1769 | Ga0466972_0132607 | |||
| 1770 | Ga0466959_0091013 | |||
| 1771 | Ga0466959_0121103 | |||
| 1772 | Ga0466967_0031972 | |||
| 1773 | Ga0495603_0015905 | |||
| 1774 | Ga0495603_0016623 | |||
| 1775 | Ga0495629_0000083 | |||
| 1776 | Ga0495629_0043397 | |||
| 1777 | Ga0495629_0070518 | |||
| 1778 | Ga0495641_0008459 | |||
| 1779 | Ga0495651_0015048 | |||
| 1780 | Ga0495651_0180024 | |||
| 1781 | Ga0495651_0229996 | |||
| 1782 | Ga0495653_0038786 | |||
| 1783 | Ga0495650_0048232 | |||
| 1784 | Ga0495580_0001769 | |||
| 1785 | Ga0495580_0035790 | |||
| 1786 | Ga0495582_0000206 | |||
| 1787 | Ga0495582_0038376 | |||
| 1788 | Ga0495639_0000167 | |||
| 1789 | Ga0495639_0147949 | |||
| 1790 | Ga0495662_0000457 | |||
| 1791 | Ga0495662_0106280 | |||
| 1792 | Ga0495664_0003502 | |||
| 1793 | Ga0495664_0023653 | |||
| 1794 | Ga0495594_0000838 | |||
| 1795 | Ga0495596_0035514 | |||
| 1796 | Ga0495606_0013130 | |||
| 1797 | Ga0495606_0111919 | |||
| 1798 | Ga0495610_0059184 | |||
| 1799 | Ga0495618_0014131 | |||
| 1800 | Ga0495618_0052279 | |||
| 1801 | Ga0495628_0045817 | |||
| 1802 | Ga0495630_0053174 | |||
| 1803 | Ga0495632_0084116 | |||
| 1804 | Ga0495632_0091564 | |||
| 1805 | Ga0495648_0000160 | |||
| 1806 | Ga0495648_0001196 | |||
| 1807 | Ga0495666_0029252 | |||
| 1808 | Ga0495666_0098796 | |||
| 1809 | Ga0495652_0071311 | |||
| 1810 | Ga0495665_0000399 | |||
| 1811 | Ga0495665_0017095 | |||
| 1812 | Ga0495640_0006041 | |||
| 1813 | Ga0495640_0022858 | |||
| 1814 | Ga0495640_0121299 | |||
| 1815 | Ga0495587_0049159 | |||
| 1816 | Ga0495645_0127101 | |||
| 1817 | Ga0495667_0009670 | |||
| 1818 | Ga0495667_0025334 | |||
| 1819 | Ga0495667_0157758 | |||
| 1820 | Ga0495656_0049430 | |||
| 1821 | Ga0495668_0143725 | |||
| 1822 | Ga0495634_0049262 | |||
| 1823 | Ga0495625_0267779 | |||
| 1824 | Ga0495635_0001363 | |||
| 1825 | Ga0495635_0030361 | |||
| 1826 | Ga0495588_0150158 | |||
| 1827 | Ga0495657_0018064 | |||
| 1828 | Ga0495657_0041184 | |||
| 1829 | Ga0495599_0009520 | |||
| 1830 | Ga0495599_0096181 | |||
| 1831 | Ga0495623_0055361 | |||
| 1832 | Ga0495623_0144693 | |||
| 1833 | Ga0495623_0163188 | |||
| 1834 | Ga0495646_0007314 | |||
| 1835 | Ga0495646_0015020 | |||
| 1836 | Ga0495658_0003680 | |||
| 1837 | Ga0495658_0034618 | |||
| 1838 | Ga0495658_0121531 | |||
| 1839 | Ga0495658_0152549 | |||
| 1840 | Ga0495669_0023373 | |||
| 1841 | Ga0495613_0002852 | |||
| 1842 | Ga0495613_0161412 | |||
| 1843 | Ga0495624_0000096 | |||
| 1844 | Ga0495670_0092353 | |||
| 1845 | Ga0495600_0079852 | |||
| 1846 | Ga0495581_0000311 | |||
| 1847 | Ga0495581_0027251 | |||
| 1848 | Ga0495604_0022802 | |||
| 1849 | Ga0495674_0050857 | |||
| 1850 | Ga0495674_0183913 | |||
| 1851 | Ga0495672_0009354 | |||
| 1852 | Ga0495672_0015084 | |||
| 1853 | Ga0495672_0017739 | |||
| 1854 | Ga0495672_0055917 | |||
| 1855 | Ga0495672_0104877 | |||
| 1856 | Ga0495676_0291284 | |||
| 1857 | Ga0495680_0040520 | |||
| 1858 | Ga0495675_0008762 | |||
| 1859 | Ga0495673_0074239 | |||
| 1860 | Ga0495681_0143834 | |||
| 1861 | Ga0495684_0015876 | |||
| 1862 | Ga0495684_0035422 | |||
| 1863 | Ga0495614_0021984 | |||
| 1864 | Ga0495615_0045850 | |||
| 1865 | Ga0496100_0190959 | |||
| 1866 | Ga0496101_0029223 | |||
| 1867 | Ga0496102_0001926 | |||
| 1868 | Ga0496102_0040079 | |||
| 1869 | Ga0496102_0116650 | |||
| 1870 | Ga0496102_0149692 | |||
| 1871 | Ga0496102_0492695 | |||
| 1872 | Ga0496103_0065835 | |||
| 1873 | Ga0496103_0268480 | |||
| 1874 | Ga0496104_0016935 | |||
| 1875 | Ga0496104_0050836 | |||
| 1876 | Ga0496105_0014383 | |||
| 1877 | Ga0496106_0007840 | |||
| 1878 | Ga0496106_0015567 | |||
| 1879 | Ga0496106_0189353 | |||
| 1880 | Ga0496106_0369476 | |||
| 1881 | Ga0496107_0014875 | |||
| 1882 | Ga0496107_0028174 | |||
| 1883 | Ga0496107_0117834 | |||
| 1884 | Ga0496108_0017540 | |||
| 1885 | Ga0496108_0062659 | |||
| 1886 | Ga0496108_0503076 | |||
| 1887 | Ga0496109_0048435 | |||
| 1888 | Ga0496109_0138834 | |||
| 1889 | Ga0496109_0162539 | |||
| 1890 | Ga0496109_0182096 | |||
| 1891 | Ga0496110_0020916 | |||
| 1892 | Ga0496110_0105745 | |||
| 1893 | Ga0496110_0193606 | |||
| 1894 | Ga0496110_0331119 | |||
| 1895 | Ga0496111_0029215 | |||
| 1896 | Ga0496111_0063294 | |||
| 1897 | Ga0496112_0000079 | |||
| 1898 | Ga0496112_0017117 | |||
| 1899 | Ga0496112_0041980 | |||
| 1900 | Ga0496112_0078172 | |||
| 1901 | Ga0496112_0183955 | |||
| 1902 | Ga0496113_0008709 | |||
| 1903 | Ga0496113_0009465 | |||
| 1904 | Ga0496113_0014956 | |||
| 1905 | Ga0496113_0033288 | |||
| 1906 | Ga0496113_0171594 | |||
| 1907 | Ga0496114_0025447 | |||
| 1908 | Ga0496114_0124677 | |||
| 1909 | Ga0496114_0187265 | |||
| 1910 | Ga0496115_0032477 | |||
| 1911 | Ga0496115_0036116 | |||
| 1912 | Ga0496115_0120255 | |||
| 1913 | Ga0496115_0381964 | |||
| 1914 | Ga0496117_0014455 | |||
| 1915 | Ga0496118_0023890 | |||
| 1916 | Ga0496118_0033952 | |||
| 1917 | Ga0496119_0001067 | |||
| 1918 | Ga0496119_0045578 | |||
| 1919 | Ga0496121_0000495 | |||
| 1920 | Ga0496121_0026710 | |||
| 1921 | Ga0496121_0045260 | |||
| 1922 | Ga0496121_0082038 | |||
| 1923 | Ga0496121_0088366 | |||
| 1924 | Ga0496121_0118639 | |||
| 1925 | Ga0496121_0133274 | |||
| 1926 | Ga0496122_0002451 | |||
| 1927 | Ga0496122_0091580 | |||
| 1928 | Ga0496123_0002729 | |||
| 1929 | Ga0496123_0018019 | |||
| 1930 | Ga0496123_0120012 | |||
| 1931 | Ga0496124_0032050 | |||
| 1932 | Ga0496125_0000756 | |||
| 1933 | Ga0496125_0062680 | |||
| 1934 | Ga0496125_0076405 | |||
| 1935 | Ga0496125_0086468 | |||
| 1936 | Ga0496126_0003586 | |||
| 1937 | Ga0496126_0016488 | |||
| 1938 | Ga0496126_0026376 | |||
| 1939 | Ga0496126_0028995 | |||
| 1940 | Ga0496126_0033722 | |||
| 1941 | Ga0496126_0036229 | |||
| 1942 | Ga0496126_0036387 | |||
| 1943 | Ga0496126_0042356 | |||
| 1944 | Ga0496126_0046139 | |||
| 1945 | Ga0496126_0061695 | |||
| 1946 | Ga0496126_0073591 | |||
| 1947 | Ga0496126_0079278 | |||
| 1948 | Ga0496126_0135859 | |||
| 1949 | Ga0496126_0246358 | |||
| 1950 | Ga0496126_0369530 | |||
| 1951 | Ga0501031_0019410 | |||
| 1952 | Ga0501031_0021878 | |||
| 1953 | Ga0501031_0030985 | |||
| 1954 | Ga0501031_0130669 | |||
| 1955 | Ga0501032_0000333 | |||
| 1956 | Ga0501032_0018351 | |||
| 1957 | Ga0501032_0054042 | |||
| 1958 | Ga0501032_0076934 | |||
| 1959 | Ga0501032_0133646 | |||
| 1960 | Ga0501033_0000313 | |||
| 1961 | Ga0501033_0001956 | |||
| 1962 | Ga0501033_0013274 | |||
| 1963 | Ga0501033_0041454 | |||
| 1964 | Ga0501033_0149987 | |||
| 1965 | Ga0501033_0186400 | |||
| 1966 | Ga0501033_0194193 | |||
| 1967 | Ga0501034_0000232 | |||
| 1968 | Ga0501034_0069629 | |||
| 1969 | Ga0501034_0102117 | |||
| 1970 | Ga0501034_0164700 | |||
| 1971 | Ga0501034_0298259 | |||
| 1972 | Ga0501036_0000032 | |||
| 1973 | Ga0501036_0091635 | |||
| 1974 | Ga0501036_0092462 | |||
| 1975 | Ga0501036_0195628 | |||
| 1976 | Ga0501036_0200944 | |||
| 1977 | Ga0501037_0000505 | |||
| 1978 | Ga0501037_0004799 | |||
| 1979 | Ga0501037_0079717 | |||
| 1980 | Ga0501037_0149999 | |||
| 1981 | Ga0501038_0000112 | |||
| 1982 | Ga0501038_0008822 | |||
| 1983 | Ga0501038_0013084 | |||
| 1984 | Ga0501038_0042838 | |||
| 1985 | Ga0501038_0173627 | |||
| 1986 | Ga0501038_0310963 | |||
| 1987 | Ga0501039_0000078 | |||
| 1988 | Ga0501039_0018886 | |||
| 1989 | Ga0501042_0058150 | |||
| 1990 | Ga0501043_0000220 | |||
| 1991 | Ga0501043_0014699 | |||
| 1992 | Ga0501043_0033825 | |||
| 1993 | Ga0501043_0093896 | |||
| 1994 | Ga0501043_0131001 | |||
| 1995 | Ga0501046_0000176 | |||
| 1996 | Ga0501046_0096951 | |||
| 1997 | Ga0501047_0000085 | |||
| 1998 | Ga0501047_0027577 | |||
| 1999 | Ga0501047_0029059 | |||
| 2000 | Ga0501048_0000246 | |||
| 2001 | Ga0501067_0002027 | |||
| 2002 | Ga0501067_0034038 | |||
| 2003 | Ga0501068_0011114 | |||
| 2004 | Ga0501070_0012856 | |||
| 2005 | Ga0501070_0069456 | |||
| 2006 | Ga0501070_0111162 | |||
| 2007 | Ga0501072_0012237 | |||
| 2008 | Ga0501072_0099188 | |||
| 2009 | Ga0501073_0000026 | |||
| 2010 | Ga0501073_0033655 | |||
| 2011 | Ga0501074_0000191 | |||
| 2012 | Ga0501074_0025625 | |||
| 2013 | Ga0501074_0036410 | |||
| 2014 | Ga0501075_0157735 | |||
| 2015 | Ga0501077_0124227 | |||
| 2016 | Ga0501079_0093595 | |||
| 2017 | Ga0501079_0270421 | |||
| 2018 | Ga0501080_0002583 | |||
| 2019 | Ga0501080_0013807 | |||
| 2020 | Ga0501080_0083779 | |||
| 2021 | Ga0501081_0217773 | |||
| 2022 | Ga0501083_0003196 | |||
| 2023 | Ga0501083_0012664 | |||
| 2024 | Ga0501035_0000760 | |||
| 2025 | Ga0501035_0059715 | |||
| 2026 | Ga0501035_0127352 | |||
| 2027 | Ga0501035_0171271 | |||
| 2028 | Ga0501035_0176718 | |||
| 2029 | Ga0501035_0325160 | |||
| 2030 | Ga0501035_0439292 | |||
| 2031 | Ga0501035_0441765 | |||
| 2032 | Ga0501035_0484716 | |||
| 2033 | Ga0501044_0000061 | |||
| 2034 | Ga0501044_0025310 | |||
| 2035 | Ga0501044_0043287 | |||
| 2036 | Ga0501044_0097109 | |||
| 2037 | Ga0501044_0134259 | |||
| 2038 | Ga0501044_0193327 | |||
| 2039 | Ga0501044_0248997 | |||
| 2040 | Ga0501045_0026450 | |||
| 2041 | nmdc:mga03683_18061_c1 | |||
| 2042 | nmdc:mga03n38_11230_c1 | |||
| 2043 | nmdc:mga03n38_832_c1 | |||
| 2044 | nmdc:mga00v17_39956_c1 | |||
| 2045 | nmdc:mga00v17_56350_c1 | |||
| 2046 | nmdc:mga0yw44_68398_c1 | |||
| 2047 | nmdc:mga0yw44_75400_c1 | |||
| 2048 | nmdc:mga0yw44_9913_c1 | |||
| 2049 | nmdc:mga0k408_145364_c1 | |||
| 2050 | nmdc:mga06z11_162667_c1 | |||
| 2051 | nmdc:mga06z11_47538_c1 | |||
| 2052 | nmdc:mga06z11_6009_c1 | |||
| 2053 | nmdc:mga04h51_27178_c1 | |||
| 2054 | nmdc:mga07m45_103305_c1 | |||
| 2055 | nmdc:mga07m45_38380_c1 | |||
| 2056 | nmdc:mga07m45_59268_c1 | |||
| 2057 | nmdc:mga07m45_7096_c1 | |||
| 2058 | nmdc:mga08y16_141983_c1 | |||
| 2059 | nmdc:mga08y16_155436_c1 | |||
| 2060 | nmdc:mga08y16_258555_c1 | |||
| 2061 | nmdc:mga0n895_321283_c1 | |||
| 2062 | nmdc:mga0rr50_67594_c1 | |||
| 2063 | nmdc:mga0rr50_84510_c1 | |||
| 2064 | nmdc:mga0sz30_27184_c1 | |||
| 2065 | Ga0495601_0108159 | |||
| 2066 | Ga0495601_0119060 | |||
| 2067 | Ga0495612_0091884 | |||
| 2068 | Ga0495612_0103586 | |||
| 2069 | Ga0495655_0020140 | |||
| 2070 | Ga0495595_0015234 | |||
| 2071 | Ga0495619_0033009 | |||
| 2072 | Ga0495619_0033668 | |||
| 2073 | Ga0500583_0023142 | |||
| 2074 | Ga0500651_0022399 | |||
| 2075 | Ga0500566_0000038 | |||
| 2076 | Ga0500640_000048 | |||
| 2077 | Ga0500641_0016051 | |||
| 2078 | Ga0500641_0056051 | |||
| 2079 | Ga0500650_0130967 | |||
| 2080 | Ga0500554_004657 | |||
| 2081 | Ga0500556_0000018 | |||
| 2082 | Ga0500556_0025875 | |||
| 2083 | Ga0500572_000010 | |||
| 2084 | Ga0500572_000687 | |||
| 2085 | Ga0500594_0023556 | |||
| 2086 | Ga0500595_000143 | |||
| 2087 | Ga0500595_002817 | |||
| 2088 | Ga0500595_007196 | |||
| 2089 | Ga0500595_038700 | |||
| 2090 | Ga0500614_001505 | |||
| 2091 | Ga0500642_0016098 | |||
| 2092 | Ga0500652_001910 | |||
| 2093 | Ga0500559_0000554 | |||
| 2094 | Ga0500559_0002882 | |||
| 2095 | Ga0500568_0001566 | |||
| 2096 | Ga0500577_0000336 | |||
| 2097 | Ga0500590_034029 | |||
| 2098 | Ga0500603_001182 | |||
| 2099 | Ga0500603_003083 | |||
| 2100 | Ga0500603_044415 | |||
| 2101 | Ga0500616_0000139 | |||
| 2102 | Ga0500622_0005549 | |||
| 2103 | Ga0500627_0078587 | |||
| 2104 | Ga0500630_001647 | |||
| 2105 | Ga0500638_006620 | |||
| 2106 | Ga0500639_000034 | |||
| 2107 | Ga0500636_0004113 | |||
| 2108 | Ga0500636_0005212 | |||
| 2109 | Ga0500636_0101086 | |||
| 2110 | Ga0500636_0189629 | |||
| 2111 | Ga0500637_0007438 | |||
| 2112 | Ga0500637_0033915 | |||
| 2113 | Ga0500637_0063815 | |||
| 2114 | Ga0500645_013191 | |||
| 2115 | Ga0500596_000711 | |||
| 2116 | Ga0500601_005398 | |||
| 2117 | Ga0501084_0061256 | |||
| 2118 | Ga0500661_000428 | |||
| 2119 | Ga0501082_0005939 | |||
| 2120 | Ga0501082_0097270 | |||
| 2121 | Ga0501082_0148028 | |||
| 2122 | 2509147206 | |||
| 2123 | 2513656578 | |||
| 2124 | 2513672366 | |||
| 2125 | 2513691759 | |||
| 2126 | 2513717519 | |||
| 2127 | 2513859535 | |||
| 2128 | 2513889276 | |||
| 2129 | 2513917763 | |||
| 2130 | 2513925781 | |||
| 2131 | 2517893165 | |||
| 2132 | 2524466829 | |||
| 2133 | 2524537284 | |||
| 2134 | 2545675516 | |||
| 2135 | 2599418513 | |||
| 2136 | 2644728282 | |||
| 2137 | 2644746683 | |||
| 2138 | 2671117799 | |||
| 2139 | 2723845831 | |||
| 2140 | 2728754600 | |||
| 2141 | 2774868575 | |||
| 2142 | 2776260387 | |||
| 2143 | 2793069967 | |||
| 2144 | 2793077177 | |||
| 2145 | 2838037789 | |||
| 2146 | 2838662802 | |||
| 2147 | 2874609523 | |||
| 2148 | 2876810978 | |||
| 2149 | 2879115703 | |||
| 2150 | 2882460349 | |||
| 2151 | 2884300190 | |||
| 2152 | 2885374757 | |||
| 2153 | 2885391709 | |||
| 2154 | 2889040672 | |||
| 2155 | 2894240583 | |||
| 2156 | 2903777836 | |||
| 2157 | 2904696497 | |||
| 2158 | 2904702043 | |||
| 2159 | 2906617627 | |||
| 2160 | 2906640880 | |||
| 2161 | 2906667859 | |||
| 2162 | 2908743556 | |||
| 2163 | 2908760348 | |||
| 2164 | 2917700748 | |||
| 2165 | 2919454675 | |||
| 2166 | 2922367774 | |||
| 2167 | 2922392323 | |||
| 2168 | 2922429323 | |||
| 2169 | 2935634102 | |||
| 2170 | 2941510993 | |||
| 2171 | 2941518377 | |||
| 2172 | 2941527360 | |||
| 2173 | 3003669126 | |||
| 2174 | 3005479491 | |||
| 2175 | 641646326 | |||
| 2176 | 643604627 | |||
| 2177 | 8001849630 | |||
| 2178 | 8006941657 | |||
| 2179 | 8006971954 | |||
| 2180 | 8006981367 | |||
| 2181 | 8006990367 | |||
| 2182 | 8006996411 | |||
| 2183 | 8019557571 | |||
| 2184 | 8019567727 | |||
| 2185 | 8056674658 | |||
| 2186 | 8056688546 | |||
| 2187 | 8056690247 | |||
| 2188 | 8057535262 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5bnr-assembly1.cif.gz_A-2 | e. coli fabh with small molecule inhibitor 2 | 0.9813 | 5 | 324 |
| 4z19-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine | 0.9809 | 5 | 324 |
| 4ylt-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis | 0.9783 | 5 | 324 |
| 5bnr-assembly1.cif.gz_A-2 | e. coli fabh with small molecule inhibitor 2 | 0.9751 | 5 | 324 |
| 4z19-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine | 0.9747 | 5 | 324 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3il3A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9846 | 5 | 172 | 3.40.47.10 |
| 2ebdB02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9739 | 183 | 324 | 3.40.47.10 |
| 3il4B01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9727 | 5 | 172 | 3.40.47.10 |
| af_Q2FZS0_1_313_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.972 | 5 | 324 | 3.40.47.10 |
| 2x3eB01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9719 | 5 | 172 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P1BWG9-F1-model_v4 | Beta-ketoacyl-ACP synthase 3 (EC 2.3.1.180) | 0.9992 | 1 | 215 |
GO:0004315
GO:0006633 GO:0033818 GO:0044550 |
| AF-A0A259KT87-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9959 | 3 | 168 |
GO:0004315
GO:0006633 GO:0044550 |
| AF-A0A6P1BWG9-F1-model_v4 | Beta-ketoacyl-ACP synthase 3 (EC 2.3.1.180) | 0.9946 | 1 | 215 |
GO:0004315
GO:0006633 GO:0033818 GO:0044550 |
| AF-A0A848YF74-F1-model_v4 | Ketoacyl-ACP synthase III | 0.9943 | 72 | 324 |
GO:0004315
GO:0005737 GO:0006633 GO:0044550 |
| AF-A0A3B9NPJ8-F1-model_v4 | 3-oxoacyl-ACP synthase (EC 2.3.1.180) | 0.9925 | 214 | 324 |
GO:0033818
|