F489934

General Info

Members Datasets Scaffolds Average Seq Length
1094 485 2188 322

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10007089|JGI25404J52841_100070892
Length 348
Sequence VTAIRSVVLGCGSYLPQKVLTNAELAARIDTSDEWIVQRTGIRQRHIAADDEFTSHLGVNAARAALAHAGIDAQSIDLIVVATSTPDNTFPATAVAIQNALGITHGAAFDLQAVCSGFIFAMATADNFLRSGAYKRALVIGAETFSRILDWNDRTTCVLFGDGAGAVVLEAQEQPGGTTDRGILTSHLRSDGRHQSKLYVDGGPGSTKTVGHLKMEGREVFKHAVGMVTDVIVDAFKATGTSVEDIDWFIPHQANRRIIDATAHKLHLAPEKVVLTVDQHGNTSAASIPLALCVAVKXGRVKKGDLXMLEAMGGGFTWGSVLLRWXVWHKDFYAKYKCVFMLLHDARC

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
94 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
95 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
194 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
195 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
196 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
206 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
211 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
212 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
225 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
226 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
227 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
228 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
229 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
232 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
233 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
247 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
248 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
249 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
250 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
253 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
254 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
255 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
256 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
257 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
258 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
278 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
279 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
280 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
281 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
282 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
283 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
284 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
312 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
313 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
314 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
315 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
333 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
334 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
335 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
336 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
337 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
355 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
358 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
360 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
361 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
362 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
363 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
364 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
365 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
366 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
369 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
370 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
371 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
372 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
373 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
374 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
375 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
376 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
380 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
381 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
382 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
383 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
384 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
385 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
386 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
387 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
388 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
389 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
390 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
391 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
392 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
393 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
394 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
395 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
396 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
397 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
398 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
399 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
400 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
401 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
402 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
403 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
404 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
405 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
406 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
407 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
408 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
409 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
410 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
411 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
412 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
413 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
414 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
415 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
416 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
417 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
418 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
419 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
420 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
421 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
422 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
423 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
424 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
425 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
426 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
427 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
428 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
429 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
430 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
431 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
432 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
433 2643221733 Bosea sp. Root381 Isolate Unclassified
434 2643221736 Bosea sp. Root483D1 Isolate Unclassified
435 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
436 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
437 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
438 2773857925 Microvirga vignae BR3299 Isolate Unclassified
439 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
440 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
441 2791355199
442 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
443 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
444 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
445 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
446 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
447 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
448 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
449 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
450 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
451 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
452 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
453 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
454 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
455 2904699407
456 2906610324
457 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
458 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
459 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
460 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
461 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
462 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
463 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
464 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
465 2922425934
466 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
467 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
468 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
469 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
470 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
471 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
472 641522639 Methylobacterium sp. 4-46 Isolate Nodule
473 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
474 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
475 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
476 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
477 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
478 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
479 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
480 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
481 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
482 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
483 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
484 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
485 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.13
Metatranscriptomes 0.09
Isolates 5.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.96
Nodule 4.66
Rhizoplane 4.57
Rhizosphere 73.31
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10007089 3300003659 Bacteria 2363
2 JGI24740J21852_10006297 3300001979 Bacteria 4928
3 JGI24738J21930_10011139 3300002075 Bacteria 1985
4 JGI25406J46586_10000006 3300003203 Bacteria 114937
5 JGI25406J46586_10015653 3300003203 Bacteria 3191
6 JGI25153J46596_10004068 3300003215 Bacteria 7963
7 rootH1_10137999 3300003323 Bacteria 1607
8 JGI25404J52841_10000633 3300003659 Bacteria 5323
9 JGI25404J52841_10009381 3300003659 Bacteria 2092
10 Ga0055526_1000468 3300003771 Bacteria 32069
11 Ga0055524_1000352 3300003775 Bacteria 41872
12 Ga0065165_1000046 3300005262 Bacteria 198873
13 Ga0070658_10025139 3300005327 Bacteria 4774
14 Ga0070658_10129968 3300005327 Bacteria 2098
15 Ga0070658_10338376 3300005327 Bacteria 1287
16 Ga0070658_10396321 3300005327 Bacteria 1185
17 Ga0070676_10010147 3300005328 Bacteria 5105
18 Ga0070676_10047040 3300005328 Bacteria 2518
19 Ga0070683_100053161 3300005329 Bacteria 3753
20 Ga0070683_100095305 3300005329 Bacteria 2798
21 Ga0070683_100241102 3300005329 Bacteria 1719
22 Ga0070690_100029843 3300005330 Bacteria 3386
23 Ga0070690_100096123 3300005330 Bacteria 1957
24 Ga0070670_100006838 3300005331 Bacteria 9664
25 Ga0070670_100177228 3300005331 Bacteria 1850
26 Ga0070677_10002482 3300005333 Bacteria 5900
27 Ga0068869_100002596 3300005334 Bacteria 10912
28 Ga0068869_100004697 3300005334 Bacteria 8524
29 Ga0068869_100206651 3300005334 Bacteria 1551
30 Ga0068869_100249388 3300005334 Bacteria 1417
31 Ga0070666_10063577 3300005335 Bacteria 2502
32 Ga0070680_100054413 3300005336 Bacteria 3268
33 Ga0070680_100063343 3300005336 Bacteria 3029
34 Ga0070680_100328225 3300005336 Bacteria 1299
35 Ga0070682_100172467 3300005337 Bacteria 1504
36 Ga0068868_100075697 3300005338 Bacteria 2690
37 Ga0068868_100089024 3300005338 Bacteria 2485
38 Ga0068868_100386282 3300005338 Bacteria 1205
39 Ga0070660_100003180 3300005339 Bacteria 11282
40 Ga0070689_100071264 3300005340 Bacteria 2715
41 Ga0070661_100336523 3300005344 Bacteria 1181
42 Ga0070668_100007129 3300005347 Bacteria 8283
43 Ga0070668_100010143 3300005347 Bacteria 6983
44 Ga0070668_100018023 3300005347 Bacteria 5297
45 Ga0070668_100045066 3300005347 Bacteria 3384
46 Ga0070668_100188945 3300005347 Bacteria 1686
47 Ga0070669_100009649 3300005353 Bacteria 6875
48 Ga0070675_100007819 3300005354 Bacteria 8286
49 Ga0070675_100086448 3300005354 Bacteria 2621
50 Ga0070671_100005455 3300005355 Bacteria 10154
51 Ga0070671_100013034 3300005355 Bacteria 6701
52 Ga0070671_100111160 3300005355 Bacteria 2302
53 Ga0070671_100231194 3300005355 Bacteria 1569
54 Ga0070674_100003800 3300005356 Bacteria 8533
55 Ga0070674_100034126 3300005356 Bacteria 3395
56 Ga0070673_100010465 3300005364 Bacteria 6281
57 Ga0070673_100124435 3300005364 Bacteria 2155
58 Ga0070688_100005381 3300005365 Bacteria 6735
59 Ga0070659_100011346 3300005366 Bacteria 6589
60 Ga0070667_100006047 3300005367 Bacteria 10053
61 Ga0070667_100006908 3300005367 Bacteria 9429
62 Ga0070667_100103359 3300005367 Bacteria 2463
63 Ga0070709_10000640 3300005434 Bacteria 19980
64 Ga0070709_10000814 3300005434 Bacteria 17403
65 Ga0070709_10011971 3300005434 Bacteria 4848
66 Ga0070709_10023138 3300005434 Bacteria 3645
67 Ga0070709_10034707 3300005434 Bacteria 3060
68 Ga0070714_100001978 3300005435 Bacteria 14970
69 Ga0070714_100018170 3300005435 Bacteria 5705
70 Ga0070714_100066721 3300005435 Bacteria 3101
71 Ga0070714_100070911 3300005435 Bacteria 3012
72 Ga0070714_100195923 3300005435 Bacteria 1846
73 Ga0070713_100001376 3300005436 Bacteria 15569
74 Ga0070713_100005011 3300005436 Bacteria 8995
75 Ga0070713_100006728 3300005436 Bacteria 8004
76 Ga0070713_100037946 3300005436 Bacteria 3899
77 Ga0070710_10000766 3300005437 Bacteria 15325
78 Ga0070710_10002013 3300005437 Bacteria 9610
79 Ga0070710_10005543 3300005437 Bacteria 6006
80 Ga0070711_100007282 3300005439 Bacteria 6725
81 Ga0070711_100014164 3300005439 Bacteria 5020
82 Ga0070711_100015664 3300005439 Bacteria 4799
83 Ga0070711_100016788 3300005439 Bacteria 4653
84 Ga0070705_100008967 3300005440 Bacteria 4962
85 Ga0070705_100198714 3300005440 Bacteria 1373
86 Ga0070700_100166732 3300005441 Bacteria 1522
87 Ga0070700_100194139 3300005441 Bacteria 1422
88 Ga0070700_100279113 3300005441 Bacteria 1210
89 Ga0070694_100190348 3300005444 Bacteria 1523
90 Ga0070708_100102480 3300005445 Bacteria 2622
91 Ga0070663_100022618 3300005455 Bacteria 4206
92 Ga0070663_100064606 3300005455 Bacteria 2646
93 Ga0070663_100168409 3300005455 Bacteria 1691
94 Ga0070663_100222792 3300005455 Bacteria 1481
95 Ga0070678_100044935 3300005456 Bacteria 3157
96 Ga0070678_100064693 3300005456 Bacteria 2711
97 Ga0070678_100107123 3300005456 Bacteria 2179
98 Ga0070678_100128606 3300005456 Bacteria 2009
99 Ga0070678_100153857 3300005456 Bacteria 1856
100 Ga0070678_100251757 3300005456 Bacteria 1481
101 Ga0070662_100087302 3300005457 Bacteria 2335
102 Ga0070681_10025556 3300005458 Bacteria 5940
103 Ga0070681_10038316 3300005458 Bacteria 4806
104 Ga0070681_10081622 3300005458 Bacteria 3189
105 Ga0070681_10162290 3300005458 Bacteria 2159
106 Ga0070681_10177870 3300005458 Bacteria 2049
107 Ga0070681_10203329 3300005458 Bacteria 1898
108 Ga0070681_10341650 3300005458 Bacteria 1407
109 Ga0068867_100005228 3300005459 Bacteria 9159
110 Ga0068867_100062386 3300005459 Bacteria 2769
111 Ga0068867_100087556 3300005459 Bacteria 2358
112 Ga0070698_100009493 3300005471 Bacteria 10421
113 Ga0070679_100014960 3300005530 Bacteria 7454
114 Ga0070679_100030520 3300005530 Bacteria 5321
115 Ga0070684_100019257 3300005535 Bacteria 5643
116 Ga0070684_100031500 3300005535 Bacteria 4515
117 Ga0070684_100096349 3300005535 Bacteria 2637
118 Ga0068853_100006610 3300005539 Bacteria 9230
119 Ga0068853_100020640 3300005539 Bacteria 5478
120 Ga0068853_100105016 3300005539 Bacteria 2502
121 Ga0068853_100197342 3300005539 Bacteria 1831
122 Ga0070672_100091381 3300005543 Bacteria 2456
123 Ga0070672_100189360 3300005543 Bacteria 1717
124 Ga0070672_100209703 3300005543 Bacteria 1631
125 Ga0070672_100319012 3300005543 Bacteria 1321
126 Ga0070696_100064559 3300005546 Bacteria 2565
127 Ga0070665_100008939 3300005548 Bacteria 10151
128 Ga0070665_100013374 3300005548 Bacteria 8260
129 Ga0070665_100057794 3300005548 Bacteria 3889
130 Ga0070665_100094750 3300005548 Bacteria 2990
131 Ga0070665_100214588 3300005548 Bacteria 1925
132 Ga0070665_100587646 3300005548 Bacteria 1126
133 Ga0070704_100172316 3300005549 Bacteria 1722
134 Ga0068855_100035310 3300005563 Bacteria 5955
135 Ga0068855_100036199 3300005563 Bacteria 5877
136 Ga0068855_100052296 3300005563 Bacteria 4809
137 Ga0068855_100096063 3300005563 Bacteria 3415
138 Ga0068855_100206739 3300005563 Bacteria 2208
139 Ga0068855_100241389 3300005563 Bacteria 2019
140 Ga0068855_100278723 3300005563 Bacteria 1857
141 Ga0068855_100704865 3300005563 Bacteria 1080
142 Ga0070664_100132245 3300005564 Bacteria 2192
143 Ga0070664_100137999 3300005564 Bacteria 2145
144 Ga0068857_100004656 3300005577 Bacteria 11621
145 Ga0068857_100015427 3300005577 Bacteria 6671
146 Ga0068857_100037534 3300005577 Bacteria 4292
147 Ga0068857_100046999 3300005577 Bacteria 3831
148 Ga0068857_100068681 3300005577 Bacteria 3154
149 Ga0068857_100071936 3300005577 Bacteria 3082
150 Ga0068857_100151174 3300005577 Bacteria 2103
151 Ga0068854_100003076 3300005578 Bacteria 10391
152 Ga0068854_100079434 3300005578 Bacteria 2418
153 Ga0068854_100080953 3300005578 Bacteria 2397
154 Ga0068854_100090422 3300005578 Bacteria 2276
155 Ga0068854_100146703 3300005578 Bacteria 1816
156 Ga0068856_100002728 3300005614 Bacteria 18074
157 Ga0068856_100009830 3300005614 Bacteria 9291
158 Ga0068856_100321564 3300005614 Bacteria 1564
159 Ga0070702_100127289 3300005615 Bacteria 1603
160 Ga0070702_100179647 3300005615 Bacteria 1384
161 Ga0068852_100002660 3300005616 Bacteria 12353
162 Ga0068852_100019989 3300005616 Bacteria 5317
163 Ga0068852_100053086 3300005616 Bacteria 3487
164 Ga0068852_100241503 3300005616 Bacteria 1726
165 Ga0068859_100008168 3300005617 Bacteria 10619
166 Ga0068859_100078169 3300005617 Bacteria 3349
167 Ga0068859_100084702 3300005617 Bacteria 3215
168 Ga0068859_100120910 3300005617 Bacteria 2685
169 Ga0068864_100000456 3300005618 Bacteria 35356
170 Ga0068864_100010237 3300005618 Bacteria 7744
171 Ga0068864_100081773 3300005618 Bacteria 2832
172 Ga0068864_100141492 3300005618 Bacteria 2170
173 Ga0068866_10082316 3300005718 Bacteria 1731
174 Ga0068866_10095923 3300005718 Bacteria 1625
175 Ga0068866_10104077 3300005718 Bacteria 1571
176 Ga0068861_100009658 3300005719 Bacteria 6664
177 Ga0068851_10002062 3300005834 Bacteria 8852
178 Ga0068851_10005576 3300005834 Bacteria 5709
179 Ga0068870_10008724 3300005840 Bacteria 4571
180 Ga0068863_100100035 3300005841 Bacteria 2756
181 Ga0068863_100162305 3300005841 Bacteria 2141
182 Ga0068858_100008910 3300005842 Bacteria 9618
183 Ga0068858_100145418 3300005842 Bacteria 2226
184 Ga0068858_100153569 3300005842 Bacteria 2165
185 Ga0068858_100163523 3300005842 Bacteria 2096
186 Ga0068858_100259178 3300005842 Bacteria 1653
187 Ga0068858_100282784 3300005842 Bacteria 1580
188 Ga0068860_100000058 3300005843 Bacteria 197181
189 Ga0068860_100008086 3300005843 Bacteria 10474
190 Ga0068860_100011681 3300005843 Bacteria 8657
191 Ga0068860_100018455 3300005843 Bacteria 6785
192 Ga0068860_100031752 3300005843 Bacteria 5078
193 Ga0068862_100008392 3300005844 Bacteria 8549
194 Ga0068862_100031093 3300005844 Bacteria 4503
195 Ga0068862_100035873 3300005844 Bacteria 4201
196 Ga0068862_100081154 3300005844 Bacteria 2813
197 Ga0081455_10001410 3300005937 Bacteria 29737
198 Ga0081455_10001781 3300005937 Bacteria 26018
199 Ga0081455_10004929 3300005937 Bacteria 14767
200 Ga0081455_10032437 3300005937 Bacteria 4706
201 Ga0081455_10036644 3300005937 Bacteria 4364
202 Ga0081455_10098761 3300005937 Bacteria 2350
203 Ga0081540_1002699 3300005983 Bacteria 14438
204 Ga0081540_1003795 3300005983 Bacteria 11825
205 Ga0081540_1005283 3300005983 Bacteria 9665
206 Ga0081540_1005851 3300005983 Bacteria 9093
207 Ga0081540_1008346 3300005983 Bacteria 7242
208 Ga0081540_1010920 3300005983 Bacteria 6099
209 Ga0081540_1022377 3300005983 Bacteria 3733
210 Ga0081540_1026189 3300005983 Bacteria 3336
211 Ga0081539_10000176 3300005985 Bacteria 150292
212 Ga0081539_10000231 3300005985 Bacteria 131197
213 Ga0081539_10024164 3300005985 Bacteria 3953
214 Ga0081539_10047543 3300005985 Bacteria 2449
215 Ga0081539_10104293 3300005985 Bacteria 1439
216 Ga0070717_10003916 3300006028 Bacteria 10717
217 Ga0070717_10038425 3300006028 Bacteria 3891
218 Ga0070717_10134968 3300006028 Bacteria 2124
219 Ga0070717_10197111 3300006028 Bacteria 1762
220 Ga0075365_10004977 3300006038 Bacteria 7115
221 Ga0075365_10069918 3300006038 Bacteria 2360
222 Ga0075365_10130601 3300006038 Bacteria 1738
223 Ga0075365_10139751 3300006038 Bacteria 1681
224 Ga0075365_10155593 3300006038 Bacteria 1591
225 Ga0075368_10009652 3300006042 Bacteria 3475
226 Ga0075368_10029354 3300006042 Bacteria 2126
227 Ga0075363_100009297 3300006048 Bacteria 4617
228 Ga0075363_100066488 3300006048 Bacteria 1951
229 Ga0075364_10023373 3300006051 Bacteria 3914
230 Ga0070715_10001403 3300006163 Bacteria 6964
231 Ga0070716_100004448 3300006173 Bacteria 6701
232 Ga0070716_100008376 3300006173 Bacteria 5130
233 Ga0070712_100087828 3300006175 Bacteria 2270
234 Ga0075367_10002730 3300006178 Bacteria 8160
235 Ga0075367_10064108 3300006178 Bacteria 2197
236 Ga0075367_10081152 3300006178 Bacteria 1962
237 Ga0075369_10110703 3300006186 Bacteria 1237
238 Ga0075369_10111356 3300006186 Bacteria 1234
239 Ga0097621_100004460 3300006237 Bacteria 9751
240 Ga0097621_100029361 3300006237 Bacteria 4342
241 Ga0075370_10017240 3300006353 Bacteria 3900
242 Ga0075370_10019215 3300006353 Bacteria 3719
243 Ga0075370_10033797 3300006353 Bacteria 2864
244 Ga0068871_100004954 3300006358 Bacteria 9303
245 Ga0068871_100050314 3300006358 Bacteria 3371
246 Ga0068871_100053398 3300006358 Bacteria 3275
247 Ga0068871_100195862 3300006358 Bacteria 1742
248 Ga0075428_100102576 3300006844 Bacteria 3119
249 Ga0075428_100177503 3300006844 Bacteria 2306
250 Ga0075434_100381276 3300006871 Bacteria 1431
251 Ga0075429_100327768 3300006880 Bacteria 1340
252 Ga0068865_100059567 3300006881 Bacteria 2671
253 Ga0097620_100008167 3300006931 Bacteria 10619
254 Ga0097620_100078169 3300006931 Bacteria 3349
255 Ga0097620_100084701 3300006931 Bacteria 3215
256 Ga0097620_100120911 3300006931 Bacteria 2685
257 Ga0099825_1025547 3300006941 Bacteria 3272
258 Ga0099824_1010180 3300006942 Bacteria 11239
259 Ga0099824_1013426 3300006942 Bacteria 8507
260 Ga0099822_1000628 3300006943 Bacteria 34929
261 Ga0099794_10094286 3300007265 Bacteria 1488
262 Ga0099795_10012210 3300007788 Bacteria 2597
263 Ga0105240_10016661 3300009093 Bacteria 9941
264 Ga0105240_10029346 3300009093 Bacteria 7168
265 Ga0105240_10086998 3300009093 Bacteria 3827
266 Ga0105240_10097952 3300009093 Bacteria 3573
267 Ga0105240_10176195 3300009093 Bacteria 2528
268 Ga0105240_10277106 3300009093 Bacteria 1928
269 Ga0105245_10050419 3300009098 Bacteria 3731
270 Ga0105245_10152141 3300009098 Bacteria 2189
271 Ga0105245_10169370 3300009098 Bacteria 2079
272 Ga0105247_10016073 3300009101 Bacteria 4483
273 Ga0105247_10068517 3300009101 Bacteria 2212
274 Ga0105243_10286050 3300009148 Bacteria 1487
275 Ga0105241_10009864 3300009174 Bacteria 7018
276 Ga0105248_10007225 3300009177 Bacteria 12184
277 Ga0105248_10016076 3300009177 Bacteria 8237
278 Ga0105248_10132713 3300009177 Bacteria 2810
279 Ga0105248_10432588 3300009177 Bacteria 1482
280 Ga0105237_10067725 3300009545 Bacteria 3564
281 Ga0105237_10113083 3300009545 Bacteria 2707
282 Ga0105237_10181565 3300009545 Bacteria 2104
283 Ga0105237_10274069 3300009545 Bacteria 1690
284 Ga0105237_10327854 3300009545 Bacteria 1535
285 Ga0105238_10002811 3300009551 Bacteria 17365
286 Ga0105238_10012890 3300009551 Bacteria 8437
287 Ga0105238_10029984 3300009551 Bacteria 5537
288 Ga0105238_10065071 3300009551 Bacteria 3647
289 Ga0105238_10089082 3300009551 Bacteria 3073
290 Ga0105238_10171113 3300009551 Bacteria 2148
291 Ga0105238_10444266 3300009551 Bacteria 1293
292 Ga0105249_10015186 3300009553 Bacteria 6815
293 Ga0105239_10024336 3300010375 Bacteria 6671
294 Ga0105239_10042814 3300010375 Bacteria 4962
295 Ga0105239_10062251 3300010375 Bacteria 4095
296 Ga0105239_10065172 3300010375 Bacteria 4000
297 Ga0105239_10117512 3300010375 Bacteria 2951
298 Ga0105239_10161443 3300010375 Bacteria 2503
299 Ga0105239_10189484 3300010375 Bacteria 2302
300 Ga0105246_10131919 3300011119 Bacteria 1867
301 Ga0105246_10147927 3300011119 Bacteria 1775
302 Ga0157373_10008811 3300013100 Bacteria 7474
303 Ga0157371_10005809 3300013102 Bacteria 10324
304 Ga0157370_10005379 3300013104 Bacteria 14376
305 Ga0157370_10038788 3300013104 Bacteria 4607
306 Ga0157370_10477146 3300013104 Bacteria 1146
307 Ga0157369_10004098 3300013105 Bacteria 17262
308 Ga0157369_10080589 3300013105 Bacteria 3485
309 Ga0157369_10088852 3300013105 Bacteria 3299
310 Ga0157369_10096347 3300013105 Bacteria 3157
311 Ga0171462_1011 3300013250 Bacteria 229282
312 Ga0157374_10195235 3300013296 Bacteria 1981
313 Ga0157374_10287723 3300013296 Bacteria 1623
314 Ga0157374_10693692 3300013296 Bacteria 1031
315 Ga0157378_10016765 3300013297 Bacteria 6419
316 Ga0157378_10086750 3300013297 Bacteria 2838
317 Ga0157378_10160370 3300013297 Bacteria 2103
318 Ga0163162_10023700 3300013306 Bacteria 6058
319 Ga0163162_10035737 3300013306 Bacteria 4950
320 Ga0163162_10132258 3300013306 Bacteria 2604
321 Ga0157375_10009213 3300013308 Bacteria 8658
322 Ga0157375_10009300 3300013308 Bacteria 8625
323 Ga0157375_10010588 3300013308 Bacteria 8119
324 Ga0157375_10075444 3300013308 Bacteria 3396
325 Ga0163163_10011827 3300014325 Bacteria 7936
326 Ga0163163_10060169 3300014325 Bacteria 3760
327 Ga0163163_10070835 3300014325 Bacteria 3473
328 Ga0163163_10119522 3300014325 Bacteria 2668
329 Ga0163163_10248806 3300014325 Bacteria 1828
330 Ga0163163_10557719 3300014325 Bacteria 1208
331 Ga0157380_10018325 3300014326 Bacteria 5195
332 Ga0157377_10112587 3300014745 Bacteria 1638
333 Ga0157379_10000246 3300014968 Bacteria 42489
334 Ga0157379_10059933 3300014968 Bacteria 3403
335 Ga0157376_10006054 3300014969 Bacteria 8505
336 Ga0157376_10009356 3300014969 Bacteria 7120
337 Ga0157376_10024704 3300014969 Bacteria 4723
338 Ga0157376_10039678 3300014969 Bacteria 3842
339 Ga0157376_10352139 3300014969 Bacteria 1409
340 Ga0157376_10369338 3300014969 Bacteria 1378
341 Ga0163161_10019421 3300017792 Bacteria 4768
342 Ga0206353_11365297 3300020082 Bacteria 2655
343 Ga0213874_10002910 3300021377 Bacteria 3735
344 Ga0213876_10015796 3300021384 Bacteria 3995
345 Ga0213876_10042552 3300021384 Bacteria 2400
346 Ga0213876_10091555 3300021384 Bacteria 1610
347 Ga0213875_10007779 3300021388 Bacteria 5509
348 Ga0209677_101611 3300025253 Bacteria 9518
349 Ga0209233_1006049 3300025261 Bacteria 3943
350 Ga0209130_1000703 3300025284 Bacteria 29959
351 Ga0209675_1001330 3300025291 Bacteria 14616
352 Ga0209025_1000016 3300025294 Bacteria 770739
353 Ga0209025_1002211 3300025294 Bacteria 21463
354 Ga0209564_1000023 3300025295 Bacteria 555102
355 Ga0209564_1000035 3300025295 Bacteria 442446
356 Ga0209564_1008909 3300025295 Bacteria 4870
357 Ga0209758_1004676 3300025297 Bacteria 11193
358 Ga0209758_1014026 3300025297 Bacteria 4307
359 Ga0209256_1000025 3300025299 Bacteria 442449
360 Ga0207656_10020136 3300025321 Bacteria 2648
361 Ga0207682_10000600 3300025893 Bacteria 16720
362 Ga0207692_10001752 3300025898 Bacteria 8233
363 Ga0207692_10003198 3300025898 Bacteria 6365
364 Ga0207692_10064878 3300025898 Bacteria 1903
365 Ga0207692_10187102 3300025898 Bacteria 1210
366 Ga0207710_10016038 3300025900 Bacteria 3170
367 Ga0207710_10036693 3300025900 Bacteria 2162
368 Ga0207688_10030116 3300025901 Bacteria 2992
369 Ga0207688_10071462 3300025901 Bacteria 1970
370 Ga0207688_10099593 3300025901 Bacteria 1677
371 Ga0207680_10090058 3300025903 Bacteria 1949
372 Ga0207680_10090388 3300025903 Bacteria 1946
373 Ga0207680_10097460 3300025903 Bacteria 1883
374 Ga0207647_10011930 3300025904 Bacteria 6068
375 Ga0207647_10068496 3300025904 Bacteria 2148
376 Ga0207685_10003885 3300025905 Bacteria 3705
377 Ga0207699_10007628 3300025906 Bacteria 5298
378 Ga0207699_10015007 3300025906 Bacteria 4013
379 Ga0207699_10080507 3300025906 Bacteria 2018
380 Ga0207645_10004697 3300025907 Bacteria 10049
381 Ga0207645_10031672 3300025907 Bacteria 3402
382 Ga0207645_10047170 3300025907 Bacteria 2751
383 Ga0207643_10025397 3300025908 Bacteria 3274
384 Ga0207684_10450348 3300025910 Bacteria 1105
385 Ga0207654_10000968 3300025911 Bacteria 15767
386 Ga0207654_10004279 3300025911 Bacteria 7204
387 Ga0207707_10004344 3300025912 Bacteria 12544
388 Ga0207707_10103544 3300025912 Bacteria 2488
389 Ga0207707_10181771 3300025912 Bacteria 1836
390 Ga0207695_10003702 3300025913 Bacteria 21304
391 Ga0207695_10015923 3300025913 Bacteria 8830
392 Ga0207671_10024084 3300025914 Bacteria 4582
393 Ga0207671_10061368 3300025914 Bacteria 2789
394 Ga0207671_10202458 3300025914 Bacteria 1551
395 Ga0207693_10003588 3300025915 Bacteria 13253
396 Ga0207693_10019182 3300025915 Bacteria 5442
397 Ga0207693_10040712 3300025915 Bacteria 3659
398 Ga0207693_10049803 3300025915 Bacteria 3289
399 Ga0207693_10077009 3300025915 Bacteria 2612
400 Ga0207663_10002056 3300025916 Bacteria 9591
401 Ga0207663_10006350 3300025916 Bacteria 6042
402 Ga0207663_10061932 3300025916 Bacteria 2376
403 Ga0207660_10002460 3300025917 Bacteria 12166
404 Ga0207660_10012121 3300025917 Bacteria 5635
405 Ga0207660_10087859 3300025917 Bacteria 2298
406 Ga0207660_10205573 3300025917 Bacteria 1540
407 Ga0207657_10000297 3300025919 Bacteria 52991
408 Ga0207657_10002222 3300025919 Bacteria 21059
409 Ga0207657_10030755 3300025919 Bacteria 4868
410 Ga0207649_10305383 3300025920 Bacteria 1165
411 Ga0207652_10010300 3300025921 Bacteria 7526
412 Ga0207652_10015488 3300025921 Bacteria 6199
413 Ga0207652_10016438 3300025921 Bacteria 6042
414 Ga0207694_10001639 3300025924 Bacteria 18837
415 Ga0207694_10008346 3300025924 Bacteria 7829
416 Ga0207694_10046702 3300025924 Bacteria 3347
417 Ga0207694_10083288 3300025924 Bacteria 2515
418 Ga0207694_10123866 3300025924 Bacteria 2066
419 Ga0207650_10004702 3300025925 Bacteria 9329
420 Ga0207650_10139069 3300025925 Bacteria 1908
421 Ga0207659_10048551 3300025926 Bacteria 3007
422 Ga0207659_10191695 3300025926 Bacteria 1627
423 Ga0207687_10084525 3300025927 Bacteria 2300
424 Ga0207687_10115219 3300025927 Bacteria 2002
425 Ga0207700_10008958 3300025928 Bacteria 6230
426 Ga0207700_10039853 3300025928 Bacteria 3424
427 Ga0207700_10042207 3300025928 Bacteria 3342
428 Ga0207664_10010987 3300025929 Bacteria 6411
429 Ga0207664_10019635 3300025929 Bacteria 4999
430 Ga0207664_10056781 3300025929 Bacteria 3110
431 Ga0207664_10068217 3300025929 Bacteria 2856
432 Ga0207664_10079285 3300025929 Bacteria 2665
433 Ga0207664_10100081 3300025929 Bacteria 2393
434 Ga0207644_10006040 3300025931 Bacteria 7896
435 Ga0207644_10041918 3300025931 Bacteria 3240
436 Ga0207644_10085093 3300025931 Bacteria 2345
437 Ga0207644_10109970 3300025931 Bacteria 2083
438 Ga0207644_10231263 3300025931 Bacteria 1469
439 Ga0207644_10234208 3300025931 Bacteria 1460
440 Ga0207690_10010823 3300025932 Bacteria 5436
441 Ga0207690_10039340 3300025932 Bacteria 3085
442 Ga0207690_10092175 3300025932 Bacteria 2143
443 Ga0207706_10154343 3300025933 Bacteria 2020
444 Ga0207706_10283039 3300025933 Bacteria 1446
445 Ga0207669_10031192 3300025937 Bacteria 2974
446 Ga0207669_10049642 3300025937 Bacteria 2502
447 Ga0207704_10055882 3300025938 Bacteria 2415
448 Ga0207704_10083959 3300025938 Bacteria 2069
449 Ga0207704_10105001 3300025938 Bacteria 1894
450 Ga0207665_10000769 3300025939 Bacteria 21572
451 Ga0207665_10012564 3300025939 Bacteria 5564
452 Ga0207665_10089156 3300025939 Bacteria 2136
453 Ga0207665_10167911 3300025939 Bacteria 1583
454 Ga0207691_10008356 3300025940 Bacteria 9945
455 Ga0207691_10066113 3300025940 Bacteria 3272
456 Ga0207691_10086468 3300025940 Bacteria 2813
457 Ga0207711_10021208 3300025941 Bacteria 5426
458 Ga0207711_10043099 3300025941 Bacteria 3847
459 Ga0207711_10259611 3300025941 Bacteria 1596
460 Ga0207711_10286625 3300025941 Bacteria 1517
461 Ga0207689_10001032 3300025942 Bacteria 26745
462 Ga0207689_10002117 3300025942 Bacteria 18668
463 Ga0207689_10065242 3300025942 Bacteria 2995
464 Ga0207661_10017104 3300025944 Bacteria 5358
465 Ga0207661_10018752 3300025944 Bacteria 5146
466 Ga0207661_10036158 3300025944 Bacteria 3853
467 Ga0207679_10102626 3300025945 Bacteria 2240
468 Ga0207679_10140197 3300025945 Bacteria 1953
469 Ga0207679_10193460 3300025945 Bacteria 1693
470 Ga0207679_10312573 3300025945 Bacteria 1358
471 Ga0207667_10000695 3300025949 Bacteria 43623
472 Ga0207667_10045339 3300025949 Bacteria 4657
473 Ga0207667_10078040 3300025949 Bacteria 3433
474 Ga0207667_10090833 3300025949 Bacteria 3156
475 Ga0207667_10102682 3300025949 Bacteria 2949
476 Ga0207667_10103927 3300025949 Bacteria 2930
477 Ga0207651_10004079 3300025960 Bacteria 7281
478 Ga0207651_10107656 3300025960 Bacteria 2084
479 Ga0207712_10020564 3300025961 Bacteria 4324
480 Ga0207712_10109912 3300025961 Bacteria 2066
481 Ga0207668_10002227 3300025972 Bacteria 11308
482 Ga0207668_10043366 3300025972 Bacteria 3052
483 Ga0207668_10084965 3300025972 Bacteria 2307
484 Ga0207668_10299720 3300025972 Bacteria 1326
485 Ga0207640_10019508 3300025981 Bacteria 4007
486 Ga0207640_10053481 3300025981 Bacteria 2636
487 Ga0207640_10157753 3300025981 Bacteria 1675
488 Ga0207658_10004931 3300025986 Bacteria 9207
489 Ga0207658_10038002 3300025986 Bacteria 3465
490 Ga0207658_10088674 3300025986 Bacteria 2392
491 Ga0207658_10091307 3300025986 Bacteria 2362
492 Ga0207677_10018849 3300026023 Bacteria 4153
493 Ga0207677_10027954 3300026023 Bacteria 3561
494 Ga0207677_10046392 3300026023 Bacteria 2909
495 Ga0207677_10169547 3300026023 Bacteria 1705
496 Ga0207677_10191917 3300026023 Bacteria 1616
497 Ga0207677_10242241 3300026023 Bacteria 1460
498 Ga0207677_10257000 3300026023 Bacteria 1422
499 Ga0207703_10007505 3300026035 Bacteria 8656
500 Ga0207703_10124736 3300026035 Bacteria 2215
501 Ga0207639_10006291 3300026041 Bacteria 8064
502 Ga0207639_10366357 3300026041 Bacteria 1291
503 Ga0207678_10003850 3300026067 Bacteria 13493
504 Ga0207678_10076204 3300026067 Bacteria 2873
505 Ga0207678_10103157 3300026067 Bacteria 2435
506 Ga0207678_10104869 3300026067 Bacteria 2412
507 Ga0207678_10114463 3300026067 Bacteria 2301
508 Ga0207678_10126265 3300026067 Bacteria 2182
509 Ga0207678_10189349 3300026067 Bacteria 1758
510 Ga0207702_10000005 3300026078 Bacteria 420296
511 Ga0207702_10000178 3300026078 Bacteria 76683
512 Ga0207702_10076553 3300026078 Bacteria 2892
513 Ga0207702_10270508 3300026078 Bacteria 1603
514 Ga0207702_10357095 3300026078 Bacteria 1400
515 Ga0207641_10013613 3300026088 Bacteria 6671
516 Ga0207641_10078085 3300026088 Bacteria 2867
517 Ga0207641_10088791 3300026088 Bacteria 2700
518 Ga0207648_10004696 3300026089 Bacteria 13969
519 Ga0207648_10013227 3300026089 Bacteria 7688
520 Ga0207648_10050348 3300026089 Bacteria 3642
521 Ga0207648_10208020 3300026089 Bacteria 1736
522 Ga0207648_10594117 3300026089 Bacteria 1020
523 Ga0207676_10001747 3300026095 Bacteria 15971
524 Ga0207676_10007631 3300026095 Bacteria 7679
525 Ga0207676_10030686 3300026095 Bacteria 4037
526 Ga0207676_10069332 3300026095 Bacteria 2823
527 Ga0207674_10000396 3300026116 Bacteria 56376
528 Ga0207674_10034959 3300026116 Bacteria 5248
529 Ga0207674_10042203 3300026116 Bacteria 4713
530 Ga0207674_10143664 3300026116 Bacteria 2345
531 Ga0207674_10347269 3300026116 Bacteria 1434
532 Ga0207675_100017442 3300026118 Bacteria 6702
533 Ga0207675_100047402 3300026118 Bacteria 4012
534 Ga0207675_100085004 3300026118 Bacteria 2969
535 Ga0207675_100198107 3300026118 Bacteria 1928
536 Ga0207675_100517029 3300026118 Bacteria 1190
537 Ga0207683_10006461 3300026121 Bacteria 10034
538 Ga0207683_10012473 3300026121 Bacteria 7251
539 Ga0207683_10069174 3300026121 Bacteria 3118
540 Ga0207683_10069873 3300026121 Bacteria 3102
541 Ga0207683_10082355 3300026121 Bacteria 2859
542 Ga0207683_10125511 3300026121 Bacteria 2306
543 Ga0207683_10251250 3300026121 Bacteria 1614
544 Ga0207683_10285121 3300026121 Bacteria 1510
545 Ga0207698_10017296 3300026142 Bacteria 4888
546 Ga0207698_10033941 3300026142 Bacteria 3713
547 Ga0207698_10098832 3300026142 Bacteria 2412
548 Ga0207698_10149306 3300026142 Bacteria 2026
549 Ga0207698_10403756 3300026142 Bacteria 1307
550 Ga0207698_10419125 3300026142 Bacteria 1284
551 Ga0209589_1000023 3300027357 Bacteria 177856
552 Ga0209489_100032 3300027361 Bacteria 177856
553 Ga0209700_100040 3300027363 Bacteria 177856
554 Ga0209179_1001602 3300027512 Bacteria 2833
555 Ga0209813_10000922 3300027866 Bacteria 6610
556 Ga0268266_10003342 3300028379 Bacteria 16063
557 Ga0268266_10006607 3300028379 Bacteria 10586
558 Ga0268266_10009629 3300028379 Bacteria 8496
559 Ga0268266_10057820 3300028379 Bacteria 3337
560 Ga0268266_10104298 3300028379 Bacteria 2503
561 Ga0268266_10251779 3300028379 Bacteria 1634
562 Ga0268265_10012963 3300028380 Bacteria 5660
563 Ga0268265_10015854 3300028380 Bacteria 5168
564 Ga0268265_10061792 3300028380 Bacteria 2876
565 Ga0268265_10087123 3300028380 Bacteria 2484
566 Ga0268265_10137183 3300028380 Bacteria 2042
567 Ga0268264_10000022 3300028381 Bacteria 476624
568 Ga0268264_10005591 3300028381 Bacteria 10650
569 Ga0268264_10059201 3300028381 Bacteria 3209
570 Ga0268264_10089122 3300028381 Bacteria 2656
571 Ga0268264_10483887 3300028381 Bacteria 1204
572 Ga0265336_10004089 3300028666 Bacteria 5558
573 Ga0307517_10005009 3300028786 Bacteria 20143
574 Ga0307515_10051754 3300028794 Bacteria 6112
575 Ga0265338_10003088 3300028800 Bacteria 23887
576 Ga0265324_10024421 3300029957 Bacteria 2146
577 Ga0265330_10005670 3300031235 Bacteria 6209
578 Ga0265332_10000824 3300031238 Bacteria 18837
579 Ga0265328_10004314 3300031239 Bacteria 6181
580 Ga0265325_10072205 3300031241 Bacteria 1730
581 Ga0265339_10004830 3300031249 Bacteria 9111
582 Ga0265331_10000237 3300031250 Bacteria 66600
583 Ga0265331_10000305 3300031250 Bacteria 53782
584 Ga0265327_10000458 3300031251 Bacteria 73095
585 Ga0265327_10000517 3300031251 Bacteria 66613
586 Ga0265327_10004446 3300031251 Bacteria 12401
587 Ga0307509_10085539 3300031507 Bacteria 3245
588 Ga0307408_100185278 3300031548 Bacteria 1673
589 Ga0307508_10000009 3300031616 Bacteria 256966
590 Ga0307508_10054636 3300031616 Bacteria 3540
591 Ga0307508_10099280 3300031616 Bacteria 2505
592 Ga0265314_10068903 3300031711 Bacteria 2376
593 Ga0265314_10131972 3300031711 Bacteria 1557
594 Ga0265342_10005456 3300031712 Bacteria 9684
595 Ga0265342_10031924 3300031712 Bacteria 3251
596 Ga0307516_10029403 3300031730 Bacteria 5556
597 Ga0307516_10100895 3300031730 Bacteria 2702
598 Ga0307516_10335265 3300031730 Bacteria 1180
599 Ga0307410_10195367 3300031852 Bacteria 1541
600 Ga0307406_10068657 3300031901 Bacteria 2315
601 Ga0307409_100244992 3300031995 Bacteria 1634
602 Ga0307416_100291661 3300032002 Bacteria 1615
603 Ga0307415_100091229 3300032126 Bacteria 2206
604 Ga0307415_100130845 3300032126 Bacteria 1899
605 Ga0307510_10021690 3300033180 Bacteria 7481
606 Ga0307510_10044918 3300033180 Bacteria 4778
607 Ga0307510_10123424 3300033180 Bacteria 2287
608 Ga0315911_1000001 3300033442 Bacteria 1088602
609 Ga0373926_0016472 3300035083 Bacteria 2529
610 Ga0373944_0026414 3300035089 Bacteria 1715
611 Ga0373952_0021323 3300035092 Bacteria 1367
612 Ga0373923_0005783 3300035111 Bacteria 4222
613 Ga0373936_0007012 3300035113 Bacteria 4241
614 Ga0373936_0011048 3300035113 Bacteria 3413
615 Ga0373936_0027480 3300035113 Bacteria 2232
616 Ga0373936_0028088 3300035113 Bacteria 2210
617 Ga0373953_0010957 3300035117 Bacteria 3169
618 Ga0373954_0035950 3300035118 Bacteria 2298
619 Ga0373954_0039781 3300035118 Bacteria 2189
620 Ga0373954_0104514 3300035118 Bacteria 1367
621 Ga0373957_0005054 3300035120 Bacteria 4071
622 Ga0373943_0016066 3300035170 Bacteria 3409
623 Ga0373943_0039078 3300035170 Bacteria 2284
624 Ga0373946_0129214 3300035171 Bacteria 1161
625 Ga0373955_0104290 3300035172 Bacteria 1631
626 Ga0373935_0003830 3300035692 Bacteria 8772
627 Ga0373935_0231081 3300035692 Bacteria 1288
628 Ga0373927_0020885 3300035695 Bacteria 4291
629 Ga0373927_0039408 3300035695 Bacteria 3067
630 Ga0373927_0113654 3300035695 Bacteria 1764
631 Ga0373927_0149777 3300035695 Bacteria 1528
632 Ga0373933_0000781 3300035724 Bacteria 19421
633 Ga0373933_0016755 3300035724 Bacteria 4104
634 Ga0373933_0034746 3300035724 Bacteria 2940
635 Ga0373947_0005936 3300035725 Bacteria 7117
636 Ga0373947_0012802 3300035725 Bacteria 4808
637 Ga0373947_0031330 3300035725 Bacteria 3129
638 Ga0373937_0011582 3300036401 Bacteria 7742
639 Ga0373937_0037854 3300036401 Bacteria 4396
640 Ga0373937_0073229 3300036401 Bacteria 3160
641 Ga0373937_0088438 3300036401 Bacteria 2868
642 Ga0373937_0116609 3300036401 Unclassified 2487
643 Ga0395900_0093574 3300037418 Bacteria 3087
644 Ga0395900_0360796 3300037418 Bacteria 1424
645 Ga0395898_0028162 3300037466 Bacteria 5634
646 Ga0395898_0068252 3300037466 Bacteria 3440
647 Ga0395898_0121911 3300037466 Bacteria 2498
648 Ga0395898_0152454 3300037466 Bacteria 2211
649 Ga0436364_0059037 3300037853 Bacteria 1106
650 Ga0436364_0693921 3300037853 Bacteria 5729
651 Ga0395901_0010512 3300038443 Bacteria 9373
652 Ga0395901_0041679 3300038443 Bacteria 4759
653 Ga0395901_0154216 3300038443 Bacteria 2413
654 Ga0400484_03261 3300038725 Bacteria 37196
655 Ga0400484_43122 3300038725 Bacteria 3224
656 Ga0400490_20091 3300038726 Bacteria 9857
657 Ga0400491_10244 3300038727 Bacteria 3893
658 Ga0400486_00975 3300038742 Bacteria 3104
659 Ga0400487_15725 3300039110 Bacteria 1480
660 Ga0400487_27362 3300039110 Bacteria 16177
661 Ga0436365_0189813 3300039437 Bacteria 1134
662 Ga0436365_0336775 3300039437 Bacteria 3612
663 Ga0436365_0484561 3300039437 Bacteria 5768
664 Ga0436365_0541977 3300039437 Bacteria 1735
665 Ga0436365_1003039 3300039437 Bacteria 1777
666 Ga0436360_0083451 3300039438 Bacteria 2005
667 Ga0436361_0708810 3300039447 Bacteria 1820
668 Ga0436361_1057156 3300039447 Bacteria 4137
669 Ga0436363_0149962 3300039450 Bacteria 1076
670 Ga0436363_1293231 3300039450 Bacteria 9037
671 Ga0436363_1512041 3300039450 Bacteria 5904
672 Ga0436362_0094827 3300039453 Bacteria 2097
673 Ga0451841_0161589 3300041498 Bacteria 1514
674 Ga0439445_0036880 3300042004 Bacteria 1288
675 Ga0466972_0132607 3300044658 Bacteria 1173
676 Ga0466959_0091013 3300045049 Bacteria 2191
677 Ga0466959_0121103 3300045049 Bacteria 1860
678 Ga0466967_0031972 3300045976 Bacteria 4438
679 Ga0495603_0015905 3300046455 Bacteria 4548
680 Ga0495603_0016623 3300046455 Bacteria 4452
681 Ga0495629_0000083 3300046459 Bacteria 83715
682 Ga0495629_0043397 3300046459 Bacteria 3157
683 Ga0495629_0070518 3300046459 Bacteria 2438
684 Ga0495641_0008459 3300046461 Bacteria 6269
685 Ga0495651_0015048 3300046462 Bacteria 5979
686 Ga0495651_0180024 3300046462 Bacteria 1497
687 Ga0495651_0229996 3300046462 Bacteria 1278
688 Ga0495653_0038786 3300046463 Bacteria 3737
689 Ga0495650_0048232 3300046471 Bacteria 1777
690 Ga0495580_0001769 3300046472 Bacteria 18986
691 Ga0495580_0035790 3300046472 Bacteria 3569
692 Ga0495582_0000206 3300046473 Bacteria 32664
693 Ga0495582_0038376 3300046473 Bacteria 2636
694 Ga0495639_0000167 3300046475 Bacteria 34509
695 Ga0495639_0147949 3300046475 Bacteria 1132
696 Ga0495662_0000457 3300046476 Bacteria 18414
697 Ga0495662_0106280 3300046476 Bacteria 1374
698 Ga0495664_0003502 3300046477 Bacteria 8549
699 Ga0495664_0023653 3300046477 Bacteria 3566
700 Ga0495594_0000838 3300046499 Bacteria 15872
701 Ga0495596_0035514 3300046500 Bacteria 1976
702 Ga0495606_0013130 3300046507 Bacteria 6575
703 Ga0495606_0111919 3300046507 Bacteria 1646
704 Ga0495610_0059184 3300046512 Bacteria 1830
705 Ga0495618_0014131 3300046514 Bacteria 4861
706 Ga0495618_0052279 3300046514 Bacteria 2582
707 Ga0495628_0045817 3300046516 Bacteria 3475
708 Ga0495630_0053174 3300046517 Bacteria 3032
709 Ga0495632_0084116 3300046519 Bacteria 1514
710 Ga0495632_0091564 3300046519 Bacteria 1441
711 Ga0495648_0000160 3300046524 Bacteria 80523
712 Ga0495648_0001196 3300046524 Bacteria 25992
713 Ga0495666_0029252 3300046526 Bacteria 2711
714 Ga0495666_0098796 3300046526 Bacteria 1376
715 Ga0495652_0071311 3300046529 Bacteria 2900
716 Ga0495665_0000399 3300046531 Bacteria 22087
717 Ga0495665_0017095 3300046531 Bacteria 3902
718 Ga0495640_0006041 3300046533 Bacteria 9605
719 Ga0495640_0022858 3300046533 Bacteria 4565
720 Ga0495640_0121299 3300046533 Bacteria 1699
721 Ga0495587_0049159 3300046536 Bacteria 2496
722 Ga0495645_0127101 3300046543 Bacteria 1790
723 Ga0495667_0009670 3300046559 Bacteria 6536
724 Ga0495667_0025334 3300046559 Bacteria 3997
725 Ga0495667_0157758 3300046559 Bacteria 1460
726 Ga0495656_0049430 3300046615 Bacteria 1791
727 Ga0495668_0143725 3300046616 Bacteria 1306
728 Ga0495634_0049262 3300046642 Bacteria 2833
729 Ga0495625_0267779 3300046660 Bacteria 1104
730 Ga0495635_0001363 3300046663 Bacteria 16259
731 Ga0495635_0030361 3300046663 Bacteria 3756
732 Ga0495588_0150158 3300046674 Bacteria 1232
733 Ga0495657_0018064 3300046675 Bacteria 5111
734 Ga0495657_0041184 3300046675 Bacteria 3164
735 Ga0495599_0009520 3300046678 Bacteria 5941
736 Ga0495599_0096181 3300046678 Bacteria 1847
737 Ga0495623_0055361 3300046679 Bacteria 2500
738 Ga0495623_0144693 3300046679 Bacteria 1411
739 Ga0495623_0163188 3300046679 Bacteria 1308
740 Ga0495646_0007314 3300046680 Bacteria 7014
741 Ga0495646_0015020 3300046680 Bacteria 4918
742 Ga0495658_0003680 3300046683 Bacteria 7585
743 Ga0495658_0034618 3300046683 Bacteria 2772
744 Ga0495658_0121531 3300046683 Bacteria 1580
745 Ga0495658_0152549 3300046683 Bacteria 1420
746 Ga0495669_0023373 3300046684 Bacteria 2690
747 Ga0495613_0002852 3300046689 Bacteria 12940
748 Ga0495613_0161412 3300046689 Bacteria 1594
749 Ga0495624_0000096 3300046690 Bacteria 59307
750 Ga0495670_0092353 3300046691 Bacteria 1550
751 Ga0495600_0079852 3300046809 Bacteria 2135
752 Ga0495581_0000311 3300047315 Bacteria 23901
753 Ga0495581_0027251 3300047315 Bacteria 3313
754 Ga0495604_0022802 3300047317 Bacteria 4997
755 Ga0495674_0050857 3300047319 Bacteria 3655
756 Ga0495674_0183913 3300047319 Bacteria 1739
757 Ga0495672_0009354 3300047320 Bacteria 7110
758 Ga0495672_0015084 3300047320 Bacteria 5259
759 Ga0495672_0017739 3300047320 Bacteria 4750
760 Ga0495672_0055917 3300047320 Bacteria 2300
761 Ga0495672_0104877 3300047320 Bacteria 1526
762 Ga0495676_0291284 3300047321 Bacteria 1103
763 Ga0495680_0040520 3300047322 Bacteria 3710
764 Ga0495675_0008762 3300047444 Bacteria 6280
765 Ga0495673_0074239 3300047469 Bacteria 1423
766 Ga0495681_0143834 3300047470 Bacteria 1005
767 Ga0495684_0015876 3300047471 Bacteria 5798
768 Ga0495684_0035422 3300047471 Bacteria 3828
769 Ga0495614_0021984 3300048089 Bacteria 2754
770 Ga0495615_0045850 3300048090 Bacteria 1109
771 Ga0496100_0190959 3300048903 Bacteria 1487
772 Ga0496101_0029223 3300048904 Bacteria 3855
773 Ga0496102_0001926 3300048905 Bacteria 17867
774 Ga0496102_0040079 3300048905 Bacteria 4236
775 Ga0496102_0116650 3300048905 Bacteria 2491
776 Ga0496102_0149692 3300048905 Bacteria 2192
777 Ga0496102_0492695 3300048905 Bacteria 1147
778 Ga0496103_0065835 3300048906 Bacteria 2261
779 Ga0496103_0268480 3300048906 Bacteria 1097
780 Ga0496104_0016935 3300048907 Bacteria 6630
781 Ga0496104_0050836 3300048907 Bacteria 3911
782 Ga0496105_0014383 3300048908 Bacteria 6298
783 Ga0496106_0007840 3300048909 Bacteria 7905
784 Ga0496106_0015567 3300048909 Bacteria 5625
785 Ga0496106_0189353 3300048909 Bacteria 1635
786 Ga0496106_0369476 3300048909 Bacteria 1152
787 Ga0496107_0014875 3300048910 Bacteria 5449
788 Ga0496107_0028174 3300048910 Bacteria 3991
789 Ga0496107_0117834 3300048910 Bacteria 1955
790 Ga0496108_0017540 3300048911 Bacteria 5858
791 Ga0496108_0062659 3300048911 Bacteria 3131
792 Ga0496108_0503076 3300048911 Bacteria 1058
793 Ga0496109_0048435 3300048912 Bacteria 3867
794 Ga0496109_0138834 3300048912 Bacteria 2272
795 Ga0496109_0162539 3300048912 Bacteria 2092
796 Ga0496109_0182096 3300048912 Bacteria 1973
797 Ga0496110_0020916 3300048913 Bacteria 5528
798 Ga0496110_0105745 3300048913 Bacteria 2525
799 Ga0496110_0193606 3300048913 Bacteria 1846
800 Ga0496110_0331119 3300048913 Bacteria 1387
801 Ga0496111_0029215 3300048914 Bacteria 3914
802 Ga0496111_0063294 3300048914 Bacteria 2683
803 Ga0496112_0000079 3300048915 Bacteria 64101
804 Ga0496112_0017117 3300048915 Bacteria 6805
805 Ga0496112_0041980 3300048915 Bacteria 4475
806 Ga0496112_0078172 3300048915 Bacteria 3272
807 Ga0496112_0183955 3300048915 Bacteria 2053
808 Ga0496113_0008709 3300048916 Bacteria 6624
809 Ga0496113_0009465 3300048916 Bacteria 6391
810 Ga0496113_0014956 3300048916 Bacteria 5313
811 Ga0496113_0033288 3300048916 Bacteria 3752
812 Ga0496113_0171594 3300048916 Bacteria 1718
813 Ga0496114_0025447 3300048917 Bacteria 4838
814 Ga0496114_0124677 3300048917 Bacteria 2219
815 Ga0496114_0187265 3300048917 Bacteria 1809
816 Ga0496115_0032477 3300048918 Bacteria 4117
817 Ga0496115_0036116 3300048918 Bacteria 3911
818 Ga0496115_0120255 3300048918 Bacteria 2161
819 Ga0496115_0381964 3300048918 Bacteria 1145
820 Ga0496117_0014455 3300048920 Bacteria 6799
821 Ga0496118_0023890 3300048921 Bacteria 5293
822 Ga0496118_0033952 3300048921 Bacteria 4174
823 Ga0496119_0001067 3300048922 Bacteria 34838
824 Ga0496119_0045578 3300048922 Bacteria 2747
825 Ga0496121_0000495 3300048924 Bacteria 75339
826 Ga0496121_0026710 3300048924 Bacteria 5427
827 Ga0496121_0045260 3300048924 Bacteria 3783
828 Ga0496121_0082038 3300048924 Bacteria 2550
829 Ga0496121_0088366 3300048924 Bacteria 2430
830 Ga0496121_0118639 3300048924 Bacteria 2002
831 Ga0496121_0133274 3300048924 Bacteria 1855
832 Ga0496122_0002451 3300048925 Bacteria 26250
833 Ga0496122_0091580 3300048925 Bacteria 2070
834 Ga0496123_0002729 3300048926 Bacteria 21168
835 Ga0496123_0018019 3300048926 Bacteria 5649
836 Ga0496123_0120012 3300048926 Bacteria 1482
837 Ga0496124_0032050 3300048927 Bacteria 4648
838 Ga0496125_0000756 3300048928 Bacteria 52960
839 Ga0496125_0062680 3300048928 Bacteria 2971
840 Ga0496125_0076405 3300048928 Bacteria 2586
841 Ga0496125_0086468 3300048928 Bacteria 2371
842 Ga0496126_0003586 3300048929 Bacteria 19458
843 Ga0496126_0016488 3300048929 Bacteria 7383
844 Ga0496126_0026376 3300048929 Bacteria 5572
845 Ga0496126_0028995 3300048929 Bacteria 5263
846 Ga0496126_0033722 3300048929 Bacteria 4815
847 Ga0496126_0036229 3300048929 Bacteria 4615
848 Ga0496126_0036387 3300048929 Bacteria 4603
849 Ga0496126_0042356 3300048929 Bacteria 4206
850 Ga0496126_0046139 3300048929 Bacteria 4000
851 Ga0496126_0061695 3300048929 Bacteria 3367
852 Ga0496126_0073591 3300048929 Bacteria 3037
853 Ga0496126_0079278 3300048929 Bacteria 2907
854 Ga0496126_0135859 3300048929 Bacteria 2121
855 Ga0496126_0246358 3300048929 Bacteria 1491
856 Ga0496126_0369530 3300048929 Bacteria 1170
857 Ga0501031_0019410 3300049568 Bacteria 4429
858 Ga0501031_0021878 3300049568 Bacteria 4166
859 Ga0501031_0030985 3300049568 Bacteria 3489
860 Ga0501031_0130669 3300049568 Bacteria 1641
861 Ga0501032_0000333 3300049569 Bacteria 39401
862 Ga0501032_0018351 3300049569 Bacteria 4902
863 Ga0501032_0054042 3300049569 Bacteria 2703
864 Ga0501032_0076934 3300049569 Bacteria 2221
865 Ga0501032_0133646 3300049569 Bacteria 1636
866 Ga0501033_0000313 3300049570 Bacteria 45940
867 Ga0501033_0001956 3300049570 Bacteria 17932
868 Ga0501033_0013274 3300049570 Bacteria 6277
869 Ga0501033_0041454 3300049570 Bacteria 3435
870 Ga0501033_0149987 3300049570 Bacteria 1682
871 Ga0501033_0186400 3300049570 Bacteria 1486
872 Ga0501033_0194193 3300049570 Bacteria 1452
873 Ga0501034_0000232 3300049571 Bacteria 103995
874 Ga0501034_0069629 3300049571 Bacteria 3529
875 Ga0501034_0102117 3300049571 Bacteria 2861
876 Ga0501034_0164700 3300049571 Bacteria 2186
877 Ga0501034_0298259 3300049571 Bacteria 1549
878 Ga0501036_0000032 3300049572 Bacteria 91370
879 Ga0501036_0091635 3300049572 Bacteria 2567
880 Ga0501036_0092462 3300049572 Bacteria 2555
881 Ga0501036_0195628 3300049572 Bacteria 1701
882 Ga0501036_0200944 3300049572 Bacteria 1676
883 Ga0501037_0000505 3300049573 Bacteria 31438
884 Ga0501037_0004799 3300049573 Bacteria 9829
885 Ga0501037_0079717 3300049573 Bacteria 2376
886 Ga0501037_0149999 3300049573 Bacteria 1666
887 Ga0501038_0000112 3300049574 Bacteria 68326
888 Ga0501038_0008822 3300049574 Bacteria 9248
889 Ga0501038_0013084 3300049574 Bacteria 7569
890 Ga0501038_0042838 3300049574 Bacteria 3941
891 Ga0501038_0173627 3300049574 Bacteria 1743
892 Ga0501038_0310963 3300049574 Bacteria 1234
893 Ga0501039_0000078 3300049575 Bacteria 73768
894 Ga0501039_0018886 3300049575 Bacteria 5293
895 Ga0501042_0058150 3300049578 Bacteria 2759
896 Ga0501043_0000220 3300049579 Bacteria 51696
897 Ga0501043_0014699 3300049579 Bacteria 6128
898 Ga0501043_0033825 3300049579 Bacteria 4022
899 Ga0501043_0093896 3300049579 Bacteria 2358
900 Ga0501043_0131001 3300049579 Bacteria 1965
901 Ga0501046_0000176 3300049580 Bacteria 65273
902 Ga0501046_0096951 3300049580 Bacteria 2265
903 Ga0501047_0000085 3300049581 Bacteria 118617
904 Ga0501047_0027577 3300049581 Bacteria 5471
905 Ga0501047_0029059 3300049581 Bacteria 5332
906 Ga0501048_0000246 3300049582 Bacteria 36139
907 Ga0501067_0002027 3300049583 Bacteria 11170
908 Ga0501067_0034038 3300049583 Bacteria 2827
909 Ga0501068_0011114 3300049584 Bacteria 5070
910 Ga0501070_0012856 3300049586 Bacteria 7053
911 Ga0501070_0069456 3300049586 Bacteria 2916
912 Ga0501070_0111162 3300049586 Bacteria 2264
913 Ga0501072_0012237 3300049588 Bacteria 6557
914 Ga0501072_0099188 3300049588 Bacteria 2315
915 Ga0501073_0000026 3300049589 Bacteria 124358
916 Ga0501073_0033655 3300049589 Bacteria 3648
917 Ga0501074_0000191 3300049590 Bacteria 33363
918 Ga0501074_0025625 3300049590 Bacteria 4280
919 Ga0501074_0036410 3300049590 Bacteria 3564
920 Ga0501075_0157735 3300049591 Bacteria 1731
921 Ga0501077_0124227 3300049593 Bacteria 1636
922 Ga0501079_0093595 3300049741 Bacteria 2328
923 Ga0501079_0270421 3300049741 Bacteria 1328
924 Ga0501080_0002583 3300049742 Bacteria 15858
925 Ga0501080_0013807 3300049742 Bacteria 7435
926 Ga0501080_0083779 3300049742 Bacteria 2962
927 Ga0501081_0217773 3300049743 Bacteria 1388
928 Ga0501083_0003196 3300049744 Bacteria 11410
929 Ga0501083_0012664 3300049744 Bacteria 5902
930 Ga0501035_0000760 3300049822 Bacteria 34705
931 Ga0501035_0059715 3300049822 Bacteria 3396
932 Ga0501035_0127352 3300049822 Bacteria 2222
933 Ga0501035_0171271 3300049822 Bacteria 1875
934 Ga0501035_0176718 3300049822 Bacteria 1841
935 Ga0501035_0325160 3300049822 Bacteria 1291
936 Ga0501035_0439292 3300049822 Bacteria 1081
937 Ga0501035_0441765 3300049822 Bacteria 1077
938 Ga0501035_0484716 3300049822 Bacteria 1019
939 Ga0501044_0000061 3300049823 Bacteria 133207
940 Ga0501044_0025310 3300049823 Bacteria 6289
941 Ga0501044_0043287 3300049823 Bacteria 4678
942 Ga0501044_0097109 3300049823 Bacteria 2968
943 Ga0501044_0134259 3300049823 Bacteria 2467
944 Ga0501044_0193327 3300049823 Bacteria 1996
945 Ga0501044_0248997 3300049823 Bacteria 1718
946 Ga0501045_0026450 3300049824 Bacteria 4174
947 nmdc:mga03683_18061_c1 3300050489 Bacteria 2677
948 nmdc:mga03n38_11230_c1 3300050490 Bacteria 3328
949 nmdc:mga03n38_832_c1 3300050490 Bacteria 8253
950 nmdc:mga00v17_39956_c1 3300050491 Bacteria 2812
951 nmdc:mga00v17_56350_c1 3300050491 Bacteria 2403
952 nmdc:mga0yw44_68398_c1 3300050492 Bacteria 2197
953 nmdc:mga0yw44_75400_c1 3300050492 Bacteria 2103
954 nmdc:mga0yw44_9913_c1 3300050492 Bacteria 4842
955 nmdc:mga0k408_145364_c1 3300050493 Bacteria 1411
956 nmdc:mga06z11_162667_c1 3300050494 Bacteria 1277
957 nmdc:mga06z11_47538_c1 3300050494 Bacteria 2180
958 nmdc:mga06z11_6009_c1 3300050494 Bacteria 4907
959 nmdc:mga04h51_27178_c1 3300050495 Bacteria 1776
960 nmdc:mga07m45_103305_c1 3300050496 Bacteria 1638
961 nmdc:mga07m45_38380_c1 3300050496 Bacteria 2672
962 nmdc:mga07m45_59268_c1 3300050496 Bacteria 2166
963 nmdc:mga07m45_7096_c1 3300050496 Bacteria 5705
964 nmdc:mga08y16_141983_c1 3300050511 Bacteria 2496
965 nmdc:mga08y16_155436_c1 3300050511 Bacteria 2377
966 nmdc:mga08y16_258555_c1 3300050511 Bacteria 1798
967 nmdc:mga0n895_321283_c1 3300050512 Bacteria 1569
968 nmdc:mga0rr50_67594_c1 3300050513 Bacteria 2715
969 nmdc:mga0rr50_84510_c1 3300050513 Bacteria 2457
970 nmdc:mga0sz30_27184_c1 3300050516 Bacteria 2349
971 Ga0495601_0108159 3300053077 Bacteria 1799
972 Ga0495601_0119060 3300053077 Bacteria 1714
973 Ga0495612_0091884 3300053078 Bacteria 1286
974 Ga0495612_0103586 3300053078 Bacteria 1213
975 Ga0495655_0020140 3300053083 Bacteria 1492
976 Ga0495595_0015234 3300053084 Bacteria 3276
977 Ga0495619_0033009 3300053085 Bacteria 3360
978 Ga0495619_0033668 3300053085 Bacteria 3328
979 Ga0500583_0023142 3300053092 Bacteria 2614
980 Ga0500651_0022399 3300053093 Bacteria 3945
981 Ga0500566_0000038 3300053094 Bacteria 66925
982 Ga0500640_000048 3300053095 Bacteria 18246
983 Ga0500641_0016051 3300053096 Bacteria 2785
984 Ga0500641_0056051 3300053096 Bacteria 1632
985 Ga0500650_0130967 3300053098 Bacteria 1166
986 Ga0500554_004657 3300053102 Bacteria 2925
987 Ga0500556_0000018 3300053104 Bacteria 188459
988 Ga0500556_0025875 3300053104 Bacteria 1944
989 Ga0500572_000010 3300053111 Bacteria 67071
990 Ga0500572_000687 3300053111 Bacteria 11057
991 Ga0500594_0023556 3300053118 Bacteria 1562
992 Ga0500595_000143 3300053119 Bacteria 46542
993 Ga0500595_002817 3300053119 Bacteria 8362
994 Ga0500595_007196 3300053119 Bacteria 4638
995 Ga0500595_038700 3300053119 Bacteria 1548
996 Ga0500614_001505 3300053123 Bacteria 5555
997 Ga0500642_0016098 3300053130 Bacteria 2831
998 Ga0500652_001910 3300053131 Bacteria 6276
999 Ga0500559_0000554 3300053136 Bacteria 25892
1000 Ga0500559_0002882 3300053136 Bacteria 8672
1001 Ga0500568_0001566 3300053139 Bacteria 14459
1002 Ga0500577_0000336 3300053142 Bacteria 12140
1003 Ga0500590_034029 3300053148 Bacteria 2639
1004 Ga0500603_001182 3300053150 Bacteria 6053
1005 Ga0500603_003083 3300053150 Bacteria 3597
1006 Ga0500603_044415 3300053150 Bacteria 1196
1007 Ga0500616_0000139 3300053153 Bacteria 123841
1008 Ga0500622_0005549 3300053156 Bacteria 7544
1009 Ga0500627_0078587 3300053158 Bacteria 1468
1010 Ga0500630_001647 3300053159 Bacteria 10690
1011 Ga0500638_006620 3300053162 Bacteria 4764
1012 Ga0500639_000034 3300053163 Bacteria 66994
1013 Ga0500636_0004113 3300053177 Bacteria 8223
1014 Ga0500636_0005212 3300053177 Bacteria 7396
1015 Ga0500636_0101086 3300053177 Bacteria 1639
1016 Ga0500636_0189629 3300053177 Bacteria 1096
1017 Ga0500637_0007438 3300053178 Bacteria 5475
1018 Ga0500637_0033915 3300053178 Bacteria 2853
1019 Ga0500637_0063815 3300053178 Bacteria 2112
1020 Ga0500645_013191 3300053730 Bacteria 2658
1021 Ga0500596_000711 3300053735 Bacteria 6504
1022 Ga0500601_005398 3300053737 Bacteria 1398
1023 Ga0501084_0061256 3300054114 Bacteria 3150
1024 Ga0500661_000428 3300055283 Bacteria 7774
1025 Ga0501082_0005939 3300060353 Bacteria 10588
1026 Ga0501082_0097270 3300060353 Bacteria 2544
1027 Ga0501082_0148028 3300060353 Bacteria 2039
1028 2509147206 2508501128 Bacteria 8613869
1029 2513656578 2513237096 Bacteria 8722461
1030 2513672366 2513237098 Bacteria 9902361
1031 2513691759 2513237101 Bacteria 7952346
1032 2513717519 2513237104 Bacteria 10034502
1033 2513859535 2513237137 Bacteria 9558895
1034 2513889276 2513237141 Bacteria 8496279
1035 2513917763 2513237145 Bacteria 8979722
1036 2513925781 2513237146 Bacteria 7166346
1037 2517893165 2517572143 Bacteria 9484767
1038 2524466829 2524023210 Bacteria 9029266
1039 2524537284 2524023228 Bacteria 10118060
1040 2545675516 2545555834 Bacteria 8130841
1041 2599418513 2599185170 Bacteria 7295545
1042 2644728282 2643221733 Bacteria 5690728
1043 2644746683 2643221736 Bacteria 6608466
1044 2671117799 2667528175 Bacteria 7532676
1045 2723845831 2721755755 Bacteria 8322773
1046 2728754600 2728368998 Bacteria 8720350
1047 2774868575 2773857925 Bacteria 6472445
1048 2776260387 2775506901 Bacteria 9631051
1049 2793069967 2791355197 Bacteria 8420563
1050 2793077177
1051 2838037789 2838035591 Bacteria 7166484
1052 2838662802 2838661181 Bacteria 7385261
1053 2874609523 2874604998 Bacteria 7834745
1054 2876810978 2876808645 Bacteria 8824342
1055 2879115703 2879110137 Bacteria 8907982
1056 2882460349 2882456835 Bacteria 6863978
1057 2884300190 2884298095 Bacteria 3823049
1058 2885374757 2885374607 Bacteria 8927485
1059 2885391709 2885383462 Bacteria 9473874
1060 2889040672 2889033259 Bacteria 9099371
1061 2894240583 2894232714 Bacteria 8834183
1062 2903777836 2903768456 Bacteria 9749579
1063 2904696497 2904690495 Bacteria 9412302
1064 2904702043
1065 2906617627
1066 2906640880 2906635258 Bacteria 8601019
1067 2906667859 2906660503 Bacteria 8595048
1068 2908743556 2908739725 Bacteria 8628932
1069 2908760348 2908756301 Bacteria 8864324
1070 2917700748 2917699015 Bacteria 7043791
1071 2919454675 2919450847 Bacteria 5631160
1072 2922367774 2922361189 Bacteria 7436256
1073 2922392323 2922386360 Bacteria 7017218
1074 2922429323
1075 2935634102 2935630451 Bacteria 8169952
1076 2941510993 2941507105 Bacteria 8166816
1077 2941518377 2941515067 Bacteria 8166720
1078 2941527360 2941523033 Bacteria 8169134
1079 3003669126 3003665799 Bacteria 7279786
1080 3005479491 3005474847 Bacteria 9259049
1081 641646326 641522639 Bacteria 7737025
1082 643604627 643348564 Bacteria 8839022
1083 8001849630 8001845381 Bacteria 5804942
1084 8006941657 8006933436 Bacteria 10410654
1085 8006971954 8006964411 Bacteria 8966052
1086 8006981367 8006973647 Bacteria 10679141
1087 8006990367 8006984368 Bacteria 9651211
1088 8006996411 8006994254 Bacteria 8309700
1089 8019557571 8019555841 Bacteria 9642137
1090 8019567727 8019565922 Bacteria 9639779
1091 8056674658 8056673599 Bacteria 7871253
1092 8056688546 8056681323 Bacteria 8472857
1093 8056690247 8056689827 Bacteria 6712655
1094 8057535262 8057529695 Bacteria 6306553
1095 JGI25404J52841_10007089
1096 JGI24740J21852_10006297
1097 JGI24738J21930_10011139
1098 JGI25406J46586_10000006
1099 JGI25406J46586_10015653
1100 JGI25153J46596_10004068
1101 rootH1_10137999
1102 JGI25404J52841_10000633
1103 JGI25404J52841_10009381
1104 Ga0055526_1000468
1105 Ga0055524_1000352
1106 Ga0065165_1000046
1107 Ga0070658_10025139
1108 Ga0070658_10129968
1109 Ga0070658_10338376
1110 Ga0070658_10396321
1111 Ga0070676_10010147
1112 Ga0070676_10047040
1113 Ga0070683_100053161
1114 Ga0070683_100095305
1115 Ga0070683_100241102
1116 Ga0070690_100029843
1117 Ga0070690_100096123
1118 Ga0070670_100006838
1119 Ga0070670_100177228
1120 Ga0070677_10002482
1121 Ga0068869_100002596
1122 Ga0068869_100004697
1123 Ga0068869_100206651
1124 Ga0068869_100249388
1125 Ga0070666_10063577
1126 Ga0070680_100054413
1127 Ga0070680_100063343
1128 Ga0070680_100328225
1129 Ga0070682_100172467
1130 Ga0068868_100075697
1131 Ga0068868_100089024
1132 Ga0068868_100386282
1133 Ga0070660_100003180
1134 Ga0070689_100071264
1135 Ga0070661_100336523
1136 Ga0070668_100007129
1137 Ga0070668_100010143
1138 Ga0070668_100018023
1139 Ga0070668_100045066
1140 Ga0070668_100188945
1141 Ga0070669_100009649
1142 Ga0070675_100007819
1143 Ga0070675_100086448
1144 Ga0070671_100005455
1145 Ga0070671_100013034
1146 Ga0070671_100111160
1147 Ga0070671_100231194
1148 Ga0070674_100003800
1149 Ga0070674_100034126
1150 Ga0070673_100010465
1151 Ga0070673_100124435
1152 Ga0070688_100005381
1153 Ga0070659_100011346
1154 Ga0070667_100006047
1155 Ga0070667_100006908
1156 Ga0070667_100103359
1157 Ga0070709_10000640
1158 Ga0070709_10000814
1159 Ga0070709_10011971
1160 Ga0070709_10023138
1161 Ga0070709_10034707
1162 Ga0070714_100001978
1163 Ga0070714_100018170
1164 Ga0070714_100066721
1165 Ga0070714_100070911
1166 Ga0070714_100195923
1167 Ga0070713_100001376
1168 Ga0070713_100005011
1169 Ga0070713_100006728
1170 Ga0070713_100037946
1171 Ga0070710_10000766
1172 Ga0070710_10002013
1173 Ga0070710_10005543
1174 Ga0070711_100007282
1175 Ga0070711_100014164
1176 Ga0070711_100015664
1177 Ga0070711_100016788
1178 Ga0070705_100008967
1179 Ga0070705_100198714
1180 Ga0070700_100166732
1181 Ga0070700_100194139
1182 Ga0070700_100279113
1183 Ga0070694_100190348
1184 Ga0070708_100102480
1185 Ga0070663_100022618
1186 Ga0070663_100064606
1187 Ga0070663_100168409
1188 Ga0070663_100222792
1189 Ga0070678_100044935
1190 Ga0070678_100064693
1191 Ga0070678_100107123
1192 Ga0070678_100128606
1193 Ga0070678_100153857
1194 Ga0070678_100251757
1195 Ga0070662_100087302
1196 Ga0070681_10025556
1197 Ga0070681_10038316
1198 Ga0070681_10081622
1199 Ga0070681_10162290
1200 Ga0070681_10177870
1201 Ga0070681_10203329
1202 Ga0070681_10341650
1203 Ga0068867_100005228
1204 Ga0068867_100062386
1205 Ga0068867_100087556
1206 Ga0070698_100009493
1207 Ga0070679_100014960
1208 Ga0070679_100030520
1209 Ga0070684_100019257
1210 Ga0070684_100031500
1211 Ga0070684_100096349
1212 Ga0068853_100006610
1213 Ga0068853_100020640
1214 Ga0068853_100105016
1215 Ga0068853_100197342
1216 Ga0070672_100091381
1217 Ga0070672_100189360
1218 Ga0070672_100209703
1219 Ga0070672_100319012
1220 Ga0070696_100064559
1221 Ga0070665_100008939
1222 Ga0070665_100013374
1223 Ga0070665_100057794
1224 Ga0070665_100094750
1225 Ga0070665_100214588
1226 Ga0070665_100587646
1227 Ga0070704_100172316
1228 Ga0068855_100035310
1229 Ga0068855_100036199
1230 Ga0068855_100052296
1231 Ga0068855_100096063
1232 Ga0068855_100206739
1233 Ga0068855_100241389
1234 Ga0068855_100278723
1235 Ga0068855_100704865
1236 Ga0070664_100132245
1237 Ga0070664_100137999
1238 Ga0068857_100004656
1239 Ga0068857_100015427
1240 Ga0068857_100037534
1241 Ga0068857_100046999
1242 Ga0068857_100068681
1243 Ga0068857_100071936
1244 Ga0068857_100151174
1245 Ga0068854_100003076
1246 Ga0068854_100079434
1247 Ga0068854_100080953
1248 Ga0068854_100090422
1249 Ga0068854_100146703
1250 Ga0068856_100002728
1251 Ga0068856_100009830
1252 Ga0068856_100321564
1253 Ga0070702_100127289
1254 Ga0070702_100179647
1255 Ga0068852_100002660
1256 Ga0068852_100019989
1257 Ga0068852_100053086
1258 Ga0068852_100241503
1259 Ga0068859_100008168
1260 Ga0068859_100078169
1261 Ga0068859_100084702
1262 Ga0068859_100120910
1263 Ga0068864_100000456
1264 Ga0068864_100010237
1265 Ga0068864_100081773
1266 Ga0068864_100141492
1267 Ga0068866_10082316
1268 Ga0068866_10095923
1269 Ga0068866_10104077
1270 Ga0068861_100009658
1271 Ga0068851_10002062
1272 Ga0068851_10005576
1273 Ga0068870_10008724
1274 Ga0068863_100100035
1275 Ga0068863_100162305
1276 Ga0068858_100008910
1277 Ga0068858_100145418
1278 Ga0068858_100153569
1279 Ga0068858_100163523
1280 Ga0068858_100259178
1281 Ga0068858_100282784
1282 Ga0068860_100000058
1283 Ga0068860_100008086
1284 Ga0068860_100011681
1285 Ga0068860_100018455
1286 Ga0068860_100031752
1287 Ga0068862_100008392
1288 Ga0068862_100031093
1289 Ga0068862_100035873
1290 Ga0068862_100081154
1291 Ga0081455_10001410
1292 Ga0081455_10001781
1293 Ga0081455_10004929
1294 Ga0081455_10032437
1295 Ga0081455_10036644
1296 Ga0081455_10098761
1297 Ga0081540_1002699
1298 Ga0081540_1003795
1299 Ga0081540_1005283
1300 Ga0081540_1005851
1301 Ga0081540_1008346
1302 Ga0081540_1010920
1303 Ga0081540_1022377
1304 Ga0081540_1026189
1305 Ga0081539_10000176
1306 Ga0081539_10000231
1307 Ga0081539_10024164
1308 Ga0081539_10047543
1309 Ga0081539_10104293
1310 Ga0070717_10003916
1311 Ga0070717_10038425
1312 Ga0070717_10134968
1313 Ga0070717_10197111
1314 Ga0075365_10004977
1315 Ga0075365_10069918
1316 Ga0075365_10130601
1317 Ga0075365_10139751
1318 Ga0075365_10155593
1319 Ga0075368_10009652
1320 Ga0075368_10029354
1321 Ga0075363_100009297
1322 Ga0075363_100066488
1323 Ga0075364_10023373
1324 Ga0070715_10001403
1325 Ga0070716_100004448
1326 Ga0070716_100008376
1327 Ga0070712_100087828
1328 Ga0075367_10002730
1329 Ga0075367_10064108
1330 Ga0075367_10081152
1331 Ga0075369_10110703
1332 Ga0075369_10111356
1333 Ga0097621_100004460
1334 Ga0097621_100029361
1335 Ga0075370_10017240
1336 Ga0075370_10019215
1337 Ga0075370_10033797
1338 Ga0068871_100004954
1339 Ga0068871_100050314
1340 Ga0068871_100053398
1341 Ga0068871_100195862
1342 Ga0075428_100102576
1343 Ga0075428_100177503
1344 Ga0075434_100381276
1345 Ga0075429_100327768
1346 Ga0068865_100059567
1347 Ga0097620_100008167
1348 Ga0097620_100078169
1349 Ga0097620_100084701
1350 Ga0097620_100120911
1351 Ga0099825_1025547
1352 Ga0099824_1010180
1353 Ga0099824_1013426
1354 Ga0099822_1000628
1355 Ga0099794_10094286
1356 Ga0099795_10012210
1357 Ga0105240_10016661
1358 Ga0105240_10029346
1359 Ga0105240_10086998
1360 Ga0105240_10097952
1361 Ga0105240_10176195
1362 Ga0105240_10277106
1363 Ga0105245_10050419
1364 Ga0105245_10152141
1365 Ga0105245_10169370
1366 Ga0105247_10016073
1367 Ga0105247_10068517
1368 Ga0105243_10286050
1369 Ga0105241_10009864
1370 Ga0105248_10007225
1371 Ga0105248_10016076
1372 Ga0105248_10132713
1373 Ga0105248_10432588
1374 Ga0105237_10067725
1375 Ga0105237_10113083
1376 Ga0105237_10181565
1377 Ga0105237_10274069
1378 Ga0105237_10327854
1379 Ga0105238_10002811
1380 Ga0105238_10012890
1381 Ga0105238_10029984
1382 Ga0105238_10065071
1383 Ga0105238_10089082
1384 Ga0105238_10171113
1385 Ga0105238_10444266
1386 Ga0105249_10015186
1387 Ga0105239_10024336
1388 Ga0105239_10042814
1389 Ga0105239_10062251
1390 Ga0105239_10065172
1391 Ga0105239_10117512
1392 Ga0105239_10161443
1393 Ga0105239_10189484
1394 Ga0105246_10131919
1395 Ga0105246_10147927
1396 Ga0157373_10008811
1397 Ga0157371_10005809
1398 Ga0157370_10005379
1399 Ga0157370_10038788
1400 Ga0157370_10477146
1401 Ga0157369_10004098
1402 Ga0157369_10080589
1403 Ga0157369_10088852
1404 Ga0157369_10096347
1405 Ga0171462_1011
1406 Ga0157374_10195235
1407 Ga0157374_10287723
1408 Ga0157374_10693692
1409 Ga0157378_10016765
1410 Ga0157378_10086750
1411 Ga0157378_10160370
1412 Ga0163162_10023700
1413 Ga0163162_10035737
1414 Ga0163162_10132258
1415 Ga0157375_10009213
1416 Ga0157375_10009300
1417 Ga0157375_10010588
1418 Ga0157375_10075444
1419 Ga0163163_10011827
1420 Ga0163163_10060169
1421 Ga0163163_10070835
1422 Ga0163163_10119522
1423 Ga0163163_10248806
1424 Ga0163163_10557719
1425 Ga0157380_10018325
1426 Ga0157377_10112587
1427 Ga0157379_10000246
1428 Ga0157379_10059933
1429 Ga0157376_10006054
1430 Ga0157376_10009356
1431 Ga0157376_10024704
1432 Ga0157376_10039678
1433 Ga0157376_10352139
1434 Ga0157376_10369338
1435 Ga0163161_10019421
1436 Ga0206353_11365297
1437 Ga0213874_10002910
1438 Ga0213876_10015796
1439 Ga0213876_10042552
1440 Ga0213876_10091555
1441 Ga0213875_10007779
1442 Ga0209677_101611
1443 Ga0209233_1006049
1444 Ga0209130_1000703
1445 Ga0209675_1001330
1446 Ga0209025_1000016
1447 Ga0209025_1002211
1448 Ga0209564_1000023
1449 Ga0209564_1000035
1450 Ga0209564_1008909
1451 Ga0209758_1004676
1452 Ga0209758_1014026
1453 Ga0209256_1000025
1454 Ga0207656_10020136
1455 Ga0207682_10000600
1456 Ga0207692_10001752
1457 Ga0207692_10003198
1458 Ga0207692_10064878
1459 Ga0207692_10187102
1460 Ga0207710_10016038
1461 Ga0207710_10036693
1462 Ga0207688_10030116
1463 Ga0207688_10071462
1464 Ga0207688_10099593
1465 Ga0207680_10090058
1466 Ga0207680_10090388
1467 Ga0207680_10097460
1468 Ga0207647_10011930
1469 Ga0207647_10068496
1470 Ga0207685_10003885
1471 Ga0207699_10007628
1472 Ga0207699_10015007
1473 Ga0207699_10080507
1474 Ga0207645_10004697
1475 Ga0207645_10031672
1476 Ga0207645_10047170
1477 Ga0207643_10025397
1478 Ga0207684_10450348
1479 Ga0207654_10000968
1480 Ga0207654_10004279
1481 Ga0207707_10004344
1482 Ga0207707_10103544
1483 Ga0207707_10181771
1484 Ga0207695_10003702
1485 Ga0207695_10015923
1486 Ga0207671_10024084
1487 Ga0207671_10061368
1488 Ga0207671_10202458
1489 Ga0207693_10003588
1490 Ga0207693_10019182
1491 Ga0207693_10040712
1492 Ga0207693_10049803
1493 Ga0207693_10077009
1494 Ga0207663_10002056
1495 Ga0207663_10006350
1496 Ga0207663_10061932
1497 Ga0207660_10002460
1498 Ga0207660_10012121
1499 Ga0207660_10087859
1500 Ga0207660_10205573
1501 Ga0207657_10000297
1502 Ga0207657_10002222
1503 Ga0207657_10030755
1504 Ga0207649_10305383
1505 Ga0207652_10010300
1506 Ga0207652_10015488
1507 Ga0207652_10016438
1508 Ga0207694_10001639
1509 Ga0207694_10008346
1510 Ga0207694_10046702
1511 Ga0207694_10083288
1512 Ga0207694_10123866
1513 Ga0207650_10004702
1514 Ga0207650_10139069
1515 Ga0207659_10048551
1516 Ga0207659_10191695
1517 Ga0207687_10084525
1518 Ga0207687_10115219
1519 Ga0207700_10008958
1520 Ga0207700_10039853
1521 Ga0207700_10042207
1522 Ga0207664_10010987
1523 Ga0207664_10019635
1524 Ga0207664_10056781
1525 Ga0207664_10068217
1526 Ga0207664_10079285
1527 Ga0207664_10100081
1528 Ga0207644_10006040
1529 Ga0207644_10041918
1530 Ga0207644_10085093
1531 Ga0207644_10109970
1532 Ga0207644_10231263
1533 Ga0207644_10234208
1534 Ga0207690_10010823
1535 Ga0207690_10039340
1536 Ga0207690_10092175
1537 Ga0207706_10154343
1538 Ga0207706_10283039
1539 Ga0207669_10031192
1540 Ga0207669_10049642
1541 Ga0207704_10055882
1542 Ga0207704_10083959
1543 Ga0207704_10105001
1544 Ga0207665_10000769
1545 Ga0207665_10012564
1546 Ga0207665_10089156
1547 Ga0207665_10167911
1548 Ga0207691_10008356
1549 Ga0207691_10066113
1550 Ga0207691_10086468
1551 Ga0207711_10021208
1552 Ga0207711_10043099
1553 Ga0207711_10259611
1554 Ga0207711_10286625
1555 Ga0207689_10001032
1556 Ga0207689_10002117
1557 Ga0207689_10065242
1558 Ga0207661_10017104
1559 Ga0207661_10018752
1560 Ga0207661_10036158
1561 Ga0207679_10102626
1562 Ga0207679_10140197
1563 Ga0207679_10193460
1564 Ga0207679_10312573
1565 Ga0207667_10000695
1566 Ga0207667_10045339
1567 Ga0207667_10078040
1568 Ga0207667_10090833
1569 Ga0207667_10102682
1570 Ga0207667_10103927
1571 Ga0207651_10004079
1572 Ga0207651_10107656
1573 Ga0207712_10020564
1574 Ga0207712_10109912
1575 Ga0207668_10002227
1576 Ga0207668_10043366
1577 Ga0207668_10084965
1578 Ga0207668_10299720
1579 Ga0207640_10019508
1580 Ga0207640_10053481
1581 Ga0207640_10157753
1582 Ga0207658_10004931
1583 Ga0207658_10038002
1584 Ga0207658_10088674
1585 Ga0207658_10091307
1586 Ga0207677_10018849
1587 Ga0207677_10027954
1588 Ga0207677_10046392
1589 Ga0207677_10169547
1590 Ga0207677_10191917
1591 Ga0207677_10242241
1592 Ga0207677_10257000
1593 Ga0207703_10007505
1594 Ga0207703_10124736
1595 Ga0207639_10006291
1596 Ga0207639_10366357
1597 Ga0207678_10003850
1598 Ga0207678_10076204
1599 Ga0207678_10103157
1600 Ga0207678_10104869
1601 Ga0207678_10114463
1602 Ga0207678_10126265
1603 Ga0207678_10189349
1604 Ga0207702_10000005
1605 Ga0207702_10000178
1606 Ga0207702_10076553
1607 Ga0207702_10270508
1608 Ga0207702_10357095
1609 Ga0207641_10013613
1610 Ga0207641_10078085
1611 Ga0207641_10088791
1612 Ga0207648_10004696
1613 Ga0207648_10013227
1614 Ga0207648_10050348
1615 Ga0207648_10208020
1616 Ga0207648_10594117
1617 Ga0207676_10001747
1618 Ga0207676_10007631
1619 Ga0207676_10030686
1620 Ga0207676_10069332
1621 Ga0207674_10000396
1622 Ga0207674_10034959
1623 Ga0207674_10042203
1624 Ga0207674_10143664
1625 Ga0207674_10347269
1626 Ga0207675_100017442
1627 Ga0207675_100047402
1628 Ga0207675_100085004
1629 Ga0207675_100198107
1630 Ga0207675_100517029
1631 Ga0207683_10006461
1632 Ga0207683_10012473
1633 Ga0207683_10069174
1634 Ga0207683_10069873
1635 Ga0207683_10082355
1636 Ga0207683_10125511
1637 Ga0207683_10251250
1638 Ga0207683_10285121
1639 Ga0207698_10017296
1640 Ga0207698_10033941
1641 Ga0207698_10098832
1642 Ga0207698_10149306
1643 Ga0207698_10403756
1644 Ga0207698_10419125
1645 Ga0209589_1000023
1646 Ga0209489_100032
1647 Ga0209700_100040
1648 Ga0209179_1001602
1649 Ga0209813_10000922
1650 Ga0268266_10003342
1651 Ga0268266_10006607
1652 Ga0268266_10009629
1653 Ga0268266_10057820
1654 Ga0268266_10104298
1655 Ga0268266_10251779
1656 Ga0268265_10012963
1657 Ga0268265_10015854
1658 Ga0268265_10061792
1659 Ga0268265_10087123
1660 Ga0268265_10137183
1661 Ga0268264_10000022
1662 Ga0268264_10005591
1663 Ga0268264_10059201
1664 Ga0268264_10089122
1665 Ga0268264_10483887
1666 Ga0265336_10004089
1667 Ga0307517_10005009
1668 Ga0307515_10051754
1669 Ga0265338_10003088
1670 Ga0265324_10024421
1671 Ga0265330_10005670
1672 Ga0265332_10000824
1673 Ga0265328_10004314
1674 Ga0265325_10072205
1675 Ga0265339_10004830
1676 Ga0265331_10000237
1677 Ga0265331_10000305
1678 Ga0265327_10000458
1679 Ga0265327_10000517
1680 Ga0265327_10004446
1681 Ga0307509_10085539
1682 Ga0307408_100185278
1683 Ga0307508_10000009
1684 Ga0307508_10054636
1685 Ga0307508_10099280
1686 Ga0265314_10068903
1687 Ga0265314_10131972
1688 Ga0265342_10005456
1689 Ga0265342_10031924
1690 Ga0307516_10029403
1691 Ga0307516_10100895
1692 Ga0307516_10335265
1693 Ga0307410_10195367
1694 Ga0307406_10068657
1695 Ga0307409_100244992
1696 Ga0307416_100291661
1697 Ga0307415_100091229
1698 Ga0307415_100130845
1699 Ga0307510_10021690
1700 Ga0307510_10044918
1701 Ga0307510_10123424
1702 Ga0315911_1000001
1703 Ga0373926_0016472
1704 Ga0373944_0026414
1705 Ga0373952_0021323
1706 Ga0373923_0005783
1707 Ga0373936_0007012
1708 Ga0373936_0011048
1709 Ga0373936_0027480
1710 Ga0373936_0028088
1711 Ga0373953_0010957
1712 Ga0373954_0035950
1713 Ga0373954_0039781
1714 Ga0373954_0104514
1715 Ga0373957_0005054
1716 Ga0373943_0016066
1717 Ga0373943_0039078
1718 Ga0373946_0129214
1719 Ga0373955_0104290
1720 Ga0373935_0003830
1721 Ga0373935_0231081
1722 Ga0373927_0020885
1723 Ga0373927_0039408
1724 Ga0373927_0113654
1725 Ga0373927_0149777
1726 Ga0373933_0000781
1727 Ga0373933_0016755
1728 Ga0373933_0034746
1729 Ga0373947_0005936
1730 Ga0373947_0012802
1731 Ga0373947_0031330
1732 Ga0373937_0011582
1733 Ga0373937_0037854
1734 Ga0373937_0073229
1735 Ga0373937_0088438
1736 Ga0373937_0116609
1737 Ga0395900_0093574
1738 Ga0395900_0360796
1739 Ga0395898_0028162
1740 Ga0395898_0068252
1741 Ga0395898_0121911
1742 Ga0395898_0152454
1743 Ga0436364_0059037
1744 Ga0436364_0693921
1745 Ga0395901_0010512
1746 Ga0395901_0041679
1747 Ga0395901_0154216
1748 Ga0400484_03261
1749 Ga0400484_43122
1750 Ga0400490_20091
1751 Ga0400491_10244
1752 Ga0400486_00975
1753 Ga0400487_15725
1754 Ga0400487_27362
1755 Ga0436365_0189813
1756 Ga0436365_0336775
1757 Ga0436365_0484561
1758 Ga0436365_0541977
1759 Ga0436365_1003039
1760 Ga0436360_0083451
1761 Ga0436361_0708810
1762 Ga0436361_1057156
1763 Ga0436363_0149962
1764 Ga0436363_1293231
1765 Ga0436363_1512041
1766 Ga0436362_0094827
1767 Ga0451841_0161589
1768 Ga0439445_0036880
1769 Ga0466972_0132607
1770 Ga0466959_0091013
1771 Ga0466959_0121103
1772 Ga0466967_0031972
1773 Ga0495603_0015905
1774 Ga0495603_0016623
1775 Ga0495629_0000083
1776 Ga0495629_0043397
1777 Ga0495629_0070518
1778 Ga0495641_0008459
1779 Ga0495651_0015048
1780 Ga0495651_0180024
1781 Ga0495651_0229996
1782 Ga0495653_0038786
1783 Ga0495650_0048232
1784 Ga0495580_0001769
1785 Ga0495580_0035790
1786 Ga0495582_0000206
1787 Ga0495582_0038376
1788 Ga0495639_0000167
1789 Ga0495639_0147949
1790 Ga0495662_0000457
1791 Ga0495662_0106280
1792 Ga0495664_0003502
1793 Ga0495664_0023653
1794 Ga0495594_0000838
1795 Ga0495596_0035514
1796 Ga0495606_0013130
1797 Ga0495606_0111919
1798 Ga0495610_0059184
1799 Ga0495618_0014131
1800 Ga0495618_0052279
1801 Ga0495628_0045817
1802 Ga0495630_0053174
1803 Ga0495632_0084116
1804 Ga0495632_0091564
1805 Ga0495648_0000160
1806 Ga0495648_0001196
1807 Ga0495666_0029252
1808 Ga0495666_0098796
1809 Ga0495652_0071311
1810 Ga0495665_0000399
1811 Ga0495665_0017095
1812 Ga0495640_0006041
1813 Ga0495640_0022858
1814 Ga0495640_0121299
1815 Ga0495587_0049159
1816 Ga0495645_0127101
1817 Ga0495667_0009670
1818 Ga0495667_0025334
1819 Ga0495667_0157758
1820 Ga0495656_0049430
1821 Ga0495668_0143725
1822 Ga0495634_0049262
1823 Ga0495625_0267779
1824 Ga0495635_0001363
1825 Ga0495635_0030361
1826 Ga0495588_0150158
1827 Ga0495657_0018064
1828 Ga0495657_0041184
1829 Ga0495599_0009520
1830 Ga0495599_0096181
1831 Ga0495623_0055361
1832 Ga0495623_0144693
1833 Ga0495623_0163188
1834 Ga0495646_0007314
1835 Ga0495646_0015020
1836 Ga0495658_0003680
1837 Ga0495658_0034618
1838 Ga0495658_0121531
1839 Ga0495658_0152549
1840 Ga0495669_0023373
1841 Ga0495613_0002852
1842 Ga0495613_0161412
1843 Ga0495624_0000096
1844 Ga0495670_0092353
1845 Ga0495600_0079852
1846 Ga0495581_0000311
1847 Ga0495581_0027251
1848 Ga0495604_0022802
1849 Ga0495674_0050857
1850 Ga0495674_0183913
1851 Ga0495672_0009354
1852 Ga0495672_0015084
1853 Ga0495672_0017739
1854 Ga0495672_0055917
1855 Ga0495672_0104877
1856 Ga0495676_0291284
1857 Ga0495680_0040520
1858 Ga0495675_0008762
1859 Ga0495673_0074239
1860 Ga0495681_0143834
1861 Ga0495684_0015876
1862 Ga0495684_0035422
1863 Ga0495614_0021984
1864 Ga0495615_0045850
1865 Ga0496100_0190959
1866 Ga0496101_0029223
1867 Ga0496102_0001926
1868 Ga0496102_0040079
1869 Ga0496102_0116650
1870 Ga0496102_0149692
1871 Ga0496102_0492695
1872 Ga0496103_0065835
1873 Ga0496103_0268480
1874 Ga0496104_0016935
1875 Ga0496104_0050836
1876 Ga0496105_0014383
1877 Ga0496106_0007840
1878 Ga0496106_0015567
1879 Ga0496106_0189353
1880 Ga0496106_0369476
1881 Ga0496107_0014875
1882 Ga0496107_0028174
1883 Ga0496107_0117834
1884 Ga0496108_0017540
1885 Ga0496108_0062659
1886 Ga0496108_0503076
1887 Ga0496109_0048435
1888 Ga0496109_0138834
1889 Ga0496109_0162539
1890 Ga0496109_0182096
1891 Ga0496110_0020916
1892 Ga0496110_0105745
1893 Ga0496110_0193606
1894 Ga0496110_0331119
1895 Ga0496111_0029215
1896 Ga0496111_0063294
1897 Ga0496112_0000079
1898 Ga0496112_0017117
1899 Ga0496112_0041980
1900 Ga0496112_0078172
1901 Ga0496112_0183955
1902 Ga0496113_0008709
1903 Ga0496113_0009465
1904 Ga0496113_0014956
1905 Ga0496113_0033288
1906 Ga0496113_0171594
1907 Ga0496114_0025447
1908 Ga0496114_0124677
1909 Ga0496114_0187265
1910 Ga0496115_0032477
1911 Ga0496115_0036116
1912 Ga0496115_0120255
1913 Ga0496115_0381964
1914 Ga0496117_0014455
1915 Ga0496118_0023890
1916 Ga0496118_0033952
1917 Ga0496119_0001067
1918 Ga0496119_0045578
1919 Ga0496121_0000495
1920 Ga0496121_0026710
1921 Ga0496121_0045260
1922 Ga0496121_0082038
1923 Ga0496121_0088366
1924 Ga0496121_0118639
1925 Ga0496121_0133274
1926 Ga0496122_0002451
1927 Ga0496122_0091580
1928 Ga0496123_0002729
1929 Ga0496123_0018019
1930 Ga0496123_0120012
1931 Ga0496124_0032050
1932 Ga0496125_0000756
1933 Ga0496125_0062680
1934 Ga0496125_0076405
1935 Ga0496125_0086468
1936 Ga0496126_0003586
1937 Ga0496126_0016488
1938 Ga0496126_0026376
1939 Ga0496126_0028995
1940 Ga0496126_0033722
1941 Ga0496126_0036229
1942 Ga0496126_0036387
1943 Ga0496126_0042356
1944 Ga0496126_0046139
1945 Ga0496126_0061695
1946 Ga0496126_0073591
1947 Ga0496126_0079278
1948 Ga0496126_0135859
1949 Ga0496126_0246358
1950 Ga0496126_0369530
1951 Ga0501031_0019410
1952 Ga0501031_0021878
1953 Ga0501031_0030985
1954 Ga0501031_0130669
1955 Ga0501032_0000333
1956 Ga0501032_0018351
1957 Ga0501032_0054042
1958 Ga0501032_0076934
1959 Ga0501032_0133646
1960 Ga0501033_0000313
1961 Ga0501033_0001956
1962 Ga0501033_0013274
1963 Ga0501033_0041454
1964 Ga0501033_0149987
1965 Ga0501033_0186400
1966 Ga0501033_0194193
1967 Ga0501034_0000232
1968 Ga0501034_0069629
1969 Ga0501034_0102117
1970 Ga0501034_0164700
1971 Ga0501034_0298259
1972 Ga0501036_0000032
1973 Ga0501036_0091635
1974 Ga0501036_0092462
1975 Ga0501036_0195628
1976 Ga0501036_0200944
1977 Ga0501037_0000505
1978 Ga0501037_0004799
1979 Ga0501037_0079717
1980 Ga0501037_0149999
1981 Ga0501038_0000112
1982 Ga0501038_0008822
1983 Ga0501038_0013084
1984 Ga0501038_0042838
1985 Ga0501038_0173627
1986 Ga0501038_0310963
1987 Ga0501039_0000078
1988 Ga0501039_0018886
1989 Ga0501042_0058150
1990 Ga0501043_0000220
1991 Ga0501043_0014699
1992 Ga0501043_0033825
1993 Ga0501043_0093896
1994 Ga0501043_0131001
1995 Ga0501046_0000176
1996 Ga0501046_0096951
1997 Ga0501047_0000085
1998 Ga0501047_0027577
1999 Ga0501047_0029059
2000 Ga0501048_0000246
2001 Ga0501067_0002027
2002 Ga0501067_0034038
2003 Ga0501068_0011114
2004 Ga0501070_0012856
2005 Ga0501070_0069456
2006 Ga0501070_0111162
2007 Ga0501072_0012237
2008 Ga0501072_0099188
2009 Ga0501073_0000026
2010 Ga0501073_0033655
2011 Ga0501074_0000191
2012 Ga0501074_0025625
2013 Ga0501074_0036410
2014 Ga0501075_0157735
2015 Ga0501077_0124227
2016 Ga0501079_0093595
2017 Ga0501079_0270421
2018 Ga0501080_0002583
2019 Ga0501080_0013807
2020 Ga0501080_0083779
2021 Ga0501081_0217773
2022 Ga0501083_0003196
2023 Ga0501083_0012664
2024 Ga0501035_0000760
2025 Ga0501035_0059715
2026 Ga0501035_0127352
2027 Ga0501035_0171271
2028 Ga0501035_0176718
2029 Ga0501035_0325160
2030 Ga0501035_0439292
2031 Ga0501035_0441765
2032 Ga0501035_0484716
2033 Ga0501044_0000061
2034 Ga0501044_0025310
2035 Ga0501044_0043287
2036 Ga0501044_0097109
2037 Ga0501044_0134259
2038 Ga0501044_0193327
2039 Ga0501044_0248997
2040 Ga0501045_0026450
2041 nmdc:mga03683_18061_c1
2042 nmdc:mga03n38_11230_c1
2043 nmdc:mga03n38_832_c1
2044 nmdc:mga00v17_39956_c1
2045 nmdc:mga00v17_56350_c1
2046 nmdc:mga0yw44_68398_c1
2047 nmdc:mga0yw44_75400_c1
2048 nmdc:mga0yw44_9913_c1
2049 nmdc:mga0k408_145364_c1
2050 nmdc:mga06z11_162667_c1
2051 nmdc:mga06z11_47538_c1
2052 nmdc:mga06z11_6009_c1
2053 nmdc:mga04h51_27178_c1
2054 nmdc:mga07m45_103305_c1
2055 nmdc:mga07m45_38380_c1
2056 nmdc:mga07m45_59268_c1
2057 nmdc:mga07m45_7096_c1
2058 nmdc:mga08y16_141983_c1
2059 nmdc:mga08y16_155436_c1
2060 nmdc:mga08y16_258555_c1
2061 nmdc:mga0n895_321283_c1
2062 nmdc:mga0rr50_67594_c1
2063 nmdc:mga0rr50_84510_c1
2064 nmdc:mga0sz30_27184_c1
2065 Ga0495601_0108159
2066 Ga0495601_0119060
2067 Ga0495612_0091884
2068 Ga0495612_0103586
2069 Ga0495655_0020140
2070 Ga0495595_0015234
2071 Ga0495619_0033009
2072 Ga0495619_0033668
2073 Ga0500583_0023142
2074 Ga0500651_0022399
2075 Ga0500566_0000038
2076 Ga0500640_000048
2077 Ga0500641_0016051
2078 Ga0500641_0056051
2079 Ga0500650_0130967
2080 Ga0500554_004657
2081 Ga0500556_0000018
2082 Ga0500556_0025875
2083 Ga0500572_000010
2084 Ga0500572_000687
2085 Ga0500594_0023556
2086 Ga0500595_000143
2087 Ga0500595_002817
2088 Ga0500595_007196
2089 Ga0500595_038700
2090 Ga0500614_001505
2091 Ga0500642_0016098
2092 Ga0500652_001910
2093 Ga0500559_0000554
2094 Ga0500559_0002882
2095 Ga0500568_0001566
2096 Ga0500577_0000336
2097 Ga0500590_034029
2098 Ga0500603_001182
2099 Ga0500603_003083
2100 Ga0500603_044415
2101 Ga0500616_0000139
2102 Ga0500622_0005549
2103 Ga0500627_0078587
2104 Ga0500630_001647
2105 Ga0500638_006620
2106 Ga0500639_000034
2107 Ga0500636_0004113
2108 Ga0500636_0005212
2109 Ga0500636_0101086
2110 Ga0500636_0189629
2111 Ga0500637_0007438
2112 Ga0500637_0033915
2113 Ga0500637_0063815
2114 Ga0500645_013191
2115 Ga0500596_000711
2116 Ga0500601_005398
2117 Ga0501084_0061256
2118 Ga0500661_000428
2119 Ga0501082_0005939
2120 Ga0501082_0097270
2121 Ga0501082_0148028
2122 2509147206
2123 2513656578
2124 2513672366
2125 2513691759
2126 2513717519
2127 2513859535
2128 2513889276
2129 2513917763
2130 2513925781
2131 2517893165
2132 2524466829
2133 2524537284
2134 2545675516
2135 2599418513
2136 2644728282
2137 2644746683
2138 2671117799
2139 2723845831
2140 2728754600
2141 2774868575
2142 2776260387
2143 2793069967
2144 2793077177
2145 2838037789
2146 2838662802
2147 2874609523
2148 2876810978
2149 2879115703
2150 2882460349
2151 2884300190
2152 2885374757
2153 2885391709
2154 2889040672
2155 2894240583
2156 2903777836
2157 2904696497
2158 2904702043
2159 2906617627
2160 2906640880
2161 2906667859
2162 2908743556
2163 2908760348
2164 2917700748
2165 2919454675
2166 2922367774
2167 2922392323
2168 2922429323
2169 2935634102
2170 2941510993
2171 2941518377
2172 2941527360
2173 3003669126
2174 3005479491
2175 641646326
2176 643604627
2177 8001849630
2178 8006941657
2179 8006971954
2180 8006981367
2181 8006990367
2182 8006996411
2183 8019557571
2184 8019567727
2185 8056674658
2186 8056688546
2187 8056690247
2188 8057535262

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

236

325

0.98

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

109

192

0.92

PF00108

Thiolase_N

Thiolase, N-terminal domain

36

158

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bnr-assembly1.cif.gz_A-2 e. coli fabh with small molecule inhibitor 2 0.9813 5 324
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9809 5 324
4ylt-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis 0.9783 5 324
5bnr-assembly1.cif.gz_A-2 e. coli fabh with small molecule inhibitor 2 0.9751 5 324
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9747 5 324
ID Description Score Start End Superfamily
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9846 5 172 3.40.47.10
2ebdB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9739 183 324 3.40.47.10
3il4B01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9727 5 172 3.40.47.10
af_Q2FZS0_1_313_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.972 5 324 3.40.47.10
2x3eB01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9719 5 172 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A6P1BWG9-F1-model_v4 Beta-ketoacyl-ACP synthase 3 (EC 2.3.1.180) 0.9992 1 215 GO:0004315
GO:0006633
GO:0033818
GO:0044550
AF-A0A259KT87-F1-model_v4 3-oxoacyl-ACP synthase 0.9959 3 168 GO:0004315
GO:0006633
GO:0044550
AF-A0A6P1BWG9-F1-model_v4 Beta-ketoacyl-ACP synthase 3 (EC 2.3.1.180) 0.9946 1 215 GO:0004315
GO:0006633
GO:0033818
GO:0044550
AF-A0A848YF74-F1-model_v4 Ketoacyl-ACP synthase III 0.9943 72 324 GO:0004315
GO:0005737
GO:0006633
GO:0044550
AF-A0A3B9NPJ8-F1-model_v4 3-oxoacyl-ACP synthase (EC 2.3.1.180) 0.9925 214 324 GO:0033818

Map