F489822

General Info

Members Datasets Scaffolds Average Seq Length
1088 361 1088 212

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100137328|Ga0070697_1001373282
Length 246
Sequence VGRVARVSDRGFLGRRWQRLRRAGADAGQGRAIVIERVKDAYTSEARRLASRSILGLTRTRISPNALTASGVALCAAASVLVYFEYRDELLFYWLGAGFFVIGSILDILDGALARAGGKTTPFGAFLDSTTDRVSEGFMLGAIALVFSRHADEVALAFAFAAVAGSFLVSYTRARAEALGLRGDVGIGSRAERVVVITVGLVFAPWGALPWAIYLLAATAWVTVLQRILHVRTQLRRKDSDGFEKR

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
167 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
213 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
214 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
215 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
216 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
247 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
248 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
252 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
253 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
256 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
286 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
287 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
324 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
353 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 1.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 13.79
Rhizosphere 84.83
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10003353 3300003373 Bacteria 3820
2 Ga0070683_100000847 3300005329 Bacteria 22661
3 Ga0070683_100026408 3300005329 Bacteria 5228
4 Ga0070683_100073714 3300005329 Bacteria 3187
5 Ga0070683_100087739 3300005329 Bacteria 2918
6 Ga0070683_100198472 3300005329 Bacteria 1905
7 Ga0070690_100051760 3300005330 Bacteria 2623
8 Ga0070666_10340104 3300005335 Unclassified 1072
9 Ga0070680_100005810 3300005336 Bacteria 9364
10 Ga0070680_100051747 3300005336 Bacteria 3352
11 Ga0070680_100056397 3300005336 Bacteria 3211
12 Ga0070680_100057548 3300005336 Bacteria 3178
13 Ga0070680_100085414 3300005336 Bacteria 2607
14 Ga0070680_100248904 3300005336 Bacteria 1502
15 Ga0070682_100076586 3300005337 Bacteria 2154
16 Ga0070682_100174664 3300005337 Bacteria 1496
17 Ga0070682_100479636 3300005337 Bacteria 959
18 Ga0068868_100016225 3300005338 Bacteria 5526
19 Ga0068868_100089156 3300005338 Bacteria 2483
20 Ga0070660_100011699 3300005339 Bacteria 6248
21 Ga0070660_100012668 3300005339 Bacteria 6027
22 Ga0070660_100128974 3300005339 Bacteria 2022
23 Ga0070660_100144604 3300005339 Bacteria 1909
24 Ga0070660_100425612 3300005339 Bacteria 1100
25 Ga0070660_100446182 3300005339 Bacteria 1073
26 Ga0070660_100521225 3300005339 Unclassified 990
27 Ga0070661_100061509 3300005344 Bacteria 2756
28 Ga0070661_100086063 3300005344 Bacteria 2323
29 Ga0070661_100668741 3300005344 Unclassified 844
30 Ga0070692_10058883 3300005345 Bacteria 2018
31 Ga0070668_100016085 3300005347 Bacteria 5599
32 Ga0070675_100104713 3300005354 Bacteria 2387
33 Ga0070671_100069910 3300005355 Bacteria 2928
34 Ga0070674_100134103 3300005356 Bacteria 1850
35 Ga0070673_100037073 3300005364 Bacteria 3712
36 Ga0070659_100031080 3300005366 Bacteria 4134
37 Ga0070659_100153962 3300005366 Bacteria 1876
38 Ga0070659_100221410 3300005366 Bacteria 1562
39 Ga0070659_100641945 3300005366 Unclassified 915
40 Ga0070667_100110520 3300005367 Bacteria 2383
41 Ga0070709_10181086 3300005434 Bacteria 1480
42 Ga0070714_100112927 3300005435 Bacteria 2408
43 Ga0070714_100546332 3300005435 Bacteria 1109
44 Ga0070713_100043623 3300005436 Bacteria 3667
45 Ga0070713_100269516 3300005436 Bacteria 1559
46 Ga0070710_10035305 3300005437 Bacteria 2725
47 Ga0070710_10390822 3300005437 Unclassified 930
48 Ga0070701_10034471 3300005438 Bacteria 2535
49 Ga0070711_100001144 3300005439 Bacteria 14228
50 Ga0070711_100704877 3300005439 Bacteria 850
51 Ga0070711_100790723 3300005439 Bacteria 804
52 Ga0070705_100009138 3300005440 Bacteria 4919
53 Ga0070700_100007946 3300005441 Bacteria 5757
54 Ga0070694_100025028 3300005444 Bacteria 3857
55 Ga0070708_100008860 3300005445 Bacteria 8097
56 Ga0070663_100607076 3300005455 Bacteria 921
57 Ga0070678_100045725 3300005456 Bacteria 3134
58 Ga0070678_100071581 3300005456 Bacteria 2596
59 Ga0070678_100155325 3300005456 Bacteria 1848
60 Ga0070681_10008727 3300005458 Bacteria 9945
61 Ga0070681_10013690 3300005458 Bacteria 8073
62 Ga0070681_10019935 3300005458 Bacteria 6718
63 Ga0070681_10020145 3300005458 Bacteria 6685
64 Ga0070681_10031845 3300005458 Bacteria 5293
65 Ga0070681_10046119 3300005458 Bacteria 4358
66 Ga0070681_10052560 3300005458 Bacteria 4064
67 Ga0070681_10078196 3300005458 Bacteria 3265
68 Ga0070681_10147028 3300005458 Bacteria 2285
69 Ga0070681_10221168 3300005458 Bacteria 1809
70 Ga0070681_10812478 3300005458 Bacteria 852
71 Ga0070685_10520404 3300005466 Bacteria 845
72 Ga0070706_100737313 3300005467 Bacteria 913
73 Ga0070707_100014979 3300005468 Bacteria 7276
74 Ga0070707_100349120 3300005468 Bacteria 1437
75 Ga0070698_100168661 3300005471 Bacteria 2131
76 Ga0070698_100460454 3300005471 Bacteria 1208
77 Ga0070699_100511212 3300005518 Bacteria 1092
78 Ga0070679_100017413 3300005530 Bacteria 6954
79 Ga0070679_100030040 3300005530 Bacteria 5363
80 Ga0070679_100035170 3300005530 Bacteria 4969
81 Ga0070679_100106662 3300005530 Bacteria 2787
82 Ga0070679_100111292 3300005530 Bacteria 2724
83 Ga0070679_100394017 3300005530 Bacteria 1331
84 Ga0070684_100005178 3300005535 Bacteria 9968
85 Ga0070684_100017725 3300005535 Bacteria 5852
86 Ga0070684_100208601 3300005535 Bacteria 1781
87 Ga0070684_100214626 3300005535 Bacteria 1754
88 Ga0070684_100235223 3300005535 Bacteria 1673
89 Ga0070684_100330614 3300005535 Bacteria 1400
90 Ga0070684_100503559 3300005535 Bacteria 1122
91 Ga0070697_100137328 3300005536 Bacteria 2054
92 Ga0068853_100028151 3300005539 Bacteria 4724
93 Ga0068853_100229361 3300005539 Bacteria 1698
94 Ga0068853_100489117 3300005539 Unclassified 1161
95 Ga0070695_100207014 3300005545 Bacteria 1406
96 Ga0070696_100199666 3300005546 Bacteria 1492
97 Ga0070693_100100573 3300005547 Bacteria 1761
98 Ga0070665_100040732 3300005548 Bacteria 4668
99 Ga0070665_100106594 3300005548 Bacteria 2804
100 Ga0070665_100266455 3300005548 Bacteria 1714
101 Ga0068855_100003593 3300005563 Bacteria 18943
102 Ga0068855_100011169 3300005563 Bacteria 10843
103 Ga0068855_100024835 3300005563 Bacteria 7169
104 Ga0068855_100042632 3300005563 Bacteria 5376
105 Ga0068855_100049137 3300005563 Bacteria 4976
106 Ga0068855_100196517 3300005563 Bacteria 2272
107 Ga0068855_100284095 3300005563 Bacteria 1836
108 Ga0068855_100371293 3300005563 Bacteria 1572
109 Ga0070664_100079695 3300005564 Bacteria 2820
110 Ga0068857_100087436 3300005577 Bacteria 2787
111 Ga0068854_100127321 3300005578 Bacteria 1941
112 Ga0068854_100357746 3300005578 Bacteria 1197
113 Ga0068854_100630827 3300005578 Bacteria 918
114 Ga0068856_100120281 3300005614 Bacteria 2627
115 Ga0068856_100195492 3300005614 Bacteria 2037
116 Ga0068856_100341905 3300005614 Bacteria 1515
117 Ga0068856_100967463 3300005614 Bacteria 870
118 Ga0068852_100072114 3300005616 Bacteria 3034
119 Ga0068852_100356913 3300005616 Unclassified 1429
120 Ga0068852_100481222 3300005616 Bacteria 1234
121 Ga0068866_10003857 3300005718 Bacteria 6153
122 Ga0068861_100024794 3300005719 Bacteria 4342
123 Ga0068870_10155309 3300005840 Bacteria 1352
124 Ga0068858_100569595 3300005842 Bacteria 1097
125 Ga0068860_100139091 3300005843 Bacteria 2333
126 Ga0068862_100342030 3300005844 Bacteria 1386
127 Ga0081455_10141099 3300005937 Unclassified 1871
128 Ga0081538_10002124 3300005981 Bacteria 19751
129 Ga0081539_10001192 3300005985 Bacteria 46924
130 Ga0070717_10050873 3300006028 Bacteria 3408
131 Ga0070717_10333750 3300006028 Bacteria 1353
132 Ga0075365_10021647 3300006038 Bacteria 4014
133 Ga0075365_10233816 3300006038 Unclassified 1291
134 Ga0075364_10065715 3300006051 Bacteria 2381
135 Ga0075432_10031194 3300006058 Bacteria 1845
136 Ga0075432_10068553 3300006058 Bacteria 1272
137 Ga0070715_10141881 3300006163 Unclassified 1168
138 Ga0070712_100197026 3300006175 Bacteria 1580
139 Ga0070712_100409100 3300006175 Bacteria 1122
140 Ga0070712_100629141 3300006175 Bacteria 910
141 Ga0075366_10148581 3300006195 Unclassified 1418
142 Ga0097621_100011723 3300006237 Bacteria 6472
143 Ga0097621_100180783 3300006237 Bacteria 1822
144 Ga0097621_100249110 3300006237 Bacteria 1555
145 Ga0068871_100026438 3300006358 Bacteria 4528
146 Ga0075428_100281741 3300006844 Bacteria 1788
147 Ga0075428_100583806 3300006844 Bacteria 1194
148 Ga0075428_100942740 3300006844 Unclassified 915
149 Ga0075430_100105604 3300006846 Bacteria 2350
150 Ga0075431_100353481 3300006847 Bacteria 1477
151 Ga0075433_10008761 3300006852 Bacteria 8073
152 Ga0075433_10233798 3300006852 Bacteria 1632
153 Ga0075433_10864939 3300006852 Bacteria 789
154 Ga0075434_100126426 3300006871 Bacteria 2573
155 Ga0075434_100359177 3300006871 Bacteria 1478
156 Ga0075434_100852607 3300006871 Unclassified 926
157 Ga0075434_100968584 3300006871 Bacteria 865
158 Ga0068865_100049045 3300006881 Bacteria 2908
159 Ga0075436_100013785 3300006914 Bacteria 5536
160 Ga0075435_100002153 3300007076 Bacteria 12981
161 Ga0075435_100005538 3300007076 Bacteria 8832
162 Ga0075435_100490375 3300007076 Bacteria 1062
163 Ga0105240_10045516 3300009093 Bacteria 5565
164 Ga0105240_10231006 3300009093 Bacteria 2150
165 Ga0105240_10437930 3300009093 Bacteria 1465
166 Ga0111539_10556351 3300009094 Bacteria 1336
167 Ga0111539_10815293 3300009094 Unclassified 1086
168 Ga0105245_10006098 3300009098 Bacteria 10598
169 Ga0105245_10020362 3300009098 Bacteria 5818
170 Ga0105245_10093166 3300009098 Bacteria 2775
171 Ga0105245_10123267 3300009098 Bacteria 2423
172 Ga0105245_10536150 3300009098 Bacteria 1191
173 Ga0105245_10572165 3300009098 Unclassified 1154
174 Ga0105245_11246535 3300009098 Bacteria 792
175 Ga0105247_10104196 3300009101 Bacteria 1817
176 Ga0114129_10010920 3300009147 Bacteria 12939
177 Ga0114129_10026913 3300009147 Bacteria 8141
178 Ga0114129_10084015 3300009147 Bacteria 4421
179 Ga0114129_10102347 3300009147 Bacteria 3961
180 Ga0114129_10173306 3300009147 Bacteria 2940
181 Ga0114129_10300988 3300009147 Bacteria 2137
182 Ga0114129_10531756 3300009147 Bacteria 1531
183 Ga0114129_11043703 3300009147 Bacteria 1027
184 Ga0105243_10003921 3300009148 Bacteria 11874
185 Ga0105242_10062210 3300009176 Bacteria 3071
186 Ga0105242_10107249 3300009176 Bacteria 2375
187 Ga0105242_11039328 3300009176 Bacteria 829
188 Ga0105248_10340525 3300009177 Bacteria 1689
189 Ga0105248_10412913 3300009177 Unclassified 1520
190 Ga0105248_10516646 3300009177 Bacteria 1347
191 Ga0105248_10597848 3300009177 Bacteria 1245
192 Ga0105248_11753928 3300009177 Unclassified 704
193 Ga0105237_10115359 3300009545 Bacteria 2679
194 Ga0105237_10508886 3300009545 Bacteria 1211
195 Ga0105238_10026868 3300009551 Bacteria 5867
196 Ga0105238_10042715 3300009551 Bacteria 4589
197 Ga0105249_10003964 3300009553 Bacteria 12771
198 Ga0105249_10615190 3300009553 Unclassified 1142
199 Ga0105239_10104874 3300010375 Bacteria 3130
200 Ga0105239_10145120 3300010375 Bacteria 2646
201 Ga0105239_10373664 3300010375 Bacteria 1611
202 Ga0105239_10667147 3300010375 Bacteria 1188
203 Ga0105239_10678821 3300010375 Bacteria 1177
204 Ga0105246_10035463 3300011119 Bacteria 3335
205 Ga0157373_10064041 3300013100 Bacteria 2603
206 Ga0157371_10338406 3300013102 Bacteria 1094
207 Ga0157370_10003010 3300013104 Bacteria 20004
208 Ga0157370_10093384 3300013104 Bacteria 2823
209 Ga0157370_10109886 3300013104 Bacteria 2577
210 Ga0157370_10743713 3300013104 Bacteria 894
211 Ga0157369_10028618 3300013105 Bacteria 6166
212 Ga0157369_10071297 3300013105 Bacteria 3730
213 Ga0157369_10239499 3300013105 Bacteria 1895
214 Ga0157369_10321824 3300013105 Bacteria 1608
215 Ga0157374_10026155 3300013296 Bacteria 5248
216 Ga0157374_10242616 3300013296 Bacteria 1772
217 Ga0157374_10581480 3300013296 Bacteria 1129
218 Ga0157374_11012556 3300013296 Bacteria 850
219 Ga0157378_10068908 3300013297 Bacteria 3173
220 Ga0163162_10005877 3300013306 Bacteria 11871
221 Ga0157372_10029509 3300013307 Bacteria 5990
222 Ga0157372_10030921 3300013307 Bacteria 5859
223 Ga0157372_10047864 3300013307 Bacteria 4752
224 Ga0157372_10168880 3300013307 Bacteria 2530
225 Ga0157372_10459071 3300013307 Bacteria 1485
226 Ga0157375_11128391 3300013308 Bacteria 918
227 Ga0163163_10318191 3300014325 Bacteria 1610
228 Ga0163163_10810045 3300014325 Bacteria 1000
229 Ga0157380_10008469 3300014326 Bacteria 7346
230 Ga0157380_10298626 3300014326 Bacteria 1482
231 Ga0157380_11302672 3300014326 Bacteria 774
232 Ga0182008_10024958 3300014497 Bacteria 3040
233 Ga0157377_10613276 3300014745 Bacteria 778
234 Ga0157379_10665641 3300014968 Unclassified 975
235 Ga0157376_10007598 3300014969 Bacteria 7755
236 Ga0157376_10240750 3300014969 Bacteria 1685
237 Ga0157376_10267528 3300014969 Bacteria 1604
238 Ga0197907_10620317 3300020069 Bacteria 3831
239 Ga0197907_11022464 3300020069 Bacteria 1675
240 Ga0206356_10298171 3300020070 Bacteria 2814
241 Ga0206356_10607613 3300020070 Bacteria 1017
242 Ga0206356_11237666 3300020070 Bacteria 1233
243 Ga0206350_10077237 3300020080 Bacteria 1209
244 Ga0206354_10340070 3300020081 Bacteria 1566
245 Ga0206354_11223639 3300020081 Bacteria 1418
246 Ga0206354_11537358 3300020081 Bacteria 1776
247 Ga0206353_10480853 3300020082 Bacteria 2137
248 Ga0206353_10846342 3300020082 Bacteria 990
249 Ga0206353_11108111 3300020082 Bacteria 1033
250 Ga0213876_10039968 3300021384 Bacteria 2478
251 Ga0224712_10111683 3300022467 Bacteria 1173
252 Ga0224712_10233350 3300022467 Bacteria 845
253 Ga0207692_10276217 3300025898 Bacteria 1015
254 Ga0207642_10036145 3300025899 Bacteria 2117
255 Ga0207699_10089496 3300025906 Bacteria 1929
256 Ga0207643_10054543 3300025908 Bacteria 2272
257 Ga0207705_10006569 3300025909 Bacteria 8614
258 Ga0207705_10054207 3300025909 Bacteria 2890
259 Ga0207705_10215198 3300025909 Bacteria 1458
260 Ga0207684_10552858 3300025910 Bacteria 985
261 Ga0207654_10050233 3300025911 Bacteria 2395
262 Ga0207654_10069834 3300025911 Unclassified 2083
263 Ga0207707_10008378 3300025912 Bacteria 8972
264 Ga0207707_10013655 3300025912 Bacteria 7082
265 Ga0207707_10033202 3300025912 Bacteria 4517
266 Ga0207707_10056274 3300025912 Bacteria 3422
267 Ga0207707_10081382 3300025912 Bacteria 2827
268 Ga0207707_10166069 3300025912 Bacteria 1929
269 Ga0207707_10239464 3300025912 Bacteria 1578
270 Ga0207707_10384948 3300025912 Bacteria 1205
271 Ga0207695_10153461 3300025913 Bacteria 2240
272 Ga0207695_10376768 3300025913 Bacteria 1305
273 Ga0207671_10263148 3300025914 Bacteria 1358
274 Ga0207693_10001754 3300025915 Bacteria 19046
275 Ga0207693_10069728 3300025915 Bacteria 2751
276 Ga0207693_10146534 3300025915 Bacteria 1857
277 Ga0207693_10154209 3300025915 Bacteria 1807
278 Ga0207693_10468136 3300025915 Bacteria 984
279 Ga0207663_10041896 3300025916 Bacteria 2794
280 Ga0207663_10197041 3300025916 Bacteria 1450
281 Ga0207663_10555568 3300025916 Unclassified 898
282 Ga0207660_10007020 3300025917 Bacteria 7294
283 Ga0207660_10023010 3300025917 Bacteria 4205
284 Ga0207660_10068408 3300025917 Bacteria 2575
285 Ga0207660_10098706 3300025917 Bacteria 2179
286 Ga0207660_10123410 3300025917 Bacteria 1964
287 Ga0207660_10211296 3300025917 Bacteria 1519
288 Ga0207660_10346436 3300025917 Bacteria 1190
289 Ga0207660_10614308 3300025917 Bacteria 886
290 Ga0207662_10014548 3300025918 Bacteria 4417
291 Ga0207657_10020124 3300025919 Bacteria 6315
292 Ga0207657_10020746 3300025919 Bacteria 6201
293 Ga0207657_10025885 3300025919 Bacteria 5402
294 Ga0207657_10026725 3300025919 Bacteria 5297
295 Ga0207657_10240112 3300025919 Bacteria 1447
296 Ga0207657_10520623 3300025919 Unclassified 931
297 Ga0207649_10042138 3300025920 Bacteria 2783
298 Ga0207652_10008202 3300025921 Bacteria 8388
299 Ga0207652_10021758 3300025921 Bacteria 5296
300 Ga0207652_10043128 3300025921 Bacteria 3841
301 Ga0207652_10190191 3300025921 Bacteria 1846
302 Ga0207652_10236055 3300025921 Bacteria 1648
303 Ga0207652_10240478 3300025921 Bacteria 1632
304 Ga0207646_10011532 3300025922 Bacteria 8549
305 Ga0207646_10286850 3300025922 Bacteria 1488
306 Ga0207694_10029487 3300025924 Bacteria 4187
307 Ga0207694_10102747 3300025924 Bacteria 2266
308 Ga0207659_10072351 3300025926 Bacteria 2520
309 Ga0207687_10003480 3300025927 Bacteria 10598
310 Ga0207687_10070262 3300025927 Bacteria 2499
311 Ga0207687_10263485 3300025927 Bacteria 1375
312 Ga0207700_10000002 3300025928 Bacteria 775978
313 Ga0207700_10255815 3300025928 Bacteria 1498
314 Ga0207700_10485828 3300025928 Bacteria 1092
315 Ga0207664_10101566 3300025929 Bacteria 2377
316 Ga0207664_10112348 3300025929 Bacteria 2268
317 Ga0207664_10783000 3300025929 Bacteria 858
318 Ga0207664_10843804 3300025929 Bacteria 823
319 Ga0207644_10067873 3300025931 Bacteria 2600
320 Ga0207690_10067212 3300025932 Bacteria 2458
321 Ga0207690_10144472 3300025932 Bacteria 1757
322 Ga0207690_10381964 3300025932 Unclassified 1120
323 Ga0207706_10017688 3300025933 Bacteria 6422
324 Ga0207706_10167089 3300025933 Bacteria 1933
325 Ga0207686_10098921 3300025934 Bacteria 1943
326 Ga0207686_10172516 3300025934 Bacteria 1526
327 Ga0207709_10014190 3300025935 Bacteria 4398
328 Ga0207670_10011870 3300025936 Bacteria 5073
329 Ga0207669_10061307 3300025937 Bacteria 2311
330 Ga0207665_10014209 3300025939 Bacteria 5239
331 Ga0207665_10023137 3300025939 Bacteria 4092
332 Ga0207665_10276326 3300025939 Bacteria 1249
333 Ga0207691_10002643 3300025940 Bacteria 17505
334 Ga0207711_10271573 3300025941 Bacteria 1560
335 Ga0207661_10000646 3300025944 Bacteria 22497
336 Ga0207661_10052247 3300025944 Bacteria 3264
337 Ga0207661_10103205 3300025944 Bacteria 2399
338 Ga0207661_10237120 3300025944 Bacteria 1617
339 Ga0207679_10074293 3300025945 Bacteria 2575
340 Ga0207667_10073330 3300025949 Bacteria 3557
341 Ga0207667_10247646 3300025949 Bacteria 1823
342 Ga0207712_10004878 3300025961 Bacteria 8485
343 Ga0207712_10159907 3300025961 Bacteria 1749
344 Ga0207668_10013595 3300025972 Bacteria 5020
345 Ga0207668_10130431 3300025972 Bacteria 1919
346 Ga0207677_10021579 3300026023 Bacteria 3937
347 Ga0207677_10071251 3300026023 Bacteria 2452
348 Ga0207639_10632854 3300026041 Bacteria 989
349 Ga0207678_10443769 3300026067 Bacteria 1127
350 Ga0207708_10004755 3300026075 Bacteria 9992
351 Ga0207702_10013311 3300026078 Bacteria 6842
352 Ga0207702_10069185 3300026078 Bacteria 3034
353 Ga0207702_10871568 3300026078 Bacteria 892
354 Ga0207648_10000150 3300026089 Bacteria 70019
355 Ga0207648_10376140 3300026089 Bacteria 1284
356 Ga0207676_10472465 3300026095 Bacteria 1186
357 Ga0207674_10091516 3300026116 Bacteria 3031
358 Ga0207675_100011845 3300026118 Bacteria 8150
359 Ga0207675_100343044 3300026118 Bacteria 1462
360 Ga0207675_100355780 3300026118 Bacteria 1436
361 Ga0207683_10000131 3300026121 Bacteria 61423
362 Ga0207683_10099829 3300026121 Bacteria 2591
363 Ga0207683_10122977 3300026121 Bacteria 2331
364 Ga0207698_10079897 3300026142 Bacteria 2632
365 Ga0207698_10450766 3300026142 Bacteria 1242
366 Ga0207698_10494885 3300026142 Unclassified 1189
367 Ga0207428_10079558 3300027907 Bacteria 2563
368 Ga0207428_10299312 3300027907 Unclassified 1191
369 Ga0268266_10038991 3300028379 Bacteria 4046
370 Ga0268266_10158191 3300028379 Bacteria 2048
371 Ga0268265_10255892 3300028380 Bacteria 1554
372 Ga0268264_10427563 3300028381 Bacteria 1278
373 Ga0265334_10004404 3300028573 Bacteria 6253
374 Ga0265318_10006205 3300028577 Bacteria 5528
375 Ga0265318_10084732 3300028577 Bacteria 1169
376 Ga0265322_10007859 3300028654 Bacteria 3108
377 Ga0265322_10036811 3300028654 Bacteria 1394
378 Ga0265336_10004674 3300028666 Bacteria 5138
379 Ga0265338_10001061 3300028800 Bacteria 45726
380 Ga0265338_10002640 3300028800 Bacteria 26412
381 Ga0265338_10003129 3300028800 Bacteria 23635
382 Ga0265338_10016568 3300028800 Bacteria 8002
383 Ga0265338_10068850 3300028800 Bacteria 3046
384 Ga0265338_10071361 3300028800 Bacteria 2972
385 Ga0265338_10321404 3300028800 Unclassified 1120
386 Ga0265328_10102210 3300031239 Bacteria 1062
387 Ga0265320_10186717 3300031240 Bacteria 928
388 Ga0265320_10277778 3300031240 Bacteria 742
389 Ga0265325_10005024 3300031241 Bacteria 8231
390 Ga0265331_10027432 3300031250 Bacteria 2855
391 Ga0265327_10021489 3300031251 Bacteria 3893
392 Ga0265327_10063716 3300031251 Bacteria 1871
393 Ga0265316_10010014 3300031344 Bacteria 8671
394 Ga0265316_10047132 3300031344 Bacteria 3411
395 Ga0265316_10235790 3300031344 Bacteria 1346
396 Ga0265316_10369149 3300031344 Unclassified 1037
397 Ga0307408_100886549 3300031548 Bacteria 816
398 Ga0265313_10004905 3300031595 Bacteria 10029
399 Ga0265313_10020901 3300031595 Bacteria 3595
400 Ga0265313_10121658 3300031595 Bacteria 1138
401 Ga0265314_10004407 3300031711 Bacteria 13073
402 Ga0265342_10097441 3300031712 Bacteria 1679
403 Ga0307405_10109727 3300031731 Unclassified 1867
404 Ga0307405_10155804 3300031731 Bacteria 1612
405 Ga0307410_10697518 3300031852 Bacteria 855
406 Ga0307407_10277879 3300031903 Bacteria 1159
407 Ga0307409_100060313 3300031995 Bacteria 2958
408 Ga0307409_100238338 3300031995 Unclassified 1654
409 Ga0307409_100450650 3300031995 Bacteria 1242
410 Ga0307416_100140355 3300032002 Bacteria 2195
411 Ga0307416_100207823 3300032002 Bacteria 1864
412 Ga0307416_101084168 3300032002 Bacteria 905
413 Ga0307415_100018386 3300032126 Bacteria 4220
414 Ga0307415_100146507 3300032126 Bacteria 1811
415 Ga0373926_0014627 3300035083 Bacteria 2670
416 Ga0373944_0060343 3300035089 Bacteria 1215
417 Ga0373944_0079798 3300035089 Bacteria 1079
418 Ga0373936_0009587 3300035113 Bacteria 3648
419 Ga0373936_0016204 3300035113 Bacteria 2866
420 Ga0373939_0023376 3300035114 Bacteria 1712
421 Ga0373945_0005969 3300035116 Bacteria 3913
422 Ga0373945_0025864 3300035116 Bacteria 2042
423 Ga0373945_0110664 3300035116 Bacteria 1083
424 Ga0373953_0121954 3300035117 Bacteria 1108
425 Ga0373954_0029594 3300035118 Bacteria 2523
426 Ga0373957_0069477 3300035120 Bacteria 1375
427 Ga0373943_0000357 3300035170 Bacteria 19352
428 Ga0373943_0005270 3300035170 Bacteria 5819
429 Ga0373943_0036413 3300035170 Bacteria 2356
430 Ga0373943_0163452 3300035170 Bacteria 1214
431 Ga0373946_0024116 3300035171 Bacteria 2381
432 Ga0373946_0081016 3300035171 Bacteria 1421
433 Ga0373955_0087890 3300035172 Bacteria 1767
434 Ga0373924_0059168 3300035410 Bacteria 1600
435 Ga0373935_0048387 3300035692 Bacteria 2692
436 Ga0373935_0081654 3300035692 Bacteria 2102
437 Ga0373927_0015946 3300035695 Bacteria 4959
438 Ga0373927_0101418 3300035695 Bacteria 1872
439 Ga0373933_0012801 3300035724 Bacteria 4638
440 Ga0373947_0000467 3300035725 Bacteria 23084
441 Ga0373947_0006736 3300035725 Bacteria 6665
442 Ga0373947_0129897 3300035725 Bacteria 1607
443 Ga0373937_0031471 3300036401 Bacteria 4808
444 Ga0373937_0529716 3300036401 Bacteria 1119
445 Ga0373937_1052429 3300036401 Bacteria 762
446 Ga0373925_0011045 3300037068 Bacteria 6558
447 Ga0373925_0015591 3300037068 Bacteria 5499
448 Ga0373925_0239637 3300037068 Bacteria 1452
449 Ga0395899_0001360 3300037312 Bacteria 20970
450 Ga0395899_0010041 3300037312 Bacteria 7258
451 Ga0395899_0012131 3300037312 Bacteria 6598
452 Ga0395899_0018647 3300037312 Bacteria 5272
453 Ga0395899_0027220 3300037312 Bacteria 4312
454 Ga0395899_0056755 3300037312 Bacteria 2893
455 Ga0395899_0154798 3300037312 Bacteria 1623
456 Ga0395899_0160309 3300037312 Bacteria 1590
457 Ga0395899_0287948 3300037312 Bacteria 1115
458 Ga0395900_0002321 3300037418 Bacteria 21097
459 Ga0395900_0002916 3300037418 Bacteria 18634
460 Ga0395900_0003619 3300037418 Bacteria 16614
461 Ga0395900_0006950 3300037418 Bacteria 11741
462 Ga0395900_0008280 3300037418 Bacteria 10703
463 Ga0395900_0025335 3300037418 Bacteria 6072
464 Ga0395900_0026751 3300037418 Bacteria 5904
465 Ga0395900_0029803 3300037418 Bacteria 5601
466 Ga0395900_0118229 3300037418 Bacteria 2720
467 Ga0395900_0163100 3300037418 Bacteria 2272
468 Ga0395900_0169751 3300037418 Bacteria 2221
469 Ga0395900_0191056 3300037418 Bacteria 2077
470 Ga0395900_0204366 3300037418 Bacteria 1997
471 Ga0395900_0210549 3300037418 Bacteria 1963
472 Ga0395900_0225740 3300037418 Bacteria 1885
473 Ga0395900_0250782 3300037418 Bacteria 1771
474 Ga0395900_0260579 3300037418 Bacteria 1732
475 Ga0395900_0261714 3300037418 Bacteria 1727
476 Ga0395900_0287912 3300037418 Bacteria 1632
477 Ga0395900_0300023 3300037418 Bacteria 1593
478 Ga0395900_0318074 3300037418 Bacteria 1537
479 Ga0395900_0405916 3300037418 Bacteria 1326
480 Ga0395900_0410049 3300037418 Unclassified 1317
481 Ga0395900_0525138 3300037418 Bacteria 1131
482 Ga0395900_0590022 3300037418 Unclassified 1052
483 Ga0395900_0621409 3300037418 Bacteria 1019
484 Ga0395900_0898157 3300037418 Bacteria 809
485 Ga0395898_0002298 3300037466 Bacteria 22946
486 Ga0395898_0003164 3300037466 Bacteria 18563
487 Ga0395898_0006898 3300037466 Bacteria 12082
488 Ga0395898_0010435 3300037466 Bacteria 9710
489 Ga0395898_0030395 3300037466 Bacteria 5405
490 Ga0395898_0038637 3300037466 Bacteria 4729
491 Ga0395898_0050632 3300037466 Bacteria 4064
492 Ga0395898_0081996 3300037466 Bacteria 3109
493 Ga0395898_0089660 3300037466 Bacteria 2959
494 Ga0395898_0091570 3300037466 Bacteria 2925
495 Ga0395898_0108302 3300037466 Bacteria 2664
496 Ga0395898_0147719 3300037466 Bacteria 2250
497 Ga0395898_0148534 3300037466 Bacteria 2243
498 Ga0395898_0153541 3300037466 Bacteria 2203
499 Ga0395898_0165006 3300037466 Bacteria 2118
500 Ga0395898_0197340 3300037466 Bacteria 1922
501 Ga0395898_0197360 3300037466 Bacteria 1922
502 Ga0395898_0239854 3300037466 Bacteria 1729
503 Ga0395898_0243274 3300037466 Unclassified 1716
504 Ga0395898_0272320 3300037466 Bacteria 1615
505 Ga0395898_0338657 3300037466 Bacteria 1434
506 Ga0395898_0351910 3300037466 Bacteria 1405
507 Ga0395898_0352011 3300037466 Bacteria 1404
508 Ga0395905_0002318 3300037471 Bacteria 21320
509 Ga0395905_0015483 3300037471 Bacteria 7249
510 Ga0395905_0019582 3300037471 Bacteria 6415
511 Ga0395905_0023688 3300037471 Bacteria 5796
512 Ga0395905_0026294 3300037471 Bacteria 5488
513 Ga0395905_0041514 3300037471 Bacteria 4316
514 Ga0395905_0060724 3300037471 Bacteria 3535
515 Ga0395905_0077445 3300037471 Bacteria 3116
516 Ga0395905_0081765 3300037471 Bacteria 3027
517 Ga0395905_0094392 3300037471 Bacteria 2806
518 Ga0395905_0142238 3300037471 Bacteria 2257
519 Ga0395905_0209470 3300037471 Bacteria 1826
520 Ga0395905_0523005 3300037471 Unclassified 1087
521 Ga0395901_0002740 3300038443 Bacteria 17773
522 Ga0395901_0005214 3300038443 Bacteria 13118
523 Ga0395901_0009262 3300038443 Bacteria 9984
524 Ga0395901_0009857 3300038443 Bacteria 9683
525 Ga0395901_0011266 3300038443 Bacteria 9059
526 Ga0395901_0013991 3300038443 Bacteria 8166
527 Ga0395901_0016094 3300038443 Bacteria 7619
528 Ga0395901_0016980 3300038443 Bacteria 7417
529 Ga0395901_0061225 3300038443 Bacteria 3917
530 Ga0395901_0061405 3300038443 Bacteria 3910
531 Ga0395901_0070139 3300038443 Bacteria 3651
532 Ga0395901_0070469 3300038443 Bacteria 3642
533 Ga0395901_0136266 3300038443 Bacteria 2580
534 Ga0395901_0146620 3300038443 Bacteria 2480
535 Ga0395901_0158299 3300038443 Bacteria 2379
536 Ga0395901_0162385 3300038443 Bacteria 2346
537 Ga0395901_0168495 3300038443 Bacteria 2298
538 Ga0395901_0209905 3300038443 Bacteria 2038
539 Ga0395901_0237973 3300038443 Bacteria 1899
540 Ga0395901_0286495 3300038443 Bacteria 1710
541 Ga0395901_0411832 3300038443 Bacteria 1387
542 Ga0395901_0454189 3300038443 Bacteria 1310
543 Ga0395901_0855875 3300038443 Bacteria 894
544 Ga0395901_1101423 3300038443 Bacteria 765
545 Ga0395901_1324214 3300038443 Bacteria 681
546 Ga0436365_1605333 3300039437 Bacteria 5255
547 Ga0436360_1350995 3300039438 Bacteria 1490
548 Ga0436363_0030512 3300039450 Bacteria 1147
549 Ga0436363_0225970 3300039450 Bacteria 1453
550 Ga0436363_0546918 3300039450 Bacteria 1155
551 Ga0436363_1093415 3300039450 Bacteria 1101
552 Ga0436362_1150903 3300039453 Bacteria 1279
553 Ga0439466_0067191 3300041411 Bacteria 1147
554 Ga0451800_1681006 3300041459 Bacteria 1001
555 Ga0451835_0298821 3300041492 Unclassified 809
556 Ga0439448_0045292 3300042005 Bacteria 1432
557 Ga0450890_034001 3300042127 Bacteria 735
558 Ga0466969_0124210 3300044656 Bacteria 1200
559 Ga0466965_0060374 3300044683 Bacteria 1894
560 Ga0466966_0148093 3300044684 Bacteria 1433
561 Ga0466966_0200675 3300044684 Bacteria 1207
562 Ga0466961_0079786 3300044693 Bacteria 2072
563 Ga0466961_0177642 3300044693 Bacteria 1322
564 Ga0466961_0307979 3300044693 Bacteria 967
565 Ga0466963_0003436 3300044694 Bacteria 9066
566 Ga0466963_0012752 3300044694 Bacteria 5149
567 Ga0466963_0039511 3300044694 Bacteria 3090
568 Ga0466963_0092161 3300044694 Bacteria 2065
569 Ga0466963_0147283 3300044694 Bacteria 1634
570 Ga0466963_0164462 3300044694 Bacteria 1545
571 Ga0466964_0001492 3300044706 Bacteria 8023
572 Ga0466964_0012301 3300044706 Bacteria 3238
573 Ga0466971_0006706 3300044719 Bacteria 5010
574 Ga0466971_0031883 3300044719 Bacteria 2360
575 Ga0466968_0022352 3300044735 Bacteria 2570
576 Ga0466968_0032792 3300044735 Bacteria 2162
577 Ga0466968_0051476 3300044735 Bacteria 1759
578 Ga0466957_0006475 3300044842 Bacteria 6612
579 Ga0466957_0041861 3300044842 Bacteria 2770
580 Ga0466957_0046503 3300044842 Bacteria 2635
581 Ga0466957_0070755 3300044842 Bacteria 2156
582 Ga0466957_0088618 3300044842 Bacteria 1936
583 Ga0466960_0414368 3300044901 Bacteria 778
584 Ga0466959_0030513 3300045049 Bacteria 3991
585 Ga0466959_0032895 3300045049 Bacteria 3838
586 Ga0466959_0048335 3300045049 Bacteria 3126
587 Ga0466959_0099750 3300045049 Bacteria 2079
588 Ga0466959_0246075 3300045049 Bacteria 1234
589 Ga0451576_0308746 3300045051 Bacteria 1655
590 Ga0466958_0019417 3300045836 Bacteria 3956
591 Ga0466958_0023936 3300045836 Bacteria 3590
592 Ga0466958_0036084 3300045836 Bacteria 2957
593 Ga0466958_0042828 3300045836 Bacteria 2726
594 Ga0466958_0203357 3300045836 Unclassified 1261
595 Ga0466958_0230678 3300045836 Bacteria 1182
596 Ga0466967_0016056 3300045976 Bacteria 5891
597 Ga0466967_0024467 3300045976 Bacteria 4965
598 Ga0466967_0046297 3300045976 Bacteria 3786
599 Ga0466967_0048580 3300045976 Bacteria 3706
600 Ga0466967_0049411 3300045976 Bacteria 3678
601 Ga0466967_0106537 3300045976 Bacteria 2570
602 Ga0466967_0117652 3300045976 Bacteria 2450
603 Ga0466967_0141382 3300045976 Bacteria 2242
604 Ga0466967_0149982 3300045976 Bacteria 2178
605 Ga0466967_0161988 3300045976 Bacteria 2100
606 Ga0466967_0279461 3300045976 Bacteria 1601
607 Ga0466967_0401381 3300045976 Bacteria 1334
608 Ga0466967_0439910 3300045976 Bacteria 1273
609 Ga0466967_0559536 3300045976 Bacteria 1126
610 Ga0466967_0710183 3300045976 Bacteria 996
611 Ga0466967_0775280 3300045976 Bacteria 951
612 Ga0466967_0844112 3300045976 Unclassified 910
613 Ga0495592_0041408 3300046454 Bacteria 3452
614 Ga0495592_0134647 3300046454 Bacteria 1725
615 Ga0495592_0140018 3300046454 Bacteria 1684
616 Ga0495592_0165294 3300046454 Bacteria 1519
617 Ga0495592_0181259 3300046454 Bacteria 1434
618 Ga0495603_0051830 3300046455 Bacteria 2437
619 Ga0495603_0115231 3300046455 Bacteria 1567
620 Ga0495603_0303431 3300046455 Bacteria 917
621 Ga0495590_0071372 3300046457 Bacteria 1219
622 Ga0495629_0003480 3300046459 Bacteria 11903
623 Ga0495629_0207889 3300046459 Bacteria 1352
624 Ga0495641_0001617 3300046461 Bacteria 18950
625 Ga0495641_0027802 3300046461 Bacteria 2744
626 Ga0495641_0178407 3300046461 Bacteria 951
627 Ga0495651_0003896 3300046462 Bacteria 11410
628 Ga0495651_0016883 3300046462 Bacteria 5654
629 Ga0495651_0168173 3300046462 Bacteria 1564
630 Ga0495651_0226737 3300046462 Bacteria 1289
631 Ga0495651_0521262 3300046462 Unclassified 758
632 Ga0495653_0019059 3300046463 Bacteria 5568
633 Ga0495653_0024022 3300046463 Bacteria 4917
634 Ga0495653_0027602 3300046463 Bacteria 4543
635 Ga0495653_0081821 3300046463 Bacteria 2385
636 Ga0495653_0159454 3300046463 Unclassified 1567
637 Ga0495653_0210213 3300046463 Bacteria 1314
638 Ga0495582_0000682 3300046473 Bacteria 18675
639 Ga0495582_0052285 3300046473 Bacteria 2253
640 Ga0495582_0084100 3300046473 Bacteria 1768
641 Ga0495582_0118536 3300046473 Bacteria 1490
642 Ga0495605_0114575 3300046474 Bacteria 1227
643 Ga0495639_0002305 3300046475 Bacteria 8370
644 Ga0495639_0039970 3300046475 Bacteria 2109
645 Ga0495662_0005055 3300046476 Bacteria 6607
646 Ga0495662_0252168 3300046476 Bacteria 869
647 Ga0495664_0030696 3300046477 Bacteria 3149
648 Ga0495664_0046958 3300046477 Bacteria 2562
649 Ga0495664_0082522 3300046477 Bacteria 1928
650 Ga0495664_0538116 3300046477 Bacteria 696
651 Ga0495584_0048577 3300046491 Bacteria 2139
652 Ga0495584_0160527 3300046491 Bacteria 1142
653 Ga0495585_0143385 3300046492 Bacteria 1250
654 Ga0495594_0105508 3300046499 Bacteria 1586
655 Ga0495594_0172866 3300046499 Bacteria 1229
656 Ga0495596_0156531 3300046500 Bacteria 885
657 Ga0495583_0054971 3300046506 Bacteria 1801
658 Ga0495608_0003436 3300046511 Bacteria 11343
659 Ga0495608_0016422 3300046511 Bacteria 5123
660 Ga0495608_0088444 3300046511 Bacteria 2005
661 Ga0495608_0113615 3300046511 Bacteria 1739
662 Ga0495608_0136865 3300046511 Bacteria 1565
663 Ga0495608_0147392 3300046511 Bacteria 1501
664 Ga0495608_0181152 3300046511 Bacteria 1333
665 Ga0495618_0037859 3300046514 Bacteria 3030
666 Ga0495618_0181776 3300046514 Bacteria 1336
667 Ga0495618_0221899 3300046514 Bacteria 1192
668 Ga0495628_0008643 3300046516 Bacteria 8722
669 Ga0495628_0069241 3300046516 Bacteria 2752
670 Ga0495628_0487527 3300046516 Bacteria 891
671 Ga0495630_0005888 3300046517 Bacteria 8670
672 Ga0495630_0006300 3300046517 Bacteria 8429
673 Ga0495630_0101498 3300046517 Bacteria 2176
674 Ga0495630_0131912 3300046517 Bacteria 1897
675 Ga0495630_0349475 3300046517 Bacteria 1132
676 Ga0495630_0541823 3300046517 Bacteria 892
677 Ga0495631_0125378 3300046518 Unclassified 1104
678 Ga0495644_0126602 3300046523 Bacteria 973
679 Ga0495663_0019713 3300046525 Bacteria 1933
680 Ga0495666_0110241 3300046526 Bacteria 1293
681 Ga0495642_0019012 3300046528 Bacteria 2691
682 Ga0495652_0035030 3300046529 Bacteria 4370
683 Ga0495652_0060983 3300046529 Bacteria 3185
684 Ga0495652_0081588 3300046529 Bacteria 2667
685 Ga0495652_0083524 3300046529 Bacteria 2628
686 Ga0495652_0160406 3300046529 Bacteria 1747
687 Ga0495652_0183662 3300046529 Bacteria 1602
688 Ga0495652_0240175 3300046529 Bacteria 1348
689 Ga0495665_0000111 3300046531 Bacteria 38528
690 Ga0495640_0029153 3300046533 Bacteria 3966
691 Ga0495640_0085256 3300046533 Bacteria 2093
692 Ga0495640_0185010 3300046533 Bacteria 1326
693 Ga0495586_0036367 3300046535 Bacteria 2643
694 Ga0495587_0002231 3300046536 Bacteria 12952
695 Ga0495645_0069595 3300046543 Bacteria 2540
696 Ga0495645_0095460 3300046543 Bacteria 2120
697 Ga0495667_0000965 3300046559 Bacteria 18594
698 Ga0495667_0002507 3300046559 Bacteria 12258
699 Ga0495667_0003549 3300046559 Bacteria 10479
700 Ga0495667_0024631 3300046559 Bacteria 4054
701 Ga0495667_0082540 3300046559 Bacteria 2088
702 Ga0495667_0192551 3300046559 Unclassified 1306
703 Ga0495667_0213205 3300046559 Bacteria 1234
704 Ga0495656_0009876 3300046615 Bacteria 3448
705 Ga0495656_0026348 3300046615 Bacteria 2314
706 Ga0495656_0060924 3300046615 Unclassified 1646
707 Ga0495656_0079134 3300046615 Bacteria 1479
708 Ga0495656_0088648 3300046615 Unclassified 1411
709 Ga0495634_0020937 3300046642 Bacteria 4632
710 Ga0495634_0040520 3300046642 Bacteria 3167
711 Ga0495634_0108756 3300046642 Bacteria 1784
712 Ga0495634_0137867 3300046642 Bacteria 1551
713 Ga0495634_0162315 3300046642 Bacteria 1408
714 Ga0495634_0253383 3300046642 Bacteria 1076
715 Ga0495634_0255984 3300046642 Bacteria 1069
716 Ga0495634_0278999 3300046642 Bacteria 1015
717 Ga0495634_0390613 3300046642 Bacteria 828
718 Ga0495635_0007253 3300046663 Bacteria 7747
719 Ga0495635_0075695 3300046663 Bacteria 2306
720 Ga0495635_0270692 3300046663 Unclassified 1142
721 Ga0495635_0343104 3300046663 Bacteria 997
722 Ga0495635_0645507 3300046663 Bacteria 689
723 Ga0495588_0047299 3300046674 Bacteria 2208
724 Ga0495657_0005164 3300046675 Bacteria 10341
725 Ga0495657_0029506 3300046675 Bacteria 3846
726 Ga0495657_0190178 3300046675 Bacteria 1255
727 Ga0495599_0010791 3300046678 Bacteria 5598
728 Ga0495599_0031242 3300046678 Bacteria 3343
729 Ga0495599_0035678 3300046678 Bacteria 3122
730 Ga0495623_0196912 3300046679 Bacteria 1160
731 Ga0495623_0294858 3300046679 Unclassified 898
732 Ga0495623_0367890 3300046679 Bacteria 780
733 Ga0495646_0020943 3300046680 Bacteria 4135
734 Ga0495646_0046251 3300046680 Bacteria 2654
735 Ga0495646_0057536 3300046680 Bacteria 2327
736 Ga0495646_0074492 3300046680 Bacteria 1992
737 Ga0495647_0179494 3300046681 Bacteria 920
738 Ga0495658_0000330 3300046683 Bacteria 26505
739 Ga0495658_0165748 3300046683 Bacteria 1365
740 Ga0495658_0476609 3300046683 Bacteria 798
741 Ga0495658_0501577 3300046683 Unclassified 776
742 Ga0495613_0003457 3300046689 Bacteria 11809
743 Ga0495613_0045815 3300046689 Bacteria 3234
744 Ga0495613_0073293 3300046689 Bacteria 2495
745 Ga0495613_0117075 3300046689 Bacteria 1916
746 Ga0495613_0140080 3300046689 Bacteria 1729
747 Ga0495613_0160226 3300046689 Bacteria 1601
748 Ga0495613_0185986 3300046689 Bacteria 1470
749 Ga0495613_0206527 3300046689 Bacteria 1383
750 Ga0495624_0024911 3300046690 Bacteria 3936
751 Ga0495624_0043738 3300046690 Bacteria 2856
752 Ga0495670_0268156 3300046691 Unclassified 912
753 Ga0495589_0253521 3300046794 Bacteria 822
754 Ga0495589_0341096 3300046794 Bacteria 691
755 Ga0495600_0001291 3300046809 Bacteria 13844
756 Ga0495600_0021213 3300046809 Bacteria 4159
757 Ga0495600_0052829 3300046809 Bacteria 2653
758 Ga0495600_0341491 3300046809 Unclassified 939
759 Ga0495581_0001504 3300047315 Bacteria 12978
760 Ga0495581_0030055 3300047315 Bacteria 3150
761 Ga0495581_0206064 3300047315 Bacteria 1150
762 Ga0495581_0342152 3300047315 Unclassified 873
763 Ga0495581_0370078 3300047315 Bacteria 836
764 Ga0495604_0003733 3300047317 Bacteria 12128
765 Ga0495604_0072526 3300047317 Bacteria 2601
766 Ga0495604_0094973 3300047317 Bacteria 2203
767 Ga0495604_0576289 3300047317 Unclassified 724
768 Ga0495636_0035350 3300047318 Bacteria 2058
769 Ga0495674_0021694 3300047319 Bacteria 5938
770 Ga0495674_0026937 3300047319 Bacteria 5257
771 Ga0495674_0122190 3300047319 Bacteria 2199
772 Ga0495674_0123627 3300047319 Bacteria 2185
773 Ga0495674_0138705 3300047319 Bacteria 2045
774 Ga0495674_0197027 3300047319 Bacteria 1672
775 Ga0495674_0257790 3300047319 Unclassified 1433
776 Ga0495676_0000450 3300047321 Bacteria 33719
777 Ga0495676_0036162 3300047321 Bacteria 4126
778 Ga0495676_0064124 3300047321 Bacteria 2860
779 Ga0495676_0083785 3300047321 Bacteria 2408
780 Ga0495676_0131631 3300047321 Bacteria 1805
781 Ga0495676_0184408 3300047321 Bacteria 1460
782 Ga0495680_0002908 3300047322 Bacteria 17206
783 Ga0495680_0006974 3300047322 Bacteria 10420
784 Ga0495680_0009129 3300047322 Bacteria 8949
785 Ga0495680_0009676 3300047322 Bacteria 8650
786 Ga0495680_0013899 3300047322 Bacteria 7004
787 Ga0495680_0014309 3300047322 Bacteria 6879
788 Ga0495675_0051883 3300047444 Bacteria 2604
789 Ga0495677_0131546 3300047445 Bacteria 958
790 Ga0495677_0193950 3300047445 Bacteria 789
791 Ga0495679_068180 3300047446 Bacteria 1030
792 Ga0495684_0008955 3300047471 Bacteria 7730
793 Ga0495684_0011927 3300047471 Bacteria 6702
794 Ga0495684_0017940 3300047471 Bacteria 5452
795 Ga0495684_0023917 3300047471 Bacteria 4699
796 Ga0495684_0028310 3300047471 Bacteria 4302
797 Ga0495684_0346688 3300047471 Unclassified 1055
798 Ga0495593_0008171 3300047673 Bacteria 6087
799 Ga0495593_0060508 3300047673 Bacteria 1983
800 Ga0495602_0012401 3300048088 Bacteria 8765
801 Ga0495602_0153156 3300048088 Bacteria 1809
802 Ga0495602_0220245 3300048088 Bacteria 1433
803 Ga0495602_0342804 3300048088 Bacteria 1080
804 Ga0495614_0007584 3300048089 Bacteria 4828
805 Ga0496100_0003687 3300048903 Bacteria 8017
806 Ga0496100_0004055 3300048903 Bacteria 7721
807 Ga0496100_0004256 3300048903 Bacteria 7567
808 Ga0496100_0015632 3300048903 Bacteria 4435
809 Ga0496100_0016329 3300048903 Bacteria 4358
810 Ga0496100_0025706 3300048903 Bacteria 3602
811 Ga0496100_0167753 3300048903 Unclassified 1578
812 Ga0496100_0334844 3300048903 Bacteria 1140
813 Ga0496100_0343380 3300048903 Unclassified 1126
814 Ga0496100_0425477 3300048903 Unclassified 1015
815 Ga0496100_0451708 3300048903 Unclassified 985
816 Ga0496100_0878658 3300048903 Archaea 704
817 Ga0496101_0008094 3300048904 Bacteria 6856
818 Ga0496101_0028304 3300048904 Bacteria 3911
819 Ga0496101_0053373 3300048904 Bacteria 2916
820 Ga0496101_0077655 3300048904 Bacteria 2447
821 Ga0496101_0084889 3300048904 Bacteria 2345
822 Ga0496101_0284739 3300048904 Bacteria 1292
823 Ga0496101_0458711 3300048904 Unclassified 1005
824 Ga0496101_0473043 3300048904 Archaea 989
825 Ga0496101_0653425 3300048904 Bacteria 831
826 Ga0496102_0009326 3300048905 Bacteria 8429
827 Ga0496102_0010523 3300048905 Bacteria 7964
828 Ga0496102_0024471 3300048905 Bacteria 5368
829 Ga0496102_0028507 3300048905 Bacteria 4987
830 Ga0496102_0101814 3300048905 Bacteria 2669
831 Ga0496102_0111378 3300048905 Bacteria 2552
832 Ga0496102_0219048 3300048905 Bacteria 1794
833 Ga0496102_0335817 3300048905 Unclassified 1423
834 Ga0496103_0010053 3300048906 Bacteria 5594
835 Ga0496103_0025806 3300048906 Bacteria 3553
836 Ga0496103_0045468 3300048906 Bacteria 2709
837 Ga0496103_0343184 3300048906 Bacteria 960
838 Ga0496103_0353083 3300048906 Bacteria 945
839 Ga0496104_0000617 3300048907 Bacteria 30492
840 Ga0496104_0006326 3300048907 Bacteria 10418
841 Ga0496104_0009980 3300048907 Bacteria 8478
842 Ga0496104_0020456 3300048907 Bacteria 6068
843 Ga0496104_0021027 3300048907 Bacteria 5987
844 Ga0496104_0037862 3300048907 Bacteria 4510
845 Ga0496104_0089314 3300048907 Bacteria 2944
846 Ga0496104_0310341 3300048907 Bacteria 1490
847 Ga0496104_0365388 3300048907 Unclassified 1355
848 Ga0496104_0467852 3300048907 Bacteria 1172
849 Ga0496104_1056369 3300048907 Bacteria 716
850 Ga0496105_0000147 3300048908 Bacteria 46556
851 Ga0496105_0007064 3300048908 Bacteria 8655
852 Ga0496105_0007204 3300048908 Bacteria 8586
853 Ga0496105_0052606 3300048908 Bacteria 3364
854 Ga0496105_0065718 3300048908 Bacteria 2993
855 Ga0496105_0077393 3300048908 Bacteria 2747
856 Ga0496105_0171178 3300048908 Bacteria 1780
857 Ga0496105_0307830 3300048908 Unclassified 1272
858 Ga0496105_0433390 3300048908 Bacteria 1039
859 Ga0496106_0004250 3300048909 Bacteria 10660
860 Ga0496106_0022615 3300048909 Bacteria 4672
861 Ga0496106_0047941 3300048909 Bacteria 3216
862 Ga0496106_0091766 3300048909 Bacteria 2345
863 Ga0496106_0097026 3300048909 Bacteria 2282
864 Ga0496106_0417554 3300048909 Bacteria 1078
865 Ga0496106_0475013 3300048909 Bacteria 1004
866 Ga0496107_0006798 3300048910 Bacteria 7877
867 Ga0496107_0009452 3300048910 Bacteria 6764
868 Ga0496107_0014706 3300048910 Bacteria 5479
869 Ga0496107_0017194 3300048910 Bacteria 5087
870 Ga0496107_0172596 3300048910 Bacteria 1605
871 Ga0496107_0180335 3300048910 Bacteria 1568
872 Ga0496107_0185737 3300048910 Bacteria 1544
873 Ga0496107_0282623 3300048910 Bacteria 1235
874 Ga0496107_0307822 3300048910 Unclassified 1179
875 Ga0496108_0001690 3300048911 Bacteria 17508
876 Ga0496108_0016216 3300048911 Bacteria 6075
877 Ga0496108_0065911 3300048911 Bacteria 3053
878 Ga0496108_0124059 3300048911 Bacteria 2216
879 Ga0496108_0256827 3300048911 Bacteria 1520
880 Ga0496108_0913420 3300048911 Unclassified 753
881 Ga0496109_0000576 3300048912 Bacteria 30721
882 Ga0496109_0000605 3300048912 Bacteria 29977
883 Ga0496109_0002132 3300048912 Bacteria 16461
884 Ga0496109_0003633 3300048912 Bacteria 12890
885 Ga0496109_0020405 3300048912 Bacteria 5852
886 Ga0496109_0069099 3300048912 Bacteria 3239
887 Ga0496109_0082140 3300048912 Bacteria 2969
888 Ga0496109_0109156 3300048912 Bacteria 2572
889 Ga0496109_0118720 3300048912 Bacteria 2462
890 Ga0496109_0172051 3300048912 Bacteria 2032
891 Ga0496109_0204306 3300048912 Bacteria 1857
892 Ga0496109_0271373 3300048912 Bacteria 1598
893 Ga0496109_0535479 3300048912 Bacteria 1105
894 Ga0496110_0003721 3300048913 Bacteria 11747
895 Ga0496110_0004408 3300048913 Bacteria 10902
896 Ga0496110_0024265 3300048913 Bacteria 5166
897 Ga0496110_0035220 3300048913 Bacteria 4342
898 Ga0496110_0036414 3300048913 Bacteria 4273
899 Ga0496110_0116351 3300048913 Bacteria 2407
900 Ga0496110_0181288 3300048913 Bacteria 1912
901 Ga0496110_0201241 3300048913 Bacteria 1810
902 Ga0496110_0202035 3300048913 Bacteria 1806
903 Ga0496110_0202978 3300048913 Bacteria 1801
904 Ga0496110_0211734 3300048913 Bacteria 1762
905 Ga0496110_0446840 3300048913 Bacteria 1178
906 Ga0496110_0652466 3300048913 Bacteria 952
907 Ga0496111_0001372 3300048914 Bacteria 13804
908 Ga0496111_0005287 3300048914 Bacteria 8245
909 Ga0496111_0011531 3300048914 Bacteria 5959
910 Ga0496111_0025935 3300048914 Bacteria 4136
911 Ga0496111_0045100 3300048914 Bacteria 3171
912 Ga0496111_0077649 3300048914 Bacteria 2421
913 Ga0496111_0091267 3300048914 Bacteria 2232
914 Ga0496111_0158808 3300048914 Bacteria 1678
915 Ga0496111_0186357 3300048914 Bacteria 1543
916 Ga0496111_0208968 3300048914 Bacteria 1450
917 Ga0496111_0334179 3300048914 Bacteria 1122
918 Ga0496112_0000273 3300048915 Bacteria 33471
919 Ga0496112_0009544 3300048915 Bacteria 8751
920 Ga0496112_0011211 3300048915 Bacteria 8175
921 Ga0496112_0019704 3300048915 Bacteria 6375
922 Ga0496112_0027531 3300048915 Bacteria 5481
923 Ga0496112_0108747 3300048915 Bacteria 2743
924 Ga0496112_0112468 3300048915 Bacteria 2693
925 Ga0496112_0184011 3300048915 Unclassified 2053
926 Ga0496112_0259474 3300048915 Bacteria 1687
927 Ga0496112_0478562 3300048915 Bacteria 1182
928 Ga0496112_0558889 3300048915 Bacteria 1078
929 Ga0496112_0647974 3300048915 Bacteria 986
930 Ga0496112_1084694 3300048915 Bacteria 719
931 Ga0496113_0021814 3300048916 Bacteria 4522
932 Ga0496113_0181162 3300048916 Bacteria 1670
933 Ga0496113_0343732 3300048916 Bacteria 1197
934 Ga0496113_0404965 3300048916 Unclassified 1095
935 Ga0496113_0497603 3300048916 Bacteria 979
936 Ga0496114_0002378 3300048917 Bacteria 14307
937 Ga0496114_0002771 3300048917 Bacteria 13416
938 Ga0496114_0004042 3300048917 Bacteria 11332
939 Ga0496114_0012654 3300048917 Bacteria 6758
940 Ga0496114_0021259 3300048917 Bacteria 5277
941 Ga0496114_0027028 3300048917 Bacteria 4700
942 Ga0496114_0029401 3300048917 Bacteria 4516
943 Ga0496114_0120163 3300048917 Bacteria 2259
944 Ga0496114_0164191 3300048917 Bacteria 1933
945 Ga0496114_0272143 3300048917 Bacteria 1492
946 Ga0496114_0366793 3300048917 Bacteria 1274
947 Ga0496115_0001894 3300048918 Bacteria 14979
948 Ga0496115_0005207 3300048918 Bacteria 9455
949 Ga0496115_0006368 3300048918 Bacteria 8647
950 Ga0496115_0033800 3300048918 Bacteria 4039
951 Ga0496115_0165067 3300048918 Bacteria 1831
952 Ga0496115_0214161 3300048918 Bacteria 1591
953 Ga0496115_0222658 3300048918 Bacteria 1557
954 Ga0501031_0001694 3300049568 Bacteria 13843
955 Ga0501031_0006544 3300049568 Bacteria 7597
956 Ga0501031_0073567 3300049568 Bacteria 2225
957 Ga0501032_0018156 3300049569 Bacteria 4929
958 Ga0501033_0039387 3300049570 Bacteria 3530
959 Ga0501034_0164444 3300049571 Bacteria 2188
960 Ga0501036_0002633 3300049572 Bacteria 14148
961 Ga0501036_0063805 3300049572 Bacteria 3118
962 Ga0501037_0055083 3300049573 Bacteria 2908
963 Ga0501037_0251475 3300049573 Unclassified 1237
964 Ga0501038_0010236 3300049574 Bacteria 8582
965 Ga0501039_0002091 3300049575 Bacteria 14799
966 Ga0501040_0002120 3300049576 Bacteria 12789
967 Ga0501040_0002148 3300049576 Bacteria 12729
968 Ga0501040_0101560 3300049576 Bacteria 2007
969 Ga0501041_0018181 3300049577 Bacteria 4186
970 Ga0501041_0021300 3300049577 Bacteria 3884
971 Ga0501041_0072141 3300049577 Bacteria 2121
972 Ga0501042_0027080 3300049578 Bacteria 4030
973 Ga0501042_0162016 3300049578 Bacteria 1614
974 Ga0501042_0302541 3300049578 Bacteria 1155
975 Ga0501043_0041040 3300049579 Bacteria 3636
976 Ga0501043_0133897 3300049579 Bacteria 1942
977 Ga0501046_0036825 3300049580 Bacteria 3935
978 Ga0501046_0190722 3300049580 Bacteria 1529
979 Ga0501046_0238708 3300049580 Bacteria 1341
980 Ga0501047_0010057 3300049581 Bacteria 8942
981 Ga0501047_0026688 3300049581 Bacteria 5559
982 Ga0501048_0002553 3300049582 Bacteria 13932
983 Ga0501048_0074470 3300049582 Bacteria 2395
984 Ga0501048_0277378 3300049582 Bacteria 1192
985 Ga0501067_0001219 3300049583 Bacteria 13976
986 Ga0501067_0026272 3300049583 Bacteria 3226
987 Ga0501067_0077725 3300049583 Bacteria 1839
988 Ga0501067_0203132 3300049583 Bacteria 1104
989 Ga0501068_0022601 3300049584 Bacteria 3678
990 Ga0501068_0126481 3300049584 Bacteria 1596
991 Ga0501069_0007861 3300049585 Bacteria 5598
992 Ga0501069_0061929 3300049585 Bacteria 2089
993 Ga0501070_0000120 3300049586 Bacteria 70354
994 Ga0501071_0000414 3300049587 Bacteria 21222
995 Ga0501071_0003032 3300049587 Bacteria 10397
996 Ga0501072_0001365 3300049588 Bacteria 18321
997 Ga0501072_0013944 3300049588 Bacteria 6159
998 Ga0501072_0580028 3300049588 Bacteria 885
999 Ga0501073_0072000 3300049589 Bacteria 2408
1000 Ga0501074_0010622 3300049590 Bacteria 6684
1001 Ga0501074_0010836 3300049590 Bacteria 6620
1002 Ga0501074_0040774 3300049590 Bacteria 3361
1003 Ga0501075_0020376 3300049591 Bacteria 4823
1004 Ga0501075_0109046 3300049591 Bacteria 2105
1005 Ga0501076_0001627 3300049592 Bacteria 15150
1006 Ga0501076_0011984 3300049592 Bacteria 6477
1007 Ga0501076_0260869 3300049592 Bacteria 1419
1008 Ga0501076_0320252 3300049592 Bacteria 1272
1009 Ga0501076_0479639 3300049592 Bacteria 1025
1010 Ga0501077_0017171 3300049593 Bacteria 4564
1011 Ga0501077_0208605 3300049593 Bacteria 1241
1012 Ga0501079_0010395 3300049741 Bacteria 7073
1013 Ga0501079_0480727 3300049741 Bacteria 976
1014 Ga0501080_0260736 3300049742 Bacteria 1579
1015 Ga0501081_0011312 3300049743 Bacteria 5838
1016 Ga0501081_0059229 3300049743 Bacteria 2651
1017 Ga0501081_0156408 3300049743 Bacteria 1640
1018 Ga0501081_0298485 3300049743 Bacteria 1182
1019 Ga0501081_0706371 3300049743 Bacteria 757
1020 Ga0501083_0032408 3300049744 Bacteria 3583
1021 Ga0501035_0042130 3300049822 Bacteria 4119
1022 Ga0501035_0076895 3300049822 Bacteria 2951
1023 Ga0501035_0297353 3300049822 Bacteria 1361
1024 Ga0501035_0394119 3300049822 Bacteria 1153
1025 Ga0501044_0098899 3300049823 Bacteria 2937
1026 Ga0501044_0211408 3300049823 Bacteria 1894
1027 Ga0501044_0334938 3300049823 Bacteria 1435
1028 Ga0501045_0011285 3300049824 Bacteria 6270
1029 Ga0501045_0036522 3300049824 Bacteria 3567
1030 Ga0501045_0219339 3300049824 Bacteria 1416
1031 Ga0501045_0381355 3300049824 Bacteria 1049
1032 nmdc:mga03n38_112395_c1 3300050490 Bacteria 1328
1033 nmdc:mga0yw44_234796_c1 3300050492 Unclassified 1218
1034 nmdc:mga0yw44_45111_c1 3300050492 Bacteria 2641
1035 nmdc:mga0k408_90160_c1 3300050493 Bacteria 1800
1036 nmdc:mga05p37_10748_c1 3300050507 Bacteria 10866
1037 nmdc:mga05p37_1109513_c1 3300050507 Bacteria 827
1038 nmdc:mga05p37_147138_c1 3300050507 Bacteria 2883
1039 nmdc:mga05p37_208837_c1 3300050507 Bacteria 2361
1040 nmdc:mga05p37_308934_c1 3300050507 Bacteria 1875
1041 nmdc:mga05p37_436175_c1 3300050507 Unclassified 1521
1042 nmdc:mga09592_571015_c1 3300050508 Unclassified 971
1043 nmdc:mga06r32_144488_c1 3300050510 Bacteria 2356
1044 nmdc:mga06r32_325621_c1 3300050510 Bacteria 1522
1045 nmdc:mga06r32_740491_c1 3300050510 Unclassified 947
1046 nmdc:mga0n895_40422_c1 3300050512 Bacteria 4530
1047 nmdc:mga0n895_503189_c1 3300050512 Bacteria 1220
1048 nmdc:mga0n895_713751_c1 3300050512 Bacteria 998
1049 nmdc:mga0n895_958627_c1 3300050512 Unclassified 838
1050 nmdc:mga0rr50_143685_c1 3300050513 Bacteria 1922
1051 nmdc:mga0rr50_17281_c1 3300050513 Bacteria 4813
1052 nmdc:mga0rr50_198601_c1 3300050513 Bacteria 1647
1053 nmdc:mga0rr50_795523_c1 3300050513 Bacteria 807
1054 nmdc:mga08x19_36535_c1 3300050514 Bacteria 3112
1055 nmdc:mga0a205_151356_c2 3300050515 Bacteria 1582
1056 nmdc:mga0a205_296230_c1 3300050515 Bacteria 1491
1057 nmdc:mga0a205_63929_c1 3300050515 Bacteria 3555
1058 Ga0495601_0016778 3300053077 Bacteria 4441
1059 Ga0495601_0029007 3300053077 Bacteria 3430
1060 Ga0495601_0076054 3300053077 Bacteria 2149
1061 Ga0495601_0130067 3300053077 Bacteria 1639
1062 Ga0495601_0226003 3300053077 Bacteria 1223
1063 Ga0495601_0230641 3300053077 Bacteria 1209
1064 Ga0495601_0267342 3300053077 Bacteria 1116
1065 Ga0495612_0044660 3300053078 Bacteria 1813
1066 Ga0495612_0184169 3300053078 Unclassified 918
1067 Ga0495595_0018078 3300053084 Bacteria 3042
1068 Ga0495595_0037728 3300053084 Bacteria 2198
1069 Ga0495595_0057306 3300053084 Bacteria 1817
1070 Ga0495595_0096445 3300053084 Bacteria 1423
1071 Ga0495619_0001713 3300053085 Bacteria 14540
1072 Ga0495619_0002632 3300053085 Bacteria 11726
1073 Ga0495619_0002961 3300053085 Bacteria 11026
1074 Ga0495619_0021685 3300053085 Bacteria 4104
1075 Ga0495619_0147967 3300053085 Bacteria 1620
1076 Ga0501084_0000569 3300054114 Bacteria 28211
1077 Ga0501084_0012234 3300054114 Bacteria 7104
1078 Ga0590071_036211 3300059421 Bacteria 1183
1079 Ga0590074_011756 3300059423 Bacteria 1467
1080 Ga0590077_005096 3300059426 Bacteria 2686
1081 Ga0501082_0005617 3300060353 Bacteria 10883
1082 Ga0501082_0071094 3300060353 Bacteria 2996
1083 Ga0501082_0261483 3300060353 Bacteria 1505
1084 Ga0501082_0572802 3300060353 Bacteria 988
1085 Ga0466962_0024171 3300061719 Bacteria 2919
1086 Ga0530510_0030064 3300061734 Bacteria 3900
1087 Ga0530510_0038763 3300061734 Bacteria 3441
1088 Ga0530510_0069148 3300061734 Bacteria 2562

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035116 Ga0373945_0025864 Ga0373945_0025864_782_1453 173
2 3300035170 Ga0373943_0036413 Ga0373943_0036413_1337_2008 173
3 3300035171 Ga0373946_0081016 Ga0373946_0081016_696_1328 173
4 3300035692 Ga0373935_0048387 Ga0373935_0048387_1674_2306 173
5 3300035695 Ga0373927_0015946 Ga0373927_0015946_786_1457 173
6 3300035725 Ga0373947_0129897 Ga0373947_0129897_65_697 173
7 3300037068 Ga0373925_0239637 Ga0373925_0239637_368_1000 173
8 3300047321 Ga0495676_0083785 Ga0495676_0083785_490_1122 173
9 3300044842 Ga0466957_0070755 Ga0466957_0070755_107_820 175
10 3300045976 Ga0466967_0049411 Ga0466967_0049411_2399_3112 175
11 3300046559 Ga0495667_0213205 Ga0495667_0213205_187_894 180
12 3300031344 Ga0265316_10047132 Ga0265316_100471323 182
13 3300031344 Ga0265316_10235790 Ga0265316_102357902 182
14 3300037466 Ga0395898_0338657 Ga0395898_0338657_213_857 183
15 3300049583 Ga0501067_0026272 Ga0501067_0026272_1102_1812 183
16 3300025898 Ga0207692_10276217 Ga0207692_102762172 184
17 3300036401 Ga0373937_1052429 Ga0373937_1052429_15_668 185
18 3300037418 Ga0395900_0590022 Ga0395900_0590022_228_908 185
19 3300046462 Ga0495651_0226737 Ga0495651_0226737_92_745 185
20 3300046463 Ga0495653_0019059 Ga0495653_0019059_243_896 185
21 3300046559 Ga0495667_0003549 Ga0495667_0003549_5214_5867 185
22 3300046642 Ga0495634_0162315 Ga0495634_0162315_221_874 185
23 3300046675 Ga0495657_0029506 Ga0495657_0029506_598_1251 185
24 3300047322 Ga0495680_0014309 Ga0495680_0014309_2549_3202 185
25 3300053084 Ga0495595_0096445 Ga0495595_0096445_403_1056 185
26 3300005468 Ga0070707_100014979 Ga0070707_1000149792 186
27 3300009147 Ga0114129_10173306 Ga0114129_101733061 186
28 3300025922 Ga0207646_10011532 Ga0207646_100115323 186
29 3300046506 Ga0495583_0054971 Ga0495583_0054971_40_669 186
30 3300005337 Ga0070682_100174664 Ga0070682_1001746642 187
31 3300009177 Ga0105248_10597848 Ga0105248_105978482 187
32 3300037471 Ga0395905_0142238 Ga0395905_0142238_1082_1708 187
33 3300048903 Ga0496100_0334844 Ga0496100_0334844_132_806 187
34 3300048907 Ga0496104_0037862 Ga0496104_0037862_506_1180 187
35 3300048912 Ga0496109_0172051 Ga0496109_0172051_195_869 187
36 3300005467 Ga0070706_100737313 Ga0070706_1007373132 188
37 3300005471 Ga0070698_100168661 Ga0070698_1001686613 188
38 3300025910 Ga0207684_10552858 Ga0207684_105528582 188
39 3300046477 Ga0495664_0030696 Ga0495664_0030696_1987_2697 188
40 3300046514 Ga0495618_0181776 Ga0495618_0181776_520_1230 188
41 3300046642 Ga0495634_0255984 Ga0495634_0255984_228_938 188
42 3300005937 Ga0081455_10141099 Ga0081455_101410992 189
43 3300025939 Ga0207665_10276326 Ga0207665_102763262 191
44 3300037418 Ga0395900_0410049 Ga0395900_0410049_318_923 192
45 3300037466 Ga0395898_0010435 Ga0395898_0010435_2810_3415 192
46 3300037471 Ga0395905_0023688 Ga0395905_0023688_4469_5074 192
47 3300038443 Ga0395901_0005214 Ga0395901_0005214_5808_6413 192
48 3300039450 Ga0436363_0546918 Ga0436363_0546918_507_1118 192
49 3300048915 Ga0496112_0478562 Ga0496112_0478562_252_866 192
50 3300005329 Ga0070683_100000847 Ga0070683_1000008478 193
51 3300005336 Ga0070680_100051747 Ga0070680_1000517473 193
52 3300005337 Ga0070682_100479636 Ga0070682_1004796362 193
53 3300005338 Ga0068868_100089156 Ga0068868_1000891562 193
54 3300005339 Ga0070660_100521225 Ga0070660_1005212251 193
55 3300005366 Ga0070659_100641945 Ga0070659_1006419451 193
56 3300005456 Ga0070678_100071581 Ga0070678_1000715813 193
57 3300005456 Ga0070678_100155325 Ga0070678_1001553252 193
58 3300005458 Ga0070681_10013690 Ga0070681_100136907 193
59 3300005518 Ga0070699_100511212 Ga0070699_1005112121 193
60 3300005530 Ga0070679_100111292 Ga0070679_1001112922 193
61 3300005535 Ga0070684_100005178 Ga0070684_1000051784 193
62 3300005548 Ga0070665_100040732 Ga0070665_1000407322 193
63 3300005564 Ga0070664_100079695 Ga0070664_1000796952 193
64 3300005614 Ga0068856_100341905 Ga0068856_1003419052 193
65 3300005840 Ga0068870_10155309 Ga0068870_101553092 193
66 3300006237 Ga0097621_100249110 Ga0097621_1002491102 193
67 3300006852 Ga0075433_10233798 Ga0075433_102337982 193
68 3300006871 Ga0075434_100359177 Ga0075434_1003591772 193
69 3300006871 Ga0075434_100852607 Ga0075434_1008526071 193
70 3300007076 Ga0075435_100490375 Ga0075435_1004903752 193
71 3300009094 Ga0111539_10815293 Ga0111539_108152931 193
72 3300009098 Ga0105245_10006098 Ga0105245_100060982 193
73 3300009098 Ga0105245_10123267 Ga0105245_101232672 193
74 3300009098 Ga0105245_10536150 Ga0105245_105361501 193
75 3300009098 Ga0105245_10572165 Ga0105245_105721652 193
76 3300009147 Ga0114129_10300988 Ga0114129_103009882 193
77 3300009177 Ga0105248_10412913 Ga0105248_104129132 193
78 3300009553 Ga0105249_10615190 Ga0105249_106151902 193
79 3300010375 Ga0105239_10104874 Ga0105239_101048742 193
80 3300010375 Ga0105239_10373664 Ga0105239_103736642 193
81 3300014326 Ga0157380_10298626 Ga0157380_102986262 193
82 3300014745 Ga0157377_10613276 Ga0157377_106132761 193
83 3300014968 Ga0157379_10665641 Ga0157379_106656411 193
84 3300025908 Ga0207643_10054543 Ga0207643_100545432 193
85 3300025911 Ga0207654_10050233 Ga0207654_100502333 193
86 3300025912 Ga0207707_10056274 Ga0207707_100562744 193
87 3300025917 Ga0207660_10023010 Ga0207660_100230102 193
88 3300025919 Ga0207657_10520623 Ga0207657_105206232 193
89 3300025921 Ga0207652_10008202 Ga0207652_100082028 193
90 3300025927 Ga0207687_10003480 Ga0207687_100034809 193
91 3300025927 Ga0207687_10263485 Ga0207687_102634852 193
92 3300025932 Ga0207690_10381964 Ga0207690_103819641 193
93 3300025937 Ga0207669_10061307 Ga0207669_100613073 193
94 3300025944 Ga0207661_10000646 Ga0207661_100006469 193
95 3300025945 Ga0207679_10074293 Ga0207679_100742932 193
96 3300025961 Ga0207712_10159907 Ga0207712_101599072 193
97 3300026023 Ga0207677_10021579 Ga0207677_100215794 193
98 3300026078 Ga0207702_10013311 Ga0207702_100133114 193
99 3300026078 Ga0207702_10871568 Ga0207702_108715682 193
100 3300026089 Ga0207648_10376140 Ga0207648_103761402 193
101 3300026121 Ga0207683_10099829 Ga0207683_100998293 193
102 3300026121 Ga0207683_10122977 Ga0207683_101229772 193
103 3300028379 Ga0268266_10038991 Ga0268266_100389912 193
104 3300031731 Ga0307405_10155804 Ga0307405_101558041 193
105 3300031903 Ga0307407_10277879 Ga0307407_102778792 193
106 3300031995 Ga0307409_100060313 Ga0307409_1000603133 193
107 3300031995 Ga0307409_100450650 Ga0307409_1004506502 193
108 3300032002 Ga0307416_100207823 Ga0307416_1002078233 193
109 3300032126 Ga0307415_100018386 Ga0307415_1000183864 193
110 3300037466 Ga0395898_0243274 Ga0395898_0243274_540_1160 193
111 3300038443 Ga0395901_0158299 Ga0395901_0158299_118_738 193
112 3300038443 Ga0395901_1101423 Ga0395901_1101423_78_695 193
113 3300042127 Ga0450890_034001 Ga0450890_034001_33_644 193
114 3300046459 Ga0495629_0207889 Ga0495629_0207889_111_722 193
115 3300046523 Ga0495644_0126602 Ga0495644_0126602_94_702 193
116 3300046615 Ga0495656_0026348 Ga0495656_0026348_263_871 193
117 3300046642 Ga0495634_0137867 Ga0495634_0137867_788_1408 193
118 3300046663 Ga0495635_0645507 Ga0495635_0645507_34_645 193
119 3300046689 Ga0495613_0206527 Ga0495613_0206527_683_1303 193
120 3300047319 Ga0495674_0138705 Ga0495674_0138705_1413_2024 193
121 3300047446 Ga0495679_068180 Ga0495679_068180_392_1003 193
122 3300048903 Ga0496100_0004055 Ga0496100_0004055_5739_6353 193
123 3300048903 Ga0496100_0451708 Ga0496100_0451708_227_841 193
124 3300048904 Ga0496101_0458711 Ga0496101_0458711_350_964 193
125 3300048904 Ga0496101_0653425 Ga0496101_0653425_51_659 193
126 3300048905 Ga0496102_0009326 Ga0496102_0009326_2048_2662 193
127 3300048905 Ga0496102_0335817 Ga0496102_0335817_227_841 193
128 3300048906 Ga0496103_0353083 Ga0496103_0353083_104_718 193
129 3300048907 Ga0496104_0000617 Ga0496104_0000617_29573_30187 193
130 3300048907 Ga0496104_0021027 Ga0496104_0021027_3680_4294 193
131 3300048908 Ga0496105_0000147 Ga0496105_0000147_26054_26668 193
132 3300048908 Ga0496105_0052606 Ga0496105_0052606_2443_3063 193
133 3300048908 Ga0496105_0077393 Ga0496105_0077393_46_660 193
134 3300048909 Ga0496106_0475013 Ga0496106_0475013_325_939 193
135 3300048910 Ga0496107_0180335 Ga0496107_0180335_411_1025 193
136 3300048911 Ga0496108_0256827 Ga0496108_0256827_161_775 193
137 3300048912 Ga0496109_0002132 Ga0496109_0002132_448_1062 193
138 3300048912 Ga0496109_0069099 Ga0496109_0069099_832_1440 193
139 3300048912 Ga0496109_0118720 Ga0496109_0118720_432_1046 193
140 3300048913 Ga0496110_0004408 Ga0496110_0004408_4419_5033 193
141 3300048913 Ga0496110_0024265 Ga0496110_0024265_1526_2140 193
142 3300048913 Ga0496110_0036414 Ga0496110_0036414_525_1139 193
143 3300048913 Ga0496110_0116351 Ga0496110_0116351_1694_2314 193
144 3300048913 Ga0496110_0201241 Ga0496110_0201241_770_1378 193
145 3300048914 Ga0496111_0005287 Ga0496111_0005287_5265_5879 193
146 3300048915 Ga0496112_0647974 Ga0496112_0647974_151_759 193
147 3300048916 Ga0496113_0343732 Ga0496113_0343732_76_690 193
148 3300048917 Ga0496114_0002378 Ga0496114_0002378_5067_5681 193
149 3300048917 Ga0496114_0004042 Ga0496114_0004042_7011_7625 193
150 3300048917 Ga0496114_0027028 Ga0496114_0027028_2225_2839 193
151 3300048918 Ga0496115_0214161 Ga0496115_0214161_913_1527 193
152 3300049568 Ga0501031_0001694 Ga0501031_0001694_2747_3358 193
153 3300049568 Ga0501031_0073567 Ga0501031_0073567_1076_1684 193
154 3300049569 Ga0501032_0018156 Ga0501032_0018156_2615_3226 193
155 3300049570 Ga0501033_0039387 Ga0501033_0039387_251_862 193
156 3300049572 Ga0501036_0002633 Ga0501036_0002633_10464_11075 193
157 3300049573 Ga0501037_0055083 Ga0501037_0055083_1150_1761 193
158 3300049574 Ga0501038_0010236 Ga0501038_0010236_2336_2947 193
159 3300049575 Ga0501039_0002091 Ga0501039_0002091_11402_12013 193
160 3300049576 Ga0501040_0002120 Ga0501040_0002120_9793_10404 193
161 3300049576 Ga0501040_0101560 Ga0501040_0101560_566_1180 193
162 3300049577 Ga0501041_0021300 Ga0501041_0021300_1790_2401 193
163 3300049577 Ga0501041_0072141 Ga0501041_0072141_790_1404 193
164 3300049578 Ga0501042_0162016 Ga0501042_0162016_249_857 193
165 3300049578 Ga0501042_0302541 Ga0501042_0302541_499_1110 193
166 3300049579 Ga0501043_0041040 Ga0501043_0041040_665_1276 193
167 3300049580 Ga0501046_0036825 Ga0501046_0036825_659_1270 193
168 3300049580 Ga0501046_0238708 Ga0501046_0238708_703_1317 193
169 3300049582 Ga0501048_0002553 Ga0501048_0002553_2859_3470 193
170 3300049582 Ga0501048_0277378 Ga0501048_0277378_260_886 193
171 3300049584 Ga0501068_0022601 Ga0501068_0022601_1216_1827 193
172 3300049587 Ga0501071_0000414 Ga0501071_0000414_11494_12105 193
173 3300049588 Ga0501072_0013944 Ga0501072_0013944_2946_3557 193
174 3300049590 Ga0501074_0010836 Ga0501074_0010836_4138_4749 193
175 3300049591 Ga0501075_0020376 Ga0501075_0020376_2801_3412 193
176 3300049591 Ga0501075_0109046 Ga0501075_0109046_520_1134 193
177 3300049592 Ga0501076_0001627 Ga0501076_0001627_2735_3346 193
178 3300049593 Ga0501077_0017171 Ga0501077_0017171_1285_1896 193
179 3300049741 Ga0501079_0010395 Ga0501079_0010395_5534_6145 193
180 3300049743 Ga0501081_0059229 Ga0501081_0059229_859_1473 193
181 3300049743 Ga0501081_0156408 Ga0501081_0156408_59_670 193
182 3300049743 Ga0501081_0706371 Ga0501081_0706371_13_624 193
183 3300049744 Ga0501083_0032408 Ga0501083_0032408_2587_3198 193
184 3300049822 Ga0501035_0042130 Ga0501035_0042130_1412_2023 193
185 3300049823 Ga0501044_0098899 Ga0501044_0098899_1704_2315 193
186 3300049824 Ga0501045_0011285 Ga0501045_0011285_3097_3708 193
187 3300049824 Ga0501045_0219339 Ga0501045_0219339_358_972 193
188 3300050513 nmdc:mga0rr50_795523_c1 nmdc:mga0rr50_795523_c1_26_640 193
189 3300050515 nmdc:mga0a205_296230_c1 nmdc:mga0a205_296230_c1_239_853 193
190 3300053085 Ga0495619_0021685 Ga0495619_0021685_2102_2713 193
191 3300054114 Ga0501084_0000569 Ga0501084_0000569_27571_28182 193
192 3300060353 Ga0501082_0005617 Ga0501082_0005617_51_662 193
193 3300061734 Ga0530510_0030064 Ga0530510_0030064_202_813 193
194 3300005535 Ga0070684_100503559 Ga0070684_1005035592 194
195 3300005842 Ga0068858_100569595 Ga0068858_1005695952 194
196 3300031548 Ga0307408_100886549 Ga0307408_1008865491 194
197 3300031731 Ga0307405_10109727 Ga0307405_101097272 194
198 3300031852 Ga0307410_10697518 Ga0307410_106975182 194
199 3300031995 Ga0307409_100238338 Ga0307409_1002383382 194
200 3300032002 Ga0307416_101084168 Ga0307416_1010841681 194
201 3300041411 Ga0439466_0067191 Ga0439466_0067191_170_784 194
202 3300046492 Ga0495585_0143385 Ga0495585_0143385_139_756 194
203 3300046615 Ga0495656_0060924 Ga0495656_0060924_626_1240 194
204 3300046615 Ga0495656_0079134 Ga0495656_0079134_665_1282 194
205 3300046691 Ga0495670_0268156 Ga0495670_0268156_47_661 194
206 3300046794 Ga0495589_0253521 Ga0495589_0253521_151_768 194
207 3300047445 Ga0495677_0193950 Ga0495677_0193950_154_771 194
208 3300048907 Ga0496104_0467852 Ga0496104_0467852_105_716 194
209 3300049568 Ga0501031_0006544 Ga0501031_0006544_3464_4081 194
210 3300049572 Ga0501036_0063805 Ga0501036_0063805_971_1588 194
211 3300049573 Ga0501037_0251475 Ga0501037_0251475_352_969 194
212 3300049576 Ga0501040_0002148 Ga0501040_0002148_3022_3639 194
213 3300049577 Ga0501041_0018181 Ga0501041_0018181_2862_3479 194
214 3300049578 Ga0501042_0027080 Ga0501042_0027080_2314_2931 194
215 3300049579 Ga0501043_0133897 Ga0501043_0133897_520_1137 194
216 3300049582 Ga0501048_0074470 Ga0501048_0074470_907_1524 194
217 3300049587 Ga0501071_0003032 Ga0501071_0003032_1868_2485 194
218 3300049588 Ga0501072_0001365 Ga0501072_0001365_8704_9321 194
219 3300049588 Ga0501072_0580028 Ga0501072_0580028_154_774 194
220 3300049590 Ga0501074_0040774 Ga0501074_0040774_1524_2141 194
221 3300049592 Ga0501076_0011984 Ga0501076_0011984_3323_3940 194
222 3300049592 Ga0501076_0320252 Ga0501076_0320252_144_764 194
223 3300049743 Ga0501081_0011312 Ga0501081_0011312_1617_2234 194
224 3300049822 Ga0501035_0076895 Ga0501035_0076895_1313_1930 194
225 3300049824 Ga0501045_0036522 Ga0501045_0036522_1083_1700 194
226 3300054114 Ga0501084_0012234 Ga0501084_0012234_4977_5594 194
227 3300059421 Ga0590071_036211 Ga0590071_036211_220_849 194
228 3300059423 Ga0590074_011756 Ga0590074_011756_643_1272 194
229 3300059426 Ga0590077_005096 Ga0590077_005096_1210_1839 194
230 3300060353 Ga0501082_0071094 Ga0501082_0071094_1512_2129 194
231 3300061734 Ga0530510_0038763 Ga0530510_0038763_1543_2160 194
232 3300005471 Ga0070698_100460454 Ga0070698_1004604541 195
233 3300006844 Ga0075428_100281741 Ga0075428_1002817412 195
234 3300009147 Ga0114129_10026913 Ga0114129_100269139 195
235 3300009176 Ga0105242_11039328 Ga0105242_110393282 195
236 3300037418 Ga0395900_0029803 Ga0395900_0029803_2545_3162 195
237 3300037418 Ga0395900_0118229 Ga0395900_0118229_1493_2110 195
238 3300037418 Ga0395900_0261714 Ga0395900_0261714_104_721 195
239 3300037418 Ga0395900_0621409 Ga0395900_0621409_58_675 195
240 3300037466 Ga0395898_0239854 Ga0395898_0239854_654_1271 195
241 3300038443 Ga0395901_0061225 Ga0395901_0061225_2584_3201 195
242 3300038443 Ga0395901_0146620 Ga0395901_0146620_1796_2413 195
243 3300038443 Ga0395901_1324214 Ga0395901_1324214_47_664 195
244 3300045051 Ga0451576_0308746 Ga0451576_0308746_704_1321 195
245 3300045976 Ga0466967_0710183 Ga0466967_0710183_127_744 195
246 3300046454 Ga0495592_0134647 Ga0495592_0134647_23_640 195
247 3300046794 Ga0495589_0341096 Ga0495589_0341096_24_641 195
248 3300005439 Ga0070711_100704877 Ga0070711_1007048771 196
249 3300005458 Ga0070681_10812478 Ga0070681_108124781 196
250 3300005530 Ga0070679_100394017 Ga0070679_1003940172 196
251 3300005578 Ga0068854_100630827 Ga0068854_1006308272 196
252 3300006175 Ga0070712_100409100 Ga0070712_1004091001 196
253 3300009094 Ga0111539_10556351 Ga0111539_105563512 196
254 3300009098 Ga0105245_10093166 Ga0105245_100931663 196
255 3300009147 Ga0114129_10531756 Ga0114129_105317562 196
256 3300010375 Ga0105239_10145120 Ga0105239_101451203 196
257 3300013307 Ga0157372_10030921 Ga0157372_100309214 196
258 3300025933 Ga0207706_10017688 Ga0207706_100176882 196
259 3300026118 Ga0207675_100343044 Ga0207675_1003430442 196
260 3300037466 Ga0395898_0153541 Ga0395898_0153541_1408_2034 196
261 3300038443 Ga0395901_0162385 Ga0395901_0162385_838_1464 196
262 3300041459 Ga0451800_1681006 Ga0451800_1681006_136_771 196
263 3300041492 Ga0451835_0298821 Ga0451835_0298821_135_770 196
264 3300045976 Ga0466967_0439910 Ga0466967_0439910_199_822 196
265 3300046457 Ga0495590_0071372 Ga0495590_0071372_440_1081 196
266 3300046477 Ga0495664_0538116 Ga0495664_0538116_30_653 196
267 3300046491 Ga0495584_0160527 Ga0495584_0160527_269_910 196
268 3300046500 Ga0495596_0156531 Ga0495596_0156531_156_797 196
269 3300048903 Ga0496100_0425477 Ga0496100_0425477_240_863 196
270 3300048912 Ga0496109_0109156 Ga0496109_0109156_578_1213 196
271 3300048913 Ga0496110_0202035 Ga0496110_0202035_135_770 196
272 3300048917 Ga0496114_0164191 Ga0496114_0164191_342_965 196
273 3300053077 Ga0495601_0226003 Ga0495601_0226003_518_1141 196
274 3300006058 Ga0075432_10068553 Ga0075432_100685532 197
275 3300006844 Ga0075428_100583806 Ga0075428_1005838062 197
276 3300009093 Ga0105240_10437930 Ga0105240_104379301 197
277 3300013105 Ga0157369_10239499 Ga0157369_102394992 197
278 3300031344 Ga0265316_10369149 Ga0265316_103691492 197
279 3300042005 Ga0439448_0045292 Ga0439448_0045292_456_1079 197
280 3300044683 Ga0466965_0060374 Ga0466965_0060374_604_1314 197
281 3300044684 Ga0466966_0148093 Ga0466966_0148093_71_703 197
282 3300044694 Ga0466963_0003436 Ga0466963_0003436_3050_3760 197
283 3300044694 Ga0466963_0012752 Ga0466963_0012752_3245_3877 197
284 3300044719 Ga0466971_0006706 Ga0466971_0006706_744_1376 197
285 3300044719 Ga0466971_0031883 Ga0466971_0031883_1089_1721 197
286 3300044842 Ga0466957_0006475 Ga0466957_0006475_2902_3612 197
287 3300044842 Ga0466957_0088618 Ga0466957_0088618_1125_1757 197
288 3300045836 Ga0466958_0036084 Ga0466958_0036084_1216_1848 197
289 3300045836 Ga0466958_0042828 Ga0466958_0042828_759_1391 197
290 3300045976 Ga0466967_0161988 Ga0466967_0161988_743_1375 197
291 3300045976 Ga0466967_0279461 Ga0466967_0279461_656_1366 197
292 3300048903 Ga0496100_0878658 Ga0496100_0878658_51_674 197
293 3300048904 Ga0496101_0473043 Ga0496101_0473043_107_730 197
294 3300049593 Ga0501077_0208605 Ga0501077_0208605_294_920 197
295 3300049741 Ga0501079_0480727 Ga0501079_0480727_228_932 197
296 3300049743 Ga0501081_0298485 Ga0501081_0298485_359_1063 197
297 3300049824 Ga0501045_0381355 Ga0501045_0381355_316_1020 197
298 3300050507 nmdc:mga05p37_308934_c1 nmdc:mga05p37_308934_c1_1170_1808 197
299 3300061719 Ga0466962_0024171 Ga0466962_0024171_2004_2636 197
300 3300005329 Ga0070683_100026408 Ga0070683_1000264082 198
301 3300005329 Ga0070683_100073714 Ga0070683_1000737143 198
302 3300005329 Ga0070683_100087739 Ga0070683_1000877393 198
303 3300005329 Ga0070683_100198472 Ga0070683_1001984722 198
304 3300005336 Ga0070680_100005810 Ga0070680_1000058108 198
305 3300005336 Ga0070680_100056397 Ga0070680_1000563973 198
306 3300005336 Ga0070680_100057548 Ga0070680_1000575483 198
307 3300005336 Ga0070680_100085414 Ga0070680_1000854143 198
308 3300005336 Ga0070680_100248904 Ga0070680_1002489042 198
309 3300005337 Ga0070682_100076586 Ga0070682_1000765862 198
310 3300005339 Ga0070660_100012668 Ga0070660_1000126687 198
311 3300005339 Ga0070660_100128974 Ga0070660_1001289742 198
312 3300005339 Ga0070660_100144604 Ga0070660_1001446042 198
313 3300005339 Ga0070660_100425612 Ga0070660_1004256121 198
314 3300005339 Ga0070660_100446182 Ga0070660_1004461822 198
315 3300005344 Ga0070661_100061509 Ga0070661_1000615092 198
316 3300005344 Ga0070661_100086063 Ga0070661_1000860633 198
317 3300005344 Ga0070661_100668741 Ga0070661_1006687411 198
318 3300005355 Ga0070671_100069910 Ga0070671_1000699103 198
319 3300005366 Ga0070659_100153962 Ga0070659_1001539623 198
320 3300005366 Ga0070659_100221410 Ga0070659_1002214102 198
321 3300005435 Ga0070714_100112927 Ga0070714_1001129272 198
322 3300005435 Ga0070714_100546332 Ga0070714_1005463322 198
323 3300005436 Ga0070713_100043623 Ga0070713_1000436233 198
324 3300005436 Ga0070713_100269516 Ga0070713_1002695162 198
325 3300005437 Ga0070710_10390822 Ga0070710_103908222 198
326 3300005439 Ga0070711_100790723 Ga0070711_1007907231 198
327 3300005445 Ga0070708_100008860 Ga0070708_1000088604 198
328 3300005455 Ga0070663_100607076 Ga0070663_1006070762 198
329 3300005456 Ga0070678_100045725 Ga0070678_1000457253 198
330 3300005458 Ga0070681_10008727 Ga0070681_100087274 198
331 3300005458 Ga0070681_10019935 Ga0070681_100199352 198
332 3300005458 Ga0070681_10020145 Ga0070681_100201452 198
333 3300005458 Ga0070681_10031845 Ga0070681_100318452 198
334 3300005458 Ga0070681_10046119 Ga0070681_100461195 198
335 3300005458 Ga0070681_10052560 Ga0070681_100525607 198
336 3300005458 Ga0070681_10078196 Ga0070681_100781962 198
337 3300005458 Ga0070681_10147028 Ga0070681_101470282 198
338 3300005458 Ga0070681_10221168 Ga0070681_102211682 198
339 3300005468 Ga0070707_100349120 Ga0070707_1003491202 198
340 3300005530 Ga0070679_100017413 Ga0070679_1000174133 198
341 3300005530 Ga0070679_100030040 Ga0070679_1000300402 198
342 3300005530 Ga0070679_100035170 Ga0070679_1000351704 198
343 3300005530 Ga0070679_100106662 Ga0070679_1001066623 198
344 3300005535 Ga0070684_100017725 Ga0070684_1000177252 198
345 3300005535 Ga0070684_100208601 Ga0070684_1002086012 198
346 3300005535 Ga0070684_100214626 Ga0070684_1002146262 198
347 3300005535 Ga0070684_100235223 Ga0070684_1002352232 198
348 3300005535 Ga0070684_100330614 Ga0070684_1003306142 198
349 3300005539 Ga0068853_100229361 Ga0068853_1002293612 198
350 3300005539 Ga0068853_100489117 Ga0068853_1004891171 198
351 3300005548 Ga0070665_100106594 Ga0070665_1001065942 198
352 3300005563 Ga0068855_100003593 Ga0068855_1000035933 198
353 3300005563 Ga0068855_100011169 Ga0068855_1000111692 198
354 3300005563 Ga0068855_100024835 Ga0068855_1000248355 198
355 3300005563 Ga0068855_100042632 Ga0068855_1000426323 198
356 3300005563 Ga0068855_100049137 Ga0068855_1000491372 198
357 3300005563 Ga0068855_100196517 Ga0068855_1001965172 198
358 3300005563 Ga0068855_100284095 Ga0068855_1002840952 198
359 3300005563 Ga0068855_100371293 Ga0068855_1003712932 198
360 3300005577 Ga0068857_100087436 Ga0068857_1000874363 198
361 3300005578 Ga0068854_100127321 Ga0068854_1001273212 198
362 3300005578 Ga0068854_100357746 Ga0068854_1003577462 198
363 3300005614 Ga0068856_100120281 Ga0068856_1001202813 198
364 3300005614 Ga0068856_100195492 Ga0068856_1001954922 198
365 3300005614 Ga0068856_100967463 Ga0068856_1009674632 198
366 3300005616 Ga0068852_100072114 Ga0068852_1000721142 198
367 3300005616 Ga0068852_100481222 Ga0068852_1004812222 198
368 3300005985 Ga0081539_10001192 Ga0081539_100011924 198
369 3300006028 Ga0070717_10050873 Ga0070717_100508735 198
370 3300006028 Ga0070717_10333750 Ga0070717_103337502 198
371 3300006038 Ga0075365_10021647 Ga0075365_100216473 198
372 3300006175 Ga0070712_100197026 Ga0070712_1001970262 198
373 3300006175 Ga0070712_100629141 Ga0070712_1006291411 198
374 3300006237 Ga0097621_100180783 Ga0097621_1001807832 198
375 3300006844 Ga0075428_100942740 Ga0075428_1009427402 198
376 3300006847 Ga0075431_100353481 Ga0075431_1003534812 198
377 3300006852 Ga0075433_10008761 Ga0075433_100087615 198
378 3300006852 Ga0075433_10864939 Ga0075433_108649392 198
379 3300006871 Ga0075434_100126426 Ga0075434_1001264262 198
380 3300006871 Ga0075434_100968584 Ga0075434_1009685842 198
381 3300006914 Ga0075436_100013785 Ga0075436_1000137856 198
382 3300007076 Ga0075435_100002153 Ga0075435_1000021536 198
383 3300007076 Ga0075435_100005538 Ga0075435_10000553811 198
384 3300009093 Ga0105240_10045516 Ga0105240_100455166 198
385 3300009147 Ga0114129_10010920 Ga0114129_100109206 198
386 3300009147 Ga0114129_10084015 Ga0114129_100840155 198
387 3300009147 Ga0114129_10102347 Ga0114129_101023472 198
388 3300009147 Ga0114129_11043703 Ga0114129_110437032 198
389 3300009176 Ga0105242_10062210 Ga0105242_100622103 198
390 3300009176 Ga0105242_10107249 Ga0105242_101072492 198
391 3300009177 Ga0105248_11753928 Ga0105248_117539281 198
392 3300009545 Ga0105237_10115359 Ga0105237_101153593 198
393 3300009545 Ga0105237_10508886 Ga0105237_105088862 198
394 3300009551 Ga0105238_10026868 Ga0105238_100268682 198
395 3300010375 Ga0105239_10667147 Ga0105239_106671472 198
396 3300010375 Ga0105239_10678821 Ga0105239_106788212 198
397 3300013100 Ga0157373_10064041 Ga0157373_100640412 198
398 3300013102 Ga0157371_10338406 Ga0157371_103384062 198
399 3300013104 Ga0157370_10003010 Ga0157370_100030102 198
400 3300013104 Ga0157370_10093384 Ga0157370_100933842 198
401 3300013104 Ga0157370_10109886 Ga0157370_101098862 198
402 3300013104 Ga0157370_10743713 Ga0157370_107437132 198
403 3300013105 Ga0157369_10028618 Ga0157369_100286187 198
404 3300013105 Ga0157369_10071297 Ga0157369_100712972 198
405 3300013105 Ga0157369_10321824 Ga0157369_103218242 198
406 3300013296 Ga0157374_10242616 Ga0157374_102426163 198
407 3300013296 Ga0157374_10581480 Ga0157374_105814802 198
408 3300013296 Ga0157374_11012556 Ga0157374_110125561 198
409 3300013307 Ga0157372_10029509 Ga0157372_100295097 198
410 3300013307 Ga0157372_10047864 Ga0157372_100478645 198
411 3300013307 Ga0157372_10168880 Ga0157372_101688803 198
412 3300013307 Ga0157372_10459071 Ga0157372_104590712 198
413 3300013308 Ga0157375_11128391 Ga0157375_111283912 198
414 3300014325 Ga0163163_10318191 Ga0163163_103181912 198
415 3300014325 Ga0163163_10810045 Ga0163163_108100452 198
416 3300014326 Ga0157380_11302672 Ga0157380_113026722 198
417 3300014497 Ga0182008_10024958 Ga0182008_100249582 198
418 3300014969 Ga0157376_10240750 Ga0157376_102407502 198
419 3300014969 Ga0157376_10267528 Ga0157376_102675282 198
420 3300020069 Ga0197907_10620317 Ga0197907_106203174 198
421 3300020069 Ga0197907_11022464 Ga0197907_110224642 198
422 3300020070 Ga0206356_10298171 Ga0206356_102981713 198
423 3300020070 Ga0206356_10607613 Ga0206356_106076132 198
424 3300020070 Ga0206356_11237666 Ga0206356_112376662 198
425 3300020080 Ga0206350_10077237 Ga0206350_100772372 198
426 3300020081 Ga0206354_10340070 Ga0206354_103400702 198
427 3300020081 Ga0206354_11223639 Ga0206354_112236392 198
428 3300020081 Ga0206354_11537358 Ga0206354_115373582 198
429 3300020082 Ga0206353_10480853 Ga0206353_104808533 198
430 3300020082 Ga0206353_10846342 Ga0206353_108463422 198
431 3300020082 Ga0206353_11108111 Ga0206353_111081112 198
432 3300021384 Ga0213876_10039968 Ga0213876_100399683 198
433 3300022467 Ga0224712_10111683 Ga0224712_101116832 198
434 3300022467 Ga0224712_10233350 Ga0224712_102333501 198
435 3300025909 Ga0207705_10006569 Ga0207705_100065698 198
436 3300025909 Ga0207705_10054207 Ga0207705_100542073 198
437 3300025909 Ga0207705_10215198 Ga0207705_102151982 198
438 3300025912 Ga0207707_10008378 Ga0207707_100083787 198
439 3300025912 Ga0207707_10013655 Ga0207707_100136552 198
440 3300025912 Ga0207707_10033202 Ga0207707_100332024 198
441 3300025912 Ga0207707_10081382 Ga0207707_100813822 198
442 3300025912 Ga0207707_10166069 Ga0207707_101660692 198
443 3300025912 Ga0207707_10239464 Ga0207707_102394642 198
444 3300025912 Ga0207707_10384948 Ga0207707_103849482 198
445 3300025913 Ga0207695_10153461 Ga0207695_101534612 198
446 3300025913 Ga0207695_10376768 Ga0207695_103767682 198
447 3300025914 Ga0207671_10263148 Ga0207671_102631482 198
448 3300025915 Ga0207693_10069728 Ga0207693_100697282 198
449 3300025915 Ga0207693_10146534 Ga0207693_101465342 198
450 3300025915 Ga0207693_10154209 Ga0207693_101542092 198
451 3300025915 Ga0207693_10468136 Ga0207693_104681362 198
452 3300025916 Ga0207663_10041896 Ga0207663_100418962 198
453 3300025916 Ga0207663_10197041 Ga0207663_101970412 198
454 3300025916 Ga0207663_10555568 Ga0207663_105555682 198
455 3300025917 Ga0207660_10007020 Ga0207660_100070203 198
456 3300025917 Ga0207660_10068408 Ga0207660_100684083 198
457 3300025917 Ga0207660_10098706 Ga0207660_100987062 198
458 3300025917 Ga0207660_10211296 Ga0207660_102112962 198
459 3300025917 Ga0207660_10346436 Ga0207660_103464362 198
460 3300025917 Ga0207660_10614308 Ga0207660_106143082 198
461 3300025919 Ga0207657_10020746 Ga0207657_100207464 198
462 3300025919 Ga0207657_10025885 Ga0207657_100258857 198
463 3300025919 Ga0207657_10026725 Ga0207657_100267252 198
464 3300025919 Ga0207657_10240112 Ga0207657_102401122 198
465 3300025920 Ga0207649_10042138 Ga0207649_100421382 198
466 3300025921 Ga0207652_10021758 Ga0207652_100217586 198
467 3300025921 Ga0207652_10043128 Ga0207652_100431283 198
468 3300025921 Ga0207652_10190191 Ga0207652_101901912 198
469 3300025921 Ga0207652_10236055 Ga0207652_102360552 198
470 3300025921 Ga0207652_10240478 Ga0207652_102404782 198
471 3300025922 Ga0207646_10286850 Ga0207646_102868502 198
472 3300025924 Ga0207694_10029487 Ga0207694_100294875 198
473 3300025924 Ga0207694_10102747 Ga0207694_101027473 198
474 3300025927 Ga0207687_10070262 Ga0207687_100702622 198
475 3300025928 Ga0207700_10000002 Ga0207700_10000002664 198
476 3300025928 Ga0207700_10255815 Ga0207700_102558152 198
477 3300025928 Ga0207700_10485828 Ga0207700_104858282 198
478 3300025929 Ga0207664_10112348 Ga0207664_101123482 198
479 3300025929 Ga0207664_10783000 Ga0207664_107830001 198
480 3300025929 Ga0207664_10843804 Ga0207664_108438041 198
481 3300025931 Ga0207644_10067873 Ga0207644_100678732 198
482 3300025932 Ga0207690_10067212 Ga0207690_100672123 198
483 3300025934 Ga0207686_10098921 Ga0207686_100989212 198
484 3300025934 Ga0207686_10172516 Ga0207686_101725162 198
485 3300025939 Ga0207665_10023137 Ga0207665_100231373 198
486 3300025944 Ga0207661_10052247 Ga0207661_100522475 198
487 3300025944 Ga0207661_10103205 Ga0207661_101032052 198
488 3300025944 Ga0207661_10237120 Ga0207661_102371202 198
489 3300025949 Ga0207667_10073330 Ga0207667_100733302 198
490 3300025949 Ga0207667_10247646 Ga0207667_102476463 198
491 3300025972 Ga0207668_10130431 Ga0207668_101304313 198
492 3300026041 Ga0207639_10632854 Ga0207639_106328542 198
493 3300026067 Ga0207678_10443769 Ga0207678_104437692 198
494 3300026116 Ga0207674_10091516 Ga0207674_100915162 198
495 3300026118 Ga0207675_100355780 Ga0207675_1003557801 198
496 3300026142 Ga0207698_10079897 Ga0207698_100798973 198
497 3300026142 Ga0207698_10450766 Ga0207698_104507662 198
498 3300026142 Ga0207698_10494885 Ga0207698_104948851 198
499 3300027907 Ga0207428_10079558 Ga0207428_100795583 198
500 3300028379 Ga0268266_10158191 Ga0268266_101581912 198
501 3300028577 Ga0265318_10006205 Ga0265318_100062052 198
502 3300028577 Ga0265318_10084732 Ga0265318_100847322 198
503 3300028654 Ga0265322_10007859 Ga0265322_100078594 198
504 3300028800 Ga0265338_10016568 Ga0265338_100165683 198
505 3300028800 Ga0265338_10068850 Ga0265338_100688502 198
506 3300028800 Ga0265338_10071361 Ga0265338_100713611 198
507 3300028800 Ga0265338_10321404 Ga0265338_103214042 198
508 3300031240 Ga0265320_10186717 Ga0265320_101867172 198
509 3300031240 Ga0265320_10277778 Ga0265320_102777781 198
510 3300031241 Ga0265325_10005024 Ga0265325_100050243 198
511 3300031250 Ga0265331_10027432 Ga0265331_100274322 198
512 3300031251 Ga0265327_10063716 Ga0265327_100637162 198
513 3300031344 Ga0265316_10010014 Ga0265316_100100147 198
514 3300031595 Ga0265313_10020901 Ga0265313_100209013 198
515 3300031595 Ga0265313_10121658 Ga0265313_101216581 198
516 3300031711 Ga0265314_10004407 Ga0265314_100044073 198
517 3300031712 Ga0265342_10097441 Ga0265342_100974412 198
518 3300032002 Ga0307416_100140355 Ga0307416_1001403552 198
519 3300032126 Ga0307415_100146507 Ga0307415_1001465072 198
520 3300035083 Ga0373926_0014627 Ga0373926_0014627_222_857 198
521 3300035089 Ga0373944_0060343 Ga0373944_0060343_158_793 198
522 3300035089 Ga0373944_0079798 Ga0373944_0079798_109_741 198
523 3300035113 Ga0373936_0009587 Ga0373936_0009587_2726_3358 198
524 3300035113 Ga0373936_0016204 Ga0373936_0016204_157_792 198
525 3300035116 Ga0373945_0005969 Ga0373945_0005969_2810_3442 198
526 3300035116 Ga0373945_0110664 Ga0373945_0110664_177_812 198
527 3300035117 Ga0373953_0121954 Ga0373953_0121954_268_978 198
528 3300035118 Ga0373954_0029594 Ga0373954_0029594_10_642 198
529 3300035120 Ga0373957_0069477 Ga0373957_0069477_575_1285 198
530 3300035170 Ga0373943_0000357 Ga0373943_0000357_3369_4004 198
531 3300035170 Ga0373943_0005270 Ga0373943_0005270_4644_5276 198
532 3300035170 Ga0373943_0163452 Ga0373943_0163452_239_868 198
533 3300035171 Ga0373946_0024116 Ga0373946_0024116_1610_2242 198
534 3300035172 Ga0373955_0087890 Ga0373955_0087890_578_1288 198
535 3300035692 Ga0373935_0081654 Ga0373935_0081654_1362_1994 198
536 3300035695 Ga0373927_0101418 Ga0373927_0101418_943_1575 198
537 3300035724 Ga0373933_0012801 Ga0373933_0012801_3637_4347 198
538 3300035725 Ga0373947_0000467 Ga0373947_0000467_5467_6102 198
539 3300035725 Ga0373947_0006736 Ga0373947_0006736_2667_3299 198
540 3300036401 Ga0373937_0031471 Ga0373937_0031471_3755_4465 198
541 3300037068 Ga0373925_0011045 Ga0373925_0011045_5667_6299 198
542 3300037068 Ga0373925_0015591 Ga0373925_0015591_1821_2456 198
543 3300037312 Ga0395899_0056755 Ga0395899_0056755_702_1334 198
544 3300037312 Ga0395899_0154798 Ga0395899_0154798_191_826 198
545 3300037312 Ga0395899_0160309 Ga0395899_0160309_645_1274 198
546 3300037418 Ga0395900_0008280 Ga0395900_0008280_784_1419 198
547 3300037418 Ga0395900_0025335 Ga0395900_0025335_1816_2448 198
548 3300037418 Ga0395900_0026751 Ga0395900_0026751_3520_4149 198
549 3300037418 Ga0395900_0191056 Ga0395900_0191056_525_1154 198
550 3300037418 Ga0395900_0204366 Ga0395900_0204366_274_978 198
551 3300037418 Ga0395900_0210549 Ga0395900_0210549_349_1065 198
552 3300037418 Ga0395900_0225740 Ga0395900_0225740_739_1371 198
553 3300037418 Ga0395900_0260579 Ga0395900_0260579_1045_1683 198
554 3300037418 Ga0395900_0300023 Ga0395900_0300023_63_698 198
555 3300037418 Ga0395900_0318074 Ga0395900_0318074_26_658 198
556 3300037418 Ga0395900_0405916 Ga0395900_0405916_190_816 198
557 3300037418 Ga0395900_0525138 Ga0395900_0525138_383_1090 198
558 3300037418 Ga0395900_0898157 Ga0395900_0898157_161_796 198
559 3300037466 Ga0395898_0006898 Ga0395898_0006898_8330_8965 198
560 3300037466 Ga0395898_0030395 Ga0395898_0030395_666_1301 198
561 3300037466 Ga0395898_0050632 Ga0395898_0050632_849_1481 198
562 3300037466 Ga0395898_0081996 Ga0395898_0081996_1558_2184 198
563 3300037466 Ga0395898_0091570 Ga0395898_0091570_2106_2735 198
564 3300037466 Ga0395898_0147719 Ga0395898_0147719_1005_1721 198
565 3300037466 Ga0395898_0148534 Ga0395898_0148534_1478_2107 198
566 3300037466 Ga0395898_0197340 Ga0395898_0197340_465_1172 198
567 3300037466 Ga0395898_0197360 Ga0395898_0197360_533_1165 198
568 3300037466 Ga0395898_0272320 Ga0395898_0272320_270_911 198
569 3300037466 Ga0395898_0352011 Ga0395898_0352011_649_1362 198
570 3300037471 Ga0395905_0019582 Ga0395905_0019582_3210_3839 198
571 3300037471 Ga0395905_0060724 Ga0395905_0060724_1356_1982 198
572 3300037471 Ga0395905_0077445 Ga0395905_0077445_1875_2510 198
573 3300037471 Ga0395905_0081765 Ga0395905_0081765_2076_2711 198
574 3300037471 Ga0395905_0523005 Ga0395905_0523005_345_1049 198
575 3300038443 Ga0395901_0009262 Ga0395901_0009262_5533_6162 198
576 3300038443 Ga0395901_0009857 Ga0395901_0009857_820_1455 198
577 3300038443 Ga0395901_0013991 Ga0395901_0013991_4377_5009 198
578 3300038443 Ga0395901_0016094 Ga0395901_0016094_4192_4818 198
579 3300038443 Ga0395901_0061405 Ga0395901_0061405_336_1049 198
580 3300038443 Ga0395901_0070139 Ga0395901_0070139_2372_3004 198
581 3300038443 Ga0395901_0070469 Ga0395901_0070469_2559_3194 198
582 3300038443 Ga0395901_0136266 Ga0395901_0136266_1136_1852 198
583 3300038443 Ga0395901_0286495 Ga0395901_0286495_140_772 198
584 3300038443 Ga0395901_0454189 Ga0395901_0454189_656_1294 198
585 3300039437 Ga0436365_1605333 Ga0436365_1605333_3463_4095 198
586 3300039438 Ga0436360_1350995 Ga0436360_1350995_693_1328 198
587 3300039450 Ga0436363_0030512 Ga0436363_0030512_488_1120 198
588 3300039450 Ga0436363_0225970 Ga0436363_0225970_452_1084 198
589 3300039453 Ga0436362_1150903 Ga0436362_1150903_184_819 198
590 3300044656 Ga0466969_0124210 Ga0466969_0124210_243_869 198
591 3300044684 Ga0466966_0200675 Ga0466966_0200675_390_1016 198
592 3300044693 Ga0466961_0079786 Ga0466961_0079786_846_1472 198
593 3300044693 Ga0466961_0177642 Ga0466961_0177642_154_828 198
594 3300044693 Ga0466961_0307979 Ga0466961_0307979_59_691 198
595 3300044694 Ga0466963_0039511 Ga0466963_0039511_2077_2787 198
596 3300044694 Ga0466963_0092161 Ga0466963_0092161_804_1439 198
597 3300044694 Ga0466963_0147283 Ga0466963_0147283_346_972 198
598 3300044694 Ga0466963_0164462 Ga0466963_0164462_549_1265 198
599 3300044706 Ga0466964_0001492 Ga0466964_0001492_2405_3046 198
600 3300044706 Ga0466964_0012301 Ga0466964_0012301_1078_1710 198
601 3300044735 Ga0466968_0022352 Ga0466968_0022352_1215_1880 198
602 3300044735 Ga0466968_0032792 Ga0466968_0032792_1131_1766 198
603 3300044735 Ga0466968_0051476 Ga0466968_0051476_14_652 198
604 3300044842 Ga0466957_0041861 Ga0466957_0041861_1610_2284 198
605 3300044842 Ga0466957_0046503 Ga0466957_0046503_903_1529 198
606 3300044901 Ga0466960_0414368 Ga0466960_0414368_129_767 198
607 3300045049 Ga0466959_0030513 Ga0466959_0030513_2157_2831 198
608 3300045049 Ga0466959_0032895 Ga0466959_0032895_1442_2080 198
609 3300045049 Ga0466959_0048335 Ga0466959_0048335_1349_2014 198
610 3300045049 Ga0466959_0099750 Ga0466959_0099750_828_1466 198
611 3300045049 Ga0466959_0246075 Ga0466959_0246075_54_680 198
612 3300045836 Ga0466958_0019417 Ga0466958_0019417_1952_2626 198
613 3300045836 Ga0466958_0023936 Ga0466958_0023936_1591_2229 198
614 3300045836 Ga0466958_0203357 Ga0466958_0203357_536_1246 198
615 3300045836 Ga0466958_0230678 Ga0466958_0230678_193_819 198
616 3300045976 Ga0466967_0016056 Ga0466967_0016056_1979_2617 198
617 3300045976 Ga0466967_0024467 Ga0466967_0024467_1066_1782 198
618 3300045976 Ga0466967_0046297 Ga0466967_0046297_1721_2431 198
619 3300045976 Ga0466967_0048580 Ga0466967_0048580_2960_3592 198
620 3300045976 Ga0466967_0106537 Ga0466967_0106537_574_1209 198
621 3300045976 Ga0466967_0117652 Ga0466967_0117652_366_1001 198
622 3300045976 Ga0466967_0141382 Ga0466967_0141382_117_830 198
623 3300045976 Ga0466967_0149982 Ga0466967_0149982_820_1461 198
624 3300045976 Ga0466967_0401381 Ga0466967_0401381_522_1160 198
625 3300045976 Ga0466967_0559536 Ga0466967_0559536_272_901 198
626 3300045976 Ga0466967_0775280 Ga0466967_0775280_78_713 198
627 3300045976 Ga0466967_0844112 Ga0466967_0844112_19_651 198
628 3300046454 Ga0495592_0041408 Ga0495592_0041408_2315_3025 198
629 3300046454 Ga0495592_0140018 Ga0495592_0140018_187_822 198
630 3300046454 Ga0495592_0181259 Ga0495592_0181259_426_1055 198
631 3300046455 Ga0495603_0115231 Ga0495603_0115231_170_850 198
632 3300046455 Ga0495603_0303431 Ga0495603_0303431_155_784 198
633 3300046459 Ga0495629_0003480 Ga0495629_0003480_4801_5436 198
634 3300046461 Ga0495641_0001617 Ga0495641_0001617_15681_16316 198
635 3300046461 Ga0495641_0027802 Ga0495641_0027802_1396_2025 198
636 3300046461 Ga0495641_0178407 Ga0495641_0178407_221_931 198
637 3300046462 Ga0495651_0003896 Ga0495651_0003896_6715_7425 198
638 3300046462 Ga0495651_0016883 Ga0495651_0016883_2431_3066 198
639 3300046463 Ga0495653_0024022 Ga0495653_0024022_1518_2228 198
640 3300046463 Ga0495653_0027602 Ga0495653_0027602_310_939 198
641 3300046463 Ga0495653_0081821 Ga0495653_0081821_1049_1684 198
642 3300046463 Ga0495653_0210213 Ga0495653_0210213_606_1241 198
643 3300046473 Ga0495582_0000682 Ga0495582_0000682_2352_2987 198
644 3300046473 Ga0495582_0052285 Ga0495582_0052285_95_724 198
645 3300046473 Ga0495582_0118536 Ga0495582_0118536_71_706 198
646 3300046474 Ga0495605_0114575 Ga0495605_0114575_345_977 198
647 3300046475 Ga0495639_0002305 Ga0495639_0002305_1346_1981 198
648 3300046475 Ga0495639_0039970 Ga0495639_0039970_1130_1759 198
649 3300046476 Ga0495662_0005055 Ga0495662_0005055_3490_4125 198
650 3300046476 Ga0495662_0252168 Ga0495662_0252168_205_834 198
651 3300046477 Ga0495664_0082522 Ga0495664_0082522_1040_1675 198
652 3300046499 Ga0495594_0105508 Ga0495594_0105508_274_909 198
653 3300046511 Ga0495608_0003436 Ga0495608_0003436_1999_2709 198
654 3300046511 Ga0495608_0016422 Ga0495608_0016422_3072_3707 198
655 3300046511 Ga0495608_0088444 Ga0495608_0088444_945_1577 198
656 3300046511 Ga0495608_0113615 Ga0495608_0113615_140_769 198
657 3300046511 Ga0495608_0136865 Ga0495608_0136865_662_1297 198
658 3300046514 Ga0495618_0037859 Ga0495618_0037859_518_1147 198
659 3300046516 Ga0495628_0008643 Ga0495628_0008643_6415_7044 198
660 3300046516 Ga0495628_0487527 Ga0495628_0487527_108_818 198
661 3300046517 Ga0495630_0005888 Ga0495630_0005888_1009_1644 198
662 3300046517 Ga0495630_0006300 Ga0495630_0006300_5911_6540 198
663 3300046517 Ga0495630_0131912 Ga0495630_0131912_317_1027 198
664 3300046517 Ga0495630_0541823 Ga0495630_0541823_19_654 198
665 3300046526 Ga0495666_0110241 Ga0495666_0110241_132_761 198
666 3300046528 Ga0495642_0019012 Ga0495642_0019012_1433_2068 198
667 3300046529 Ga0495652_0060983 Ga0495652_0060983_2293_2928 198
668 3300046529 Ga0495652_0081588 Ga0495652_0081588_1315_1947 198
669 3300046529 Ga0495652_0083524 Ga0495652_0083524_1112_1822 198
670 3300046529 Ga0495652_0160406 Ga0495652_0160406_679_1326 198
671 3300046529 Ga0495652_0183662 Ga0495652_0183662_153_782 198
672 3300046529 Ga0495652_0240175 Ga0495652_0240175_298_933 198
673 3300046531 Ga0495665_0000111 Ga0495665_0000111_4786_5421 198
674 3300046533 Ga0495640_0029153 Ga0495640_0029153_781_1410 198
675 3300046533 Ga0495640_0085256 Ga0495640_0085256_1042_1677 198
676 3300046533 Ga0495640_0185010 Ga0495640_0185010_278_988 198
677 3300046535 Ga0495586_0036367 Ga0495586_0036367_1561_2190 198
678 3300046536 Ga0495587_0002231 Ga0495587_0002231_4408_5118 198
679 3300046543 Ga0495645_0069595 Ga0495645_0069595_272_982 198
680 3300046543 Ga0495645_0095460 Ga0495645_0095460_817_1446 198
681 3300046559 Ga0495667_0000965 Ga0495667_0000965_3354_4064 198
682 3300046559 Ga0495667_0002507 Ga0495667_0002507_9368_9997 198
683 3300046559 Ga0495667_0024631 Ga0495667_0024631_2923_3558 198
684 3300046559 Ga0495667_0082540 Ga0495667_0082540_1094_1741 198
685 3300046615 Ga0495656_0009876 Ga0495656_0009876_571_1218 198
686 3300046642 Ga0495634_0020937 Ga0495634_0020937_2792_3427 198
687 3300046642 Ga0495634_0040520 Ga0495634_0040520_2317_2964 198
688 3300046642 Ga0495634_0108756 Ga0495634_0108756_1104_1739 198
689 3300046642 Ga0495634_0253383 Ga0495634_0253383_37_717 198
690 3300046642 Ga0495634_0278999 Ga0495634_0278999_330_959 198
691 3300046663 Ga0495635_0007253 Ga0495635_0007253_1380_2090 198
692 3300046663 Ga0495635_0075695 Ga0495635_0075695_130_777 198
693 3300046663 Ga0495635_0343104 Ga0495635_0343104_341_970 198
694 3300046675 Ga0495657_0005164 Ga0495657_0005164_3734_4444 198
695 3300046675 Ga0495657_0190178 Ga0495657_0190178_378_1007 198
696 3300046678 Ga0495599_0010791 Ga0495599_0010791_4467_5177 198
697 3300046678 Ga0495599_0031242 Ga0495599_0031242_639_1268 198
698 3300046678 Ga0495599_0035678 Ga0495599_0035678_1124_1759 198
699 3300046679 Ga0495623_0196912 Ga0495623_0196912_251_961 198
700 3300046679 Ga0495623_0294858 Ga0495623_0294858_46_681 198
701 3300046679 Ga0495623_0367890 Ga0495623_0367890_100_732 198
702 3300046680 Ga0495646_0020943 Ga0495646_0020943_1781_2491 198
703 3300046680 Ga0495646_0046251 Ga0495646_0046251_773_1402 198
704 3300046680 Ga0495646_0057536 Ga0495646_0057536_1029_1661 198
705 3300046680 Ga0495646_0074492 Ga0495646_0074492_365_1000 198
706 3300046681 Ga0495647_0179494 Ga0495647_0179494_100_735 198
707 3300046683 Ga0495658_0000330 Ga0495658_0000330_10183_10818 198
708 3300046683 Ga0495658_0165748 Ga0495658_0165748_136_765 198
709 3300046683 Ga0495658_0476609 Ga0495658_0476609_18_698 198
710 3300046683 Ga0495658_0501577 Ga0495658_0501577_86_715 198
711 3300046689 Ga0495613_0003457 Ga0495613_0003457_1183_1818 198
712 3300046689 Ga0495613_0045815 Ga0495613_0045815_2210_2857 198
713 3300046689 Ga0495613_0073293 Ga0495613_0073293_1797_2426 198
714 3300046689 Ga0495613_0117075 Ga0495613_0117075_1158_1787 198
715 3300046689 Ga0495613_0160226 Ga0495613_0160226_754_1386 198
716 3300046689 Ga0495613_0185986 Ga0495613_0185986_26_736 198
717 3300046690 Ga0495624_0024911 Ga0495624_0024911_1823_2458 198
718 3300046690 Ga0495624_0043738 Ga0495624_0043738_1057_1704 198
719 3300046809 Ga0495600_0001291 Ga0495600_0001291_9286_9996 198
720 3300046809 Ga0495600_0052829 Ga0495600_0052829_1975_2610 198
721 3300046809 Ga0495600_0341491 Ga0495600_0341491_233_865 198
722 3300047315 Ga0495581_0001504 Ga0495581_0001504_2377_3012 198
723 3300047315 Ga0495581_0030055 Ga0495581_0030055_1695_2324 198
724 3300047315 Ga0495581_0206064 Ga0495581_0206064_178_858 198
725 3300047315 Ga0495581_0342152 Ga0495581_0342152_218_853 198
726 3300047317 Ga0495604_0003733 Ga0495604_0003733_1112_1822 198
727 3300047317 Ga0495604_0072526 Ga0495604_0072526_416_1051 198
728 3300047319 Ga0495674_0021694 Ga0495674_0021694_4087_4722 198
729 3300047319 Ga0495674_0026937 Ga0495674_0026937_1183_1812 198
730 3300047319 Ga0495674_0122190 Ga0495674_0122190_300_1010 198
731 3300047319 Ga0495674_0123627 Ga0495674_0123627_422_1051 198
732 3300047319 Ga0495674_0197027 Ga0495674_0197027_894_1541 198
733 3300047321 Ga0495676_0000450 Ga0495676_0000450_23300_23935 198
734 3300047321 Ga0495676_0064124 Ga0495676_0064124_1402_2082 198
735 3300047321 Ga0495676_0131631 Ga0495676_0131631_718_1350 198
736 3300047321 Ga0495676_0184408 Ga0495676_0184408_403_1038 198
737 3300047322 Ga0495680_0002908 Ga0495680_0002908_8705_9340 198
738 3300047322 Ga0495680_0006974 Ga0495680_0006974_7286_7933 198
739 3300047322 Ga0495680_0009129 Ga0495680_0009129_5810_6439 198
740 3300047322 Ga0495680_0009676 Ga0495680_0009676_3417_4052 198
741 3300047322 Ga0495680_0013899 Ga0495680_0013899_5991_6701 198
742 3300047444 Ga0495675_0051883 Ga0495675_0051883_325_1035 198
743 3300047445 Ga0495677_0131546 Ga0495677_0131546_190_840 198
744 3300047471 Ga0495684_0008955 Ga0495684_0008955_6274_6909 198
745 3300047471 Ga0495684_0011927 Ga0495684_0011927_3313_3948 198
746 3300047471 Ga0495684_0017940 Ga0495684_0017940_892_1521 198
747 3300047471 Ga0495684_0023917 Ga0495684_0023917_2978_3625 198
748 3300047471 Ga0495684_0028310 Ga0495684_0028310_356_1066 198
749 3300047673 Ga0495593_0008171 Ga0495593_0008171_3243_3878 198
750 3300047673 Ga0495593_0060508 Ga0495593_0060508_488_1120 198
751 3300048088 Ga0495602_0012401 Ga0495602_0012401_5135_5845 198
752 3300048088 Ga0495602_0153156 Ga0495602_0153156_1035_1664 198
753 3300048088 Ga0495602_0342804 Ga0495602_0342804_117_749 198
754 3300048089 Ga0495614_0007584 Ga0495614_0007584_4103_4738 198
755 3300048903 Ga0496100_0003687 Ga0496100_0003687_6052_6687 198
756 3300048903 Ga0496100_0004256 Ga0496100_0004256_2181_2813 198
757 3300048903 Ga0496100_0015632 Ga0496100_0015632_412_1119 198
758 3300048903 Ga0496100_0016329 Ga0496100_0016329_3160_3795 198
759 3300048903 Ga0496100_0025706 Ga0496100_0025706_331_963 198
760 3300048903 Ga0496100_0343380 Ga0496100_0343380_296_931 198
761 3300048904 Ga0496101_0008094 Ga0496101_0008094_3471_4103 198
762 3300048904 Ga0496101_0053373 Ga0496101_0053373_1757_2464 198
763 3300048904 Ga0496101_0077655 Ga0496101_0077655_449_1081 198
764 3300048904 Ga0496101_0084889 Ga0496101_0084889_840_1475 198
765 3300048905 Ga0496102_0010523 Ga0496102_0010523_6118_6750 198
766 3300048905 Ga0496102_0024471 Ga0496102_0024471_4295_4930 198
767 3300048905 Ga0496102_0101814 Ga0496102_0101814_1165_1797 198
768 3300048905 Ga0496102_0111378 Ga0496102_0111378_1829_2464 198
769 3300048906 Ga0496103_0025806 Ga0496103_0025806_1948_2586 198
770 3300048906 Ga0496103_0045468 Ga0496103_0045468_1173_1805 198
771 3300048906 Ga0496103_0343184 Ga0496103_0343184_68_700 198
772 3300048907 Ga0496104_0006326 Ga0496104_0006326_3846_4481 198
773 3300048907 Ga0496104_0089314 Ga0496104_0089314_291_926 198
774 3300048907 Ga0496104_0310341 Ga0496104_0310341_145_774 198
775 3300048907 Ga0496104_0365388 Ga0496104_0365388_170_850 198
776 3300048907 Ga0496104_1056369 Ga0496104_1056369_62_697 198
777 3300048908 Ga0496105_0007064 Ga0496105_0007064_6058_6693 198
778 3300048908 Ga0496105_0065718 Ga0496105_0065718_446_1078 198
779 3300048908 Ga0496105_0171178 Ga0496105_0171178_770_1405 198
780 3300048908 Ga0496105_0307830 Ga0496105_0307830_451_1131 198
781 3300048908 Ga0496105_0433390 Ga0496105_0433390_259_906 198
782 3300048909 Ga0496106_0004250 Ga0496106_0004250_8893_9528 198
783 3300048909 Ga0496106_0047941 Ga0496106_0047941_213_845 198
784 3300048909 Ga0496106_0091766 Ga0496106_0091766_229_936 198
785 3300048909 Ga0496106_0417554 Ga0496106_0417554_206_850 198
786 3300048910 Ga0496107_0006798 Ga0496107_0006798_6064_6696 198
787 3300048910 Ga0496107_0009452 Ga0496107_0009452_5392_6027 198
788 3300048910 Ga0496107_0014706 Ga0496107_0014706_950_1657 198
789 3300048910 Ga0496107_0172596 Ga0496107_0172596_190_813 198
790 3300048910 Ga0496107_0185737 Ga0496107_0185737_450_1082 198
791 3300048910 Ga0496107_0282623 Ga0496107_0282623_25_654 198
792 3300048910 Ga0496107_0307822 Ga0496107_0307822_276_911 198
793 3300048911 Ga0496108_0001690 Ga0496108_0001690_8086_8766 198
794 3300048911 Ga0496108_0065911 Ga0496108_0065911_1477_2124 198
795 3300048911 Ga0496108_0124059 Ga0496108_0124059_834_1469 198
796 3300048911 Ga0496108_0913420 Ga0496108_0913420_62_694 198
797 3300048912 Ga0496109_0000605 Ga0496109_0000605_232_912 198
798 3300048912 Ga0496109_0003633 Ga0496109_0003633_4703_5338 198
799 3300048912 Ga0496109_0020405 Ga0496109_0020405_1508_2146 198
800 3300048912 Ga0496109_0082140 Ga0496109_0082140_468_1100 198
801 3300048912 Ga0496109_0204306 Ga0496109_0204306_318_965 198
802 3300048912 Ga0496109_0271373 Ga0496109_0271373_439_1068 198
803 3300048912 Ga0496109_0535479 Ga0496109_0535479_427_1062 198
804 3300048913 Ga0496110_0035220 Ga0496110_0035220_637_1272 198
805 3300048913 Ga0496110_0181288 Ga0496110_0181288_578_1225 198
806 3300048913 Ga0496110_0202978 Ga0496110_0202978_165_794 198
807 3300048913 Ga0496110_0211734 Ga0496110_0211734_942_1574 198
808 3300048913 Ga0496110_0446840 Ga0496110_0446840_166_795 198
809 3300048913 Ga0496110_0652466 Ga0496110_0652466_120_761 198
810 3300048914 Ga0496111_0001372 Ga0496111_0001372_5293_5973 198
811 3300048914 Ga0496111_0025935 Ga0496111_0025935_1192_1827 198
812 3300048914 Ga0496111_0045100 Ga0496111_0045100_2197_2871 198
813 3300048914 Ga0496111_0077649 Ga0496111_0077649_61_696 198
814 3300048914 Ga0496111_0091267 Ga0496111_0091267_982_1629 198
815 3300048914 Ga0496111_0158808 Ga0496111_0158808_969_1601 198
816 3300048914 Ga0496111_0186357 Ga0496111_0186357_500_1141 198
817 3300048914 Ga0496111_0208968 Ga0496111_0208968_421_1053 198
818 3300048914 Ga0496111_0334179 Ga0496111_0334179_413_1057 198
819 3300048915 Ga0496112_0000273 Ga0496112_0000273_8374_9003 198
820 3300048915 Ga0496112_0011211 Ga0496112_0011211_4467_5099 198
821 3300048915 Ga0496112_0019704 Ga0496112_0019704_533_1165 198
822 3300048915 Ga0496112_0027531 Ga0496112_0027531_1479_2117 198
823 3300048915 Ga0496112_0108747 Ga0496112_0108747_725_1360 198
824 3300048915 Ga0496112_0112468 Ga0496112_0112468_1436_2068 198
825 3300048915 Ga0496112_0184011 Ga0496112_0184011_522_1202 198
826 3300048915 Ga0496112_0259474 Ga0496112_0259474_156_788 198
827 3300048915 Ga0496112_0558889 Ga0496112_0558889_404_1048 198
828 3300048915 Ga0496112_1084694 Ga0496112_1084694_32_664 198
829 3300048916 Ga0496113_0181162 Ga0496113_0181162_313_945 198
830 3300048916 Ga0496113_0404965 Ga0496113_0404965_318_998 198
831 3300048916 Ga0496113_0497603 Ga0496113_0497603_151_792 198
832 3300048917 Ga0496114_0002771 Ga0496114_0002771_7226_7861 198
833 3300048917 Ga0496114_0012654 Ga0496114_0012654_822_1457 198
834 3300048917 Ga0496114_0029401 Ga0496114_0029401_957_1589 198
835 3300048917 Ga0496114_0120163 Ga0496114_0120163_90_722 198
836 3300048917 Ga0496114_0366793 Ga0496114_0366793_284_994 198
837 3300048918 Ga0496115_0001894 Ga0496115_0001894_3522_4157 198
838 3300048918 Ga0496115_0006368 Ga0496115_0006368_1986_2621 198
839 3300048918 Ga0496115_0033800 Ga0496115_0033800_1956_2666 198
840 3300048918 Ga0496115_0165067 Ga0496115_0165067_185_820 198
841 3300048918 Ga0496115_0222658 Ga0496115_0222658_241_879 198
842 3300049571 Ga0501034_0164444 Ga0501034_0164444_572_1210 198
843 3300049580 Ga0501046_0190722 Ga0501046_0190722_734_1372 198
844 3300049581 Ga0501047_0010057 Ga0501047_0010057_3526_4164 198
845 3300049581 Ga0501047_0026688 Ga0501047_0026688_302_928 198
846 3300049583 Ga0501067_0001219 Ga0501067_0001219_96_737 198
847 3300049583 Ga0501067_0077725 Ga0501067_0077725_232_867 198
848 3300049583 Ga0501067_0203132 Ga0501067_0203132_126_764 198
849 3300049584 Ga0501068_0126481 Ga0501068_0126481_662_1303 198
850 3300049585 Ga0501069_0007861 Ga0501069_0007861_3490_4131 198
851 3300049585 Ga0501069_0061929 Ga0501069_0061929_207_833 198
852 3300049586 Ga0501070_0000120 Ga0501070_0000120_42785_43501 198
853 3300049589 Ga0501073_0072000 Ga0501073_0072000_1310_1936 198
854 3300049590 Ga0501074_0010622 Ga0501074_0010622_2348_2974 198
855 3300049592 Ga0501076_0260869 Ga0501076_0260869_324_956 198
856 3300049592 Ga0501076_0479639 Ga0501076_0479639_265_897 198
857 3300049742 Ga0501080_0260736 Ga0501080_0260736_256_969 198
858 3300049822 Ga0501035_0297353 Ga0501035_0297353_342_1055 198
859 3300049822 Ga0501035_0394119 Ga0501035_0394119_168_794 198
860 3300049823 Ga0501044_0211408 Ga0501044_0211408_254_892 198
861 3300049823 Ga0501044_0334938 Ga0501044_0334938_754_1380 198
862 3300050490 nmdc:mga03n38_112395_c1 nmdc:mga03n38_112395_c1_483_1121 198
863 3300050492 nmdc:mga0yw44_45111_c1 nmdc:mga0yw44_45111_c1_547_1194 198
864 3300050507 nmdc:mga05p37_10748_c1 nmdc:mga05p37_10748_c1_1946_2584 198
865 3300050507 nmdc:mga05p37_1109513_c1 nmdc:mga05p37_1109513_c1_13_645 198
866 3300050507 nmdc:mga05p37_147138_c1 nmdc:mga05p37_147138_c1_968_1603 198
867 3300050507 nmdc:mga05p37_208837_c1 nmdc:mga05p37_208837_c1_818_1462 198
868 3300050510 nmdc:mga06r32_325621_c1 nmdc:mga06r32_325621_c1_739_1377 198
869 3300050512 nmdc:mga0n895_40422_c1 nmdc:mga0n895_40422_c1_2723_3361 198
870 3300050512 nmdc:mga0n895_503189_c1 nmdc:mga0n895_503189_c1_430_1065 198
871 3300050512 nmdc:mga0n895_713751_c1 nmdc:mga0n895_713751_c1_38_670 198
872 3300050512 nmdc:mga0n895_958627_c1 nmdc:mga0n895_958627_c1_12_680 198
873 3300050513 nmdc:mga0rr50_143685_c1 nmdc:mga0rr50_143685_c1_123_830 198
874 3300050513 nmdc:mga0rr50_17281_c1 nmdc:mga0rr50_17281_c1_719_1357 198
875 3300050513 nmdc:mga0rr50_198601_c1 nmdc:mga0rr50_198601_c1_800_1471 198
876 3300050514 nmdc:mga08x19_36535_c1 nmdc:mga08x19_36535_c1_1304_1942 198
877 3300050515 nmdc:mga0a205_151356_c2 nmdc:mga0a205_151356_c2_68_697 198
878 3300050515 nmdc:mga0a205_63929_c1 nmdc:mga0a205_63929_c1_921_1559 198
879 3300053077 Ga0495601_0016778 Ga0495601_0016778_920_1552 198
880 3300053077 Ga0495601_0230641 Ga0495601_0230641_112_741 198
881 3300053078 Ga0495612_0044660 Ga0495612_0044660_942_1574 198
882 3300053084 Ga0495595_0018078 Ga0495595_0018078_2000_2647 198
883 3300053084 Ga0495595_0037728 Ga0495595_0037728_1146_1781 198
884 3300053085 Ga0495619_0001713 Ga0495619_0001713_4721_5356 198
885 3300053085 Ga0495619_0002632 Ga0495619_0002632_4283_4993 198
886 3300053085 Ga0495619_0002961 Ga0495619_0002961_9416_10051 198
887 3300060353 Ga0501082_0261483 Ga0501082_0261483_156_794 198
888 3300060353 Ga0501082_0572802 Ga0501082_0572802_199_831 198
889 3300061734 Ga0530510_0069148 Ga0530510_0069148_1588_2229 198
890 3300005434 Ga0070709_10181086 Ga0070709_101810862 199
891 3300009098 Ga0105245_11246535 Ga0105245_112465351 199
892 3300009553 Ga0105249_10003964 Ga0105249_100039645 199
893 3300014326 Ga0157380_10008469 Ga0157380_100084692 199
894 3300014969 Ga0157376_10007598 Ga0157376_100075982 199
895 3300025906 Ga0207699_10089496 Ga0207699_100894962 199
896 3300025929 Ga0207664_10101566 Ga0207664_101015662 199
897 3300037312 Ga0395899_0027220 Ga0395899_0027220_513_1157 199
898 3300037312 Ga0395899_0287948 Ga0395899_0287948_170_799 199
899 3300037418 Ga0395900_0006950 Ga0395900_0006950_3614_4258 199
900 3300037418 Ga0395900_0287912 Ga0395900_0287912_192_821 199
901 3300037466 Ga0395898_0089660 Ga0395898_0089660_1781_2410 199
902 3300037471 Ga0395905_0094392 Ga0395905_0094392_1946_2590 199
903 3300038443 Ga0395901_0016980 Ga0395901_0016980_4577_5221 199
904 3300038443 Ga0395901_0237973 Ga0395901_0237973_1016_1645 199
905 3300046455 Ga0495603_0051830 Ga0495603_0051830_1086_1739 199
906 3300046473 Ga0495582_0084100 Ga0495582_0084100_577_1230 199
907 3300046499 Ga0495594_0172866 Ga0495594_0172866_209_862 199
908 3300046674 Ga0495588_0047299 Ga0495588_0047299_1285_1938 199
909 3300047315 Ga0495581_0370078 Ga0495581_0370078_23_676 199
910 3300047321 Ga0495676_0036162 Ga0495676_0036162_211_864 199
911 3300048904 Ga0496101_0284739 Ga0496101_0284739_351_995 199
912 3300048905 Ga0496102_0219048 Ga0496102_0219048_552_1196 199
913 3300048907 Ga0496104_0009980 Ga0496104_0009980_2243_2887 199
914 3300048908 Ga0496105_0007204 Ga0496105_0007204_5774_6418 199
915 3300048909 Ga0496106_0097026 Ga0496106_0097026_373_1017 199
916 3300048911 Ga0496108_0016216 Ga0496108_0016216_3779_4423 199
917 3300048912 Ga0496109_0000576 Ga0496109_0000576_4001_4645 199
918 3300048913 Ga0496110_0003721 Ga0496110_0003721_345_989 199
919 3300048914 Ga0496111_0011531 Ga0496111_0011531_1488_2132 199
920 3300048915 Ga0496112_0009544 Ga0496112_0009544_611_1255 199
921 3300048916 Ga0496113_0021814 Ga0496113_0021814_2255_2899 199
922 3300048917 Ga0496114_0021259 Ga0496114_0021259_1303_1947 199
923 3300048918 Ga0496115_0005207 Ga0496115_0005207_3466_4110 199
924 3300005330 Ga0070690_100051760 Ga0070690_1000517602 200
925 3300005335 Ga0070666_10340104 Ga0070666_103401042 200
926 3300005338 Ga0068868_100016225 Ga0068868_1000162254 200
927 3300005339 Ga0070660_100011699 Ga0070660_1000116994 200
928 3300005345 Ga0070692_10058883 Ga0070692_100588833 200
929 3300005347 Ga0070668_100016085 Ga0070668_1000160854 200
930 3300005354 Ga0070675_100104713 Ga0070675_1001047132 200
931 3300005356 Ga0070674_100134103 Ga0070674_1001341033 200
932 3300005364 Ga0070673_100037073 Ga0070673_1000370734 200
933 3300005366 Ga0070659_100031080 Ga0070659_1000310803 200
934 3300005367 Ga0070667_100110520 Ga0070667_1001105203 200
935 3300005437 Ga0070710_10035305 Ga0070710_100353053 200
936 3300005438 Ga0070701_10034471 Ga0070701_100344713 200
937 3300005439 Ga0070711_100001144 Ga0070711_1000011443 200
938 3300005440 Ga0070705_100009138 Ga0070705_1000091383 200
939 3300005441 Ga0070700_100007946 Ga0070700_1000079465 200
940 3300005444 Ga0070694_100025028 Ga0070694_1000250284 200
941 3300005466 Ga0070685_10520404 Ga0070685_105204041 200
942 3300005539 Ga0068853_100028151 Ga0068853_1000281514 200
943 3300005545 Ga0070695_100207014 Ga0070695_1002070142 200
944 3300005546 Ga0070696_100199666 Ga0070696_1001996663 200
945 3300005547 Ga0070693_100100573 Ga0070693_1001005732 200
946 3300005548 Ga0070665_100266455 Ga0070665_1002664553 200
947 3300005616 Ga0068852_100356913 Ga0068852_1003569132 200
948 3300005718 Ga0068866_10003857 Ga0068866_100038575 200
949 3300005719 Ga0068861_100024794 Ga0068861_1000247942 200
950 3300005843 Ga0068860_100139091 Ga0068860_1001390912 200
951 3300005844 Ga0068862_100342030 Ga0068862_1003420302 200
952 3300006163 Ga0070715_10141881 Ga0070715_101418812 200
953 3300006237 Ga0097621_100011723 Ga0097621_1000117237 200
954 3300006358 Ga0068871_100026438 Ga0068871_1000264383 200
955 3300006881 Ga0068865_100049045 Ga0068865_1000490453 200
956 3300009098 Ga0105245_10020362 Ga0105245_100203626 200
957 3300009101 Ga0105247_10104196 Ga0105247_101041962 200
958 3300009148 Ga0105243_10003921 Ga0105243_100039218 200
959 3300009177 Ga0105248_10340525 Ga0105248_103405253 200
960 3300009177 Ga0105248_10516646 Ga0105248_105166462 200
961 3300009551 Ga0105238_10042715 Ga0105238_100427153 200
962 3300011119 Ga0105246_10035463 Ga0105246_100354633 200
963 3300013296 Ga0157374_10026155 Ga0157374_100261553 200
964 3300013297 Ga0157378_10068908 Ga0157378_100689084 200
965 3300013306 Ga0163162_10005877 Ga0163162_100058779 200
966 3300025899 Ga0207642_10036145 Ga0207642_100361452 200
967 3300025911 Ga0207654_10069834 Ga0207654_100698342 200
968 3300025915 Ga0207693_10001754 Ga0207693_100017548 200
969 3300025917 Ga0207660_10123410 Ga0207660_101234103 200
970 3300025918 Ga0207662_10014548 Ga0207662_100145484 200
971 3300025919 Ga0207657_10020124 Ga0207657_100201244 200
972 3300025926 Ga0207659_10072351 Ga0207659_100723512 200
973 3300025932 Ga0207690_10144472 Ga0207690_101444722 200
974 3300025933 Ga0207706_10167089 Ga0207706_101670892 200
975 3300025935 Ga0207709_10014190 Ga0207709_100141903 200
976 3300025936 Ga0207670_10011870 Ga0207670_100118705 200
977 3300025939 Ga0207665_10014209 Ga0207665_100142096 200
978 3300025940 Ga0207691_10002643 Ga0207691_100026435 200
979 3300025941 Ga0207711_10271573 Ga0207711_102715732 200
980 3300025961 Ga0207712_10004878 Ga0207712_100048787 200
981 3300025972 Ga0207668_10013595 Ga0207668_100135954 200
982 3300026023 Ga0207677_10071251 Ga0207677_100712512 200
983 3300026075 Ga0207708_10004755 Ga0207708_1000475510 200
984 3300026078 Ga0207702_10069185 Ga0207702_100691851 200
985 3300026089 Ga0207648_10000150 Ga0207648_1000015048 200
986 3300026095 Ga0207676_10472465 Ga0207676_104724651 200
987 3300026118 Ga0207675_100011845 Ga0207675_1000118457 200
988 3300026121 Ga0207683_10000131 Ga0207683_1000013144 200
989 3300028380 Ga0268265_10255892 Ga0268265_102558923 200
990 3300028381 Ga0268264_10427563 Ga0268264_104275632 200
991 3300028800 Ga0265338_10002640 Ga0265338_100026402 200
992 3300037312 Ga0395899_0010041 Ga0395899_0010041_650_1330 200
993 3300037312 Ga0395899_0012131 Ga0395899_0012131_3644_4324 200
994 3300037418 Ga0395900_0002321 Ga0395900_0002321_6378_7058 200
995 3300037418 Ga0395900_0002916 Ga0395900_0002916_10676_11356 200
996 3300037418 Ga0395900_0003619 Ga0395900_0003619_10474_11154 200
997 3300037418 Ga0395900_0169751 Ga0395900_0169751_601_1281 200
998 3300037466 Ga0395898_0002298 Ga0395898_0002298_6379_7059 200
999 3300037466 Ga0395898_0003164 Ga0395898_0003164_4444_5124 200
1000 3300037466 Ga0395898_0038637 Ga0395898_0038637_192_848 200
1001 3300037471 Ga0395905_0002318 Ga0395905_0002318_9493_10173 200
1002 3300037471 Ga0395905_0015483 Ga0395905_0015483_6379_7059 200
1003 3300037471 Ga0395905_0026294 Ga0395905_0026294_4717_5397 200
1004 3300037471 Ga0395905_0041514 Ga0395905_0041514_1299_1979 200
1005 3300038443 Ga0395901_0002740 Ga0395901_0002740_9352_10032 200
1006 3300038443 Ga0395901_0011266 Ga0395901_0011266_2927_3607 200
1007 3300038443 Ga0395901_0209905 Ga0395901_0209905_418_1098 200
1008 3300046462 Ga0495651_0168173 Ga0495651_0168173_322_966 200
1009 3300046491 Ga0495584_0048577 Ga0495584_0048577_1021_1677 200
1010 3300046511 Ga0495608_0181152 Ga0495608_0181152_584_1225 200
1011 3300046514 Ga0495618_0221899 Ga0495618_0221899_235_879 200
1012 3300046517 Ga0495630_0101498 Ga0495630_0101498_439_1119 200
1013 3300046518 Ga0495631_0125378 Ga0495631_0125378_26_682 200
1014 3300046525 Ga0495663_0019713 Ga0495663_0019713_798_1454 200
1015 3300046529 Ga0495652_0035030 Ga0495652_0035030_2157_2798 200
1016 3300046615 Ga0495656_0088648 Ga0495656_0088648_474_1130 200
1017 3300047317 Ga0495604_0576289 Ga0495604_0576289_19_669 200
1018 3300047318 Ga0495636_0035350 Ga0495636_0035350_360_1016 200
1019 3300048903 Ga0496100_0167753 Ga0496100_0167753_300_956 200
1020 3300048904 Ga0496101_0028304 Ga0496101_0028304_3154_3810 200
1021 3300048905 Ga0496102_0028507 Ga0496102_0028507_237_893 200
1022 3300048906 Ga0496103_0010053 Ga0496103_0010053_1977_2633 200
1023 3300048907 Ga0496104_0020456 Ga0496104_0020456_2879_3535 200
1024 3300048909 Ga0496106_0022615 Ga0496106_0022615_2421_3077 200
1025 3300048910 Ga0496107_0017194 Ga0496107_0017194_1522_2178 200
1026 3300048917 Ga0496114_0272143 Ga0496114_0272143_764_1420 200
1027 3300050510 nmdc:mga06r32_144488_c1 nmdc:mga06r32_144488_c1_1009_1638 200
1028 3300053077 Ga0495601_0029007 Ga0495601_0029007_1041_1682 200
1029 3300053077 Ga0495601_0267342 Ga0495601_0267342_64_708 200
1030 3300053085 Ga0495619_0147967 Ga0495619_0147967_870_1514 200
1031 3300003373 JGI25407J50210_10003353 JGI25407J50210_100033533 201
1032 3300005536 Ga0070697_100137328 Ga0070697_1001373282 201
1033 3300005981 Ga0081538_10002124 Ga0081538_1000212416 201
1034 3300006038 Ga0075365_10233816 Ga0075365_102338162 201
1035 3300006051 Ga0075364_10065715 Ga0075364_100657152 201
1036 3300006058 Ga0075432_10031194 Ga0075432_100311942 201
1037 3300006195 Ga0075366_10148581 Ga0075366_101485812 201
1038 3300006846 Ga0075430_100105604 Ga0075430_1001056043 201
1039 3300009093 Ga0105240_10231006 Ga0105240_102310063 201
1040 3300027907 Ga0207428_10299312 Ga0207428_102993122 201
1041 3300028573 Ga0265334_10004404 Ga0265334_100044045 201
1042 3300028654 Ga0265322_10036811 Ga0265322_100368112 201
1043 3300028666 Ga0265336_10004674 Ga0265336_100046742 201
1044 3300028800 Ga0265338_10001061 Ga0265338_100010615 201
1045 3300028800 Ga0265338_10003129 Ga0265338_1000312910 201
1046 3300031239 Ga0265328_10102210 Ga0265328_101022101 201
1047 3300031251 Ga0265327_10021489 Ga0265327_100214895 201
1048 3300031595 Ga0265313_10004905 Ga0265313_100049059 201
1049 3300035114 Ga0373939_0023376 Ga0373939_0023376_439_1086 201
1050 3300035410 Ga0373924_0059168 Ga0373924_0059168_235_888 201
1051 3300036401 Ga0373937_0529716 Ga0373937_0529716_93_740 201
1052 3300037312 Ga0395899_0001360 Ga0395899_0001360_4420_5055 201
1053 3300037312 Ga0395899_0018647 Ga0395899_0018647_2275_2907 201
1054 3300037418 Ga0395900_0163100 Ga0395900_0163100_962_1597 201
1055 3300037418 Ga0395900_0250782 Ga0395900_0250782_641_1276 201
1056 3300037466 Ga0395898_0108302 Ga0395898_0108302_891_1526 201
1057 3300037466 Ga0395898_0165006 Ga0395898_0165006_383_1018 201
1058 3300037466 Ga0395898_0351910 Ga0395898_0351910_500_1165 201
1059 3300037471 Ga0395905_0209470 Ga0395905_0209470_429_1064 201
1060 3300038443 Ga0395901_0168495 Ga0395901_0168495_496_1131 201
1061 3300038443 Ga0395901_0411832 Ga0395901_0411832_59_694 201
1062 3300038443 Ga0395901_0855875 Ga0395901_0855875_61_726 201
1063 3300039450 Ga0436363_1093415 Ga0436363_1093415_331_978 201
1064 3300046454 Ga0495592_0165294 Ga0495592_0165294_157_801 201
1065 3300046462 Ga0495651_0521262 Ga0495651_0521262_95_739 201
1066 3300046463 Ga0495653_0159454 Ga0495653_0159454_18_662 201
1067 3300046477 Ga0495664_0046958 Ga0495664_0046958_865_1509 201
1068 3300046511 Ga0495608_0147392 Ga0495608_0147392_414_1058 201
1069 3300046516 Ga0495628_0069241 Ga0495628_0069241_866_1564 201
1070 3300046517 Ga0495630_0349475 Ga0495630_0349475_350_1003 201
1071 3300046559 Ga0495667_0192551 Ga0495667_0192551_391_1035 201
1072 3300046642 Ga0495634_0390613 Ga0495634_0390613_70_714 201
1073 3300046663 Ga0495635_0270692 Ga0495635_0270692_452_1096 201
1074 3300046689 Ga0495613_0140080 Ga0495613_0140080_278_931 201
1075 3300046809 Ga0495600_0021213 Ga0495600_0021213_1873_2517 201
1076 3300047317 Ga0495604_0094973 Ga0495604_0094973_1438_2082 201
1077 3300047319 Ga0495674_0257790 Ga0495674_0257790_256_900 201
1078 3300047471 Ga0495684_0346688 Ga0495684_0346688_99_743 201
1079 3300048088 Ga0495602_0220245 Ga0495602_0220245_678_1331 201
1080 3300050492 nmdc:mga0yw44_234796_c1 nmdc:mga0yw44_234796_c1_69_701 201
1081 3300050493 nmdc:mga0k408_90160_c1 nmdc:mga0k408_90160_c1_471_1103 201
1082 3300050507 nmdc:mga05p37_436175_c1 nmdc:mga05p37_436175_c1_394_1026 201
1083 3300050508 nmdc:mga09592_571015_c1 nmdc:mga09592_571015_c1_194_826 201
1084 3300050510 nmdc:mga06r32_740491_c1 nmdc:mga06r32_740491_c1_99_731 201
1085 3300053077 Ga0495601_0076054 Ga0495601_0076054_789_1433 201
1086 3300053077 Ga0495601_0130067 Ga0495601_0130067_309_953 201
1087 3300053078 Ga0495612_0184169 Ga0495612_0184169_256_900 201
1088 3300053084 Ga0495595_0057306 Ga0495595_0057306_930_1574 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

61

226

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d92-assembly2.cif.gz_B structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.7906 27 200
5d92-assembly2.cif.gz_C structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.7895 27 200
6h5a-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in complex with manganese and citrate 0.781 22 194
6h59-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) with cdp-dag bound 0.7726 20 194
6wm5-assembly1.cif.gz_C structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii 0.7701 20 191
ID Description Score Start End Superfamily
af_P9WPG7_9_203_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7632 16 194 1.20.120.1760
5d92A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7417 14 200 1.20.120.1760
4o6mB02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7388 19 195 1.20.120.1760
af_P9WPG7_9_203_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.701 16 194 1.20.120.1760
5d92A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.6907 14 200 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A7C5HE60-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9601 90 201 GO:0016020
AF-A0A7C5HE60-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9433 90 201 GO:0016020
AF-A0A3C0TUQ1-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.935 82 200 GO:0008654
GO:0016020
GO:0016780
AF-A0A1F8U2W0-F1-model_v4 CDP-alcohol phosphatidyltransferase 0.9028 77 200 GO:0008654
GO:0016020
GO:0016780
AF-A0A3C0TUQ1-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.891 82 200 GO:0008654
GO:0016020
GO:0016780

Feature Viewer

pLDDT pTM Quality
82.9 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map