F489822
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1088 | 361 | 1088 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300005536|Ga0070697_100137328|Ga0070697_1001373282 |
| Length | 246 |
| Sequence | VGRVARVSDRGFLGRRWQRLRRAGADAGQGRAIVIERVKDAYTSEARRLASRSILGLTRTRISPNALTASGVALCAAASVLVYFEYRDELLFYWLGAGFFVIGSILDILDGALARAGGKTTPFGAFLDSTTDRVSEGFMLGAIALVFSRHADEVALAFAFAAVAGSFLVSYTRARAEALGLRGDVGIGSRAERVVVITVGLVFAPWGALPWAIYLLAATAWVTVLQRILHVRTQLRRKDSDGFEKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 172 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 186 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 212 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 213 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 215 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 216 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 217 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 218 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 219 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 220 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 226 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 227 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 357 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 358 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 361 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.71 |
| Metatranscriptomes | 1.29 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.74 |
| Nodule | 0 |
| Rhizoplane | 13.79 |
| Rhizosphere | 84.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10003353 | 3300003373 | Bacteria | 3820 |
| 2 | Ga0070683_100000847 | 3300005329 | Bacteria | 22661 |
| 3 | Ga0070683_100026408 | 3300005329 | Bacteria | 5228 |
| 4 | Ga0070683_100073714 | 3300005329 | Bacteria | 3187 |
| 5 | Ga0070683_100087739 | 3300005329 | Bacteria | 2918 |
| 6 | Ga0070683_100198472 | 3300005329 | Bacteria | 1905 |
| 7 | Ga0070690_100051760 | 3300005330 | Bacteria | 2623 |
| 8 | Ga0070666_10340104 | 3300005335 | Unclassified | 1072 |
| 9 | Ga0070680_100005810 | 3300005336 | Bacteria | 9364 |
| 10 | Ga0070680_100051747 | 3300005336 | Bacteria | 3352 |
| 11 | Ga0070680_100056397 | 3300005336 | Bacteria | 3211 |
| 12 | Ga0070680_100057548 | 3300005336 | Bacteria | 3178 |
| 13 | Ga0070680_100085414 | 3300005336 | Bacteria | 2607 |
| 14 | Ga0070680_100248904 | 3300005336 | Bacteria | 1502 |
| 15 | Ga0070682_100076586 | 3300005337 | Bacteria | 2154 |
| 16 | Ga0070682_100174664 | 3300005337 | Bacteria | 1496 |
| 17 | Ga0070682_100479636 | 3300005337 | Bacteria | 959 |
| 18 | Ga0068868_100016225 | 3300005338 | Bacteria | 5526 |
| 19 | Ga0068868_100089156 | 3300005338 | Bacteria | 2483 |
| 20 | Ga0070660_100011699 | 3300005339 | Bacteria | 6248 |
| 21 | Ga0070660_100012668 | 3300005339 | Bacteria | 6027 |
| 22 | Ga0070660_100128974 | 3300005339 | Bacteria | 2022 |
| 23 | Ga0070660_100144604 | 3300005339 | Bacteria | 1909 |
| 24 | Ga0070660_100425612 | 3300005339 | Bacteria | 1100 |
| 25 | Ga0070660_100446182 | 3300005339 | Bacteria | 1073 |
| 26 | Ga0070660_100521225 | 3300005339 | Unclassified | 990 |
| 27 | Ga0070661_100061509 | 3300005344 | Bacteria | 2756 |
| 28 | Ga0070661_100086063 | 3300005344 | Bacteria | 2323 |
| 29 | Ga0070661_100668741 | 3300005344 | Unclassified | 844 |
| 30 | Ga0070692_10058883 | 3300005345 | Bacteria | 2018 |
| 31 | Ga0070668_100016085 | 3300005347 | Bacteria | 5599 |
| 32 | Ga0070675_100104713 | 3300005354 | Bacteria | 2387 |
| 33 | Ga0070671_100069910 | 3300005355 | Bacteria | 2928 |
| 34 | Ga0070674_100134103 | 3300005356 | Bacteria | 1850 |
| 35 | Ga0070673_100037073 | 3300005364 | Bacteria | 3712 |
| 36 | Ga0070659_100031080 | 3300005366 | Bacteria | 4134 |
| 37 | Ga0070659_100153962 | 3300005366 | Bacteria | 1876 |
| 38 | Ga0070659_100221410 | 3300005366 | Bacteria | 1562 |
| 39 | Ga0070659_100641945 | 3300005366 | Unclassified | 915 |
| 40 | Ga0070667_100110520 | 3300005367 | Bacteria | 2383 |
| 41 | Ga0070709_10181086 | 3300005434 | Bacteria | 1480 |
| 42 | Ga0070714_100112927 | 3300005435 | Bacteria | 2408 |
| 43 | Ga0070714_100546332 | 3300005435 | Bacteria | 1109 |
| 44 | Ga0070713_100043623 | 3300005436 | Bacteria | 3667 |
| 45 | Ga0070713_100269516 | 3300005436 | Bacteria | 1559 |
| 46 | Ga0070710_10035305 | 3300005437 | Bacteria | 2725 |
| 47 | Ga0070710_10390822 | 3300005437 | Unclassified | 930 |
| 48 | Ga0070701_10034471 | 3300005438 | Bacteria | 2535 |
| 49 | Ga0070711_100001144 | 3300005439 | Bacteria | 14228 |
| 50 | Ga0070711_100704877 | 3300005439 | Bacteria | 850 |
| 51 | Ga0070711_100790723 | 3300005439 | Bacteria | 804 |
| 52 | Ga0070705_100009138 | 3300005440 | Bacteria | 4919 |
| 53 | Ga0070700_100007946 | 3300005441 | Bacteria | 5757 |
| 54 | Ga0070694_100025028 | 3300005444 | Bacteria | 3857 |
| 55 | Ga0070708_100008860 | 3300005445 | Bacteria | 8097 |
| 56 | Ga0070663_100607076 | 3300005455 | Bacteria | 921 |
| 57 | Ga0070678_100045725 | 3300005456 | Bacteria | 3134 |
| 58 | Ga0070678_100071581 | 3300005456 | Bacteria | 2596 |
| 59 | Ga0070678_100155325 | 3300005456 | Bacteria | 1848 |
| 60 | Ga0070681_10008727 | 3300005458 | Bacteria | 9945 |
| 61 | Ga0070681_10013690 | 3300005458 | Bacteria | 8073 |
| 62 | Ga0070681_10019935 | 3300005458 | Bacteria | 6718 |
| 63 | Ga0070681_10020145 | 3300005458 | Bacteria | 6685 |
| 64 | Ga0070681_10031845 | 3300005458 | Bacteria | 5293 |
| 65 | Ga0070681_10046119 | 3300005458 | Bacteria | 4358 |
| 66 | Ga0070681_10052560 | 3300005458 | Bacteria | 4064 |
| 67 | Ga0070681_10078196 | 3300005458 | Bacteria | 3265 |
| 68 | Ga0070681_10147028 | 3300005458 | Bacteria | 2285 |
| 69 | Ga0070681_10221168 | 3300005458 | Bacteria | 1809 |
| 70 | Ga0070681_10812478 | 3300005458 | Bacteria | 852 |
| 71 | Ga0070685_10520404 | 3300005466 | Bacteria | 845 |
| 72 | Ga0070706_100737313 | 3300005467 | Bacteria | 913 |
| 73 | Ga0070707_100014979 | 3300005468 | Bacteria | 7276 |
| 74 | Ga0070707_100349120 | 3300005468 | Bacteria | 1437 |
| 75 | Ga0070698_100168661 | 3300005471 | Bacteria | 2131 |
| 76 | Ga0070698_100460454 | 3300005471 | Bacteria | 1208 |
| 77 | Ga0070699_100511212 | 3300005518 | Bacteria | 1092 |
| 78 | Ga0070679_100017413 | 3300005530 | Bacteria | 6954 |
| 79 | Ga0070679_100030040 | 3300005530 | Bacteria | 5363 |
| 80 | Ga0070679_100035170 | 3300005530 | Bacteria | 4969 |
| 81 | Ga0070679_100106662 | 3300005530 | Bacteria | 2787 |
| 82 | Ga0070679_100111292 | 3300005530 | Bacteria | 2724 |
| 83 | Ga0070679_100394017 | 3300005530 | Bacteria | 1331 |
| 84 | Ga0070684_100005178 | 3300005535 | Bacteria | 9968 |
| 85 | Ga0070684_100017725 | 3300005535 | Bacteria | 5852 |
| 86 | Ga0070684_100208601 | 3300005535 | Bacteria | 1781 |
| 87 | Ga0070684_100214626 | 3300005535 | Bacteria | 1754 |
| 88 | Ga0070684_100235223 | 3300005535 | Bacteria | 1673 |
| 89 | Ga0070684_100330614 | 3300005535 | Bacteria | 1400 |
| 90 | Ga0070684_100503559 | 3300005535 | Bacteria | 1122 |
| 91 | Ga0070697_100137328 | 3300005536 | Bacteria | 2054 |
| 92 | Ga0068853_100028151 | 3300005539 | Bacteria | 4724 |
| 93 | Ga0068853_100229361 | 3300005539 | Bacteria | 1698 |
| 94 | Ga0068853_100489117 | 3300005539 | Unclassified | 1161 |
| 95 | Ga0070695_100207014 | 3300005545 | Bacteria | 1406 |
| 96 | Ga0070696_100199666 | 3300005546 | Bacteria | 1492 |
| 97 | Ga0070693_100100573 | 3300005547 | Bacteria | 1761 |
| 98 | Ga0070665_100040732 | 3300005548 | Bacteria | 4668 |
| 99 | Ga0070665_100106594 | 3300005548 | Bacteria | 2804 |
| 100 | Ga0070665_100266455 | 3300005548 | Bacteria | 1714 |
| 101 | Ga0068855_100003593 | 3300005563 | Bacteria | 18943 |
| 102 | Ga0068855_100011169 | 3300005563 | Bacteria | 10843 |
| 103 | Ga0068855_100024835 | 3300005563 | Bacteria | 7169 |
| 104 | Ga0068855_100042632 | 3300005563 | Bacteria | 5376 |
| 105 | Ga0068855_100049137 | 3300005563 | Bacteria | 4976 |
| 106 | Ga0068855_100196517 | 3300005563 | Bacteria | 2272 |
| 107 | Ga0068855_100284095 | 3300005563 | Bacteria | 1836 |
| 108 | Ga0068855_100371293 | 3300005563 | Bacteria | 1572 |
| 109 | Ga0070664_100079695 | 3300005564 | Bacteria | 2820 |
| 110 | Ga0068857_100087436 | 3300005577 | Bacteria | 2787 |
| 111 | Ga0068854_100127321 | 3300005578 | Bacteria | 1941 |
| 112 | Ga0068854_100357746 | 3300005578 | Bacteria | 1197 |
| 113 | Ga0068854_100630827 | 3300005578 | Bacteria | 918 |
| 114 | Ga0068856_100120281 | 3300005614 | Bacteria | 2627 |
| 115 | Ga0068856_100195492 | 3300005614 | Bacteria | 2037 |
| 116 | Ga0068856_100341905 | 3300005614 | Bacteria | 1515 |
| 117 | Ga0068856_100967463 | 3300005614 | Bacteria | 870 |
| 118 | Ga0068852_100072114 | 3300005616 | Bacteria | 3034 |
| 119 | Ga0068852_100356913 | 3300005616 | Unclassified | 1429 |
| 120 | Ga0068852_100481222 | 3300005616 | Bacteria | 1234 |
| 121 | Ga0068866_10003857 | 3300005718 | Bacteria | 6153 |
| 122 | Ga0068861_100024794 | 3300005719 | Bacteria | 4342 |
| 123 | Ga0068870_10155309 | 3300005840 | Bacteria | 1352 |
| 124 | Ga0068858_100569595 | 3300005842 | Bacteria | 1097 |
| 125 | Ga0068860_100139091 | 3300005843 | Bacteria | 2333 |
| 126 | Ga0068862_100342030 | 3300005844 | Bacteria | 1386 |
| 127 | Ga0081455_10141099 | 3300005937 | Unclassified | 1871 |
| 128 | Ga0081538_10002124 | 3300005981 | Bacteria | 19751 |
| 129 | Ga0081539_10001192 | 3300005985 | Bacteria | 46924 |
| 130 | Ga0070717_10050873 | 3300006028 | Bacteria | 3408 |
| 131 | Ga0070717_10333750 | 3300006028 | Bacteria | 1353 |
| 132 | Ga0075365_10021647 | 3300006038 | Bacteria | 4014 |
| 133 | Ga0075365_10233816 | 3300006038 | Unclassified | 1291 |
| 134 | Ga0075364_10065715 | 3300006051 | Bacteria | 2381 |
| 135 | Ga0075432_10031194 | 3300006058 | Bacteria | 1845 |
| 136 | Ga0075432_10068553 | 3300006058 | Bacteria | 1272 |
| 137 | Ga0070715_10141881 | 3300006163 | Unclassified | 1168 |
| 138 | Ga0070712_100197026 | 3300006175 | Bacteria | 1580 |
| 139 | Ga0070712_100409100 | 3300006175 | Bacteria | 1122 |
| 140 | Ga0070712_100629141 | 3300006175 | Bacteria | 910 |
| 141 | Ga0075366_10148581 | 3300006195 | Unclassified | 1418 |
| 142 | Ga0097621_100011723 | 3300006237 | Bacteria | 6472 |
| 143 | Ga0097621_100180783 | 3300006237 | Bacteria | 1822 |
| 144 | Ga0097621_100249110 | 3300006237 | Bacteria | 1555 |
| 145 | Ga0068871_100026438 | 3300006358 | Bacteria | 4528 |
| 146 | Ga0075428_100281741 | 3300006844 | Bacteria | 1788 |
| 147 | Ga0075428_100583806 | 3300006844 | Bacteria | 1194 |
| 148 | Ga0075428_100942740 | 3300006844 | Unclassified | 915 |
| 149 | Ga0075430_100105604 | 3300006846 | Bacteria | 2350 |
| 150 | Ga0075431_100353481 | 3300006847 | Bacteria | 1477 |
| 151 | Ga0075433_10008761 | 3300006852 | Bacteria | 8073 |
| 152 | Ga0075433_10233798 | 3300006852 | Bacteria | 1632 |
| 153 | Ga0075433_10864939 | 3300006852 | Bacteria | 789 |
| 154 | Ga0075434_100126426 | 3300006871 | Bacteria | 2573 |
| 155 | Ga0075434_100359177 | 3300006871 | Bacteria | 1478 |
| 156 | Ga0075434_100852607 | 3300006871 | Unclassified | 926 |
| 157 | Ga0075434_100968584 | 3300006871 | Bacteria | 865 |
| 158 | Ga0068865_100049045 | 3300006881 | Bacteria | 2908 |
| 159 | Ga0075436_100013785 | 3300006914 | Bacteria | 5536 |
| 160 | Ga0075435_100002153 | 3300007076 | Bacteria | 12981 |
| 161 | Ga0075435_100005538 | 3300007076 | Bacteria | 8832 |
| 162 | Ga0075435_100490375 | 3300007076 | Bacteria | 1062 |
| 163 | Ga0105240_10045516 | 3300009093 | Bacteria | 5565 |
| 164 | Ga0105240_10231006 | 3300009093 | Bacteria | 2150 |
| 165 | Ga0105240_10437930 | 3300009093 | Bacteria | 1465 |
| 166 | Ga0111539_10556351 | 3300009094 | Bacteria | 1336 |
| 167 | Ga0111539_10815293 | 3300009094 | Unclassified | 1086 |
| 168 | Ga0105245_10006098 | 3300009098 | Bacteria | 10598 |
| 169 | Ga0105245_10020362 | 3300009098 | Bacteria | 5818 |
| 170 | Ga0105245_10093166 | 3300009098 | Bacteria | 2775 |
| 171 | Ga0105245_10123267 | 3300009098 | Bacteria | 2423 |
| 172 | Ga0105245_10536150 | 3300009098 | Bacteria | 1191 |
| 173 | Ga0105245_10572165 | 3300009098 | Unclassified | 1154 |
| 174 | Ga0105245_11246535 | 3300009098 | Bacteria | 792 |
| 175 | Ga0105247_10104196 | 3300009101 | Bacteria | 1817 |
| 176 | Ga0114129_10010920 | 3300009147 | Bacteria | 12939 |
| 177 | Ga0114129_10026913 | 3300009147 | Bacteria | 8141 |
| 178 | Ga0114129_10084015 | 3300009147 | Bacteria | 4421 |
| 179 | Ga0114129_10102347 | 3300009147 | Bacteria | 3961 |
| 180 | Ga0114129_10173306 | 3300009147 | Bacteria | 2940 |
| 181 | Ga0114129_10300988 | 3300009147 | Bacteria | 2137 |
| 182 | Ga0114129_10531756 | 3300009147 | Bacteria | 1531 |
| 183 | Ga0114129_11043703 | 3300009147 | Bacteria | 1027 |
| 184 | Ga0105243_10003921 | 3300009148 | Bacteria | 11874 |
| 185 | Ga0105242_10062210 | 3300009176 | Bacteria | 3071 |
| 186 | Ga0105242_10107249 | 3300009176 | Bacteria | 2375 |
| 187 | Ga0105242_11039328 | 3300009176 | Bacteria | 829 |
| 188 | Ga0105248_10340525 | 3300009177 | Bacteria | 1689 |
| 189 | Ga0105248_10412913 | 3300009177 | Unclassified | 1520 |
| 190 | Ga0105248_10516646 | 3300009177 | Bacteria | 1347 |
| 191 | Ga0105248_10597848 | 3300009177 | Bacteria | 1245 |
| 192 | Ga0105248_11753928 | 3300009177 | Unclassified | 704 |
| 193 | Ga0105237_10115359 | 3300009545 | Bacteria | 2679 |
| 194 | Ga0105237_10508886 | 3300009545 | Bacteria | 1211 |
| 195 | Ga0105238_10026868 | 3300009551 | Bacteria | 5867 |
| 196 | Ga0105238_10042715 | 3300009551 | Bacteria | 4589 |
| 197 | Ga0105249_10003964 | 3300009553 | Bacteria | 12771 |
| 198 | Ga0105249_10615190 | 3300009553 | Unclassified | 1142 |
| 199 | Ga0105239_10104874 | 3300010375 | Bacteria | 3130 |
| 200 | Ga0105239_10145120 | 3300010375 | Bacteria | 2646 |
| 201 | Ga0105239_10373664 | 3300010375 | Bacteria | 1611 |
| 202 | Ga0105239_10667147 | 3300010375 | Bacteria | 1188 |
| 203 | Ga0105239_10678821 | 3300010375 | Bacteria | 1177 |
| 204 | Ga0105246_10035463 | 3300011119 | Bacteria | 3335 |
| 205 | Ga0157373_10064041 | 3300013100 | Bacteria | 2603 |
| 206 | Ga0157371_10338406 | 3300013102 | Bacteria | 1094 |
| 207 | Ga0157370_10003010 | 3300013104 | Bacteria | 20004 |
| 208 | Ga0157370_10093384 | 3300013104 | Bacteria | 2823 |
| 209 | Ga0157370_10109886 | 3300013104 | Bacteria | 2577 |
| 210 | Ga0157370_10743713 | 3300013104 | Bacteria | 894 |
| 211 | Ga0157369_10028618 | 3300013105 | Bacteria | 6166 |
| 212 | Ga0157369_10071297 | 3300013105 | Bacteria | 3730 |
| 213 | Ga0157369_10239499 | 3300013105 | Bacteria | 1895 |
| 214 | Ga0157369_10321824 | 3300013105 | Bacteria | 1608 |
| 215 | Ga0157374_10026155 | 3300013296 | Bacteria | 5248 |
| 216 | Ga0157374_10242616 | 3300013296 | Bacteria | 1772 |
| 217 | Ga0157374_10581480 | 3300013296 | Bacteria | 1129 |
| 218 | Ga0157374_11012556 | 3300013296 | Bacteria | 850 |
| 219 | Ga0157378_10068908 | 3300013297 | Bacteria | 3173 |
| 220 | Ga0163162_10005877 | 3300013306 | Bacteria | 11871 |
| 221 | Ga0157372_10029509 | 3300013307 | Bacteria | 5990 |
| 222 | Ga0157372_10030921 | 3300013307 | Bacteria | 5859 |
| 223 | Ga0157372_10047864 | 3300013307 | Bacteria | 4752 |
| 224 | Ga0157372_10168880 | 3300013307 | Bacteria | 2530 |
| 225 | Ga0157372_10459071 | 3300013307 | Bacteria | 1485 |
| 226 | Ga0157375_11128391 | 3300013308 | Bacteria | 918 |
| 227 | Ga0163163_10318191 | 3300014325 | Bacteria | 1610 |
| 228 | Ga0163163_10810045 | 3300014325 | Bacteria | 1000 |
| 229 | Ga0157380_10008469 | 3300014326 | Bacteria | 7346 |
| 230 | Ga0157380_10298626 | 3300014326 | Bacteria | 1482 |
| 231 | Ga0157380_11302672 | 3300014326 | Bacteria | 774 |
| 232 | Ga0182008_10024958 | 3300014497 | Bacteria | 3040 |
| 233 | Ga0157377_10613276 | 3300014745 | Bacteria | 778 |
| 234 | Ga0157379_10665641 | 3300014968 | Unclassified | 975 |
| 235 | Ga0157376_10007598 | 3300014969 | Bacteria | 7755 |
| 236 | Ga0157376_10240750 | 3300014969 | Bacteria | 1685 |
| 237 | Ga0157376_10267528 | 3300014969 | Bacteria | 1604 |
| 238 | Ga0197907_10620317 | 3300020069 | Bacteria | 3831 |
| 239 | Ga0197907_11022464 | 3300020069 | Bacteria | 1675 |
| 240 | Ga0206356_10298171 | 3300020070 | Bacteria | 2814 |
| 241 | Ga0206356_10607613 | 3300020070 | Bacteria | 1017 |
| 242 | Ga0206356_11237666 | 3300020070 | Bacteria | 1233 |
| 243 | Ga0206350_10077237 | 3300020080 | Bacteria | 1209 |
| 244 | Ga0206354_10340070 | 3300020081 | Bacteria | 1566 |
| 245 | Ga0206354_11223639 | 3300020081 | Bacteria | 1418 |
| 246 | Ga0206354_11537358 | 3300020081 | Bacteria | 1776 |
| 247 | Ga0206353_10480853 | 3300020082 | Bacteria | 2137 |
| 248 | Ga0206353_10846342 | 3300020082 | Bacteria | 990 |
| 249 | Ga0206353_11108111 | 3300020082 | Bacteria | 1033 |
| 250 | Ga0213876_10039968 | 3300021384 | Bacteria | 2478 |
| 251 | Ga0224712_10111683 | 3300022467 | Bacteria | 1173 |
| 252 | Ga0224712_10233350 | 3300022467 | Bacteria | 845 |
| 253 | Ga0207692_10276217 | 3300025898 | Bacteria | 1015 |
| 254 | Ga0207642_10036145 | 3300025899 | Bacteria | 2117 |
| 255 | Ga0207699_10089496 | 3300025906 | Bacteria | 1929 |
| 256 | Ga0207643_10054543 | 3300025908 | Bacteria | 2272 |
| 257 | Ga0207705_10006569 | 3300025909 | Bacteria | 8614 |
| 258 | Ga0207705_10054207 | 3300025909 | Bacteria | 2890 |
| 259 | Ga0207705_10215198 | 3300025909 | Bacteria | 1458 |
| 260 | Ga0207684_10552858 | 3300025910 | Bacteria | 985 |
| 261 | Ga0207654_10050233 | 3300025911 | Bacteria | 2395 |
| 262 | Ga0207654_10069834 | 3300025911 | Unclassified | 2083 |
| 263 | Ga0207707_10008378 | 3300025912 | Bacteria | 8972 |
| 264 | Ga0207707_10013655 | 3300025912 | Bacteria | 7082 |
| 265 | Ga0207707_10033202 | 3300025912 | Bacteria | 4517 |
| 266 | Ga0207707_10056274 | 3300025912 | Bacteria | 3422 |
| 267 | Ga0207707_10081382 | 3300025912 | Bacteria | 2827 |
| 268 | Ga0207707_10166069 | 3300025912 | Bacteria | 1929 |
| 269 | Ga0207707_10239464 | 3300025912 | Bacteria | 1578 |
| 270 | Ga0207707_10384948 | 3300025912 | Bacteria | 1205 |
| 271 | Ga0207695_10153461 | 3300025913 | Bacteria | 2240 |
| 272 | Ga0207695_10376768 | 3300025913 | Bacteria | 1305 |
| 273 | Ga0207671_10263148 | 3300025914 | Bacteria | 1358 |
| 274 | Ga0207693_10001754 | 3300025915 | Bacteria | 19046 |
| 275 | Ga0207693_10069728 | 3300025915 | Bacteria | 2751 |
| 276 | Ga0207693_10146534 | 3300025915 | Bacteria | 1857 |
| 277 | Ga0207693_10154209 | 3300025915 | Bacteria | 1807 |
| 278 | Ga0207693_10468136 | 3300025915 | Bacteria | 984 |
| 279 | Ga0207663_10041896 | 3300025916 | Bacteria | 2794 |
| 280 | Ga0207663_10197041 | 3300025916 | Bacteria | 1450 |
| 281 | Ga0207663_10555568 | 3300025916 | Unclassified | 898 |
| 282 | Ga0207660_10007020 | 3300025917 | Bacteria | 7294 |
| 283 | Ga0207660_10023010 | 3300025917 | Bacteria | 4205 |
| 284 | Ga0207660_10068408 | 3300025917 | Bacteria | 2575 |
| 285 | Ga0207660_10098706 | 3300025917 | Bacteria | 2179 |
| 286 | Ga0207660_10123410 | 3300025917 | Bacteria | 1964 |
| 287 | Ga0207660_10211296 | 3300025917 | Bacteria | 1519 |
| 288 | Ga0207660_10346436 | 3300025917 | Bacteria | 1190 |
| 289 | Ga0207660_10614308 | 3300025917 | Bacteria | 886 |
| 290 | Ga0207662_10014548 | 3300025918 | Bacteria | 4417 |
| 291 | Ga0207657_10020124 | 3300025919 | Bacteria | 6315 |
| 292 | Ga0207657_10020746 | 3300025919 | Bacteria | 6201 |
| 293 | Ga0207657_10025885 | 3300025919 | Bacteria | 5402 |
| 294 | Ga0207657_10026725 | 3300025919 | Bacteria | 5297 |
| 295 | Ga0207657_10240112 | 3300025919 | Bacteria | 1447 |
| 296 | Ga0207657_10520623 | 3300025919 | Unclassified | 931 |
| 297 | Ga0207649_10042138 | 3300025920 | Bacteria | 2783 |
| 298 | Ga0207652_10008202 | 3300025921 | Bacteria | 8388 |
| 299 | Ga0207652_10021758 | 3300025921 | Bacteria | 5296 |
| 300 | Ga0207652_10043128 | 3300025921 | Bacteria | 3841 |
| 301 | Ga0207652_10190191 | 3300025921 | Bacteria | 1846 |
| 302 | Ga0207652_10236055 | 3300025921 | Bacteria | 1648 |
| 303 | Ga0207652_10240478 | 3300025921 | Bacteria | 1632 |
| 304 | Ga0207646_10011532 | 3300025922 | Bacteria | 8549 |
| 305 | Ga0207646_10286850 | 3300025922 | Bacteria | 1488 |
| 306 | Ga0207694_10029487 | 3300025924 | Bacteria | 4187 |
| 307 | Ga0207694_10102747 | 3300025924 | Bacteria | 2266 |
| 308 | Ga0207659_10072351 | 3300025926 | Bacteria | 2520 |
| 309 | Ga0207687_10003480 | 3300025927 | Bacteria | 10598 |
| 310 | Ga0207687_10070262 | 3300025927 | Bacteria | 2499 |
| 311 | Ga0207687_10263485 | 3300025927 | Bacteria | 1375 |
| 312 | Ga0207700_10000002 | 3300025928 | Bacteria | 775978 |
| 313 | Ga0207700_10255815 | 3300025928 | Bacteria | 1498 |
| 314 | Ga0207700_10485828 | 3300025928 | Bacteria | 1092 |
| 315 | Ga0207664_10101566 | 3300025929 | Bacteria | 2377 |
| 316 | Ga0207664_10112348 | 3300025929 | Bacteria | 2268 |
| 317 | Ga0207664_10783000 | 3300025929 | Bacteria | 858 |
| 318 | Ga0207664_10843804 | 3300025929 | Bacteria | 823 |
| 319 | Ga0207644_10067873 | 3300025931 | Bacteria | 2600 |
| 320 | Ga0207690_10067212 | 3300025932 | Bacteria | 2458 |
| 321 | Ga0207690_10144472 | 3300025932 | Bacteria | 1757 |
| 322 | Ga0207690_10381964 | 3300025932 | Unclassified | 1120 |
| 323 | Ga0207706_10017688 | 3300025933 | Bacteria | 6422 |
| 324 | Ga0207706_10167089 | 3300025933 | Bacteria | 1933 |
| 325 | Ga0207686_10098921 | 3300025934 | Bacteria | 1943 |
| 326 | Ga0207686_10172516 | 3300025934 | Bacteria | 1526 |
| 327 | Ga0207709_10014190 | 3300025935 | Bacteria | 4398 |
| 328 | Ga0207670_10011870 | 3300025936 | Bacteria | 5073 |
| 329 | Ga0207669_10061307 | 3300025937 | Bacteria | 2311 |
| 330 | Ga0207665_10014209 | 3300025939 | Bacteria | 5239 |
| 331 | Ga0207665_10023137 | 3300025939 | Bacteria | 4092 |
| 332 | Ga0207665_10276326 | 3300025939 | Bacteria | 1249 |
| 333 | Ga0207691_10002643 | 3300025940 | Bacteria | 17505 |
| 334 | Ga0207711_10271573 | 3300025941 | Bacteria | 1560 |
| 335 | Ga0207661_10000646 | 3300025944 | Bacteria | 22497 |
| 336 | Ga0207661_10052247 | 3300025944 | Bacteria | 3264 |
| 337 | Ga0207661_10103205 | 3300025944 | Bacteria | 2399 |
| 338 | Ga0207661_10237120 | 3300025944 | Bacteria | 1617 |
| 339 | Ga0207679_10074293 | 3300025945 | Bacteria | 2575 |
| 340 | Ga0207667_10073330 | 3300025949 | Bacteria | 3557 |
| 341 | Ga0207667_10247646 | 3300025949 | Bacteria | 1823 |
| 342 | Ga0207712_10004878 | 3300025961 | Bacteria | 8485 |
| 343 | Ga0207712_10159907 | 3300025961 | Bacteria | 1749 |
| 344 | Ga0207668_10013595 | 3300025972 | Bacteria | 5020 |
| 345 | Ga0207668_10130431 | 3300025972 | Bacteria | 1919 |
| 346 | Ga0207677_10021579 | 3300026023 | Bacteria | 3937 |
| 347 | Ga0207677_10071251 | 3300026023 | Bacteria | 2452 |
| 348 | Ga0207639_10632854 | 3300026041 | Bacteria | 989 |
| 349 | Ga0207678_10443769 | 3300026067 | Bacteria | 1127 |
| 350 | Ga0207708_10004755 | 3300026075 | Bacteria | 9992 |
| 351 | Ga0207702_10013311 | 3300026078 | Bacteria | 6842 |
| 352 | Ga0207702_10069185 | 3300026078 | Bacteria | 3034 |
| 353 | Ga0207702_10871568 | 3300026078 | Bacteria | 892 |
| 354 | Ga0207648_10000150 | 3300026089 | Bacteria | 70019 |
| 355 | Ga0207648_10376140 | 3300026089 | Bacteria | 1284 |
| 356 | Ga0207676_10472465 | 3300026095 | Bacteria | 1186 |
| 357 | Ga0207674_10091516 | 3300026116 | Bacteria | 3031 |
| 358 | Ga0207675_100011845 | 3300026118 | Bacteria | 8150 |
| 359 | Ga0207675_100343044 | 3300026118 | Bacteria | 1462 |
| 360 | Ga0207675_100355780 | 3300026118 | Bacteria | 1436 |
| 361 | Ga0207683_10000131 | 3300026121 | Bacteria | 61423 |
| 362 | Ga0207683_10099829 | 3300026121 | Bacteria | 2591 |
| 363 | Ga0207683_10122977 | 3300026121 | Bacteria | 2331 |
| 364 | Ga0207698_10079897 | 3300026142 | Bacteria | 2632 |
| 365 | Ga0207698_10450766 | 3300026142 | Bacteria | 1242 |
| 366 | Ga0207698_10494885 | 3300026142 | Unclassified | 1189 |
| 367 | Ga0207428_10079558 | 3300027907 | Bacteria | 2563 |
| 368 | Ga0207428_10299312 | 3300027907 | Unclassified | 1191 |
| 369 | Ga0268266_10038991 | 3300028379 | Bacteria | 4046 |
| 370 | Ga0268266_10158191 | 3300028379 | Bacteria | 2048 |
| 371 | Ga0268265_10255892 | 3300028380 | Bacteria | 1554 |
| 372 | Ga0268264_10427563 | 3300028381 | Bacteria | 1278 |
| 373 | Ga0265334_10004404 | 3300028573 | Bacteria | 6253 |
| 374 | Ga0265318_10006205 | 3300028577 | Bacteria | 5528 |
| 375 | Ga0265318_10084732 | 3300028577 | Bacteria | 1169 |
| 376 | Ga0265322_10007859 | 3300028654 | Bacteria | 3108 |
| 377 | Ga0265322_10036811 | 3300028654 | Bacteria | 1394 |
| 378 | Ga0265336_10004674 | 3300028666 | Bacteria | 5138 |
| 379 | Ga0265338_10001061 | 3300028800 | Bacteria | 45726 |
| 380 | Ga0265338_10002640 | 3300028800 | Bacteria | 26412 |
| 381 | Ga0265338_10003129 | 3300028800 | Bacteria | 23635 |
| 382 | Ga0265338_10016568 | 3300028800 | Bacteria | 8002 |
| 383 | Ga0265338_10068850 | 3300028800 | Bacteria | 3046 |
| 384 | Ga0265338_10071361 | 3300028800 | Bacteria | 2972 |
| 385 | Ga0265338_10321404 | 3300028800 | Unclassified | 1120 |
| 386 | Ga0265328_10102210 | 3300031239 | Bacteria | 1062 |
| 387 | Ga0265320_10186717 | 3300031240 | Bacteria | 928 |
| 388 | Ga0265320_10277778 | 3300031240 | Bacteria | 742 |
| 389 | Ga0265325_10005024 | 3300031241 | Bacteria | 8231 |
| 390 | Ga0265331_10027432 | 3300031250 | Bacteria | 2855 |
| 391 | Ga0265327_10021489 | 3300031251 | Bacteria | 3893 |
| 392 | Ga0265327_10063716 | 3300031251 | Bacteria | 1871 |
| 393 | Ga0265316_10010014 | 3300031344 | Bacteria | 8671 |
| 394 | Ga0265316_10047132 | 3300031344 | Bacteria | 3411 |
| 395 | Ga0265316_10235790 | 3300031344 | Bacteria | 1346 |
| 396 | Ga0265316_10369149 | 3300031344 | Unclassified | 1037 |
| 397 | Ga0307408_100886549 | 3300031548 | Bacteria | 816 |
| 398 | Ga0265313_10004905 | 3300031595 | Bacteria | 10029 |
| 399 | Ga0265313_10020901 | 3300031595 | Bacteria | 3595 |
| 400 | Ga0265313_10121658 | 3300031595 | Bacteria | 1138 |
| 401 | Ga0265314_10004407 | 3300031711 | Bacteria | 13073 |
| 402 | Ga0265342_10097441 | 3300031712 | Bacteria | 1679 |
| 403 | Ga0307405_10109727 | 3300031731 | Unclassified | 1867 |
| 404 | Ga0307405_10155804 | 3300031731 | Bacteria | 1612 |
| 405 | Ga0307410_10697518 | 3300031852 | Bacteria | 855 |
| 406 | Ga0307407_10277879 | 3300031903 | Bacteria | 1159 |
| 407 | Ga0307409_100060313 | 3300031995 | Bacteria | 2958 |
| 408 | Ga0307409_100238338 | 3300031995 | Unclassified | 1654 |
| 409 | Ga0307409_100450650 | 3300031995 | Bacteria | 1242 |
| 410 | Ga0307416_100140355 | 3300032002 | Bacteria | 2195 |
| 411 | Ga0307416_100207823 | 3300032002 | Bacteria | 1864 |
| 412 | Ga0307416_101084168 | 3300032002 | Bacteria | 905 |
| 413 | Ga0307415_100018386 | 3300032126 | Bacteria | 4220 |
| 414 | Ga0307415_100146507 | 3300032126 | Bacteria | 1811 |
| 415 | Ga0373926_0014627 | 3300035083 | Bacteria | 2670 |
| 416 | Ga0373944_0060343 | 3300035089 | Bacteria | 1215 |
| 417 | Ga0373944_0079798 | 3300035089 | Bacteria | 1079 |
| 418 | Ga0373936_0009587 | 3300035113 | Bacteria | 3648 |
| 419 | Ga0373936_0016204 | 3300035113 | Bacteria | 2866 |
| 420 | Ga0373939_0023376 | 3300035114 | Bacteria | 1712 |
| 421 | Ga0373945_0005969 | 3300035116 | Bacteria | 3913 |
| 422 | Ga0373945_0025864 | 3300035116 | Bacteria | 2042 |
| 423 | Ga0373945_0110664 | 3300035116 | Bacteria | 1083 |
| 424 | Ga0373953_0121954 | 3300035117 | Bacteria | 1108 |
| 425 | Ga0373954_0029594 | 3300035118 | Bacteria | 2523 |
| 426 | Ga0373957_0069477 | 3300035120 | Bacteria | 1375 |
| 427 | Ga0373943_0000357 | 3300035170 | Bacteria | 19352 |
| 428 | Ga0373943_0005270 | 3300035170 | Bacteria | 5819 |
| 429 | Ga0373943_0036413 | 3300035170 | Bacteria | 2356 |
| 430 | Ga0373943_0163452 | 3300035170 | Bacteria | 1214 |
| 431 | Ga0373946_0024116 | 3300035171 | Bacteria | 2381 |
| 432 | Ga0373946_0081016 | 3300035171 | Bacteria | 1421 |
| 433 | Ga0373955_0087890 | 3300035172 | Bacteria | 1767 |
| 434 | Ga0373924_0059168 | 3300035410 | Bacteria | 1600 |
| 435 | Ga0373935_0048387 | 3300035692 | Bacteria | 2692 |
| 436 | Ga0373935_0081654 | 3300035692 | Bacteria | 2102 |
| 437 | Ga0373927_0015946 | 3300035695 | Bacteria | 4959 |
| 438 | Ga0373927_0101418 | 3300035695 | Bacteria | 1872 |
| 439 | Ga0373933_0012801 | 3300035724 | Bacteria | 4638 |
| 440 | Ga0373947_0000467 | 3300035725 | Bacteria | 23084 |
| 441 | Ga0373947_0006736 | 3300035725 | Bacteria | 6665 |
| 442 | Ga0373947_0129897 | 3300035725 | Bacteria | 1607 |
| 443 | Ga0373937_0031471 | 3300036401 | Bacteria | 4808 |
| 444 | Ga0373937_0529716 | 3300036401 | Bacteria | 1119 |
| 445 | Ga0373937_1052429 | 3300036401 | Bacteria | 762 |
| 446 | Ga0373925_0011045 | 3300037068 | Bacteria | 6558 |
| 447 | Ga0373925_0015591 | 3300037068 | Bacteria | 5499 |
| 448 | Ga0373925_0239637 | 3300037068 | Bacteria | 1452 |
| 449 | Ga0395899_0001360 | 3300037312 | Bacteria | 20970 |
| 450 | Ga0395899_0010041 | 3300037312 | Bacteria | 7258 |
| 451 | Ga0395899_0012131 | 3300037312 | Bacteria | 6598 |
| 452 | Ga0395899_0018647 | 3300037312 | Bacteria | 5272 |
| 453 | Ga0395899_0027220 | 3300037312 | Bacteria | 4312 |
| 454 | Ga0395899_0056755 | 3300037312 | Bacteria | 2893 |
| 455 | Ga0395899_0154798 | 3300037312 | Bacteria | 1623 |
| 456 | Ga0395899_0160309 | 3300037312 | Bacteria | 1590 |
| 457 | Ga0395899_0287948 | 3300037312 | Bacteria | 1115 |
| 458 | Ga0395900_0002321 | 3300037418 | Bacteria | 21097 |
| 459 | Ga0395900_0002916 | 3300037418 | Bacteria | 18634 |
| 460 | Ga0395900_0003619 | 3300037418 | Bacteria | 16614 |
| 461 | Ga0395900_0006950 | 3300037418 | Bacteria | 11741 |
| 462 | Ga0395900_0008280 | 3300037418 | Bacteria | 10703 |
| 463 | Ga0395900_0025335 | 3300037418 | Bacteria | 6072 |
| 464 | Ga0395900_0026751 | 3300037418 | Bacteria | 5904 |
| 465 | Ga0395900_0029803 | 3300037418 | Bacteria | 5601 |
| 466 | Ga0395900_0118229 | 3300037418 | Bacteria | 2720 |
| 467 | Ga0395900_0163100 | 3300037418 | Bacteria | 2272 |
| 468 | Ga0395900_0169751 | 3300037418 | Bacteria | 2221 |
| 469 | Ga0395900_0191056 | 3300037418 | Bacteria | 2077 |
| 470 | Ga0395900_0204366 | 3300037418 | Bacteria | 1997 |
| 471 | Ga0395900_0210549 | 3300037418 | Bacteria | 1963 |
| 472 | Ga0395900_0225740 | 3300037418 | Bacteria | 1885 |
| 473 | Ga0395900_0250782 | 3300037418 | Bacteria | 1771 |
| 474 | Ga0395900_0260579 | 3300037418 | Bacteria | 1732 |
| 475 | Ga0395900_0261714 | 3300037418 | Bacteria | 1727 |
| 476 | Ga0395900_0287912 | 3300037418 | Bacteria | 1632 |
| 477 | Ga0395900_0300023 | 3300037418 | Bacteria | 1593 |
| 478 | Ga0395900_0318074 | 3300037418 | Bacteria | 1537 |
| 479 | Ga0395900_0405916 | 3300037418 | Bacteria | 1326 |
| 480 | Ga0395900_0410049 | 3300037418 | Unclassified | 1317 |
| 481 | Ga0395900_0525138 | 3300037418 | Bacteria | 1131 |
| 482 | Ga0395900_0590022 | 3300037418 | Unclassified | 1052 |
| 483 | Ga0395900_0621409 | 3300037418 | Bacteria | 1019 |
| 484 | Ga0395900_0898157 | 3300037418 | Bacteria | 809 |
| 485 | Ga0395898_0002298 | 3300037466 | Bacteria | 22946 |
| 486 | Ga0395898_0003164 | 3300037466 | Bacteria | 18563 |
| 487 | Ga0395898_0006898 | 3300037466 | Bacteria | 12082 |
| 488 | Ga0395898_0010435 | 3300037466 | Bacteria | 9710 |
| 489 | Ga0395898_0030395 | 3300037466 | Bacteria | 5405 |
| 490 | Ga0395898_0038637 | 3300037466 | Bacteria | 4729 |
| 491 | Ga0395898_0050632 | 3300037466 | Bacteria | 4064 |
| 492 | Ga0395898_0081996 | 3300037466 | Bacteria | 3109 |
| 493 | Ga0395898_0089660 | 3300037466 | Bacteria | 2959 |
| 494 | Ga0395898_0091570 | 3300037466 | Bacteria | 2925 |
| 495 | Ga0395898_0108302 | 3300037466 | Bacteria | 2664 |
| 496 | Ga0395898_0147719 | 3300037466 | Bacteria | 2250 |
| 497 | Ga0395898_0148534 | 3300037466 | Bacteria | 2243 |
| 498 | Ga0395898_0153541 | 3300037466 | Bacteria | 2203 |
| 499 | Ga0395898_0165006 | 3300037466 | Bacteria | 2118 |
| 500 | Ga0395898_0197340 | 3300037466 | Bacteria | 1922 |
| 501 | Ga0395898_0197360 | 3300037466 | Bacteria | 1922 |
| 502 | Ga0395898_0239854 | 3300037466 | Bacteria | 1729 |
| 503 | Ga0395898_0243274 | 3300037466 | Unclassified | 1716 |
| 504 | Ga0395898_0272320 | 3300037466 | Bacteria | 1615 |
| 505 | Ga0395898_0338657 | 3300037466 | Bacteria | 1434 |
| 506 | Ga0395898_0351910 | 3300037466 | Bacteria | 1405 |
| 507 | Ga0395898_0352011 | 3300037466 | Bacteria | 1404 |
| 508 | Ga0395905_0002318 | 3300037471 | Bacteria | 21320 |
| 509 | Ga0395905_0015483 | 3300037471 | Bacteria | 7249 |
| 510 | Ga0395905_0019582 | 3300037471 | Bacteria | 6415 |
| 511 | Ga0395905_0023688 | 3300037471 | Bacteria | 5796 |
| 512 | Ga0395905_0026294 | 3300037471 | Bacteria | 5488 |
| 513 | Ga0395905_0041514 | 3300037471 | Bacteria | 4316 |
| 514 | Ga0395905_0060724 | 3300037471 | Bacteria | 3535 |
| 515 | Ga0395905_0077445 | 3300037471 | Bacteria | 3116 |
| 516 | Ga0395905_0081765 | 3300037471 | Bacteria | 3027 |
| 517 | Ga0395905_0094392 | 3300037471 | Bacteria | 2806 |
| 518 | Ga0395905_0142238 | 3300037471 | Bacteria | 2257 |
| 519 | Ga0395905_0209470 | 3300037471 | Bacteria | 1826 |
| 520 | Ga0395905_0523005 | 3300037471 | Unclassified | 1087 |
| 521 | Ga0395901_0002740 | 3300038443 | Bacteria | 17773 |
| 522 | Ga0395901_0005214 | 3300038443 | Bacteria | 13118 |
| 523 | Ga0395901_0009262 | 3300038443 | Bacteria | 9984 |
| 524 | Ga0395901_0009857 | 3300038443 | Bacteria | 9683 |
| 525 | Ga0395901_0011266 | 3300038443 | Bacteria | 9059 |
| 526 | Ga0395901_0013991 | 3300038443 | Bacteria | 8166 |
| 527 | Ga0395901_0016094 | 3300038443 | Bacteria | 7619 |
| 528 | Ga0395901_0016980 | 3300038443 | Bacteria | 7417 |
| 529 | Ga0395901_0061225 | 3300038443 | Bacteria | 3917 |
| 530 | Ga0395901_0061405 | 3300038443 | Bacteria | 3910 |
| 531 | Ga0395901_0070139 | 3300038443 | Bacteria | 3651 |
| 532 | Ga0395901_0070469 | 3300038443 | Bacteria | 3642 |
| 533 | Ga0395901_0136266 | 3300038443 | Bacteria | 2580 |
| 534 | Ga0395901_0146620 | 3300038443 | Bacteria | 2480 |
| 535 | Ga0395901_0158299 | 3300038443 | Bacteria | 2379 |
| 536 | Ga0395901_0162385 | 3300038443 | Bacteria | 2346 |
| 537 | Ga0395901_0168495 | 3300038443 | Bacteria | 2298 |
| 538 | Ga0395901_0209905 | 3300038443 | Bacteria | 2038 |
| 539 | Ga0395901_0237973 | 3300038443 | Bacteria | 1899 |
| 540 | Ga0395901_0286495 | 3300038443 | Bacteria | 1710 |
| 541 | Ga0395901_0411832 | 3300038443 | Bacteria | 1387 |
| 542 | Ga0395901_0454189 | 3300038443 | Bacteria | 1310 |
| 543 | Ga0395901_0855875 | 3300038443 | Bacteria | 894 |
| 544 | Ga0395901_1101423 | 3300038443 | Bacteria | 765 |
| 545 | Ga0395901_1324214 | 3300038443 | Bacteria | 681 |
| 546 | Ga0436365_1605333 | 3300039437 | Bacteria | 5255 |
| 547 | Ga0436360_1350995 | 3300039438 | Bacteria | 1490 |
| 548 | Ga0436363_0030512 | 3300039450 | Bacteria | 1147 |
| 549 | Ga0436363_0225970 | 3300039450 | Bacteria | 1453 |
| 550 | Ga0436363_0546918 | 3300039450 | Bacteria | 1155 |
| 551 | Ga0436363_1093415 | 3300039450 | Bacteria | 1101 |
| 552 | Ga0436362_1150903 | 3300039453 | Bacteria | 1279 |
| 553 | Ga0439466_0067191 | 3300041411 | Bacteria | 1147 |
| 554 | Ga0451800_1681006 | 3300041459 | Bacteria | 1001 |
| 555 | Ga0451835_0298821 | 3300041492 | Unclassified | 809 |
| 556 | Ga0439448_0045292 | 3300042005 | Bacteria | 1432 |
| 557 | Ga0450890_034001 | 3300042127 | Bacteria | 735 |
| 558 | Ga0466969_0124210 | 3300044656 | Bacteria | 1200 |
| 559 | Ga0466965_0060374 | 3300044683 | Bacteria | 1894 |
| 560 | Ga0466966_0148093 | 3300044684 | Bacteria | 1433 |
| 561 | Ga0466966_0200675 | 3300044684 | Bacteria | 1207 |
| 562 | Ga0466961_0079786 | 3300044693 | Bacteria | 2072 |
| 563 | Ga0466961_0177642 | 3300044693 | Bacteria | 1322 |
| 564 | Ga0466961_0307979 | 3300044693 | Bacteria | 967 |
| 565 | Ga0466963_0003436 | 3300044694 | Bacteria | 9066 |
| 566 | Ga0466963_0012752 | 3300044694 | Bacteria | 5149 |
| 567 | Ga0466963_0039511 | 3300044694 | Bacteria | 3090 |
| 568 | Ga0466963_0092161 | 3300044694 | Bacteria | 2065 |
| 569 | Ga0466963_0147283 | 3300044694 | Bacteria | 1634 |
| 570 | Ga0466963_0164462 | 3300044694 | Bacteria | 1545 |
| 571 | Ga0466964_0001492 | 3300044706 | Bacteria | 8023 |
| 572 | Ga0466964_0012301 | 3300044706 | Bacteria | 3238 |
| 573 | Ga0466971_0006706 | 3300044719 | Bacteria | 5010 |
| 574 | Ga0466971_0031883 | 3300044719 | Bacteria | 2360 |
| 575 | Ga0466968_0022352 | 3300044735 | Bacteria | 2570 |
| 576 | Ga0466968_0032792 | 3300044735 | Bacteria | 2162 |
| 577 | Ga0466968_0051476 | 3300044735 | Bacteria | 1759 |
| 578 | Ga0466957_0006475 | 3300044842 | Bacteria | 6612 |
| 579 | Ga0466957_0041861 | 3300044842 | Bacteria | 2770 |
| 580 | Ga0466957_0046503 | 3300044842 | Bacteria | 2635 |
| 581 | Ga0466957_0070755 | 3300044842 | Bacteria | 2156 |
| 582 | Ga0466957_0088618 | 3300044842 | Bacteria | 1936 |
| 583 | Ga0466960_0414368 | 3300044901 | Bacteria | 778 |
| 584 | Ga0466959_0030513 | 3300045049 | Bacteria | 3991 |
| 585 | Ga0466959_0032895 | 3300045049 | Bacteria | 3838 |
| 586 | Ga0466959_0048335 | 3300045049 | Bacteria | 3126 |
| 587 | Ga0466959_0099750 | 3300045049 | Bacteria | 2079 |
| 588 | Ga0466959_0246075 | 3300045049 | Bacteria | 1234 |
| 589 | Ga0451576_0308746 | 3300045051 | Bacteria | 1655 |
| 590 | Ga0466958_0019417 | 3300045836 | Bacteria | 3956 |
| 591 | Ga0466958_0023936 | 3300045836 | Bacteria | 3590 |
| 592 | Ga0466958_0036084 | 3300045836 | Bacteria | 2957 |
| 593 | Ga0466958_0042828 | 3300045836 | Bacteria | 2726 |
| 594 | Ga0466958_0203357 | 3300045836 | Unclassified | 1261 |
| 595 | Ga0466958_0230678 | 3300045836 | Bacteria | 1182 |
| 596 | Ga0466967_0016056 | 3300045976 | Bacteria | 5891 |
| 597 | Ga0466967_0024467 | 3300045976 | Bacteria | 4965 |
| 598 | Ga0466967_0046297 | 3300045976 | Bacteria | 3786 |
| 599 | Ga0466967_0048580 | 3300045976 | Bacteria | 3706 |
| 600 | Ga0466967_0049411 | 3300045976 | Bacteria | 3678 |
| 601 | Ga0466967_0106537 | 3300045976 | Bacteria | 2570 |
| 602 | Ga0466967_0117652 | 3300045976 | Bacteria | 2450 |
| 603 | Ga0466967_0141382 | 3300045976 | Bacteria | 2242 |
| 604 | Ga0466967_0149982 | 3300045976 | Bacteria | 2178 |
| 605 | Ga0466967_0161988 | 3300045976 | Bacteria | 2100 |
| 606 | Ga0466967_0279461 | 3300045976 | Bacteria | 1601 |
| 607 | Ga0466967_0401381 | 3300045976 | Bacteria | 1334 |
| 608 | Ga0466967_0439910 | 3300045976 | Bacteria | 1273 |
| 609 | Ga0466967_0559536 | 3300045976 | Bacteria | 1126 |
| 610 | Ga0466967_0710183 | 3300045976 | Bacteria | 996 |
| 611 | Ga0466967_0775280 | 3300045976 | Bacteria | 951 |
| 612 | Ga0466967_0844112 | 3300045976 | Unclassified | 910 |
| 613 | Ga0495592_0041408 | 3300046454 | Bacteria | 3452 |
| 614 | Ga0495592_0134647 | 3300046454 | Bacteria | 1725 |
| 615 | Ga0495592_0140018 | 3300046454 | Bacteria | 1684 |
| 616 | Ga0495592_0165294 | 3300046454 | Bacteria | 1519 |
| 617 | Ga0495592_0181259 | 3300046454 | Bacteria | 1434 |
| 618 | Ga0495603_0051830 | 3300046455 | Bacteria | 2437 |
| 619 | Ga0495603_0115231 | 3300046455 | Bacteria | 1567 |
| 620 | Ga0495603_0303431 | 3300046455 | Bacteria | 917 |
| 621 | Ga0495590_0071372 | 3300046457 | Bacteria | 1219 |
| 622 | Ga0495629_0003480 | 3300046459 | Bacteria | 11903 |
| 623 | Ga0495629_0207889 | 3300046459 | Bacteria | 1352 |
| 624 | Ga0495641_0001617 | 3300046461 | Bacteria | 18950 |
| 625 | Ga0495641_0027802 | 3300046461 | Bacteria | 2744 |
| 626 | Ga0495641_0178407 | 3300046461 | Bacteria | 951 |
| 627 | Ga0495651_0003896 | 3300046462 | Bacteria | 11410 |
| 628 | Ga0495651_0016883 | 3300046462 | Bacteria | 5654 |
| 629 | Ga0495651_0168173 | 3300046462 | Bacteria | 1564 |
| 630 | Ga0495651_0226737 | 3300046462 | Bacteria | 1289 |
| 631 | Ga0495651_0521262 | 3300046462 | Unclassified | 758 |
| 632 | Ga0495653_0019059 | 3300046463 | Bacteria | 5568 |
| 633 | Ga0495653_0024022 | 3300046463 | Bacteria | 4917 |
| 634 | Ga0495653_0027602 | 3300046463 | Bacteria | 4543 |
| 635 | Ga0495653_0081821 | 3300046463 | Bacteria | 2385 |
| 636 | Ga0495653_0159454 | 3300046463 | Unclassified | 1567 |
| 637 | Ga0495653_0210213 | 3300046463 | Bacteria | 1314 |
| 638 | Ga0495582_0000682 | 3300046473 | Bacteria | 18675 |
| 639 | Ga0495582_0052285 | 3300046473 | Bacteria | 2253 |
| 640 | Ga0495582_0084100 | 3300046473 | Bacteria | 1768 |
| 641 | Ga0495582_0118536 | 3300046473 | Bacteria | 1490 |
| 642 | Ga0495605_0114575 | 3300046474 | Bacteria | 1227 |
| 643 | Ga0495639_0002305 | 3300046475 | Bacteria | 8370 |
| 644 | Ga0495639_0039970 | 3300046475 | Bacteria | 2109 |
| 645 | Ga0495662_0005055 | 3300046476 | Bacteria | 6607 |
| 646 | Ga0495662_0252168 | 3300046476 | Bacteria | 869 |
| 647 | Ga0495664_0030696 | 3300046477 | Bacteria | 3149 |
| 648 | Ga0495664_0046958 | 3300046477 | Bacteria | 2562 |
| 649 | Ga0495664_0082522 | 3300046477 | Bacteria | 1928 |
| 650 | Ga0495664_0538116 | 3300046477 | Bacteria | 696 |
| 651 | Ga0495584_0048577 | 3300046491 | Bacteria | 2139 |
| 652 | Ga0495584_0160527 | 3300046491 | Bacteria | 1142 |
| 653 | Ga0495585_0143385 | 3300046492 | Bacteria | 1250 |
| 654 | Ga0495594_0105508 | 3300046499 | Bacteria | 1586 |
| 655 | Ga0495594_0172866 | 3300046499 | Bacteria | 1229 |
| 656 | Ga0495596_0156531 | 3300046500 | Bacteria | 885 |
| 657 | Ga0495583_0054971 | 3300046506 | Bacteria | 1801 |
| 658 | Ga0495608_0003436 | 3300046511 | Bacteria | 11343 |
| 659 | Ga0495608_0016422 | 3300046511 | Bacteria | 5123 |
| 660 | Ga0495608_0088444 | 3300046511 | Bacteria | 2005 |
| 661 | Ga0495608_0113615 | 3300046511 | Bacteria | 1739 |
| 662 | Ga0495608_0136865 | 3300046511 | Bacteria | 1565 |
| 663 | Ga0495608_0147392 | 3300046511 | Bacteria | 1501 |
| 664 | Ga0495608_0181152 | 3300046511 | Bacteria | 1333 |
| 665 | Ga0495618_0037859 | 3300046514 | Bacteria | 3030 |
| 666 | Ga0495618_0181776 | 3300046514 | Bacteria | 1336 |
| 667 | Ga0495618_0221899 | 3300046514 | Bacteria | 1192 |
| 668 | Ga0495628_0008643 | 3300046516 | Bacteria | 8722 |
| 669 | Ga0495628_0069241 | 3300046516 | Bacteria | 2752 |
| 670 | Ga0495628_0487527 | 3300046516 | Bacteria | 891 |
| 671 | Ga0495630_0005888 | 3300046517 | Bacteria | 8670 |
| 672 | Ga0495630_0006300 | 3300046517 | Bacteria | 8429 |
| 673 | Ga0495630_0101498 | 3300046517 | Bacteria | 2176 |
| 674 | Ga0495630_0131912 | 3300046517 | Bacteria | 1897 |
| 675 | Ga0495630_0349475 | 3300046517 | Bacteria | 1132 |
| 676 | Ga0495630_0541823 | 3300046517 | Bacteria | 892 |
| 677 | Ga0495631_0125378 | 3300046518 | Unclassified | 1104 |
| 678 | Ga0495644_0126602 | 3300046523 | Bacteria | 973 |
| 679 | Ga0495663_0019713 | 3300046525 | Bacteria | 1933 |
| 680 | Ga0495666_0110241 | 3300046526 | Bacteria | 1293 |
| 681 | Ga0495642_0019012 | 3300046528 | Bacteria | 2691 |
| 682 | Ga0495652_0035030 | 3300046529 | Bacteria | 4370 |
| 683 | Ga0495652_0060983 | 3300046529 | Bacteria | 3185 |
| 684 | Ga0495652_0081588 | 3300046529 | Bacteria | 2667 |
| 685 | Ga0495652_0083524 | 3300046529 | Bacteria | 2628 |
| 686 | Ga0495652_0160406 | 3300046529 | Bacteria | 1747 |
| 687 | Ga0495652_0183662 | 3300046529 | Bacteria | 1602 |
| 688 | Ga0495652_0240175 | 3300046529 | Bacteria | 1348 |
| 689 | Ga0495665_0000111 | 3300046531 | Bacteria | 38528 |
| 690 | Ga0495640_0029153 | 3300046533 | Bacteria | 3966 |
| 691 | Ga0495640_0085256 | 3300046533 | Bacteria | 2093 |
| 692 | Ga0495640_0185010 | 3300046533 | Bacteria | 1326 |
| 693 | Ga0495586_0036367 | 3300046535 | Bacteria | 2643 |
| 694 | Ga0495587_0002231 | 3300046536 | Bacteria | 12952 |
| 695 | Ga0495645_0069595 | 3300046543 | Bacteria | 2540 |
| 696 | Ga0495645_0095460 | 3300046543 | Bacteria | 2120 |
| 697 | Ga0495667_0000965 | 3300046559 | Bacteria | 18594 |
| 698 | Ga0495667_0002507 | 3300046559 | Bacteria | 12258 |
| 699 | Ga0495667_0003549 | 3300046559 | Bacteria | 10479 |
| 700 | Ga0495667_0024631 | 3300046559 | Bacteria | 4054 |
| 701 | Ga0495667_0082540 | 3300046559 | Bacteria | 2088 |
| 702 | Ga0495667_0192551 | 3300046559 | Unclassified | 1306 |
| 703 | Ga0495667_0213205 | 3300046559 | Bacteria | 1234 |
| 704 | Ga0495656_0009876 | 3300046615 | Bacteria | 3448 |
| 705 | Ga0495656_0026348 | 3300046615 | Bacteria | 2314 |
| 706 | Ga0495656_0060924 | 3300046615 | Unclassified | 1646 |
| 707 | Ga0495656_0079134 | 3300046615 | Bacteria | 1479 |
| 708 | Ga0495656_0088648 | 3300046615 | Unclassified | 1411 |
| 709 | Ga0495634_0020937 | 3300046642 | Bacteria | 4632 |
| 710 | Ga0495634_0040520 | 3300046642 | Bacteria | 3167 |
| 711 | Ga0495634_0108756 | 3300046642 | Bacteria | 1784 |
| 712 | Ga0495634_0137867 | 3300046642 | Bacteria | 1551 |
| 713 | Ga0495634_0162315 | 3300046642 | Bacteria | 1408 |
| 714 | Ga0495634_0253383 | 3300046642 | Bacteria | 1076 |
| 715 | Ga0495634_0255984 | 3300046642 | Bacteria | 1069 |
| 716 | Ga0495634_0278999 | 3300046642 | Bacteria | 1015 |
| 717 | Ga0495634_0390613 | 3300046642 | Bacteria | 828 |
| 718 | Ga0495635_0007253 | 3300046663 | Bacteria | 7747 |
| 719 | Ga0495635_0075695 | 3300046663 | Bacteria | 2306 |
| 720 | Ga0495635_0270692 | 3300046663 | Unclassified | 1142 |
| 721 | Ga0495635_0343104 | 3300046663 | Bacteria | 997 |
| 722 | Ga0495635_0645507 | 3300046663 | Bacteria | 689 |
| 723 | Ga0495588_0047299 | 3300046674 | Bacteria | 2208 |
| 724 | Ga0495657_0005164 | 3300046675 | Bacteria | 10341 |
| 725 | Ga0495657_0029506 | 3300046675 | Bacteria | 3846 |
| 726 | Ga0495657_0190178 | 3300046675 | Bacteria | 1255 |
| 727 | Ga0495599_0010791 | 3300046678 | Bacteria | 5598 |
| 728 | Ga0495599_0031242 | 3300046678 | Bacteria | 3343 |
| 729 | Ga0495599_0035678 | 3300046678 | Bacteria | 3122 |
| 730 | Ga0495623_0196912 | 3300046679 | Bacteria | 1160 |
| 731 | Ga0495623_0294858 | 3300046679 | Unclassified | 898 |
| 732 | Ga0495623_0367890 | 3300046679 | Bacteria | 780 |
| 733 | Ga0495646_0020943 | 3300046680 | Bacteria | 4135 |
| 734 | Ga0495646_0046251 | 3300046680 | Bacteria | 2654 |
| 735 | Ga0495646_0057536 | 3300046680 | Bacteria | 2327 |
| 736 | Ga0495646_0074492 | 3300046680 | Bacteria | 1992 |
| 737 | Ga0495647_0179494 | 3300046681 | Bacteria | 920 |
| 738 | Ga0495658_0000330 | 3300046683 | Bacteria | 26505 |
| 739 | Ga0495658_0165748 | 3300046683 | Bacteria | 1365 |
| 740 | Ga0495658_0476609 | 3300046683 | Bacteria | 798 |
| 741 | Ga0495658_0501577 | 3300046683 | Unclassified | 776 |
| 742 | Ga0495613_0003457 | 3300046689 | Bacteria | 11809 |
| 743 | Ga0495613_0045815 | 3300046689 | Bacteria | 3234 |
| 744 | Ga0495613_0073293 | 3300046689 | Bacteria | 2495 |
| 745 | Ga0495613_0117075 | 3300046689 | Bacteria | 1916 |
| 746 | Ga0495613_0140080 | 3300046689 | Bacteria | 1729 |
| 747 | Ga0495613_0160226 | 3300046689 | Bacteria | 1601 |
| 748 | Ga0495613_0185986 | 3300046689 | Bacteria | 1470 |
| 749 | Ga0495613_0206527 | 3300046689 | Bacteria | 1383 |
| 750 | Ga0495624_0024911 | 3300046690 | Bacteria | 3936 |
| 751 | Ga0495624_0043738 | 3300046690 | Bacteria | 2856 |
| 752 | Ga0495670_0268156 | 3300046691 | Unclassified | 912 |
| 753 | Ga0495589_0253521 | 3300046794 | Bacteria | 822 |
| 754 | Ga0495589_0341096 | 3300046794 | Bacteria | 691 |
| 755 | Ga0495600_0001291 | 3300046809 | Bacteria | 13844 |
| 756 | Ga0495600_0021213 | 3300046809 | Bacteria | 4159 |
| 757 | Ga0495600_0052829 | 3300046809 | Bacteria | 2653 |
| 758 | Ga0495600_0341491 | 3300046809 | Unclassified | 939 |
| 759 | Ga0495581_0001504 | 3300047315 | Bacteria | 12978 |
| 760 | Ga0495581_0030055 | 3300047315 | Bacteria | 3150 |
| 761 | Ga0495581_0206064 | 3300047315 | Bacteria | 1150 |
| 762 | Ga0495581_0342152 | 3300047315 | Unclassified | 873 |
| 763 | Ga0495581_0370078 | 3300047315 | Bacteria | 836 |
| 764 | Ga0495604_0003733 | 3300047317 | Bacteria | 12128 |
| 765 | Ga0495604_0072526 | 3300047317 | Bacteria | 2601 |
| 766 | Ga0495604_0094973 | 3300047317 | Bacteria | 2203 |
| 767 | Ga0495604_0576289 | 3300047317 | Unclassified | 724 |
| 768 | Ga0495636_0035350 | 3300047318 | Bacteria | 2058 |
| 769 | Ga0495674_0021694 | 3300047319 | Bacteria | 5938 |
| 770 | Ga0495674_0026937 | 3300047319 | Bacteria | 5257 |
| 771 | Ga0495674_0122190 | 3300047319 | Bacteria | 2199 |
| 772 | Ga0495674_0123627 | 3300047319 | Bacteria | 2185 |
| 773 | Ga0495674_0138705 | 3300047319 | Bacteria | 2045 |
| 774 | Ga0495674_0197027 | 3300047319 | Bacteria | 1672 |
| 775 | Ga0495674_0257790 | 3300047319 | Unclassified | 1433 |
| 776 | Ga0495676_0000450 | 3300047321 | Bacteria | 33719 |
| 777 | Ga0495676_0036162 | 3300047321 | Bacteria | 4126 |
| 778 | Ga0495676_0064124 | 3300047321 | Bacteria | 2860 |
| 779 | Ga0495676_0083785 | 3300047321 | Bacteria | 2408 |
| 780 | Ga0495676_0131631 | 3300047321 | Bacteria | 1805 |
| 781 | Ga0495676_0184408 | 3300047321 | Bacteria | 1460 |
| 782 | Ga0495680_0002908 | 3300047322 | Bacteria | 17206 |
| 783 | Ga0495680_0006974 | 3300047322 | Bacteria | 10420 |
| 784 | Ga0495680_0009129 | 3300047322 | Bacteria | 8949 |
| 785 | Ga0495680_0009676 | 3300047322 | Bacteria | 8650 |
| 786 | Ga0495680_0013899 | 3300047322 | Bacteria | 7004 |
| 787 | Ga0495680_0014309 | 3300047322 | Bacteria | 6879 |
| 788 | Ga0495675_0051883 | 3300047444 | Bacteria | 2604 |
| 789 | Ga0495677_0131546 | 3300047445 | Bacteria | 958 |
| 790 | Ga0495677_0193950 | 3300047445 | Bacteria | 789 |
| 791 | Ga0495679_068180 | 3300047446 | Bacteria | 1030 |
| 792 | Ga0495684_0008955 | 3300047471 | Bacteria | 7730 |
| 793 | Ga0495684_0011927 | 3300047471 | Bacteria | 6702 |
| 794 | Ga0495684_0017940 | 3300047471 | Bacteria | 5452 |
| 795 | Ga0495684_0023917 | 3300047471 | Bacteria | 4699 |
| 796 | Ga0495684_0028310 | 3300047471 | Bacteria | 4302 |
| 797 | Ga0495684_0346688 | 3300047471 | Unclassified | 1055 |
| 798 | Ga0495593_0008171 | 3300047673 | Bacteria | 6087 |
| 799 | Ga0495593_0060508 | 3300047673 | Bacteria | 1983 |
| 800 | Ga0495602_0012401 | 3300048088 | Bacteria | 8765 |
| 801 | Ga0495602_0153156 | 3300048088 | Bacteria | 1809 |
| 802 | Ga0495602_0220245 | 3300048088 | Bacteria | 1433 |
| 803 | Ga0495602_0342804 | 3300048088 | Bacteria | 1080 |
| 804 | Ga0495614_0007584 | 3300048089 | Bacteria | 4828 |
| 805 | Ga0496100_0003687 | 3300048903 | Bacteria | 8017 |
| 806 | Ga0496100_0004055 | 3300048903 | Bacteria | 7721 |
| 807 | Ga0496100_0004256 | 3300048903 | Bacteria | 7567 |
| 808 | Ga0496100_0015632 | 3300048903 | Bacteria | 4435 |
| 809 | Ga0496100_0016329 | 3300048903 | Bacteria | 4358 |
| 810 | Ga0496100_0025706 | 3300048903 | Bacteria | 3602 |
| 811 | Ga0496100_0167753 | 3300048903 | Unclassified | 1578 |
| 812 | Ga0496100_0334844 | 3300048903 | Bacteria | 1140 |
| 813 | Ga0496100_0343380 | 3300048903 | Unclassified | 1126 |
| 814 | Ga0496100_0425477 | 3300048903 | Unclassified | 1015 |
| 815 | Ga0496100_0451708 | 3300048903 | Unclassified | 985 |
| 816 | Ga0496100_0878658 | 3300048903 | Archaea | 704 |
| 817 | Ga0496101_0008094 | 3300048904 | Bacteria | 6856 |
| 818 | Ga0496101_0028304 | 3300048904 | Bacteria | 3911 |
| 819 | Ga0496101_0053373 | 3300048904 | Bacteria | 2916 |
| 820 | Ga0496101_0077655 | 3300048904 | Bacteria | 2447 |
| 821 | Ga0496101_0084889 | 3300048904 | Bacteria | 2345 |
| 822 | Ga0496101_0284739 | 3300048904 | Bacteria | 1292 |
| 823 | Ga0496101_0458711 | 3300048904 | Unclassified | 1005 |
| 824 | Ga0496101_0473043 | 3300048904 | Archaea | 989 |
| 825 | Ga0496101_0653425 | 3300048904 | Bacteria | 831 |
| 826 | Ga0496102_0009326 | 3300048905 | Bacteria | 8429 |
| 827 | Ga0496102_0010523 | 3300048905 | Bacteria | 7964 |
| 828 | Ga0496102_0024471 | 3300048905 | Bacteria | 5368 |
| 829 | Ga0496102_0028507 | 3300048905 | Bacteria | 4987 |
| 830 | Ga0496102_0101814 | 3300048905 | Bacteria | 2669 |
| 831 | Ga0496102_0111378 | 3300048905 | Bacteria | 2552 |
| 832 | Ga0496102_0219048 | 3300048905 | Bacteria | 1794 |
| 833 | Ga0496102_0335817 | 3300048905 | Unclassified | 1423 |
| 834 | Ga0496103_0010053 | 3300048906 | Bacteria | 5594 |
| 835 | Ga0496103_0025806 | 3300048906 | Bacteria | 3553 |
| 836 | Ga0496103_0045468 | 3300048906 | Bacteria | 2709 |
| 837 | Ga0496103_0343184 | 3300048906 | Bacteria | 960 |
| 838 | Ga0496103_0353083 | 3300048906 | Bacteria | 945 |
| 839 | Ga0496104_0000617 | 3300048907 | Bacteria | 30492 |
| 840 | Ga0496104_0006326 | 3300048907 | Bacteria | 10418 |
| 841 | Ga0496104_0009980 | 3300048907 | Bacteria | 8478 |
| 842 | Ga0496104_0020456 | 3300048907 | Bacteria | 6068 |
| 843 | Ga0496104_0021027 | 3300048907 | Bacteria | 5987 |
| 844 | Ga0496104_0037862 | 3300048907 | Bacteria | 4510 |
| 845 | Ga0496104_0089314 | 3300048907 | Bacteria | 2944 |
| 846 | Ga0496104_0310341 | 3300048907 | Bacteria | 1490 |
| 847 | Ga0496104_0365388 | 3300048907 | Unclassified | 1355 |
| 848 | Ga0496104_0467852 | 3300048907 | Bacteria | 1172 |
| 849 | Ga0496104_1056369 | 3300048907 | Bacteria | 716 |
| 850 | Ga0496105_0000147 | 3300048908 | Bacteria | 46556 |
| 851 | Ga0496105_0007064 | 3300048908 | Bacteria | 8655 |
| 852 | Ga0496105_0007204 | 3300048908 | Bacteria | 8586 |
| 853 | Ga0496105_0052606 | 3300048908 | Bacteria | 3364 |
| 854 | Ga0496105_0065718 | 3300048908 | Bacteria | 2993 |
| 855 | Ga0496105_0077393 | 3300048908 | Bacteria | 2747 |
| 856 | Ga0496105_0171178 | 3300048908 | Bacteria | 1780 |
| 857 | Ga0496105_0307830 | 3300048908 | Unclassified | 1272 |
| 858 | Ga0496105_0433390 | 3300048908 | Bacteria | 1039 |
| 859 | Ga0496106_0004250 | 3300048909 | Bacteria | 10660 |
| 860 | Ga0496106_0022615 | 3300048909 | Bacteria | 4672 |
| 861 | Ga0496106_0047941 | 3300048909 | Bacteria | 3216 |
| 862 | Ga0496106_0091766 | 3300048909 | Bacteria | 2345 |
| 863 | Ga0496106_0097026 | 3300048909 | Bacteria | 2282 |
| 864 | Ga0496106_0417554 | 3300048909 | Bacteria | 1078 |
| 865 | Ga0496106_0475013 | 3300048909 | Bacteria | 1004 |
| 866 | Ga0496107_0006798 | 3300048910 | Bacteria | 7877 |
| 867 | Ga0496107_0009452 | 3300048910 | Bacteria | 6764 |
| 868 | Ga0496107_0014706 | 3300048910 | Bacteria | 5479 |
| 869 | Ga0496107_0017194 | 3300048910 | Bacteria | 5087 |
| 870 | Ga0496107_0172596 | 3300048910 | Bacteria | 1605 |
| 871 | Ga0496107_0180335 | 3300048910 | Bacteria | 1568 |
| 872 | Ga0496107_0185737 | 3300048910 | Bacteria | 1544 |
| 873 | Ga0496107_0282623 | 3300048910 | Bacteria | 1235 |
| 874 | Ga0496107_0307822 | 3300048910 | Unclassified | 1179 |
| 875 | Ga0496108_0001690 | 3300048911 | Bacteria | 17508 |
| 876 | Ga0496108_0016216 | 3300048911 | Bacteria | 6075 |
| 877 | Ga0496108_0065911 | 3300048911 | Bacteria | 3053 |
| 878 | Ga0496108_0124059 | 3300048911 | Bacteria | 2216 |
| 879 | Ga0496108_0256827 | 3300048911 | Bacteria | 1520 |
| 880 | Ga0496108_0913420 | 3300048911 | Unclassified | 753 |
| 881 | Ga0496109_0000576 | 3300048912 | Bacteria | 30721 |
| 882 | Ga0496109_0000605 | 3300048912 | Bacteria | 29977 |
| 883 | Ga0496109_0002132 | 3300048912 | Bacteria | 16461 |
| 884 | Ga0496109_0003633 | 3300048912 | Bacteria | 12890 |
| 885 | Ga0496109_0020405 | 3300048912 | Bacteria | 5852 |
| 886 | Ga0496109_0069099 | 3300048912 | Bacteria | 3239 |
| 887 | Ga0496109_0082140 | 3300048912 | Bacteria | 2969 |
| 888 | Ga0496109_0109156 | 3300048912 | Bacteria | 2572 |
| 889 | Ga0496109_0118720 | 3300048912 | Bacteria | 2462 |
| 890 | Ga0496109_0172051 | 3300048912 | Bacteria | 2032 |
| 891 | Ga0496109_0204306 | 3300048912 | Bacteria | 1857 |
| 892 | Ga0496109_0271373 | 3300048912 | Bacteria | 1598 |
| 893 | Ga0496109_0535479 | 3300048912 | Bacteria | 1105 |
| 894 | Ga0496110_0003721 | 3300048913 | Bacteria | 11747 |
| 895 | Ga0496110_0004408 | 3300048913 | Bacteria | 10902 |
| 896 | Ga0496110_0024265 | 3300048913 | Bacteria | 5166 |
| 897 | Ga0496110_0035220 | 3300048913 | Bacteria | 4342 |
| 898 | Ga0496110_0036414 | 3300048913 | Bacteria | 4273 |
| 899 | Ga0496110_0116351 | 3300048913 | Bacteria | 2407 |
| 900 | Ga0496110_0181288 | 3300048913 | Bacteria | 1912 |
| 901 | Ga0496110_0201241 | 3300048913 | Bacteria | 1810 |
| 902 | Ga0496110_0202035 | 3300048913 | Bacteria | 1806 |
| 903 | Ga0496110_0202978 | 3300048913 | Bacteria | 1801 |
| 904 | Ga0496110_0211734 | 3300048913 | Bacteria | 1762 |
| 905 | Ga0496110_0446840 | 3300048913 | Bacteria | 1178 |
| 906 | Ga0496110_0652466 | 3300048913 | Bacteria | 952 |
| 907 | Ga0496111_0001372 | 3300048914 | Bacteria | 13804 |
| 908 | Ga0496111_0005287 | 3300048914 | Bacteria | 8245 |
| 909 | Ga0496111_0011531 | 3300048914 | Bacteria | 5959 |
| 910 | Ga0496111_0025935 | 3300048914 | Bacteria | 4136 |
| 911 | Ga0496111_0045100 | 3300048914 | Bacteria | 3171 |
| 912 | Ga0496111_0077649 | 3300048914 | Bacteria | 2421 |
| 913 | Ga0496111_0091267 | 3300048914 | Bacteria | 2232 |
| 914 | Ga0496111_0158808 | 3300048914 | Bacteria | 1678 |
| 915 | Ga0496111_0186357 | 3300048914 | Bacteria | 1543 |
| 916 | Ga0496111_0208968 | 3300048914 | Bacteria | 1450 |
| 917 | Ga0496111_0334179 | 3300048914 | Bacteria | 1122 |
| 918 | Ga0496112_0000273 | 3300048915 | Bacteria | 33471 |
| 919 | Ga0496112_0009544 | 3300048915 | Bacteria | 8751 |
| 920 | Ga0496112_0011211 | 3300048915 | Bacteria | 8175 |
| 921 | Ga0496112_0019704 | 3300048915 | Bacteria | 6375 |
| 922 | Ga0496112_0027531 | 3300048915 | Bacteria | 5481 |
| 923 | Ga0496112_0108747 | 3300048915 | Bacteria | 2743 |
| 924 | Ga0496112_0112468 | 3300048915 | Bacteria | 2693 |
| 925 | Ga0496112_0184011 | 3300048915 | Unclassified | 2053 |
| 926 | Ga0496112_0259474 | 3300048915 | Bacteria | 1687 |
| 927 | Ga0496112_0478562 | 3300048915 | Bacteria | 1182 |
| 928 | Ga0496112_0558889 | 3300048915 | Bacteria | 1078 |
| 929 | Ga0496112_0647974 | 3300048915 | Bacteria | 986 |
| 930 | Ga0496112_1084694 | 3300048915 | Bacteria | 719 |
| 931 | Ga0496113_0021814 | 3300048916 | Bacteria | 4522 |
| 932 | Ga0496113_0181162 | 3300048916 | Bacteria | 1670 |
| 933 | Ga0496113_0343732 | 3300048916 | Bacteria | 1197 |
| 934 | Ga0496113_0404965 | 3300048916 | Unclassified | 1095 |
| 935 | Ga0496113_0497603 | 3300048916 | Bacteria | 979 |
| 936 | Ga0496114_0002378 | 3300048917 | Bacteria | 14307 |
| 937 | Ga0496114_0002771 | 3300048917 | Bacteria | 13416 |
| 938 | Ga0496114_0004042 | 3300048917 | Bacteria | 11332 |
| 939 | Ga0496114_0012654 | 3300048917 | Bacteria | 6758 |
| 940 | Ga0496114_0021259 | 3300048917 | Bacteria | 5277 |
| 941 | Ga0496114_0027028 | 3300048917 | Bacteria | 4700 |
| 942 | Ga0496114_0029401 | 3300048917 | Bacteria | 4516 |
| 943 | Ga0496114_0120163 | 3300048917 | Bacteria | 2259 |
| 944 | Ga0496114_0164191 | 3300048917 | Bacteria | 1933 |
| 945 | Ga0496114_0272143 | 3300048917 | Bacteria | 1492 |
| 946 | Ga0496114_0366793 | 3300048917 | Bacteria | 1274 |
| 947 | Ga0496115_0001894 | 3300048918 | Bacteria | 14979 |
| 948 | Ga0496115_0005207 | 3300048918 | Bacteria | 9455 |
| 949 | Ga0496115_0006368 | 3300048918 | Bacteria | 8647 |
| 950 | Ga0496115_0033800 | 3300048918 | Bacteria | 4039 |
| 951 | Ga0496115_0165067 | 3300048918 | Bacteria | 1831 |
| 952 | Ga0496115_0214161 | 3300048918 | Bacteria | 1591 |
| 953 | Ga0496115_0222658 | 3300048918 | Bacteria | 1557 |
| 954 | Ga0501031_0001694 | 3300049568 | Bacteria | 13843 |
| 955 | Ga0501031_0006544 | 3300049568 | Bacteria | 7597 |
| 956 | Ga0501031_0073567 | 3300049568 | Bacteria | 2225 |
| 957 | Ga0501032_0018156 | 3300049569 | Bacteria | 4929 |
| 958 | Ga0501033_0039387 | 3300049570 | Bacteria | 3530 |
| 959 | Ga0501034_0164444 | 3300049571 | Bacteria | 2188 |
| 960 | Ga0501036_0002633 | 3300049572 | Bacteria | 14148 |
| 961 | Ga0501036_0063805 | 3300049572 | Bacteria | 3118 |
| 962 | Ga0501037_0055083 | 3300049573 | Bacteria | 2908 |
| 963 | Ga0501037_0251475 | 3300049573 | Unclassified | 1237 |
| 964 | Ga0501038_0010236 | 3300049574 | Bacteria | 8582 |
| 965 | Ga0501039_0002091 | 3300049575 | Bacteria | 14799 |
| 966 | Ga0501040_0002120 | 3300049576 | Bacteria | 12789 |
| 967 | Ga0501040_0002148 | 3300049576 | Bacteria | 12729 |
| 968 | Ga0501040_0101560 | 3300049576 | Bacteria | 2007 |
| 969 | Ga0501041_0018181 | 3300049577 | Bacteria | 4186 |
| 970 | Ga0501041_0021300 | 3300049577 | Bacteria | 3884 |
| 971 | Ga0501041_0072141 | 3300049577 | Bacteria | 2121 |
| 972 | Ga0501042_0027080 | 3300049578 | Bacteria | 4030 |
| 973 | Ga0501042_0162016 | 3300049578 | Bacteria | 1614 |
| 974 | Ga0501042_0302541 | 3300049578 | Bacteria | 1155 |
| 975 | Ga0501043_0041040 | 3300049579 | Bacteria | 3636 |
| 976 | Ga0501043_0133897 | 3300049579 | Bacteria | 1942 |
| 977 | Ga0501046_0036825 | 3300049580 | Bacteria | 3935 |
| 978 | Ga0501046_0190722 | 3300049580 | Bacteria | 1529 |
| 979 | Ga0501046_0238708 | 3300049580 | Bacteria | 1341 |
| 980 | Ga0501047_0010057 | 3300049581 | Bacteria | 8942 |
| 981 | Ga0501047_0026688 | 3300049581 | Bacteria | 5559 |
| 982 | Ga0501048_0002553 | 3300049582 | Bacteria | 13932 |
| 983 | Ga0501048_0074470 | 3300049582 | Bacteria | 2395 |
| 984 | Ga0501048_0277378 | 3300049582 | Bacteria | 1192 |
| 985 | Ga0501067_0001219 | 3300049583 | Bacteria | 13976 |
| 986 | Ga0501067_0026272 | 3300049583 | Bacteria | 3226 |
| 987 | Ga0501067_0077725 | 3300049583 | Bacteria | 1839 |
| 988 | Ga0501067_0203132 | 3300049583 | Bacteria | 1104 |
| 989 | Ga0501068_0022601 | 3300049584 | Bacteria | 3678 |
| 990 | Ga0501068_0126481 | 3300049584 | Bacteria | 1596 |
| 991 | Ga0501069_0007861 | 3300049585 | Bacteria | 5598 |
| 992 | Ga0501069_0061929 | 3300049585 | Bacteria | 2089 |
| 993 | Ga0501070_0000120 | 3300049586 | Bacteria | 70354 |
| 994 | Ga0501071_0000414 | 3300049587 | Bacteria | 21222 |
| 995 | Ga0501071_0003032 | 3300049587 | Bacteria | 10397 |
| 996 | Ga0501072_0001365 | 3300049588 | Bacteria | 18321 |
| 997 | Ga0501072_0013944 | 3300049588 | Bacteria | 6159 |
| 998 | Ga0501072_0580028 | 3300049588 | Bacteria | 885 |
| 999 | Ga0501073_0072000 | 3300049589 | Bacteria | 2408 |
| 1000 | Ga0501074_0010622 | 3300049590 | Bacteria | 6684 |
| 1001 | Ga0501074_0010836 | 3300049590 | Bacteria | 6620 |
| 1002 | Ga0501074_0040774 | 3300049590 | Bacteria | 3361 |
| 1003 | Ga0501075_0020376 | 3300049591 | Bacteria | 4823 |
| 1004 | Ga0501075_0109046 | 3300049591 | Bacteria | 2105 |
| 1005 | Ga0501076_0001627 | 3300049592 | Bacteria | 15150 |
| 1006 | Ga0501076_0011984 | 3300049592 | Bacteria | 6477 |
| 1007 | Ga0501076_0260869 | 3300049592 | Bacteria | 1419 |
| 1008 | Ga0501076_0320252 | 3300049592 | Bacteria | 1272 |
| 1009 | Ga0501076_0479639 | 3300049592 | Bacteria | 1025 |
| 1010 | Ga0501077_0017171 | 3300049593 | Bacteria | 4564 |
| 1011 | Ga0501077_0208605 | 3300049593 | Bacteria | 1241 |
| 1012 | Ga0501079_0010395 | 3300049741 | Bacteria | 7073 |
| 1013 | Ga0501079_0480727 | 3300049741 | Bacteria | 976 |
| 1014 | Ga0501080_0260736 | 3300049742 | Bacteria | 1579 |
| 1015 | Ga0501081_0011312 | 3300049743 | Bacteria | 5838 |
| 1016 | Ga0501081_0059229 | 3300049743 | Bacteria | 2651 |
| 1017 | Ga0501081_0156408 | 3300049743 | Bacteria | 1640 |
| 1018 | Ga0501081_0298485 | 3300049743 | Bacteria | 1182 |
| 1019 | Ga0501081_0706371 | 3300049743 | Bacteria | 757 |
| 1020 | Ga0501083_0032408 | 3300049744 | Bacteria | 3583 |
| 1021 | Ga0501035_0042130 | 3300049822 | Bacteria | 4119 |
| 1022 | Ga0501035_0076895 | 3300049822 | Bacteria | 2951 |
| 1023 | Ga0501035_0297353 | 3300049822 | Bacteria | 1361 |
| 1024 | Ga0501035_0394119 | 3300049822 | Bacteria | 1153 |
| 1025 | Ga0501044_0098899 | 3300049823 | Bacteria | 2937 |
| 1026 | Ga0501044_0211408 | 3300049823 | Bacteria | 1894 |
| 1027 | Ga0501044_0334938 | 3300049823 | Bacteria | 1435 |
| 1028 | Ga0501045_0011285 | 3300049824 | Bacteria | 6270 |
| 1029 | Ga0501045_0036522 | 3300049824 | Bacteria | 3567 |
| 1030 | Ga0501045_0219339 | 3300049824 | Bacteria | 1416 |
| 1031 | Ga0501045_0381355 | 3300049824 | Bacteria | 1049 |
| 1032 | nmdc:mga03n38_112395_c1 | 3300050490 | Bacteria | 1328 |
| 1033 | nmdc:mga0yw44_234796_c1 | 3300050492 | Unclassified | 1218 |
| 1034 | nmdc:mga0yw44_45111_c1 | 3300050492 | Bacteria | 2641 |
| 1035 | nmdc:mga0k408_90160_c1 | 3300050493 | Bacteria | 1800 |
| 1036 | nmdc:mga05p37_10748_c1 | 3300050507 | Bacteria | 10866 |
| 1037 | nmdc:mga05p37_1109513_c1 | 3300050507 | Bacteria | 827 |
| 1038 | nmdc:mga05p37_147138_c1 | 3300050507 | Bacteria | 2883 |
| 1039 | nmdc:mga05p37_208837_c1 | 3300050507 | Bacteria | 2361 |
| 1040 | nmdc:mga05p37_308934_c1 | 3300050507 | Bacteria | 1875 |
| 1041 | nmdc:mga05p37_436175_c1 | 3300050507 | Unclassified | 1521 |
| 1042 | nmdc:mga09592_571015_c1 | 3300050508 | Unclassified | 971 |
| 1043 | nmdc:mga06r32_144488_c1 | 3300050510 | Bacteria | 2356 |
| 1044 | nmdc:mga06r32_325621_c1 | 3300050510 | Bacteria | 1522 |
| 1045 | nmdc:mga06r32_740491_c1 | 3300050510 | Unclassified | 947 |
| 1046 | nmdc:mga0n895_40422_c1 | 3300050512 | Bacteria | 4530 |
| 1047 | nmdc:mga0n895_503189_c1 | 3300050512 | Bacteria | 1220 |
| 1048 | nmdc:mga0n895_713751_c1 | 3300050512 | Bacteria | 998 |
| 1049 | nmdc:mga0n895_958627_c1 | 3300050512 | Unclassified | 838 |
| 1050 | nmdc:mga0rr50_143685_c1 | 3300050513 | Bacteria | 1922 |
| 1051 | nmdc:mga0rr50_17281_c1 | 3300050513 | Bacteria | 4813 |
| 1052 | nmdc:mga0rr50_198601_c1 | 3300050513 | Bacteria | 1647 |
| 1053 | nmdc:mga0rr50_795523_c1 | 3300050513 | Bacteria | 807 |
| 1054 | nmdc:mga08x19_36535_c1 | 3300050514 | Bacteria | 3112 |
| 1055 | nmdc:mga0a205_151356_c2 | 3300050515 | Bacteria | 1582 |
| 1056 | nmdc:mga0a205_296230_c1 | 3300050515 | Bacteria | 1491 |
| 1057 | nmdc:mga0a205_63929_c1 | 3300050515 | Bacteria | 3555 |
| 1058 | Ga0495601_0016778 | 3300053077 | Bacteria | 4441 |
| 1059 | Ga0495601_0029007 | 3300053077 | Bacteria | 3430 |
| 1060 | Ga0495601_0076054 | 3300053077 | Bacteria | 2149 |
| 1061 | Ga0495601_0130067 | 3300053077 | Bacteria | 1639 |
| 1062 | Ga0495601_0226003 | 3300053077 | Bacteria | 1223 |
| 1063 | Ga0495601_0230641 | 3300053077 | Bacteria | 1209 |
| 1064 | Ga0495601_0267342 | 3300053077 | Bacteria | 1116 |
| 1065 | Ga0495612_0044660 | 3300053078 | Bacteria | 1813 |
| 1066 | Ga0495612_0184169 | 3300053078 | Unclassified | 918 |
| 1067 | Ga0495595_0018078 | 3300053084 | Bacteria | 3042 |
| 1068 | Ga0495595_0037728 | 3300053084 | Bacteria | 2198 |
| 1069 | Ga0495595_0057306 | 3300053084 | Bacteria | 1817 |
| 1070 | Ga0495595_0096445 | 3300053084 | Bacteria | 1423 |
| 1071 | Ga0495619_0001713 | 3300053085 | Bacteria | 14540 |
| 1072 | Ga0495619_0002632 | 3300053085 | Bacteria | 11726 |
| 1073 | Ga0495619_0002961 | 3300053085 | Bacteria | 11026 |
| 1074 | Ga0495619_0021685 | 3300053085 | Bacteria | 4104 |
| 1075 | Ga0495619_0147967 | 3300053085 | Bacteria | 1620 |
| 1076 | Ga0501084_0000569 | 3300054114 | Bacteria | 28211 |
| 1077 | Ga0501084_0012234 | 3300054114 | Bacteria | 7104 |
| 1078 | Ga0590071_036211 | 3300059421 | Bacteria | 1183 |
| 1079 | Ga0590074_011756 | 3300059423 | Bacteria | 1467 |
| 1080 | Ga0590077_005096 | 3300059426 | Bacteria | 2686 |
| 1081 | Ga0501082_0005617 | 3300060353 | Bacteria | 10883 |
| 1082 | Ga0501082_0071094 | 3300060353 | Bacteria | 2996 |
| 1083 | Ga0501082_0261483 | 3300060353 | Bacteria | 1505 |
| 1084 | Ga0501082_0572802 | 3300060353 | Bacteria | 988 |
| 1085 | Ga0466962_0024171 | 3300061719 | Bacteria | 2919 |
| 1086 | Ga0530510_0030064 | 3300061734 | Bacteria | 3900 |
| 1087 | Ga0530510_0038763 | 3300061734 | Bacteria | 3441 |
| 1088 | Ga0530510_0069148 | 3300061734 | Bacteria | 2562 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035116 | Ga0373945_0025864 | Ga0373945_0025864_782_1453 | 173 |
| 2 | 3300035170 | Ga0373943_0036413 | Ga0373943_0036413_1337_2008 | 173 |
| 3 | 3300035171 | Ga0373946_0081016 | Ga0373946_0081016_696_1328 | 173 |
| 4 | 3300035692 | Ga0373935_0048387 | Ga0373935_0048387_1674_2306 | 173 |
| 5 | 3300035695 | Ga0373927_0015946 | Ga0373927_0015946_786_1457 | 173 |
| 6 | 3300035725 | Ga0373947_0129897 | Ga0373947_0129897_65_697 | 173 |
| 7 | 3300037068 | Ga0373925_0239637 | Ga0373925_0239637_368_1000 | 173 |
| 8 | 3300047321 | Ga0495676_0083785 | Ga0495676_0083785_490_1122 | 173 |
| 9 | 3300044842 | Ga0466957_0070755 | Ga0466957_0070755_107_820 | 175 |
| 10 | 3300045976 | Ga0466967_0049411 | Ga0466967_0049411_2399_3112 | 175 |
| 11 | 3300046559 | Ga0495667_0213205 | Ga0495667_0213205_187_894 | 180 |
| 12 | 3300031344 | Ga0265316_10047132 | Ga0265316_100471323 | 182 |
| 13 | 3300031344 | Ga0265316_10235790 | Ga0265316_102357902 | 182 |
| 14 | 3300037466 | Ga0395898_0338657 | Ga0395898_0338657_213_857 | 183 |
| 15 | 3300049583 | Ga0501067_0026272 | Ga0501067_0026272_1102_1812 | 183 |
| 16 | 3300025898 | Ga0207692_10276217 | Ga0207692_102762172 | 184 |
| 17 | 3300036401 | Ga0373937_1052429 | Ga0373937_1052429_15_668 | 185 |
| 18 | 3300037418 | Ga0395900_0590022 | Ga0395900_0590022_228_908 | 185 |
| 19 | 3300046462 | Ga0495651_0226737 | Ga0495651_0226737_92_745 | 185 |
| 20 | 3300046463 | Ga0495653_0019059 | Ga0495653_0019059_243_896 | 185 |
| 21 | 3300046559 | Ga0495667_0003549 | Ga0495667_0003549_5214_5867 | 185 |
| 22 | 3300046642 | Ga0495634_0162315 | Ga0495634_0162315_221_874 | 185 |
| 23 | 3300046675 | Ga0495657_0029506 | Ga0495657_0029506_598_1251 | 185 |
| 24 | 3300047322 | Ga0495680_0014309 | Ga0495680_0014309_2549_3202 | 185 |
| 25 | 3300053084 | Ga0495595_0096445 | Ga0495595_0096445_403_1056 | 185 |
| 26 | 3300005468 | Ga0070707_100014979 | Ga0070707_1000149792 | 186 |
| 27 | 3300009147 | Ga0114129_10173306 | Ga0114129_101733061 | 186 |
| 28 | 3300025922 | Ga0207646_10011532 | Ga0207646_100115323 | 186 |
| 29 | 3300046506 | Ga0495583_0054971 | Ga0495583_0054971_40_669 | 186 |
| 30 | 3300005337 | Ga0070682_100174664 | Ga0070682_1001746642 | 187 |
| 31 | 3300009177 | Ga0105248_10597848 | Ga0105248_105978482 | 187 |
| 32 | 3300037471 | Ga0395905_0142238 | Ga0395905_0142238_1082_1708 | 187 |
| 33 | 3300048903 | Ga0496100_0334844 | Ga0496100_0334844_132_806 | 187 |
| 34 | 3300048907 | Ga0496104_0037862 | Ga0496104_0037862_506_1180 | 187 |
| 35 | 3300048912 | Ga0496109_0172051 | Ga0496109_0172051_195_869 | 187 |
| 36 | 3300005467 | Ga0070706_100737313 | Ga0070706_1007373132 | 188 |
| 37 | 3300005471 | Ga0070698_100168661 | Ga0070698_1001686613 | 188 |
| 38 | 3300025910 | Ga0207684_10552858 | Ga0207684_105528582 | 188 |
| 39 | 3300046477 | Ga0495664_0030696 | Ga0495664_0030696_1987_2697 | 188 |
| 40 | 3300046514 | Ga0495618_0181776 | Ga0495618_0181776_520_1230 | 188 |
| 41 | 3300046642 | Ga0495634_0255984 | Ga0495634_0255984_228_938 | 188 |
| 42 | 3300005937 | Ga0081455_10141099 | Ga0081455_101410992 | 189 |
| 43 | 3300025939 | Ga0207665_10276326 | Ga0207665_102763262 | 191 |
| 44 | 3300037418 | Ga0395900_0410049 | Ga0395900_0410049_318_923 | 192 |
| 45 | 3300037466 | Ga0395898_0010435 | Ga0395898_0010435_2810_3415 | 192 |
| 46 | 3300037471 | Ga0395905_0023688 | Ga0395905_0023688_4469_5074 | 192 |
| 47 | 3300038443 | Ga0395901_0005214 | Ga0395901_0005214_5808_6413 | 192 |
| 48 | 3300039450 | Ga0436363_0546918 | Ga0436363_0546918_507_1118 | 192 |
| 49 | 3300048915 | Ga0496112_0478562 | Ga0496112_0478562_252_866 | 192 |
| 50 | 3300005329 | Ga0070683_100000847 | Ga0070683_1000008478 | 193 |
| 51 | 3300005336 | Ga0070680_100051747 | Ga0070680_1000517473 | 193 |
| 52 | 3300005337 | Ga0070682_100479636 | Ga0070682_1004796362 | 193 |
| 53 | 3300005338 | Ga0068868_100089156 | Ga0068868_1000891562 | 193 |
| 54 | 3300005339 | Ga0070660_100521225 | Ga0070660_1005212251 | 193 |
| 55 | 3300005366 | Ga0070659_100641945 | Ga0070659_1006419451 | 193 |
| 56 | 3300005456 | Ga0070678_100071581 | Ga0070678_1000715813 | 193 |
| 57 | 3300005456 | Ga0070678_100155325 | Ga0070678_1001553252 | 193 |
| 58 | 3300005458 | Ga0070681_10013690 | Ga0070681_100136907 | 193 |
| 59 | 3300005518 | Ga0070699_100511212 | Ga0070699_1005112121 | 193 |
| 60 | 3300005530 | Ga0070679_100111292 | Ga0070679_1001112922 | 193 |
| 61 | 3300005535 | Ga0070684_100005178 | Ga0070684_1000051784 | 193 |
| 62 | 3300005548 | Ga0070665_100040732 | Ga0070665_1000407322 | 193 |
| 63 | 3300005564 | Ga0070664_100079695 | Ga0070664_1000796952 | 193 |
| 64 | 3300005614 | Ga0068856_100341905 | Ga0068856_1003419052 | 193 |
| 65 | 3300005840 | Ga0068870_10155309 | Ga0068870_101553092 | 193 |
| 66 | 3300006237 | Ga0097621_100249110 | Ga0097621_1002491102 | 193 |
| 67 | 3300006852 | Ga0075433_10233798 | Ga0075433_102337982 | 193 |
| 68 | 3300006871 | Ga0075434_100359177 | Ga0075434_1003591772 | 193 |
| 69 | 3300006871 | Ga0075434_100852607 | Ga0075434_1008526071 | 193 |
| 70 | 3300007076 | Ga0075435_100490375 | Ga0075435_1004903752 | 193 |
| 71 | 3300009094 | Ga0111539_10815293 | Ga0111539_108152931 | 193 |
| 72 | 3300009098 | Ga0105245_10006098 | Ga0105245_100060982 | 193 |
| 73 | 3300009098 | Ga0105245_10123267 | Ga0105245_101232672 | 193 |
| 74 | 3300009098 | Ga0105245_10536150 | Ga0105245_105361501 | 193 |
| 75 | 3300009098 | Ga0105245_10572165 | Ga0105245_105721652 | 193 |
| 76 | 3300009147 | Ga0114129_10300988 | Ga0114129_103009882 | 193 |
| 77 | 3300009177 | Ga0105248_10412913 | Ga0105248_104129132 | 193 |
| 78 | 3300009553 | Ga0105249_10615190 | Ga0105249_106151902 | 193 |
| 79 | 3300010375 | Ga0105239_10104874 | Ga0105239_101048742 | 193 |
| 80 | 3300010375 | Ga0105239_10373664 | Ga0105239_103736642 | 193 |
| 81 | 3300014326 | Ga0157380_10298626 | Ga0157380_102986262 | 193 |
| 82 | 3300014745 | Ga0157377_10613276 | Ga0157377_106132761 | 193 |
| 83 | 3300014968 | Ga0157379_10665641 | Ga0157379_106656411 | 193 |
| 84 | 3300025908 | Ga0207643_10054543 | Ga0207643_100545432 | 193 |
| 85 | 3300025911 | Ga0207654_10050233 | Ga0207654_100502333 | 193 |
| 86 | 3300025912 | Ga0207707_10056274 | Ga0207707_100562744 | 193 |
| 87 | 3300025917 | Ga0207660_10023010 | Ga0207660_100230102 | 193 |
| 88 | 3300025919 | Ga0207657_10520623 | Ga0207657_105206232 | 193 |
| 89 | 3300025921 | Ga0207652_10008202 | Ga0207652_100082028 | 193 |
| 90 | 3300025927 | Ga0207687_10003480 | Ga0207687_100034809 | 193 |
| 91 | 3300025927 | Ga0207687_10263485 | Ga0207687_102634852 | 193 |
| 92 | 3300025932 | Ga0207690_10381964 | Ga0207690_103819641 | 193 |
| 93 | 3300025937 | Ga0207669_10061307 | Ga0207669_100613073 | 193 |
| 94 | 3300025944 | Ga0207661_10000646 | Ga0207661_100006469 | 193 |
| 95 | 3300025945 | Ga0207679_10074293 | Ga0207679_100742932 | 193 |
| 96 | 3300025961 | Ga0207712_10159907 | Ga0207712_101599072 | 193 |
| 97 | 3300026023 | Ga0207677_10021579 | Ga0207677_100215794 | 193 |
| 98 | 3300026078 | Ga0207702_10013311 | Ga0207702_100133114 | 193 |
| 99 | 3300026078 | Ga0207702_10871568 | Ga0207702_108715682 | 193 |
| 100 | 3300026089 | Ga0207648_10376140 | Ga0207648_103761402 | 193 |
| 101 | 3300026121 | Ga0207683_10099829 | Ga0207683_100998293 | 193 |
| 102 | 3300026121 | Ga0207683_10122977 | Ga0207683_101229772 | 193 |
| 103 | 3300028379 | Ga0268266_10038991 | Ga0268266_100389912 | 193 |
| 104 | 3300031731 | Ga0307405_10155804 | Ga0307405_101558041 | 193 |
| 105 | 3300031903 | Ga0307407_10277879 | Ga0307407_102778792 | 193 |
| 106 | 3300031995 | Ga0307409_100060313 | Ga0307409_1000603133 | 193 |
| 107 | 3300031995 | Ga0307409_100450650 | Ga0307409_1004506502 | 193 |
| 108 | 3300032002 | Ga0307416_100207823 | Ga0307416_1002078233 | 193 |
| 109 | 3300032126 | Ga0307415_100018386 | Ga0307415_1000183864 | 193 |
| 110 | 3300037466 | Ga0395898_0243274 | Ga0395898_0243274_540_1160 | 193 |
| 111 | 3300038443 | Ga0395901_0158299 | Ga0395901_0158299_118_738 | 193 |
| 112 | 3300038443 | Ga0395901_1101423 | Ga0395901_1101423_78_695 | 193 |
| 113 | 3300042127 | Ga0450890_034001 | Ga0450890_034001_33_644 | 193 |
| 114 | 3300046459 | Ga0495629_0207889 | Ga0495629_0207889_111_722 | 193 |
| 115 | 3300046523 | Ga0495644_0126602 | Ga0495644_0126602_94_702 | 193 |
| 116 | 3300046615 | Ga0495656_0026348 | Ga0495656_0026348_263_871 | 193 |
| 117 | 3300046642 | Ga0495634_0137867 | Ga0495634_0137867_788_1408 | 193 |
| 118 | 3300046663 | Ga0495635_0645507 | Ga0495635_0645507_34_645 | 193 |
| 119 | 3300046689 | Ga0495613_0206527 | Ga0495613_0206527_683_1303 | 193 |
| 120 | 3300047319 | Ga0495674_0138705 | Ga0495674_0138705_1413_2024 | 193 |
| 121 | 3300047446 | Ga0495679_068180 | Ga0495679_068180_392_1003 | 193 |
| 122 | 3300048903 | Ga0496100_0004055 | Ga0496100_0004055_5739_6353 | 193 |
| 123 | 3300048903 | Ga0496100_0451708 | Ga0496100_0451708_227_841 | 193 |
| 124 | 3300048904 | Ga0496101_0458711 | Ga0496101_0458711_350_964 | 193 |
| 125 | 3300048904 | Ga0496101_0653425 | Ga0496101_0653425_51_659 | 193 |
| 126 | 3300048905 | Ga0496102_0009326 | Ga0496102_0009326_2048_2662 | 193 |
| 127 | 3300048905 | Ga0496102_0335817 | Ga0496102_0335817_227_841 | 193 |
| 128 | 3300048906 | Ga0496103_0353083 | Ga0496103_0353083_104_718 | 193 |
| 129 | 3300048907 | Ga0496104_0000617 | Ga0496104_0000617_29573_30187 | 193 |
| 130 | 3300048907 | Ga0496104_0021027 | Ga0496104_0021027_3680_4294 | 193 |
| 131 | 3300048908 | Ga0496105_0000147 | Ga0496105_0000147_26054_26668 | 193 |
| 132 | 3300048908 | Ga0496105_0052606 | Ga0496105_0052606_2443_3063 | 193 |
| 133 | 3300048908 | Ga0496105_0077393 | Ga0496105_0077393_46_660 | 193 |
| 134 | 3300048909 | Ga0496106_0475013 | Ga0496106_0475013_325_939 | 193 |
| 135 | 3300048910 | Ga0496107_0180335 | Ga0496107_0180335_411_1025 | 193 |
| 136 | 3300048911 | Ga0496108_0256827 | Ga0496108_0256827_161_775 | 193 |
| 137 | 3300048912 | Ga0496109_0002132 | Ga0496109_0002132_448_1062 | 193 |
| 138 | 3300048912 | Ga0496109_0069099 | Ga0496109_0069099_832_1440 | 193 |
| 139 | 3300048912 | Ga0496109_0118720 | Ga0496109_0118720_432_1046 | 193 |
| 140 | 3300048913 | Ga0496110_0004408 | Ga0496110_0004408_4419_5033 | 193 |
| 141 | 3300048913 | Ga0496110_0024265 | Ga0496110_0024265_1526_2140 | 193 |
| 142 | 3300048913 | Ga0496110_0036414 | Ga0496110_0036414_525_1139 | 193 |
| 143 | 3300048913 | Ga0496110_0116351 | Ga0496110_0116351_1694_2314 | 193 |
| 144 | 3300048913 | Ga0496110_0201241 | Ga0496110_0201241_770_1378 | 193 |
| 145 | 3300048914 | Ga0496111_0005287 | Ga0496111_0005287_5265_5879 | 193 |
| 146 | 3300048915 | Ga0496112_0647974 | Ga0496112_0647974_151_759 | 193 |
| 147 | 3300048916 | Ga0496113_0343732 | Ga0496113_0343732_76_690 | 193 |
| 148 | 3300048917 | Ga0496114_0002378 | Ga0496114_0002378_5067_5681 | 193 |
| 149 | 3300048917 | Ga0496114_0004042 | Ga0496114_0004042_7011_7625 | 193 |
| 150 | 3300048917 | Ga0496114_0027028 | Ga0496114_0027028_2225_2839 | 193 |
| 151 | 3300048918 | Ga0496115_0214161 | Ga0496115_0214161_913_1527 | 193 |
| 152 | 3300049568 | Ga0501031_0001694 | Ga0501031_0001694_2747_3358 | 193 |
| 153 | 3300049568 | Ga0501031_0073567 | Ga0501031_0073567_1076_1684 | 193 |
| 154 | 3300049569 | Ga0501032_0018156 | Ga0501032_0018156_2615_3226 | 193 |
| 155 | 3300049570 | Ga0501033_0039387 | Ga0501033_0039387_251_862 | 193 |
| 156 | 3300049572 | Ga0501036_0002633 | Ga0501036_0002633_10464_11075 | 193 |
| 157 | 3300049573 | Ga0501037_0055083 | Ga0501037_0055083_1150_1761 | 193 |
| 158 | 3300049574 | Ga0501038_0010236 | Ga0501038_0010236_2336_2947 | 193 |
| 159 | 3300049575 | Ga0501039_0002091 | Ga0501039_0002091_11402_12013 | 193 |
| 160 | 3300049576 | Ga0501040_0002120 | Ga0501040_0002120_9793_10404 | 193 |
| 161 | 3300049576 | Ga0501040_0101560 | Ga0501040_0101560_566_1180 | 193 |
| 162 | 3300049577 | Ga0501041_0021300 | Ga0501041_0021300_1790_2401 | 193 |
| 163 | 3300049577 | Ga0501041_0072141 | Ga0501041_0072141_790_1404 | 193 |
| 164 | 3300049578 | Ga0501042_0162016 | Ga0501042_0162016_249_857 | 193 |
| 165 | 3300049578 | Ga0501042_0302541 | Ga0501042_0302541_499_1110 | 193 |
| 166 | 3300049579 | Ga0501043_0041040 | Ga0501043_0041040_665_1276 | 193 |
| 167 | 3300049580 | Ga0501046_0036825 | Ga0501046_0036825_659_1270 | 193 |
| 168 | 3300049580 | Ga0501046_0238708 | Ga0501046_0238708_703_1317 | 193 |
| 169 | 3300049582 | Ga0501048_0002553 | Ga0501048_0002553_2859_3470 | 193 |
| 170 | 3300049582 | Ga0501048_0277378 | Ga0501048_0277378_260_886 | 193 |
| 171 | 3300049584 | Ga0501068_0022601 | Ga0501068_0022601_1216_1827 | 193 |
| 172 | 3300049587 | Ga0501071_0000414 | Ga0501071_0000414_11494_12105 | 193 |
| 173 | 3300049588 | Ga0501072_0013944 | Ga0501072_0013944_2946_3557 | 193 |
| 174 | 3300049590 | Ga0501074_0010836 | Ga0501074_0010836_4138_4749 | 193 |
| 175 | 3300049591 | Ga0501075_0020376 | Ga0501075_0020376_2801_3412 | 193 |
| 176 | 3300049591 | Ga0501075_0109046 | Ga0501075_0109046_520_1134 | 193 |
| 177 | 3300049592 | Ga0501076_0001627 | Ga0501076_0001627_2735_3346 | 193 |
| 178 | 3300049593 | Ga0501077_0017171 | Ga0501077_0017171_1285_1896 | 193 |
| 179 | 3300049741 | Ga0501079_0010395 | Ga0501079_0010395_5534_6145 | 193 |
| 180 | 3300049743 | Ga0501081_0059229 | Ga0501081_0059229_859_1473 | 193 |
| 181 | 3300049743 | Ga0501081_0156408 | Ga0501081_0156408_59_670 | 193 |
| 182 | 3300049743 | Ga0501081_0706371 | Ga0501081_0706371_13_624 | 193 |
| 183 | 3300049744 | Ga0501083_0032408 | Ga0501083_0032408_2587_3198 | 193 |
| 184 | 3300049822 | Ga0501035_0042130 | Ga0501035_0042130_1412_2023 | 193 |
| 185 | 3300049823 | Ga0501044_0098899 | Ga0501044_0098899_1704_2315 | 193 |
| 186 | 3300049824 | Ga0501045_0011285 | Ga0501045_0011285_3097_3708 | 193 |
| 187 | 3300049824 | Ga0501045_0219339 | Ga0501045_0219339_358_972 | 193 |
| 188 | 3300050513 | nmdc:mga0rr50_795523_c1 | nmdc:mga0rr50_795523_c1_26_640 | 193 |
| 189 | 3300050515 | nmdc:mga0a205_296230_c1 | nmdc:mga0a205_296230_c1_239_853 | 193 |
| 190 | 3300053085 | Ga0495619_0021685 | Ga0495619_0021685_2102_2713 | 193 |
| 191 | 3300054114 | Ga0501084_0000569 | Ga0501084_0000569_27571_28182 | 193 |
| 192 | 3300060353 | Ga0501082_0005617 | Ga0501082_0005617_51_662 | 193 |
| 193 | 3300061734 | Ga0530510_0030064 | Ga0530510_0030064_202_813 | 193 |
| 194 | 3300005535 | Ga0070684_100503559 | Ga0070684_1005035592 | 194 |
| 195 | 3300005842 | Ga0068858_100569595 | Ga0068858_1005695952 | 194 |
| 196 | 3300031548 | Ga0307408_100886549 | Ga0307408_1008865491 | 194 |
| 197 | 3300031731 | Ga0307405_10109727 | Ga0307405_101097272 | 194 |
| 198 | 3300031852 | Ga0307410_10697518 | Ga0307410_106975182 | 194 |
| 199 | 3300031995 | Ga0307409_100238338 | Ga0307409_1002383382 | 194 |
| 200 | 3300032002 | Ga0307416_101084168 | Ga0307416_1010841681 | 194 |
| 201 | 3300041411 | Ga0439466_0067191 | Ga0439466_0067191_170_784 | 194 |
| 202 | 3300046492 | Ga0495585_0143385 | Ga0495585_0143385_139_756 | 194 |
| 203 | 3300046615 | Ga0495656_0060924 | Ga0495656_0060924_626_1240 | 194 |
| 204 | 3300046615 | Ga0495656_0079134 | Ga0495656_0079134_665_1282 | 194 |
| 205 | 3300046691 | Ga0495670_0268156 | Ga0495670_0268156_47_661 | 194 |
| 206 | 3300046794 | Ga0495589_0253521 | Ga0495589_0253521_151_768 | 194 |
| 207 | 3300047445 | Ga0495677_0193950 | Ga0495677_0193950_154_771 | 194 |
| 208 | 3300048907 | Ga0496104_0467852 | Ga0496104_0467852_105_716 | 194 |
| 209 | 3300049568 | Ga0501031_0006544 | Ga0501031_0006544_3464_4081 | 194 |
| 210 | 3300049572 | Ga0501036_0063805 | Ga0501036_0063805_971_1588 | 194 |
| 211 | 3300049573 | Ga0501037_0251475 | Ga0501037_0251475_352_969 | 194 |
| 212 | 3300049576 | Ga0501040_0002148 | Ga0501040_0002148_3022_3639 | 194 |
| 213 | 3300049577 | Ga0501041_0018181 | Ga0501041_0018181_2862_3479 | 194 |
| 214 | 3300049578 | Ga0501042_0027080 | Ga0501042_0027080_2314_2931 | 194 |
| 215 | 3300049579 | Ga0501043_0133897 | Ga0501043_0133897_520_1137 | 194 |
| 216 | 3300049582 | Ga0501048_0074470 | Ga0501048_0074470_907_1524 | 194 |
| 217 | 3300049587 | Ga0501071_0003032 | Ga0501071_0003032_1868_2485 | 194 |
| 218 | 3300049588 | Ga0501072_0001365 | Ga0501072_0001365_8704_9321 | 194 |
| 219 | 3300049588 | Ga0501072_0580028 | Ga0501072_0580028_154_774 | 194 |
| 220 | 3300049590 | Ga0501074_0040774 | Ga0501074_0040774_1524_2141 | 194 |
| 221 | 3300049592 | Ga0501076_0011984 | Ga0501076_0011984_3323_3940 | 194 |
| 222 | 3300049592 | Ga0501076_0320252 | Ga0501076_0320252_144_764 | 194 |
| 223 | 3300049743 | Ga0501081_0011312 | Ga0501081_0011312_1617_2234 | 194 |
| 224 | 3300049822 | Ga0501035_0076895 | Ga0501035_0076895_1313_1930 | 194 |
| 225 | 3300049824 | Ga0501045_0036522 | Ga0501045_0036522_1083_1700 | 194 |
| 226 | 3300054114 | Ga0501084_0012234 | Ga0501084_0012234_4977_5594 | 194 |
| 227 | 3300059421 | Ga0590071_036211 | Ga0590071_036211_220_849 | 194 |
| 228 | 3300059423 | Ga0590074_011756 | Ga0590074_011756_643_1272 | 194 |
| 229 | 3300059426 | Ga0590077_005096 | Ga0590077_005096_1210_1839 | 194 |
| 230 | 3300060353 | Ga0501082_0071094 | Ga0501082_0071094_1512_2129 | 194 |
| 231 | 3300061734 | Ga0530510_0038763 | Ga0530510_0038763_1543_2160 | 194 |
| 232 | 3300005471 | Ga0070698_100460454 | Ga0070698_1004604541 | 195 |
| 233 | 3300006844 | Ga0075428_100281741 | Ga0075428_1002817412 | 195 |
| 234 | 3300009147 | Ga0114129_10026913 | Ga0114129_100269139 | 195 |
| 235 | 3300009176 | Ga0105242_11039328 | Ga0105242_110393282 | 195 |
| 236 | 3300037418 | Ga0395900_0029803 | Ga0395900_0029803_2545_3162 | 195 |
| 237 | 3300037418 | Ga0395900_0118229 | Ga0395900_0118229_1493_2110 | 195 |
| 238 | 3300037418 | Ga0395900_0261714 | Ga0395900_0261714_104_721 | 195 |
| 239 | 3300037418 | Ga0395900_0621409 | Ga0395900_0621409_58_675 | 195 |
| 240 | 3300037466 | Ga0395898_0239854 | Ga0395898_0239854_654_1271 | 195 |
| 241 | 3300038443 | Ga0395901_0061225 | Ga0395901_0061225_2584_3201 | 195 |
| 242 | 3300038443 | Ga0395901_0146620 | Ga0395901_0146620_1796_2413 | 195 |
| 243 | 3300038443 | Ga0395901_1324214 | Ga0395901_1324214_47_664 | 195 |
| 244 | 3300045051 | Ga0451576_0308746 | Ga0451576_0308746_704_1321 | 195 |
| 245 | 3300045976 | Ga0466967_0710183 | Ga0466967_0710183_127_744 | 195 |
| 246 | 3300046454 | Ga0495592_0134647 | Ga0495592_0134647_23_640 | 195 |
| 247 | 3300046794 | Ga0495589_0341096 | Ga0495589_0341096_24_641 | 195 |
| 248 | 3300005439 | Ga0070711_100704877 | Ga0070711_1007048771 | 196 |
| 249 | 3300005458 | Ga0070681_10812478 | Ga0070681_108124781 | 196 |
| 250 | 3300005530 | Ga0070679_100394017 | Ga0070679_1003940172 | 196 |
| 251 | 3300005578 | Ga0068854_100630827 | Ga0068854_1006308272 | 196 |
| 252 | 3300006175 | Ga0070712_100409100 | Ga0070712_1004091001 | 196 |
| 253 | 3300009094 | Ga0111539_10556351 | Ga0111539_105563512 | 196 |
| 254 | 3300009098 | Ga0105245_10093166 | Ga0105245_100931663 | 196 |
| 255 | 3300009147 | Ga0114129_10531756 | Ga0114129_105317562 | 196 |
| 256 | 3300010375 | Ga0105239_10145120 | Ga0105239_101451203 | 196 |
| 257 | 3300013307 | Ga0157372_10030921 | Ga0157372_100309214 | 196 |
| 258 | 3300025933 | Ga0207706_10017688 | Ga0207706_100176882 | 196 |
| 259 | 3300026118 | Ga0207675_100343044 | Ga0207675_1003430442 | 196 |
| 260 | 3300037466 | Ga0395898_0153541 | Ga0395898_0153541_1408_2034 | 196 |
| 261 | 3300038443 | Ga0395901_0162385 | Ga0395901_0162385_838_1464 | 196 |
| 262 | 3300041459 | Ga0451800_1681006 | Ga0451800_1681006_136_771 | 196 |
| 263 | 3300041492 | Ga0451835_0298821 | Ga0451835_0298821_135_770 | 196 |
| 264 | 3300045976 | Ga0466967_0439910 | Ga0466967_0439910_199_822 | 196 |
| 265 | 3300046457 | Ga0495590_0071372 | Ga0495590_0071372_440_1081 | 196 |
| 266 | 3300046477 | Ga0495664_0538116 | Ga0495664_0538116_30_653 | 196 |
| 267 | 3300046491 | Ga0495584_0160527 | Ga0495584_0160527_269_910 | 196 |
| 268 | 3300046500 | Ga0495596_0156531 | Ga0495596_0156531_156_797 | 196 |
| 269 | 3300048903 | Ga0496100_0425477 | Ga0496100_0425477_240_863 | 196 |
| 270 | 3300048912 | Ga0496109_0109156 | Ga0496109_0109156_578_1213 | 196 |
| 271 | 3300048913 | Ga0496110_0202035 | Ga0496110_0202035_135_770 | 196 |
| 272 | 3300048917 | Ga0496114_0164191 | Ga0496114_0164191_342_965 | 196 |
| 273 | 3300053077 | Ga0495601_0226003 | Ga0495601_0226003_518_1141 | 196 |
| 274 | 3300006058 | Ga0075432_10068553 | Ga0075432_100685532 | 197 |
| 275 | 3300006844 | Ga0075428_100583806 | Ga0075428_1005838062 | 197 |
| 276 | 3300009093 | Ga0105240_10437930 | Ga0105240_104379301 | 197 |
| 277 | 3300013105 | Ga0157369_10239499 | Ga0157369_102394992 | 197 |
| 278 | 3300031344 | Ga0265316_10369149 | Ga0265316_103691492 | 197 |
| 279 | 3300042005 | Ga0439448_0045292 | Ga0439448_0045292_456_1079 | 197 |
| 280 | 3300044683 | Ga0466965_0060374 | Ga0466965_0060374_604_1314 | 197 |
| 281 | 3300044684 | Ga0466966_0148093 | Ga0466966_0148093_71_703 | 197 |
| 282 | 3300044694 | Ga0466963_0003436 | Ga0466963_0003436_3050_3760 | 197 |
| 283 | 3300044694 | Ga0466963_0012752 | Ga0466963_0012752_3245_3877 | 197 |
| 284 | 3300044719 | Ga0466971_0006706 | Ga0466971_0006706_744_1376 | 197 |
| 285 | 3300044719 | Ga0466971_0031883 | Ga0466971_0031883_1089_1721 | 197 |
| 286 | 3300044842 | Ga0466957_0006475 | Ga0466957_0006475_2902_3612 | 197 |
| 287 | 3300044842 | Ga0466957_0088618 | Ga0466957_0088618_1125_1757 | 197 |
| 288 | 3300045836 | Ga0466958_0036084 | Ga0466958_0036084_1216_1848 | 197 |
| 289 | 3300045836 | Ga0466958_0042828 | Ga0466958_0042828_759_1391 | 197 |
| 290 | 3300045976 | Ga0466967_0161988 | Ga0466967_0161988_743_1375 | 197 |
| 291 | 3300045976 | Ga0466967_0279461 | Ga0466967_0279461_656_1366 | 197 |
| 292 | 3300048903 | Ga0496100_0878658 | Ga0496100_0878658_51_674 | 197 |
| 293 | 3300048904 | Ga0496101_0473043 | Ga0496101_0473043_107_730 | 197 |
| 294 | 3300049593 | Ga0501077_0208605 | Ga0501077_0208605_294_920 | 197 |
| 295 | 3300049741 | Ga0501079_0480727 | Ga0501079_0480727_228_932 | 197 |
| 296 | 3300049743 | Ga0501081_0298485 | Ga0501081_0298485_359_1063 | 197 |
| 297 | 3300049824 | Ga0501045_0381355 | Ga0501045_0381355_316_1020 | 197 |
| 298 | 3300050507 | nmdc:mga05p37_308934_c1 | nmdc:mga05p37_308934_c1_1170_1808 | 197 |
| 299 | 3300061719 | Ga0466962_0024171 | Ga0466962_0024171_2004_2636 | 197 |
| 300 | 3300005329 | Ga0070683_100026408 | Ga0070683_1000264082 | 198 |
| 301 | 3300005329 | Ga0070683_100073714 | Ga0070683_1000737143 | 198 |
| 302 | 3300005329 | Ga0070683_100087739 | Ga0070683_1000877393 | 198 |
| 303 | 3300005329 | Ga0070683_100198472 | Ga0070683_1001984722 | 198 |
| 304 | 3300005336 | Ga0070680_100005810 | Ga0070680_1000058108 | 198 |
| 305 | 3300005336 | Ga0070680_100056397 | Ga0070680_1000563973 | 198 |
| 306 | 3300005336 | Ga0070680_100057548 | Ga0070680_1000575483 | 198 |
| 307 | 3300005336 | Ga0070680_100085414 | Ga0070680_1000854143 | 198 |
| 308 | 3300005336 | Ga0070680_100248904 | Ga0070680_1002489042 | 198 |
| 309 | 3300005337 | Ga0070682_100076586 | Ga0070682_1000765862 | 198 |
| 310 | 3300005339 | Ga0070660_100012668 | Ga0070660_1000126687 | 198 |
| 311 | 3300005339 | Ga0070660_100128974 | Ga0070660_1001289742 | 198 |
| 312 | 3300005339 | Ga0070660_100144604 | Ga0070660_1001446042 | 198 |
| 313 | 3300005339 | Ga0070660_100425612 | Ga0070660_1004256121 | 198 |
| 314 | 3300005339 | Ga0070660_100446182 | Ga0070660_1004461822 | 198 |
| 315 | 3300005344 | Ga0070661_100061509 | Ga0070661_1000615092 | 198 |
| 316 | 3300005344 | Ga0070661_100086063 | Ga0070661_1000860633 | 198 |
| 317 | 3300005344 | Ga0070661_100668741 | Ga0070661_1006687411 | 198 |
| 318 | 3300005355 | Ga0070671_100069910 | Ga0070671_1000699103 | 198 |
| 319 | 3300005366 | Ga0070659_100153962 | Ga0070659_1001539623 | 198 |
| 320 | 3300005366 | Ga0070659_100221410 | Ga0070659_1002214102 | 198 |
| 321 | 3300005435 | Ga0070714_100112927 | Ga0070714_1001129272 | 198 |
| 322 | 3300005435 | Ga0070714_100546332 | Ga0070714_1005463322 | 198 |
| 323 | 3300005436 | Ga0070713_100043623 | Ga0070713_1000436233 | 198 |
| 324 | 3300005436 | Ga0070713_100269516 | Ga0070713_1002695162 | 198 |
| 325 | 3300005437 | Ga0070710_10390822 | Ga0070710_103908222 | 198 |
| 326 | 3300005439 | Ga0070711_100790723 | Ga0070711_1007907231 | 198 |
| 327 | 3300005445 | Ga0070708_100008860 | Ga0070708_1000088604 | 198 |
| 328 | 3300005455 | Ga0070663_100607076 | Ga0070663_1006070762 | 198 |
| 329 | 3300005456 | Ga0070678_100045725 | Ga0070678_1000457253 | 198 |
| 330 | 3300005458 | Ga0070681_10008727 | Ga0070681_100087274 | 198 |
| 331 | 3300005458 | Ga0070681_10019935 | Ga0070681_100199352 | 198 |
| 332 | 3300005458 | Ga0070681_10020145 | Ga0070681_100201452 | 198 |
| 333 | 3300005458 | Ga0070681_10031845 | Ga0070681_100318452 | 198 |
| 334 | 3300005458 | Ga0070681_10046119 | Ga0070681_100461195 | 198 |
| 335 | 3300005458 | Ga0070681_10052560 | Ga0070681_100525607 | 198 |
| 336 | 3300005458 | Ga0070681_10078196 | Ga0070681_100781962 | 198 |
| 337 | 3300005458 | Ga0070681_10147028 | Ga0070681_101470282 | 198 |
| 338 | 3300005458 | Ga0070681_10221168 | Ga0070681_102211682 | 198 |
| 339 | 3300005468 | Ga0070707_100349120 | Ga0070707_1003491202 | 198 |
| 340 | 3300005530 | Ga0070679_100017413 | Ga0070679_1000174133 | 198 |
| 341 | 3300005530 | Ga0070679_100030040 | Ga0070679_1000300402 | 198 |
| 342 | 3300005530 | Ga0070679_100035170 | Ga0070679_1000351704 | 198 |
| 343 | 3300005530 | Ga0070679_100106662 | Ga0070679_1001066623 | 198 |
| 344 | 3300005535 | Ga0070684_100017725 | Ga0070684_1000177252 | 198 |
| 345 | 3300005535 | Ga0070684_100208601 | Ga0070684_1002086012 | 198 |
| 346 | 3300005535 | Ga0070684_100214626 | Ga0070684_1002146262 | 198 |
| 347 | 3300005535 | Ga0070684_100235223 | Ga0070684_1002352232 | 198 |
| 348 | 3300005535 | Ga0070684_100330614 | Ga0070684_1003306142 | 198 |
| 349 | 3300005539 | Ga0068853_100229361 | Ga0068853_1002293612 | 198 |
| 350 | 3300005539 | Ga0068853_100489117 | Ga0068853_1004891171 | 198 |
| 351 | 3300005548 | Ga0070665_100106594 | Ga0070665_1001065942 | 198 |
| 352 | 3300005563 | Ga0068855_100003593 | Ga0068855_1000035933 | 198 |
| 353 | 3300005563 | Ga0068855_100011169 | Ga0068855_1000111692 | 198 |
| 354 | 3300005563 | Ga0068855_100024835 | Ga0068855_1000248355 | 198 |
| 355 | 3300005563 | Ga0068855_100042632 | Ga0068855_1000426323 | 198 |
| 356 | 3300005563 | Ga0068855_100049137 | Ga0068855_1000491372 | 198 |
| 357 | 3300005563 | Ga0068855_100196517 | Ga0068855_1001965172 | 198 |
| 358 | 3300005563 | Ga0068855_100284095 | Ga0068855_1002840952 | 198 |
| 359 | 3300005563 | Ga0068855_100371293 | Ga0068855_1003712932 | 198 |
| 360 | 3300005577 | Ga0068857_100087436 | Ga0068857_1000874363 | 198 |
| 361 | 3300005578 | Ga0068854_100127321 | Ga0068854_1001273212 | 198 |
| 362 | 3300005578 | Ga0068854_100357746 | Ga0068854_1003577462 | 198 |
| 363 | 3300005614 | Ga0068856_100120281 | Ga0068856_1001202813 | 198 |
| 364 | 3300005614 | Ga0068856_100195492 | Ga0068856_1001954922 | 198 |
| 365 | 3300005614 | Ga0068856_100967463 | Ga0068856_1009674632 | 198 |
| 366 | 3300005616 | Ga0068852_100072114 | Ga0068852_1000721142 | 198 |
| 367 | 3300005616 | Ga0068852_100481222 | Ga0068852_1004812222 | 198 |
| 368 | 3300005985 | Ga0081539_10001192 | Ga0081539_100011924 | 198 |
| 369 | 3300006028 | Ga0070717_10050873 | Ga0070717_100508735 | 198 |
| 370 | 3300006028 | Ga0070717_10333750 | Ga0070717_103337502 | 198 |
| 371 | 3300006038 | Ga0075365_10021647 | Ga0075365_100216473 | 198 |
| 372 | 3300006175 | Ga0070712_100197026 | Ga0070712_1001970262 | 198 |
| 373 | 3300006175 | Ga0070712_100629141 | Ga0070712_1006291411 | 198 |
| 374 | 3300006237 | Ga0097621_100180783 | Ga0097621_1001807832 | 198 |
| 375 | 3300006844 | Ga0075428_100942740 | Ga0075428_1009427402 | 198 |
| 376 | 3300006847 | Ga0075431_100353481 | Ga0075431_1003534812 | 198 |
| 377 | 3300006852 | Ga0075433_10008761 | Ga0075433_100087615 | 198 |
| 378 | 3300006852 | Ga0075433_10864939 | Ga0075433_108649392 | 198 |
| 379 | 3300006871 | Ga0075434_100126426 | Ga0075434_1001264262 | 198 |
| 380 | 3300006871 | Ga0075434_100968584 | Ga0075434_1009685842 | 198 |
| 381 | 3300006914 | Ga0075436_100013785 | Ga0075436_1000137856 | 198 |
| 382 | 3300007076 | Ga0075435_100002153 | Ga0075435_1000021536 | 198 |
| 383 | 3300007076 | Ga0075435_100005538 | Ga0075435_10000553811 | 198 |
| 384 | 3300009093 | Ga0105240_10045516 | Ga0105240_100455166 | 198 |
| 385 | 3300009147 | Ga0114129_10010920 | Ga0114129_100109206 | 198 |
| 386 | 3300009147 | Ga0114129_10084015 | Ga0114129_100840155 | 198 |
| 387 | 3300009147 | Ga0114129_10102347 | Ga0114129_101023472 | 198 |
| 388 | 3300009147 | Ga0114129_11043703 | Ga0114129_110437032 | 198 |
| 389 | 3300009176 | Ga0105242_10062210 | Ga0105242_100622103 | 198 |
| 390 | 3300009176 | Ga0105242_10107249 | Ga0105242_101072492 | 198 |
| 391 | 3300009177 | Ga0105248_11753928 | Ga0105248_117539281 | 198 |
| 392 | 3300009545 | Ga0105237_10115359 | Ga0105237_101153593 | 198 |
| 393 | 3300009545 | Ga0105237_10508886 | Ga0105237_105088862 | 198 |
| 394 | 3300009551 | Ga0105238_10026868 | Ga0105238_100268682 | 198 |
| 395 | 3300010375 | Ga0105239_10667147 | Ga0105239_106671472 | 198 |
| 396 | 3300010375 | Ga0105239_10678821 | Ga0105239_106788212 | 198 |
| 397 | 3300013100 | Ga0157373_10064041 | Ga0157373_100640412 | 198 |
| 398 | 3300013102 | Ga0157371_10338406 | Ga0157371_103384062 | 198 |
| 399 | 3300013104 | Ga0157370_10003010 | Ga0157370_100030102 | 198 |
| 400 | 3300013104 | Ga0157370_10093384 | Ga0157370_100933842 | 198 |
| 401 | 3300013104 | Ga0157370_10109886 | Ga0157370_101098862 | 198 |
| 402 | 3300013104 | Ga0157370_10743713 | Ga0157370_107437132 | 198 |
| 403 | 3300013105 | Ga0157369_10028618 | Ga0157369_100286187 | 198 |
| 404 | 3300013105 | Ga0157369_10071297 | Ga0157369_100712972 | 198 |
| 405 | 3300013105 | Ga0157369_10321824 | Ga0157369_103218242 | 198 |
| 406 | 3300013296 | Ga0157374_10242616 | Ga0157374_102426163 | 198 |
| 407 | 3300013296 | Ga0157374_10581480 | Ga0157374_105814802 | 198 |
| 408 | 3300013296 | Ga0157374_11012556 | Ga0157374_110125561 | 198 |
| 409 | 3300013307 | Ga0157372_10029509 | Ga0157372_100295097 | 198 |
| 410 | 3300013307 | Ga0157372_10047864 | Ga0157372_100478645 | 198 |
| 411 | 3300013307 | Ga0157372_10168880 | Ga0157372_101688803 | 198 |
| 412 | 3300013307 | Ga0157372_10459071 | Ga0157372_104590712 | 198 |
| 413 | 3300013308 | Ga0157375_11128391 | Ga0157375_111283912 | 198 |
| 414 | 3300014325 | Ga0163163_10318191 | Ga0163163_103181912 | 198 |
| 415 | 3300014325 | Ga0163163_10810045 | Ga0163163_108100452 | 198 |
| 416 | 3300014326 | Ga0157380_11302672 | Ga0157380_113026722 | 198 |
| 417 | 3300014497 | Ga0182008_10024958 | Ga0182008_100249582 | 198 |
| 418 | 3300014969 | Ga0157376_10240750 | Ga0157376_102407502 | 198 |
| 419 | 3300014969 | Ga0157376_10267528 | Ga0157376_102675282 | 198 |
| 420 | 3300020069 | Ga0197907_10620317 | Ga0197907_106203174 | 198 |
| 421 | 3300020069 | Ga0197907_11022464 | Ga0197907_110224642 | 198 |
| 422 | 3300020070 | Ga0206356_10298171 | Ga0206356_102981713 | 198 |
| 423 | 3300020070 | Ga0206356_10607613 | Ga0206356_106076132 | 198 |
| 424 | 3300020070 | Ga0206356_11237666 | Ga0206356_112376662 | 198 |
| 425 | 3300020080 | Ga0206350_10077237 | Ga0206350_100772372 | 198 |
| 426 | 3300020081 | Ga0206354_10340070 | Ga0206354_103400702 | 198 |
| 427 | 3300020081 | Ga0206354_11223639 | Ga0206354_112236392 | 198 |
| 428 | 3300020081 | Ga0206354_11537358 | Ga0206354_115373582 | 198 |
| 429 | 3300020082 | Ga0206353_10480853 | Ga0206353_104808533 | 198 |
| 430 | 3300020082 | Ga0206353_10846342 | Ga0206353_108463422 | 198 |
| 431 | 3300020082 | Ga0206353_11108111 | Ga0206353_111081112 | 198 |
| 432 | 3300021384 | Ga0213876_10039968 | Ga0213876_100399683 | 198 |
| 433 | 3300022467 | Ga0224712_10111683 | Ga0224712_101116832 | 198 |
| 434 | 3300022467 | Ga0224712_10233350 | Ga0224712_102333501 | 198 |
| 435 | 3300025909 | Ga0207705_10006569 | Ga0207705_100065698 | 198 |
| 436 | 3300025909 | Ga0207705_10054207 | Ga0207705_100542073 | 198 |
| 437 | 3300025909 | Ga0207705_10215198 | Ga0207705_102151982 | 198 |
| 438 | 3300025912 | Ga0207707_10008378 | Ga0207707_100083787 | 198 |
| 439 | 3300025912 | Ga0207707_10013655 | Ga0207707_100136552 | 198 |
| 440 | 3300025912 | Ga0207707_10033202 | Ga0207707_100332024 | 198 |
| 441 | 3300025912 | Ga0207707_10081382 | Ga0207707_100813822 | 198 |
| 442 | 3300025912 | Ga0207707_10166069 | Ga0207707_101660692 | 198 |
| 443 | 3300025912 | Ga0207707_10239464 | Ga0207707_102394642 | 198 |
| 444 | 3300025912 | Ga0207707_10384948 | Ga0207707_103849482 | 198 |
| 445 | 3300025913 | Ga0207695_10153461 | Ga0207695_101534612 | 198 |
| 446 | 3300025913 | Ga0207695_10376768 | Ga0207695_103767682 | 198 |
| 447 | 3300025914 | Ga0207671_10263148 | Ga0207671_102631482 | 198 |
| 448 | 3300025915 | Ga0207693_10069728 | Ga0207693_100697282 | 198 |
| 449 | 3300025915 | Ga0207693_10146534 | Ga0207693_101465342 | 198 |
| 450 | 3300025915 | Ga0207693_10154209 | Ga0207693_101542092 | 198 |
| 451 | 3300025915 | Ga0207693_10468136 | Ga0207693_104681362 | 198 |
| 452 | 3300025916 | Ga0207663_10041896 | Ga0207663_100418962 | 198 |
| 453 | 3300025916 | Ga0207663_10197041 | Ga0207663_101970412 | 198 |
| 454 | 3300025916 | Ga0207663_10555568 | Ga0207663_105555682 | 198 |
| 455 | 3300025917 | Ga0207660_10007020 | Ga0207660_100070203 | 198 |
| 456 | 3300025917 | Ga0207660_10068408 | Ga0207660_100684083 | 198 |
| 457 | 3300025917 | Ga0207660_10098706 | Ga0207660_100987062 | 198 |
| 458 | 3300025917 | Ga0207660_10211296 | Ga0207660_102112962 | 198 |
| 459 | 3300025917 | Ga0207660_10346436 | Ga0207660_103464362 | 198 |
| 460 | 3300025917 | Ga0207660_10614308 | Ga0207660_106143082 | 198 |
| 461 | 3300025919 | Ga0207657_10020746 | Ga0207657_100207464 | 198 |
| 462 | 3300025919 | Ga0207657_10025885 | Ga0207657_100258857 | 198 |
| 463 | 3300025919 | Ga0207657_10026725 | Ga0207657_100267252 | 198 |
| 464 | 3300025919 | Ga0207657_10240112 | Ga0207657_102401122 | 198 |
| 465 | 3300025920 | Ga0207649_10042138 | Ga0207649_100421382 | 198 |
| 466 | 3300025921 | Ga0207652_10021758 | Ga0207652_100217586 | 198 |
| 467 | 3300025921 | Ga0207652_10043128 | Ga0207652_100431283 | 198 |
| 468 | 3300025921 | Ga0207652_10190191 | Ga0207652_101901912 | 198 |
| 469 | 3300025921 | Ga0207652_10236055 | Ga0207652_102360552 | 198 |
| 470 | 3300025921 | Ga0207652_10240478 | Ga0207652_102404782 | 198 |
| 471 | 3300025922 | Ga0207646_10286850 | Ga0207646_102868502 | 198 |
| 472 | 3300025924 | Ga0207694_10029487 | Ga0207694_100294875 | 198 |
| 473 | 3300025924 | Ga0207694_10102747 | Ga0207694_101027473 | 198 |
| 474 | 3300025927 | Ga0207687_10070262 | Ga0207687_100702622 | 198 |
| 475 | 3300025928 | Ga0207700_10000002 | Ga0207700_10000002664 | 198 |
| 476 | 3300025928 | Ga0207700_10255815 | Ga0207700_102558152 | 198 |
| 477 | 3300025928 | Ga0207700_10485828 | Ga0207700_104858282 | 198 |
| 478 | 3300025929 | Ga0207664_10112348 | Ga0207664_101123482 | 198 |
| 479 | 3300025929 | Ga0207664_10783000 | Ga0207664_107830001 | 198 |
| 480 | 3300025929 | Ga0207664_10843804 | Ga0207664_108438041 | 198 |
| 481 | 3300025931 | Ga0207644_10067873 | Ga0207644_100678732 | 198 |
| 482 | 3300025932 | Ga0207690_10067212 | Ga0207690_100672123 | 198 |
| 483 | 3300025934 | Ga0207686_10098921 | Ga0207686_100989212 | 198 |
| 484 | 3300025934 | Ga0207686_10172516 | Ga0207686_101725162 | 198 |
| 485 | 3300025939 | Ga0207665_10023137 | Ga0207665_100231373 | 198 |
| 486 | 3300025944 | Ga0207661_10052247 | Ga0207661_100522475 | 198 |
| 487 | 3300025944 | Ga0207661_10103205 | Ga0207661_101032052 | 198 |
| 488 | 3300025944 | Ga0207661_10237120 | Ga0207661_102371202 | 198 |
| 489 | 3300025949 | Ga0207667_10073330 | Ga0207667_100733302 | 198 |
| 490 | 3300025949 | Ga0207667_10247646 | Ga0207667_102476463 | 198 |
| 491 | 3300025972 | Ga0207668_10130431 | Ga0207668_101304313 | 198 |
| 492 | 3300026041 | Ga0207639_10632854 | Ga0207639_106328542 | 198 |
| 493 | 3300026067 | Ga0207678_10443769 | Ga0207678_104437692 | 198 |
| 494 | 3300026116 | Ga0207674_10091516 | Ga0207674_100915162 | 198 |
| 495 | 3300026118 | Ga0207675_100355780 | Ga0207675_1003557801 | 198 |
| 496 | 3300026142 | Ga0207698_10079897 | Ga0207698_100798973 | 198 |
| 497 | 3300026142 | Ga0207698_10450766 | Ga0207698_104507662 | 198 |
| 498 | 3300026142 | Ga0207698_10494885 | Ga0207698_104948851 | 198 |
| 499 | 3300027907 | Ga0207428_10079558 | Ga0207428_100795583 | 198 |
| 500 | 3300028379 | Ga0268266_10158191 | Ga0268266_101581912 | 198 |
| 501 | 3300028577 | Ga0265318_10006205 | Ga0265318_100062052 | 198 |
| 502 | 3300028577 | Ga0265318_10084732 | Ga0265318_100847322 | 198 |
| 503 | 3300028654 | Ga0265322_10007859 | Ga0265322_100078594 | 198 |
| 504 | 3300028800 | Ga0265338_10016568 | Ga0265338_100165683 | 198 |
| 505 | 3300028800 | Ga0265338_10068850 | Ga0265338_100688502 | 198 |
| 506 | 3300028800 | Ga0265338_10071361 | Ga0265338_100713611 | 198 |
| 507 | 3300028800 | Ga0265338_10321404 | Ga0265338_103214042 | 198 |
| 508 | 3300031240 | Ga0265320_10186717 | Ga0265320_101867172 | 198 |
| 509 | 3300031240 | Ga0265320_10277778 | Ga0265320_102777781 | 198 |
| 510 | 3300031241 | Ga0265325_10005024 | Ga0265325_100050243 | 198 |
| 511 | 3300031250 | Ga0265331_10027432 | Ga0265331_100274322 | 198 |
| 512 | 3300031251 | Ga0265327_10063716 | Ga0265327_100637162 | 198 |
| 513 | 3300031344 | Ga0265316_10010014 | Ga0265316_100100147 | 198 |
| 514 | 3300031595 | Ga0265313_10020901 | Ga0265313_100209013 | 198 |
| 515 | 3300031595 | Ga0265313_10121658 | Ga0265313_101216581 | 198 |
| 516 | 3300031711 | Ga0265314_10004407 | Ga0265314_100044073 | 198 |
| 517 | 3300031712 | Ga0265342_10097441 | Ga0265342_100974412 | 198 |
| 518 | 3300032002 | Ga0307416_100140355 | Ga0307416_1001403552 | 198 |
| 519 | 3300032126 | Ga0307415_100146507 | Ga0307415_1001465072 | 198 |
| 520 | 3300035083 | Ga0373926_0014627 | Ga0373926_0014627_222_857 | 198 |
| 521 | 3300035089 | Ga0373944_0060343 | Ga0373944_0060343_158_793 | 198 |
| 522 | 3300035089 | Ga0373944_0079798 | Ga0373944_0079798_109_741 | 198 |
| 523 | 3300035113 | Ga0373936_0009587 | Ga0373936_0009587_2726_3358 | 198 |
| 524 | 3300035113 | Ga0373936_0016204 | Ga0373936_0016204_157_792 | 198 |
| 525 | 3300035116 | Ga0373945_0005969 | Ga0373945_0005969_2810_3442 | 198 |
| 526 | 3300035116 | Ga0373945_0110664 | Ga0373945_0110664_177_812 | 198 |
| 527 | 3300035117 | Ga0373953_0121954 | Ga0373953_0121954_268_978 | 198 |
| 528 | 3300035118 | Ga0373954_0029594 | Ga0373954_0029594_10_642 | 198 |
| 529 | 3300035120 | Ga0373957_0069477 | Ga0373957_0069477_575_1285 | 198 |
| 530 | 3300035170 | Ga0373943_0000357 | Ga0373943_0000357_3369_4004 | 198 |
| 531 | 3300035170 | Ga0373943_0005270 | Ga0373943_0005270_4644_5276 | 198 |
| 532 | 3300035170 | Ga0373943_0163452 | Ga0373943_0163452_239_868 | 198 |
| 533 | 3300035171 | Ga0373946_0024116 | Ga0373946_0024116_1610_2242 | 198 |
| 534 | 3300035172 | Ga0373955_0087890 | Ga0373955_0087890_578_1288 | 198 |
| 535 | 3300035692 | Ga0373935_0081654 | Ga0373935_0081654_1362_1994 | 198 |
| 536 | 3300035695 | Ga0373927_0101418 | Ga0373927_0101418_943_1575 | 198 |
| 537 | 3300035724 | Ga0373933_0012801 | Ga0373933_0012801_3637_4347 | 198 |
| 538 | 3300035725 | Ga0373947_0000467 | Ga0373947_0000467_5467_6102 | 198 |
| 539 | 3300035725 | Ga0373947_0006736 | Ga0373947_0006736_2667_3299 | 198 |
| 540 | 3300036401 | Ga0373937_0031471 | Ga0373937_0031471_3755_4465 | 198 |
| 541 | 3300037068 | Ga0373925_0011045 | Ga0373925_0011045_5667_6299 | 198 |
| 542 | 3300037068 | Ga0373925_0015591 | Ga0373925_0015591_1821_2456 | 198 |
| 543 | 3300037312 | Ga0395899_0056755 | Ga0395899_0056755_702_1334 | 198 |
| 544 | 3300037312 | Ga0395899_0154798 | Ga0395899_0154798_191_826 | 198 |
| 545 | 3300037312 | Ga0395899_0160309 | Ga0395899_0160309_645_1274 | 198 |
| 546 | 3300037418 | Ga0395900_0008280 | Ga0395900_0008280_784_1419 | 198 |
| 547 | 3300037418 | Ga0395900_0025335 | Ga0395900_0025335_1816_2448 | 198 |
| 548 | 3300037418 | Ga0395900_0026751 | Ga0395900_0026751_3520_4149 | 198 |
| 549 | 3300037418 | Ga0395900_0191056 | Ga0395900_0191056_525_1154 | 198 |
| 550 | 3300037418 | Ga0395900_0204366 | Ga0395900_0204366_274_978 | 198 |
| 551 | 3300037418 | Ga0395900_0210549 | Ga0395900_0210549_349_1065 | 198 |
| 552 | 3300037418 | Ga0395900_0225740 | Ga0395900_0225740_739_1371 | 198 |
| 553 | 3300037418 | Ga0395900_0260579 | Ga0395900_0260579_1045_1683 | 198 |
| 554 | 3300037418 | Ga0395900_0300023 | Ga0395900_0300023_63_698 | 198 |
| 555 | 3300037418 | Ga0395900_0318074 | Ga0395900_0318074_26_658 | 198 |
| 556 | 3300037418 | Ga0395900_0405916 | Ga0395900_0405916_190_816 | 198 |
| 557 | 3300037418 | Ga0395900_0525138 | Ga0395900_0525138_383_1090 | 198 |
| 558 | 3300037418 | Ga0395900_0898157 | Ga0395900_0898157_161_796 | 198 |
| 559 | 3300037466 | Ga0395898_0006898 | Ga0395898_0006898_8330_8965 | 198 |
| 560 | 3300037466 | Ga0395898_0030395 | Ga0395898_0030395_666_1301 | 198 |
| 561 | 3300037466 | Ga0395898_0050632 | Ga0395898_0050632_849_1481 | 198 |
| 562 | 3300037466 | Ga0395898_0081996 | Ga0395898_0081996_1558_2184 | 198 |
| 563 | 3300037466 | Ga0395898_0091570 | Ga0395898_0091570_2106_2735 | 198 |
| 564 | 3300037466 | Ga0395898_0147719 | Ga0395898_0147719_1005_1721 | 198 |
| 565 | 3300037466 | Ga0395898_0148534 | Ga0395898_0148534_1478_2107 | 198 |
| 566 | 3300037466 | Ga0395898_0197340 | Ga0395898_0197340_465_1172 | 198 |
| 567 | 3300037466 | Ga0395898_0197360 | Ga0395898_0197360_533_1165 | 198 |
| 568 | 3300037466 | Ga0395898_0272320 | Ga0395898_0272320_270_911 | 198 |
| 569 | 3300037466 | Ga0395898_0352011 | Ga0395898_0352011_649_1362 | 198 |
| 570 | 3300037471 | Ga0395905_0019582 | Ga0395905_0019582_3210_3839 | 198 |
| 571 | 3300037471 | Ga0395905_0060724 | Ga0395905_0060724_1356_1982 | 198 |
| 572 | 3300037471 | Ga0395905_0077445 | Ga0395905_0077445_1875_2510 | 198 |
| 573 | 3300037471 | Ga0395905_0081765 | Ga0395905_0081765_2076_2711 | 198 |
| 574 | 3300037471 | Ga0395905_0523005 | Ga0395905_0523005_345_1049 | 198 |
| 575 | 3300038443 | Ga0395901_0009262 | Ga0395901_0009262_5533_6162 | 198 |
| 576 | 3300038443 | Ga0395901_0009857 | Ga0395901_0009857_820_1455 | 198 |
| 577 | 3300038443 | Ga0395901_0013991 | Ga0395901_0013991_4377_5009 | 198 |
| 578 | 3300038443 | Ga0395901_0016094 | Ga0395901_0016094_4192_4818 | 198 |
| 579 | 3300038443 | Ga0395901_0061405 | Ga0395901_0061405_336_1049 | 198 |
| 580 | 3300038443 | Ga0395901_0070139 | Ga0395901_0070139_2372_3004 | 198 |
| 581 | 3300038443 | Ga0395901_0070469 | Ga0395901_0070469_2559_3194 | 198 |
| 582 | 3300038443 | Ga0395901_0136266 | Ga0395901_0136266_1136_1852 | 198 |
| 583 | 3300038443 | Ga0395901_0286495 | Ga0395901_0286495_140_772 | 198 |
| 584 | 3300038443 | Ga0395901_0454189 | Ga0395901_0454189_656_1294 | 198 |
| 585 | 3300039437 | Ga0436365_1605333 | Ga0436365_1605333_3463_4095 | 198 |
| 586 | 3300039438 | Ga0436360_1350995 | Ga0436360_1350995_693_1328 | 198 |
| 587 | 3300039450 | Ga0436363_0030512 | Ga0436363_0030512_488_1120 | 198 |
| 588 | 3300039450 | Ga0436363_0225970 | Ga0436363_0225970_452_1084 | 198 |
| 589 | 3300039453 | Ga0436362_1150903 | Ga0436362_1150903_184_819 | 198 |
| 590 | 3300044656 | Ga0466969_0124210 | Ga0466969_0124210_243_869 | 198 |
| 591 | 3300044684 | Ga0466966_0200675 | Ga0466966_0200675_390_1016 | 198 |
| 592 | 3300044693 | Ga0466961_0079786 | Ga0466961_0079786_846_1472 | 198 |
| 593 | 3300044693 | Ga0466961_0177642 | Ga0466961_0177642_154_828 | 198 |
| 594 | 3300044693 | Ga0466961_0307979 | Ga0466961_0307979_59_691 | 198 |
| 595 | 3300044694 | Ga0466963_0039511 | Ga0466963_0039511_2077_2787 | 198 |
| 596 | 3300044694 | Ga0466963_0092161 | Ga0466963_0092161_804_1439 | 198 |
| 597 | 3300044694 | Ga0466963_0147283 | Ga0466963_0147283_346_972 | 198 |
| 598 | 3300044694 | Ga0466963_0164462 | Ga0466963_0164462_549_1265 | 198 |
| 599 | 3300044706 | Ga0466964_0001492 | Ga0466964_0001492_2405_3046 | 198 |
| 600 | 3300044706 | Ga0466964_0012301 | Ga0466964_0012301_1078_1710 | 198 |
| 601 | 3300044735 | Ga0466968_0022352 | Ga0466968_0022352_1215_1880 | 198 |
| 602 | 3300044735 | Ga0466968_0032792 | Ga0466968_0032792_1131_1766 | 198 |
| 603 | 3300044735 | Ga0466968_0051476 | Ga0466968_0051476_14_652 | 198 |
| 604 | 3300044842 | Ga0466957_0041861 | Ga0466957_0041861_1610_2284 | 198 |
| 605 | 3300044842 | Ga0466957_0046503 | Ga0466957_0046503_903_1529 | 198 |
| 606 | 3300044901 | Ga0466960_0414368 | Ga0466960_0414368_129_767 | 198 |
| 607 | 3300045049 | Ga0466959_0030513 | Ga0466959_0030513_2157_2831 | 198 |
| 608 | 3300045049 | Ga0466959_0032895 | Ga0466959_0032895_1442_2080 | 198 |
| 609 | 3300045049 | Ga0466959_0048335 | Ga0466959_0048335_1349_2014 | 198 |
| 610 | 3300045049 | Ga0466959_0099750 | Ga0466959_0099750_828_1466 | 198 |
| 611 | 3300045049 | Ga0466959_0246075 | Ga0466959_0246075_54_680 | 198 |
| 612 | 3300045836 | Ga0466958_0019417 | Ga0466958_0019417_1952_2626 | 198 |
| 613 | 3300045836 | Ga0466958_0023936 | Ga0466958_0023936_1591_2229 | 198 |
| 614 | 3300045836 | Ga0466958_0203357 | Ga0466958_0203357_536_1246 | 198 |
| 615 | 3300045836 | Ga0466958_0230678 | Ga0466958_0230678_193_819 | 198 |
| 616 | 3300045976 | Ga0466967_0016056 | Ga0466967_0016056_1979_2617 | 198 |
| 617 | 3300045976 | Ga0466967_0024467 | Ga0466967_0024467_1066_1782 | 198 |
| 618 | 3300045976 | Ga0466967_0046297 | Ga0466967_0046297_1721_2431 | 198 |
| 619 | 3300045976 | Ga0466967_0048580 | Ga0466967_0048580_2960_3592 | 198 |
| 620 | 3300045976 | Ga0466967_0106537 | Ga0466967_0106537_574_1209 | 198 |
| 621 | 3300045976 | Ga0466967_0117652 | Ga0466967_0117652_366_1001 | 198 |
| 622 | 3300045976 | Ga0466967_0141382 | Ga0466967_0141382_117_830 | 198 |
| 623 | 3300045976 | Ga0466967_0149982 | Ga0466967_0149982_820_1461 | 198 |
| 624 | 3300045976 | Ga0466967_0401381 | Ga0466967_0401381_522_1160 | 198 |
| 625 | 3300045976 | Ga0466967_0559536 | Ga0466967_0559536_272_901 | 198 |
| 626 | 3300045976 | Ga0466967_0775280 | Ga0466967_0775280_78_713 | 198 |
| 627 | 3300045976 | Ga0466967_0844112 | Ga0466967_0844112_19_651 | 198 |
| 628 | 3300046454 | Ga0495592_0041408 | Ga0495592_0041408_2315_3025 | 198 |
| 629 | 3300046454 | Ga0495592_0140018 | Ga0495592_0140018_187_822 | 198 |
| 630 | 3300046454 | Ga0495592_0181259 | Ga0495592_0181259_426_1055 | 198 |
| 631 | 3300046455 | Ga0495603_0115231 | Ga0495603_0115231_170_850 | 198 |
| 632 | 3300046455 | Ga0495603_0303431 | Ga0495603_0303431_155_784 | 198 |
| 633 | 3300046459 | Ga0495629_0003480 | Ga0495629_0003480_4801_5436 | 198 |
| 634 | 3300046461 | Ga0495641_0001617 | Ga0495641_0001617_15681_16316 | 198 |
| 635 | 3300046461 | Ga0495641_0027802 | Ga0495641_0027802_1396_2025 | 198 |
| 636 | 3300046461 | Ga0495641_0178407 | Ga0495641_0178407_221_931 | 198 |
| 637 | 3300046462 | Ga0495651_0003896 | Ga0495651_0003896_6715_7425 | 198 |
| 638 | 3300046462 | Ga0495651_0016883 | Ga0495651_0016883_2431_3066 | 198 |
| 639 | 3300046463 | Ga0495653_0024022 | Ga0495653_0024022_1518_2228 | 198 |
| 640 | 3300046463 | Ga0495653_0027602 | Ga0495653_0027602_310_939 | 198 |
| 641 | 3300046463 | Ga0495653_0081821 | Ga0495653_0081821_1049_1684 | 198 |
| 642 | 3300046463 | Ga0495653_0210213 | Ga0495653_0210213_606_1241 | 198 |
| 643 | 3300046473 | Ga0495582_0000682 | Ga0495582_0000682_2352_2987 | 198 |
| 644 | 3300046473 | Ga0495582_0052285 | Ga0495582_0052285_95_724 | 198 |
| 645 | 3300046473 | Ga0495582_0118536 | Ga0495582_0118536_71_706 | 198 |
| 646 | 3300046474 | Ga0495605_0114575 | Ga0495605_0114575_345_977 | 198 |
| 647 | 3300046475 | Ga0495639_0002305 | Ga0495639_0002305_1346_1981 | 198 |
| 648 | 3300046475 | Ga0495639_0039970 | Ga0495639_0039970_1130_1759 | 198 |
| 649 | 3300046476 | Ga0495662_0005055 | Ga0495662_0005055_3490_4125 | 198 |
| 650 | 3300046476 | Ga0495662_0252168 | Ga0495662_0252168_205_834 | 198 |
| 651 | 3300046477 | Ga0495664_0082522 | Ga0495664_0082522_1040_1675 | 198 |
| 652 | 3300046499 | Ga0495594_0105508 | Ga0495594_0105508_274_909 | 198 |
| 653 | 3300046511 | Ga0495608_0003436 | Ga0495608_0003436_1999_2709 | 198 |
| 654 | 3300046511 | Ga0495608_0016422 | Ga0495608_0016422_3072_3707 | 198 |
| 655 | 3300046511 | Ga0495608_0088444 | Ga0495608_0088444_945_1577 | 198 |
| 656 | 3300046511 | Ga0495608_0113615 | Ga0495608_0113615_140_769 | 198 |
| 657 | 3300046511 | Ga0495608_0136865 | Ga0495608_0136865_662_1297 | 198 |
| 658 | 3300046514 | Ga0495618_0037859 | Ga0495618_0037859_518_1147 | 198 |
| 659 | 3300046516 | Ga0495628_0008643 | Ga0495628_0008643_6415_7044 | 198 |
| 660 | 3300046516 | Ga0495628_0487527 | Ga0495628_0487527_108_818 | 198 |
| 661 | 3300046517 | Ga0495630_0005888 | Ga0495630_0005888_1009_1644 | 198 |
| 662 | 3300046517 | Ga0495630_0006300 | Ga0495630_0006300_5911_6540 | 198 |
| 663 | 3300046517 | Ga0495630_0131912 | Ga0495630_0131912_317_1027 | 198 |
| 664 | 3300046517 | Ga0495630_0541823 | Ga0495630_0541823_19_654 | 198 |
| 665 | 3300046526 | Ga0495666_0110241 | Ga0495666_0110241_132_761 | 198 |
| 666 | 3300046528 | Ga0495642_0019012 | Ga0495642_0019012_1433_2068 | 198 |
| 667 | 3300046529 | Ga0495652_0060983 | Ga0495652_0060983_2293_2928 | 198 |
| 668 | 3300046529 | Ga0495652_0081588 | Ga0495652_0081588_1315_1947 | 198 |
| 669 | 3300046529 | Ga0495652_0083524 | Ga0495652_0083524_1112_1822 | 198 |
| 670 | 3300046529 | Ga0495652_0160406 | Ga0495652_0160406_679_1326 | 198 |
| 671 | 3300046529 | Ga0495652_0183662 | Ga0495652_0183662_153_782 | 198 |
| 672 | 3300046529 | Ga0495652_0240175 | Ga0495652_0240175_298_933 | 198 |
| 673 | 3300046531 | Ga0495665_0000111 | Ga0495665_0000111_4786_5421 | 198 |
| 674 | 3300046533 | Ga0495640_0029153 | Ga0495640_0029153_781_1410 | 198 |
| 675 | 3300046533 | Ga0495640_0085256 | Ga0495640_0085256_1042_1677 | 198 |
| 676 | 3300046533 | Ga0495640_0185010 | Ga0495640_0185010_278_988 | 198 |
| 677 | 3300046535 | Ga0495586_0036367 | Ga0495586_0036367_1561_2190 | 198 |
| 678 | 3300046536 | Ga0495587_0002231 | Ga0495587_0002231_4408_5118 | 198 |
| 679 | 3300046543 | Ga0495645_0069595 | Ga0495645_0069595_272_982 | 198 |
| 680 | 3300046543 | Ga0495645_0095460 | Ga0495645_0095460_817_1446 | 198 |
| 681 | 3300046559 | Ga0495667_0000965 | Ga0495667_0000965_3354_4064 | 198 |
| 682 | 3300046559 | Ga0495667_0002507 | Ga0495667_0002507_9368_9997 | 198 |
| 683 | 3300046559 | Ga0495667_0024631 | Ga0495667_0024631_2923_3558 | 198 |
| 684 | 3300046559 | Ga0495667_0082540 | Ga0495667_0082540_1094_1741 | 198 |
| 685 | 3300046615 | Ga0495656_0009876 | Ga0495656_0009876_571_1218 | 198 |
| 686 | 3300046642 | Ga0495634_0020937 | Ga0495634_0020937_2792_3427 | 198 |
| 687 | 3300046642 | Ga0495634_0040520 | Ga0495634_0040520_2317_2964 | 198 |
| 688 | 3300046642 | Ga0495634_0108756 | Ga0495634_0108756_1104_1739 | 198 |
| 689 | 3300046642 | Ga0495634_0253383 | Ga0495634_0253383_37_717 | 198 |
| 690 | 3300046642 | Ga0495634_0278999 | Ga0495634_0278999_330_959 | 198 |
| 691 | 3300046663 | Ga0495635_0007253 | Ga0495635_0007253_1380_2090 | 198 |
| 692 | 3300046663 | Ga0495635_0075695 | Ga0495635_0075695_130_777 | 198 |
| 693 | 3300046663 | Ga0495635_0343104 | Ga0495635_0343104_341_970 | 198 |
| 694 | 3300046675 | Ga0495657_0005164 | Ga0495657_0005164_3734_4444 | 198 |
| 695 | 3300046675 | Ga0495657_0190178 | Ga0495657_0190178_378_1007 | 198 |
| 696 | 3300046678 | Ga0495599_0010791 | Ga0495599_0010791_4467_5177 | 198 |
| 697 | 3300046678 | Ga0495599_0031242 | Ga0495599_0031242_639_1268 | 198 |
| 698 | 3300046678 | Ga0495599_0035678 | Ga0495599_0035678_1124_1759 | 198 |
| 699 | 3300046679 | Ga0495623_0196912 | Ga0495623_0196912_251_961 | 198 |
| 700 | 3300046679 | Ga0495623_0294858 | Ga0495623_0294858_46_681 | 198 |
| 701 | 3300046679 | Ga0495623_0367890 | Ga0495623_0367890_100_732 | 198 |
| 702 | 3300046680 | Ga0495646_0020943 | Ga0495646_0020943_1781_2491 | 198 |
| 703 | 3300046680 | Ga0495646_0046251 | Ga0495646_0046251_773_1402 | 198 |
| 704 | 3300046680 | Ga0495646_0057536 | Ga0495646_0057536_1029_1661 | 198 |
| 705 | 3300046680 | Ga0495646_0074492 | Ga0495646_0074492_365_1000 | 198 |
| 706 | 3300046681 | Ga0495647_0179494 | Ga0495647_0179494_100_735 | 198 |
| 707 | 3300046683 | Ga0495658_0000330 | Ga0495658_0000330_10183_10818 | 198 |
| 708 | 3300046683 | Ga0495658_0165748 | Ga0495658_0165748_136_765 | 198 |
| 709 | 3300046683 | Ga0495658_0476609 | Ga0495658_0476609_18_698 | 198 |
| 710 | 3300046683 | Ga0495658_0501577 | Ga0495658_0501577_86_715 | 198 |
| 711 | 3300046689 | Ga0495613_0003457 | Ga0495613_0003457_1183_1818 | 198 |
| 712 | 3300046689 | Ga0495613_0045815 | Ga0495613_0045815_2210_2857 | 198 |
| 713 | 3300046689 | Ga0495613_0073293 | Ga0495613_0073293_1797_2426 | 198 |
| 714 | 3300046689 | Ga0495613_0117075 | Ga0495613_0117075_1158_1787 | 198 |
| 715 | 3300046689 | Ga0495613_0160226 | Ga0495613_0160226_754_1386 | 198 |
| 716 | 3300046689 | Ga0495613_0185986 | Ga0495613_0185986_26_736 | 198 |
| 717 | 3300046690 | Ga0495624_0024911 | Ga0495624_0024911_1823_2458 | 198 |
| 718 | 3300046690 | Ga0495624_0043738 | Ga0495624_0043738_1057_1704 | 198 |
| 719 | 3300046809 | Ga0495600_0001291 | Ga0495600_0001291_9286_9996 | 198 |
| 720 | 3300046809 | Ga0495600_0052829 | Ga0495600_0052829_1975_2610 | 198 |
| 721 | 3300046809 | Ga0495600_0341491 | Ga0495600_0341491_233_865 | 198 |
| 722 | 3300047315 | Ga0495581_0001504 | Ga0495581_0001504_2377_3012 | 198 |
| 723 | 3300047315 | Ga0495581_0030055 | Ga0495581_0030055_1695_2324 | 198 |
| 724 | 3300047315 | Ga0495581_0206064 | Ga0495581_0206064_178_858 | 198 |
| 725 | 3300047315 | Ga0495581_0342152 | Ga0495581_0342152_218_853 | 198 |
| 726 | 3300047317 | Ga0495604_0003733 | Ga0495604_0003733_1112_1822 | 198 |
| 727 | 3300047317 | Ga0495604_0072526 | Ga0495604_0072526_416_1051 | 198 |
| 728 | 3300047319 | Ga0495674_0021694 | Ga0495674_0021694_4087_4722 | 198 |
| 729 | 3300047319 | Ga0495674_0026937 | Ga0495674_0026937_1183_1812 | 198 |
| 730 | 3300047319 | Ga0495674_0122190 | Ga0495674_0122190_300_1010 | 198 |
| 731 | 3300047319 | Ga0495674_0123627 | Ga0495674_0123627_422_1051 | 198 |
| 732 | 3300047319 | Ga0495674_0197027 | Ga0495674_0197027_894_1541 | 198 |
| 733 | 3300047321 | Ga0495676_0000450 | Ga0495676_0000450_23300_23935 | 198 |
| 734 | 3300047321 | Ga0495676_0064124 | Ga0495676_0064124_1402_2082 | 198 |
| 735 | 3300047321 | Ga0495676_0131631 | Ga0495676_0131631_718_1350 | 198 |
| 736 | 3300047321 | Ga0495676_0184408 | Ga0495676_0184408_403_1038 | 198 |
| 737 | 3300047322 | Ga0495680_0002908 | Ga0495680_0002908_8705_9340 | 198 |
| 738 | 3300047322 | Ga0495680_0006974 | Ga0495680_0006974_7286_7933 | 198 |
| 739 | 3300047322 | Ga0495680_0009129 | Ga0495680_0009129_5810_6439 | 198 |
| 740 | 3300047322 | Ga0495680_0009676 | Ga0495680_0009676_3417_4052 | 198 |
| 741 | 3300047322 | Ga0495680_0013899 | Ga0495680_0013899_5991_6701 | 198 |
| 742 | 3300047444 | Ga0495675_0051883 | Ga0495675_0051883_325_1035 | 198 |
| 743 | 3300047445 | Ga0495677_0131546 | Ga0495677_0131546_190_840 | 198 |
| 744 | 3300047471 | Ga0495684_0008955 | Ga0495684_0008955_6274_6909 | 198 |
| 745 | 3300047471 | Ga0495684_0011927 | Ga0495684_0011927_3313_3948 | 198 |
| 746 | 3300047471 | Ga0495684_0017940 | Ga0495684_0017940_892_1521 | 198 |
| 747 | 3300047471 | Ga0495684_0023917 | Ga0495684_0023917_2978_3625 | 198 |
| 748 | 3300047471 | Ga0495684_0028310 | Ga0495684_0028310_356_1066 | 198 |
| 749 | 3300047673 | Ga0495593_0008171 | Ga0495593_0008171_3243_3878 | 198 |
| 750 | 3300047673 | Ga0495593_0060508 | Ga0495593_0060508_488_1120 | 198 |
| 751 | 3300048088 | Ga0495602_0012401 | Ga0495602_0012401_5135_5845 | 198 |
| 752 | 3300048088 | Ga0495602_0153156 | Ga0495602_0153156_1035_1664 | 198 |
| 753 | 3300048088 | Ga0495602_0342804 | Ga0495602_0342804_117_749 | 198 |
| 754 | 3300048089 | Ga0495614_0007584 | Ga0495614_0007584_4103_4738 | 198 |
| 755 | 3300048903 | Ga0496100_0003687 | Ga0496100_0003687_6052_6687 | 198 |
| 756 | 3300048903 | Ga0496100_0004256 | Ga0496100_0004256_2181_2813 | 198 |
| 757 | 3300048903 | Ga0496100_0015632 | Ga0496100_0015632_412_1119 | 198 |
| 758 | 3300048903 | Ga0496100_0016329 | Ga0496100_0016329_3160_3795 | 198 |
| 759 | 3300048903 | Ga0496100_0025706 | Ga0496100_0025706_331_963 | 198 |
| 760 | 3300048903 | Ga0496100_0343380 | Ga0496100_0343380_296_931 | 198 |
| 761 | 3300048904 | Ga0496101_0008094 | Ga0496101_0008094_3471_4103 | 198 |
| 762 | 3300048904 | Ga0496101_0053373 | Ga0496101_0053373_1757_2464 | 198 |
| 763 | 3300048904 | Ga0496101_0077655 | Ga0496101_0077655_449_1081 | 198 |
| 764 | 3300048904 | Ga0496101_0084889 | Ga0496101_0084889_840_1475 | 198 |
| 765 | 3300048905 | Ga0496102_0010523 | Ga0496102_0010523_6118_6750 | 198 |
| 766 | 3300048905 | Ga0496102_0024471 | Ga0496102_0024471_4295_4930 | 198 |
| 767 | 3300048905 | Ga0496102_0101814 | Ga0496102_0101814_1165_1797 | 198 |
| 768 | 3300048905 | Ga0496102_0111378 | Ga0496102_0111378_1829_2464 | 198 |
| 769 | 3300048906 | Ga0496103_0025806 | Ga0496103_0025806_1948_2586 | 198 |
| 770 | 3300048906 | Ga0496103_0045468 | Ga0496103_0045468_1173_1805 | 198 |
| 771 | 3300048906 | Ga0496103_0343184 | Ga0496103_0343184_68_700 | 198 |
| 772 | 3300048907 | Ga0496104_0006326 | Ga0496104_0006326_3846_4481 | 198 |
| 773 | 3300048907 | Ga0496104_0089314 | Ga0496104_0089314_291_926 | 198 |
| 774 | 3300048907 | Ga0496104_0310341 | Ga0496104_0310341_145_774 | 198 |
| 775 | 3300048907 | Ga0496104_0365388 | Ga0496104_0365388_170_850 | 198 |
| 776 | 3300048907 | Ga0496104_1056369 | Ga0496104_1056369_62_697 | 198 |
| 777 | 3300048908 | Ga0496105_0007064 | Ga0496105_0007064_6058_6693 | 198 |
| 778 | 3300048908 | Ga0496105_0065718 | Ga0496105_0065718_446_1078 | 198 |
| 779 | 3300048908 | Ga0496105_0171178 | Ga0496105_0171178_770_1405 | 198 |
| 780 | 3300048908 | Ga0496105_0307830 | Ga0496105_0307830_451_1131 | 198 |
| 781 | 3300048908 | Ga0496105_0433390 | Ga0496105_0433390_259_906 | 198 |
| 782 | 3300048909 | Ga0496106_0004250 | Ga0496106_0004250_8893_9528 | 198 |
| 783 | 3300048909 | Ga0496106_0047941 | Ga0496106_0047941_213_845 | 198 |
| 784 | 3300048909 | Ga0496106_0091766 | Ga0496106_0091766_229_936 | 198 |
| 785 | 3300048909 | Ga0496106_0417554 | Ga0496106_0417554_206_850 | 198 |
| 786 | 3300048910 | Ga0496107_0006798 | Ga0496107_0006798_6064_6696 | 198 |
| 787 | 3300048910 | Ga0496107_0009452 | Ga0496107_0009452_5392_6027 | 198 |
| 788 | 3300048910 | Ga0496107_0014706 | Ga0496107_0014706_950_1657 | 198 |
| 789 | 3300048910 | Ga0496107_0172596 | Ga0496107_0172596_190_813 | 198 |
| 790 | 3300048910 | Ga0496107_0185737 | Ga0496107_0185737_450_1082 | 198 |
| 791 | 3300048910 | Ga0496107_0282623 | Ga0496107_0282623_25_654 | 198 |
| 792 | 3300048910 | Ga0496107_0307822 | Ga0496107_0307822_276_911 | 198 |
| 793 | 3300048911 | Ga0496108_0001690 | Ga0496108_0001690_8086_8766 | 198 |
| 794 | 3300048911 | Ga0496108_0065911 | Ga0496108_0065911_1477_2124 | 198 |
| 795 | 3300048911 | Ga0496108_0124059 | Ga0496108_0124059_834_1469 | 198 |
| 796 | 3300048911 | Ga0496108_0913420 | Ga0496108_0913420_62_694 | 198 |
| 797 | 3300048912 | Ga0496109_0000605 | Ga0496109_0000605_232_912 | 198 |
| 798 | 3300048912 | Ga0496109_0003633 | Ga0496109_0003633_4703_5338 | 198 |
| 799 | 3300048912 | Ga0496109_0020405 | Ga0496109_0020405_1508_2146 | 198 |
| 800 | 3300048912 | Ga0496109_0082140 | Ga0496109_0082140_468_1100 | 198 |
| 801 | 3300048912 | Ga0496109_0204306 | Ga0496109_0204306_318_965 | 198 |
| 802 | 3300048912 | Ga0496109_0271373 | Ga0496109_0271373_439_1068 | 198 |
| 803 | 3300048912 | Ga0496109_0535479 | Ga0496109_0535479_427_1062 | 198 |
| 804 | 3300048913 | Ga0496110_0035220 | Ga0496110_0035220_637_1272 | 198 |
| 805 | 3300048913 | Ga0496110_0181288 | Ga0496110_0181288_578_1225 | 198 |
| 806 | 3300048913 | Ga0496110_0202978 | Ga0496110_0202978_165_794 | 198 |
| 807 | 3300048913 | Ga0496110_0211734 | Ga0496110_0211734_942_1574 | 198 |
| 808 | 3300048913 | Ga0496110_0446840 | Ga0496110_0446840_166_795 | 198 |
| 809 | 3300048913 | Ga0496110_0652466 | Ga0496110_0652466_120_761 | 198 |
| 810 | 3300048914 | Ga0496111_0001372 | Ga0496111_0001372_5293_5973 | 198 |
| 811 | 3300048914 | Ga0496111_0025935 | Ga0496111_0025935_1192_1827 | 198 |
| 812 | 3300048914 | Ga0496111_0045100 | Ga0496111_0045100_2197_2871 | 198 |
| 813 | 3300048914 | Ga0496111_0077649 | Ga0496111_0077649_61_696 | 198 |
| 814 | 3300048914 | Ga0496111_0091267 | Ga0496111_0091267_982_1629 | 198 |
| 815 | 3300048914 | Ga0496111_0158808 | Ga0496111_0158808_969_1601 | 198 |
| 816 | 3300048914 | Ga0496111_0186357 | Ga0496111_0186357_500_1141 | 198 |
| 817 | 3300048914 | Ga0496111_0208968 | Ga0496111_0208968_421_1053 | 198 |
| 818 | 3300048914 | Ga0496111_0334179 | Ga0496111_0334179_413_1057 | 198 |
| 819 | 3300048915 | Ga0496112_0000273 | Ga0496112_0000273_8374_9003 | 198 |
| 820 | 3300048915 | Ga0496112_0011211 | Ga0496112_0011211_4467_5099 | 198 |
| 821 | 3300048915 | Ga0496112_0019704 | Ga0496112_0019704_533_1165 | 198 |
| 822 | 3300048915 | Ga0496112_0027531 | Ga0496112_0027531_1479_2117 | 198 |
| 823 | 3300048915 | Ga0496112_0108747 | Ga0496112_0108747_725_1360 | 198 |
| 824 | 3300048915 | Ga0496112_0112468 | Ga0496112_0112468_1436_2068 | 198 |
| 825 | 3300048915 | Ga0496112_0184011 | Ga0496112_0184011_522_1202 | 198 |
| 826 | 3300048915 | Ga0496112_0259474 | Ga0496112_0259474_156_788 | 198 |
| 827 | 3300048915 | Ga0496112_0558889 | Ga0496112_0558889_404_1048 | 198 |
| 828 | 3300048915 | Ga0496112_1084694 | Ga0496112_1084694_32_664 | 198 |
| 829 | 3300048916 | Ga0496113_0181162 | Ga0496113_0181162_313_945 | 198 |
| 830 | 3300048916 | Ga0496113_0404965 | Ga0496113_0404965_318_998 | 198 |
| 831 | 3300048916 | Ga0496113_0497603 | Ga0496113_0497603_151_792 | 198 |
| 832 | 3300048917 | Ga0496114_0002771 | Ga0496114_0002771_7226_7861 | 198 |
| 833 | 3300048917 | Ga0496114_0012654 | Ga0496114_0012654_822_1457 | 198 |
| 834 | 3300048917 | Ga0496114_0029401 | Ga0496114_0029401_957_1589 | 198 |
| 835 | 3300048917 | Ga0496114_0120163 | Ga0496114_0120163_90_722 | 198 |
| 836 | 3300048917 | Ga0496114_0366793 | Ga0496114_0366793_284_994 | 198 |
| 837 | 3300048918 | Ga0496115_0001894 | Ga0496115_0001894_3522_4157 | 198 |
| 838 | 3300048918 | Ga0496115_0006368 | Ga0496115_0006368_1986_2621 | 198 |
| 839 | 3300048918 | Ga0496115_0033800 | Ga0496115_0033800_1956_2666 | 198 |
| 840 | 3300048918 | Ga0496115_0165067 | Ga0496115_0165067_185_820 | 198 |
| 841 | 3300048918 | Ga0496115_0222658 | Ga0496115_0222658_241_879 | 198 |
| 842 | 3300049571 | Ga0501034_0164444 | Ga0501034_0164444_572_1210 | 198 |
| 843 | 3300049580 | Ga0501046_0190722 | Ga0501046_0190722_734_1372 | 198 |
| 844 | 3300049581 | Ga0501047_0010057 | Ga0501047_0010057_3526_4164 | 198 |
| 845 | 3300049581 | Ga0501047_0026688 | Ga0501047_0026688_302_928 | 198 |
| 846 | 3300049583 | Ga0501067_0001219 | Ga0501067_0001219_96_737 | 198 |
| 847 | 3300049583 | Ga0501067_0077725 | Ga0501067_0077725_232_867 | 198 |
| 848 | 3300049583 | Ga0501067_0203132 | Ga0501067_0203132_126_764 | 198 |
| 849 | 3300049584 | Ga0501068_0126481 | Ga0501068_0126481_662_1303 | 198 |
| 850 | 3300049585 | Ga0501069_0007861 | Ga0501069_0007861_3490_4131 | 198 |
| 851 | 3300049585 | Ga0501069_0061929 | Ga0501069_0061929_207_833 | 198 |
| 852 | 3300049586 | Ga0501070_0000120 | Ga0501070_0000120_42785_43501 | 198 |
| 853 | 3300049589 | Ga0501073_0072000 | Ga0501073_0072000_1310_1936 | 198 |
| 854 | 3300049590 | Ga0501074_0010622 | Ga0501074_0010622_2348_2974 | 198 |
| 855 | 3300049592 | Ga0501076_0260869 | Ga0501076_0260869_324_956 | 198 |
| 856 | 3300049592 | Ga0501076_0479639 | Ga0501076_0479639_265_897 | 198 |
| 857 | 3300049742 | Ga0501080_0260736 | Ga0501080_0260736_256_969 | 198 |
| 858 | 3300049822 | Ga0501035_0297353 | Ga0501035_0297353_342_1055 | 198 |
| 859 | 3300049822 | Ga0501035_0394119 | Ga0501035_0394119_168_794 | 198 |
| 860 | 3300049823 | Ga0501044_0211408 | Ga0501044_0211408_254_892 | 198 |
| 861 | 3300049823 | Ga0501044_0334938 | Ga0501044_0334938_754_1380 | 198 |
| 862 | 3300050490 | nmdc:mga03n38_112395_c1 | nmdc:mga03n38_112395_c1_483_1121 | 198 |
| 863 | 3300050492 | nmdc:mga0yw44_45111_c1 | nmdc:mga0yw44_45111_c1_547_1194 | 198 |
| 864 | 3300050507 | nmdc:mga05p37_10748_c1 | nmdc:mga05p37_10748_c1_1946_2584 | 198 |
| 865 | 3300050507 | nmdc:mga05p37_1109513_c1 | nmdc:mga05p37_1109513_c1_13_645 | 198 |
| 866 | 3300050507 | nmdc:mga05p37_147138_c1 | nmdc:mga05p37_147138_c1_968_1603 | 198 |
| 867 | 3300050507 | nmdc:mga05p37_208837_c1 | nmdc:mga05p37_208837_c1_818_1462 | 198 |
| 868 | 3300050510 | nmdc:mga06r32_325621_c1 | nmdc:mga06r32_325621_c1_739_1377 | 198 |
| 869 | 3300050512 | nmdc:mga0n895_40422_c1 | nmdc:mga0n895_40422_c1_2723_3361 | 198 |
| 870 | 3300050512 | nmdc:mga0n895_503189_c1 | nmdc:mga0n895_503189_c1_430_1065 | 198 |
| 871 | 3300050512 | nmdc:mga0n895_713751_c1 | nmdc:mga0n895_713751_c1_38_670 | 198 |
| 872 | 3300050512 | nmdc:mga0n895_958627_c1 | nmdc:mga0n895_958627_c1_12_680 | 198 |
| 873 | 3300050513 | nmdc:mga0rr50_143685_c1 | nmdc:mga0rr50_143685_c1_123_830 | 198 |
| 874 | 3300050513 | nmdc:mga0rr50_17281_c1 | nmdc:mga0rr50_17281_c1_719_1357 | 198 |
| 875 | 3300050513 | nmdc:mga0rr50_198601_c1 | nmdc:mga0rr50_198601_c1_800_1471 | 198 |
| 876 | 3300050514 | nmdc:mga08x19_36535_c1 | nmdc:mga08x19_36535_c1_1304_1942 | 198 |
| 877 | 3300050515 | nmdc:mga0a205_151356_c2 | nmdc:mga0a205_151356_c2_68_697 | 198 |
| 878 | 3300050515 | nmdc:mga0a205_63929_c1 | nmdc:mga0a205_63929_c1_921_1559 | 198 |
| 879 | 3300053077 | Ga0495601_0016778 | Ga0495601_0016778_920_1552 | 198 |
| 880 | 3300053077 | Ga0495601_0230641 | Ga0495601_0230641_112_741 | 198 |
| 881 | 3300053078 | Ga0495612_0044660 | Ga0495612_0044660_942_1574 | 198 |
| 882 | 3300053084 | Ga0495595_0018078 | Ga0495595_0018078_2000_2647 | 198 |
| 883 | 3300053084 | Ga0495595_0037728 | Ga0495595_0037728_1146_1781 | 198 |
| 884 | 3300053085 | Ga0495619_0001713 | Ga0495619_0001713_4721_5356 | 198 |
| 885 | 3300053085 | Ga0495619_0002632 | Ga0495619_0002632_4283_4993 | 198 |
| 886 | 3300053085 | Ga0495619_0002961 | Ga0495619_0002961_9416_10051 | 198 |
| 887 | 3300060353 | Ga0501082_0261483 | Ga0501082_0261483_156_794 | 198 |
| 888 | 3300060353 | Ga0501082_0572802 | Ga0501082_0572802_199_831 | 198 |
| 889 | 3300061734 | Ga0530510_0069148 | Ga0530510_0069148_1588_2229 | 198 |
| 890 | 3300005434 | Ga0070709_10181086 | Ga0070709_101810862 | 199 |
| 891 | 3300009098 | Ga0105245_11246535 | Ga0105245_112465351 | 199 |
| 892 | 3300009553 | Ga0105249_10003964 | Ga0105249_100039645 | 199 |
| 893 | 3300014326 | Ga0157380_10008469 | Ga0157380_100084692 | 199 |
| 894 | 3300014969 | Ga0157376_10007598 | Ga0157376_100075982 | 199 |
| 895 | 3300025906 | Ga0207699_10089496 | Ga0207699_100894962 | 199 |
| 896 | 3300025929 | Ga0207664_10101566 | Ga0207664_101015662 | 199 |
| 897 | 3300037312 | Ga0395899_0027220 | Ga0395899_0027220_513_1157 | 199 |
| 898 | 3300037312 | Ga0395899_0287948 | Ga0395899_0287948_170_799 | 199 |
| 899 | 3300037418 | Ga0395900_0006950 | Ga0395900_0006950_3614_4258 | 199 |
| 900 | 3300037418 | Ga0395900_0287912 | Ga0395900_0287912_192_821 | 199 |
| 901 | 3300037466 | Ga0395898_0089660 | Ga0395898_0089660_1781_2410 | 199 |
| 902 | 3300037471 | Ga0395905_0094392 | Ga0395905_0094392_1946_2590 | 199 |
| 903 | 3300038443 | Ga0395901_0016980 | Ga0395901_0016980_4577_5221 | 199 |
| 904 | 3300038443 | Ga0395901_0237973 | Ga0395901_0237973_1016_1645 | 199 |
| 905 | 3300046455 | Ga0495603_0051830 | Ga0495603_0051830_1086_1739 | 199 |
| 906 | 3300046473 | Ga0495582_0084100 | Ga0495582_0084100_577_1230 | 199 |
| 907 | 3300046499 | Ga0495594_0172866 | Ga0495594_0172866_209_862 | 199 |
| 908 | 3300046674 | Ga0495588_0047299 | Ga0495588_0047299_1285_1938 | 199 |
| 909 | 3300047315 | Ga0495581_0370078 | Ga0495581_0370078_23_676 | 199 |
| 910 | 3300047321 | Ga0495676_0036162 | Ga0495676_0036162_211_864 | 199 |
| 911 | 3300048904 | Ga0496101_0284739 | Ga0496101_0284739_351_995 | 199 |
| 912 | 3300048905 | Ga0496102_0219048 | Ga0496102_0219048_552_1196 | 199 |
| 913 | 3300048907 | Ga0496104_0009980 | Ga0496104_0009980_2243_2887 | 199 |
| 914 | 3300048908 | Ga0496105_0007204 | Ga0496105_0007204_5774_6418 | 199 |
| 915 | 3300048909 | Ga0496106_0097026 | Ga0496106_0097026_373_1017 | 199 |
| 916 | 3300048911 | Ga0496108_0016216 | Ga0496108_0016216_3779_4423 | 199 |
| 917 | 3300048912 | Ga0496109_0000576 | Ga0496109_0000576_4001_4645 | 199 |
| 918 | 3300048913 | Ga0496110_0003721 | Ga0496110_0003721_345_989 | 199 |
| 919 | 3300048914 | Ga0496111_0011531 | Ga0496111_0011531_1488_2132 | 199 |
| 920 | 3300048915 | Ga0496112_0009544 | Ga0496112_0009544_611_1255 | 199 |
| 921 | 3300048916 | Ga0496113_0021814 | Ga0496113_0021814_2255_2899 | 199 |
| 922 | 3300048917 | Ga0496114_0021259 | Ga0496114_0021259_1303_1947 | 199 |
| 923 | 3300048918 | Ga0496115_0005207 | Ga0496115_0005207_3466_4110 | 199 |
| 924 | 3300005330 | Ga0070690_100051760 | Ga0070690_1000517602 | 200 |
| 925 | 3300005335 | Ga0070666_10340104 | Ga0070666_103401042 | 200 |
| 926 | 3300005338 | Ga0068868_100016225 | Ga0068868_1000162254 | 200 |
| 927 | 3300005339 | Ga0070660_100011699 | Ga0070660_1000116994 | 200 |
| 928 | 3300005345 | Ga0070692_10058883 | Ga0070692_100588833 | 200 |
| 929 | 3300005347 | Ga0070668_100016085 | Ga0070668_1000160854 | 200 |
| 930 | 3300005354 | Ga0070675_100104713 | Ga0070675_1001047132 | 200 |
| 931 | 3300005356 | Ga0070674_100134103 | Ga0070674_1001341033 | 200 |
| 932 | 3300005364 | Ga0070673_100037073 | Ga0070673_1000370734 | 200 |
| 933 | 3300005366 | Ga0070659_100031080 | Ga0070659_1000310803 | 200 |
| 934 | 3300005367 | Ga0070667_100110520 | Ga0070667_1001105203 | 200 |
| 935 | 3300005437 | Ga0070710_10035305 | Ga0070710_100353053 | 200 |
| 936 | 3300005438 | Ga0070701_10034471 | Ga0070701_100344713 | 200 |
| 937 | 3300005439 | Ga0070711_100001144 | Ga0070711_1000011443 | 200 |
| 938 | 3300005440 | Ga0070705_100009138 | Ga0070705_1000091383 | 200 |
| 939 | 3300005441 | Ga0070700_100007946 | Ga0070700_1000079465 | 200 |
| 940 | 3300005444 | Ga0070694_100025028 | Ga0070694_1000250284 | 200 |
| 941 | 3300005466 | Ga0070685_10520404 | Ga0070685_105204041 | 200 |
| 942 | 3300005539 | Ga0068853_100028151 | Ga0068853_1000281514 | 200 |
| 943 | 3300005545 | Ga0070695_100207014 | Ga0070695_1002070142 | 200 |
| 944 | 3300005546 | Ga0070696_100199666 | Ga0070696_1001996663 | 200 |
| 945 | 3300005547 | Ga0070693_100100573 | Ga0070693_1001005732 | 200 |
| 946 | 3300005548 | Ga0070665_100266455 | Ga0070665_1002664553 | 200 |
| 947 | 3300005616 | Ga0068852_100356913 | Ga0068852_1003569132 | 200 |
| 948 | 3300005718 | Ga0068866_10003857 | Ga0068866_100038575 | 200 |
| 949 | 3300005719 | Ga0068861_100024794 | Ga0068861_1000247942 | 200 |
| 950 | 3300005843 | Ga0068860_100139091 | Ga0068860_1001390912 | 200 |
| 951 | 3300005844 | Ga0068862_100342030 | Ga0068862_1003420302 | 200 |
| 952 | 3300006163 | Ga0070715_10141881 | Ga0070715_101418812 | 200 |
| 953 | 3300006237 | Ga0097621_100011723 | Ga0097621_1000117237 | 200 |
| 954 | 3300006358 | Ga0068871_100026438 | Ga0068871_1000264383 | 200 |
| 955 | 3300006881 | Ga0068865_100049045 | Ga0068865_1000490453 | 200 |
| 956 | 3300009098 | Ga0105245_10020362 | Ga0105245_100203626 | 200 |
| 957 | 3300009101 | Ga0105247_10104196 | Ga0105247_101041962 | 200 |
| 958 | 3300009148 | Ga0105243_10003921 | Ga0105243_100039218 | 200 |
| 959 | 3300009177 | Ga0105248_10340525 | Ga0105248_103405253 | 200 |
| 960 | 3300009177 | Ga0105248_10516646 | Ga0105248_105166462 | 200 |
| 961 | 3300009551 | Ga0105238_10042715 | Ga0105238_100427153 | 200 |
| 962 | 3300011119 | Ga0105246_10035463 | Ga0105246_100354633 | 200 |
| 963 | 3300013296 | Ga0157374_10026155 | Ga0157374_100261553 | 200 |
| 964 | 3300013297 | Ga0157378_10068908 | Ga0157378_100689084 | 200 |
| 965 | 3300013306 | Ga0163162_10005877 | Ga0163162_100058779 | 200 |
| 966 | 3300025899 | Ga0207642_10036145 | Ga0207642_100361452 | 200 |
| 967 | 3300025911 | Ga0207654_10069834 | Ga0207654_100698342 | 200 |
| 968 | 3300025915 | Ga0207693_10001754 | Ga0207693_100017548 | 200 |
| 969 | 3300025917 | Ga0207660_10123410 | Ga0207660_101234103 | 200 |
| 970 | 3300025918 | Ga0207662_10014548 | Ga0207662_100145484 | 200 |
| 971 | 3300025919 | Ga0207657_10020124 | Ga0207657_100201244 | 200 |
| 972 | 3300025926 | Ga0207659_10072351 | Ga0207659_100723512 | 200 |
| 973 | 3300025932 | Ga0207690_10144472 | Ga0207690_101444722 | 200 |
| 974 | 3300025933 | Ga0207706_10167089 | Ga0207706_101670892 | 200 |
| 975 | 3300025935 | Ga0207709_10014190 | Ga0207709_100141903 | 200 |
| 976 | 3300025936 | Ga0207670_10011870 | Ga0207670_100118705 | 200 |
| 977 | 3300025939 | Ga0207665_10014209 | Ga0207665_100142096 | 200 |
| 978 | 3300025940 | Ga0207691_10002643 | Ga0207691_100026435 | 200 |
| 979 | 3300025941 | Ga0207711_10271573 | Ga0207711_102715732 | 200 |
| 980 | 3300025961 | Ga0207712_10004878 | Ga0207712_100048787 | 200 |
| 981 | 3300025972 | Ga0207668_10013595 | Ga0207668_100135954 | 200 |
| 982 | 3300026023 | Ga0207677_10071251 | Ga0207677_100712512 | 200 |
| 983 | 3300026075 | Ga0207708_10004755 | Ga0207708_1000475510 | 200 |
| 984 | 3300026078 | Ga0207702_10069185 | Ga0207702_100691851 | 200 |
| 985 | 3300026089 | Ga0207648_10000150 | Ga0207648_1000015048 | 200 |
| 986 | 3300026095 | Ga0207676_10472465 | Ga0207676_104724651 | 200 |
| 987 | 3300026118 | Ga0207675_100011845 | Ga0207675_1000118457 | 200 |
| 988 | 3300026121 | Ga0207683_10000131 | Ga0207683_1000013144 | 200 |
| 989 | 3300028380 | Ga0268265_10255892 | Ga0268265_102558923 | 200 |
| 990 | 3300028381 | Ga0268264_10427563 | Ga0268264_104275632 | 200 |
| 991 | 3300028800 | Ga0265338_10002640 | Ga0265338_100026402 | 200 |
| 992 | 3300037312 | Ga0395899_0010041 | Ga0395899_0010041_650_1330 | 200 |
| 993 | 3300037312 | Ga0395899_0012131 | Ga0395899_0012131_3644_4324 | 200 |
| 994 | 3300037418 | Ga0395900_0002321 | Ga0395900_0002321_6378_7058 | 200 |
| 995 | 3300037418 | Ga0395900_0002916 | Ga0395900_0002916_10676_11356 | 200 |
| 996 | 3300037418 | Ga0395900_0003619 | Ga0395900_0003619_10474_11154 | 200 |
| 997 | 3300037418 | Ga0395900_0169751 | Ga0395900_0169751_601_1281 | 200 |
| 998 | 3300037466 | Ga0395898_0002298 | Ga0395898_0002298_6379_7059 | 200 |
| 999 | 3300037466 | Ga0395898_0003164 | Ga0395898_0003164_4444_5124 | 200 |
| 1000 | 3300037466 | Ga0395898_0038637 | Ga0395898_0038637_192_848 | 200 |
| 1001 | 3300037471 | Ga0395905_0002318 | Ga0395905_0002318_9493_10173 | 200 |
| 1002 | 3300037471 | Ga0395905_0015483 | Ga0395905_0015483_6379_7059 | 200 |
| 1003 | 3300037471 | Ga0395905_0026294 | Ga0395905_0026294_4717_5397 | 200 |
| 1004 | 3300037471 | Ga0395905_0041514 | Ga0395905_0041514_1299_1979 | 200 |
| 1005 | 3300038443 | Ga0395901_0002740 | Ga0395901_0002740_9352_10032 | 200 |
| 1006 | 3300038443 | Ga0395901_0011266 | Ga0395901_0011266_2927_3607 | 200 |
| 1007 | 3300038443 | Ga0395901_0209905 | Ga0395901_0209905_418_1098 | 200 |
| 1008 | 3300046462 | Ga0495651_0168173 | Ga0495651_0168173_322_966 | 200 |
| 1009 | 3300046491 | Ga0495584_0048577 | Ga0495584_0048577_1021_1677 | 200 |
| 1010 | 3300046511 | Ga0495608_0181152 | Ga0495608_0181152_584_1225 | 200 |
| 1011 | 3300046514 | Ga0495618_0221899 | Ga0495618_0221899_235_879 | 200 |
| 1012 | 3300046517 | Ga0495630_0101498 | Ga0495630_0101498_439_1119 | 200 |
| 1013 | 3300046518 | Ga0495631_0125378 | Ga0495631_0125378_26_682 | 200 |
| 1014 | 3300046525 | Ga0495663_0019713 | Ga0495663_0019713_798_1454 | 200 |
| 1015 | 3300046529 | Ga0495652_0035030 | Ga0495652_0035030_2157_2798 | 200 |
| 1016 | 3300046615 | Ga0495656_0088648 | Ga0495656_0088648_474_1130 | 200 |
| 1017 | 3300047317 | Ga0495604_0576289 | Ga0495604_0576289_19_669 | 200 |
| 1018 | 3300047318 | Ga0495636_0035350 | Ga0495636_0035350_360_1016 | 200 |
| 1019 | 3300048903 | Ga0496100_0167753 | Ga0496100_0167753_300_956 | 200 |
| 1020 | 3300048904 | Ga0496101_0028304 | Ga0496101_0028304_3154_3810 | 200 |
| 1021 | 3300048905 | Ga0496102_0028507 | Ga0496102_0028507_237_893 | 200 |
| 1022 | 3300048906 | Ga0496103_0010053 | Ga0496103_0010053_1977_2633 | 200 |
| 1023 | 3300048907 | Ga0496104_0020456 | Ga0496104_0020456_2879_3535 | 200 |
| 1024 | 3300048909 | Ga0496106_0022615 | Ga0496106_0022615_2421_3077 | 200 |
| 1025 | 3300048910 | Ga0496107_0017194 | Ga0496107_0017194_1522_2178 | 200 |
| 1026 | 3300048917 | Ga0496114_0272143 | Ga0496114_0272143_764_1420 | 200 |
| 1027 | 3300050510 | nmdc:mga06r32_144488_c1 | nmdc:mga06r32_144488_c1_1009_1638 | 200 |
| 1028 | 3300053077 | Ga0495601_0029007 | Ga0495601_0029007_1041_1682 | 200 |
| 1029 | 3300053077 | Ga0495601_0267342 | Ga0495601_0267342_64_708 | 200 |
| 1030 | 3300053085 | Ga0495619_0147967 | Ga0495619_0147967_870_1514 | 200 |
| 1031 | 3300003373 | JGI25407J50210_10003353 | JGI25407J50210_100033533 | 201 |
| 1032 | 3300005536 | Ga0070697_100137328 | Ga0070697_1001373282 | 201 |
| 1033 | 3300005981 | Ga0081538_10002124 | Ga0081538_1000212416 | 201 |
| 1034 | 3300006038 | Ga0075365_10233816 | Ga0075365_102338162 | 201 |
| 1035 | 3300006051 | Ga0075364_10065715 | Ga0075364_100657152 | 201 |
| 1036 | 3300006058 | Ga0075432_10031194 | Ga0075432_100311942 | 201 |
| 1037 | 3300006195 | Ga0075366_10148581 | Ga0075366_101485812 | 201 |
| 1038 | 3300006846 | Ga0075430_100105604 | Ga0075430_1001056043 | 201 |
| 1039 | 3300009093 | Ga0105240_10231006 | Ga0105240_102310063 | 201 |
| 1040 | 3300027907 | Ga0207428_10299312 | Ga0207428_102993122 | 201 |
| 1041 | 3300028573 | Ga0265334_10004404 | Ga0265334_100044045 | 201 |
| 1042 | 3300028654 | Ga0265322_10036811 | Ga0265322_100368112 | 201 |
| 1043 | 3300028666 | Ga0265336_10004674 | Ga0265336_100046742 | 201 |
| 1044 | 3300028800 | Ga0265338_10001061 | Ga0265338_100010615 | 201 |
| 1045 | 3300028800 | Ga0265338_10003129 | Ga0265338_1000312910 | 201 |
| 1046 | 3300031239 | Ga0265328_10102210 | Ga0265328_101022101 | 201 |
| 1047 | 3300031251 | Ga0265327_10021489 | Ga0265327_100214895 | 201 |
| 1048 | 3300031595 | Ga0265313_10004905 | Ga0265313_100049059 | 201 |
| 1049 | 3300035114 | Ga0373939_0023376 | Ga0373939_0023376_439_1086 | 201 |
| 1050 | 3300035410 | Ga0373924_0059168 | Ga0373924_0059168_235_888 | 201 |
| 1051 | 3300036401 | Ga0373937_0529716 | Ga0373937_0529716_93_740 | 201 |
| 1052 | 3300037312 | Ga0395899_0001360 | Ga0395899_0001360_4420_5055 | 201 |
| 1053 | 3300037312 | Ga0395899_0018647 | Ga0395899_0018647_2275_2907 | 201 |
| 1054 | 3300037418 | Ga0395900_0163100 | Ga0395900_0163100_962_1597 | 201 |
| 1055 | 3300037418 | Ga0395900_0250782 | Ga0395900_0250782_641_1276 | 201 |
| 1056 | 3300037466 | Ga0395898_0108302 | Ga0395898_0108302_891_1526 | 201 |
| 1057 | 3300037466 | Ga0395898_0165006 | Ga0395898_0165006_383_1018 | 201 |
| 1058 | 3300037466 | Ga0395898_0351910 | Ga0395898_0351910_500_1165 | 201 |
| 1059 | 3300037471 | Ga0395905_0209470 | Ga0395905_0209470_429_1064 | 201 |
| 1060 | 3300038443 | Ga0395901_0168495 | Ga0395901_0168495_496_1131 | 201 |
| 1061 | 3300038443 | Ga0395901_0411832 | Ga0395901_0411832_59_694 | 201 |
| 1062 | 3300038443 | Ga0395901_0855875 | Ga0395901_0855875_61_726 | 201 |
| 1063 | 3300039450 | Ga0436363_1093415 | Ga0436363_1093415_331_978 | 201 |
| 1064 | 3300046454 | Ga0495592_0165294 | Ga0495592_0165294_157_801 | 201 |
| 1065 | 3300046462 | Ga0495651_0521262 | Ga0495651_0521262_95_739 | 201 |
| 1066 | 3300046463 | Ga0495653_0159454 | Ga0495653_0159454_18_662 | 201 |
| 1067 | 3300046477 | Ga0495664_0046958 | Ga0495664_0046958_865_1509 | 201 |
| 1068 | 3300046511 | Ga0495608_0147392 | Ga0495608_0147392_414_1058 | 201 |
| 1069 | 3300046516 | Ga0495628_0069241 | Ga0495628_0069241_866_1564 | 201 |
| 1070 | 3300046517 | Ga0495630_0349475 | Ga0495630_0349475_350_1003 | 201 |
| 1071 | 3300046559 | Ga0495667_0192551 | Ga0495667_0192551_391_1035 | 201 |
| 1072 | 3300046642 | Ga0495634_0390613 | Ga0495634_0390613_70_714 | 201 |
| 1073 | 3300046663 | Ga0495635_0270692 | Ga0495635_0270692_452_1096 | 201 |
| 1074 | 3300046689 | Ga0495613_0140080 | Ga0495613_0140080_278_931 | 201 |
| 1075 | 3300046809 | Ga0495600_0021213 | Ga0495600_0021213_1873_2517 | 201 |
| 1076 | 3300047317 | Ga0495604_0094973 | Ga0495604_0094973_1438_2082 | 201 |
| 1077 | 3300047319 | Ga0495674_0257790 | Ga0495674_0257790_256_900 | 201 |
| 1078 | 3300047471 | Ga0495684_0346688 | Ga0495684_0346688_99_743 | 201 |
| 1079 | 3300048088 | Ga0495602_0220245 | Ga0495602_0220245_678_1331 | 201 |
| 1080 | 3300050492 | nmdc:mga0yw44_234796_c1 | nmdc:mga0yw44_234796_c1_69_701 | 201 |
| 1081 | 3300050493 | nmdc:mga0k408_90160_c1 | nmdc:mga0k408_90160_c1_471_1103 | 201 |
| 1082 | 3300050507 | nmdc:mga05p37_436175_c1 | nmdc:mga05p37_436175_c1_394_1026 | 201 |
| 1083 | 3300050508 | nmdc:mga09592_571015_c1 | nmdc:mga09592_571015_c1_194_826 | 201 |
| 1084 | 3300050510 | nmdc:mga06r32_740491_c1 | nmdc:mga06r32_740491_c1_99_731 | 201 |
| 1085 | 3300053077 | Ga0495601_0076054 | Ga0495601_0076054_789_1433 | 201 |
| 1086 | 3300053077 | Ga0495601_0130067 | Ga0495601_0130067_309_953 | 201 |
| 1087 | 3300053078 | Ga0495612_0184169 | Ga0495612_0184169_256_900 | 201 |
| 1088 | 3300053084 | Ga0495595_0057306 | Ga0495595_0057306_930_1574 | 201 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5d92-assembly2.cif.gz_B | structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum | 0.7906 | 27 | 200 |
| 5d92-assembly2.cif.gz_C | structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum | 0.7895 | 27 | 200 |
| 6h5a-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in complex with manganese and citrate | 0.781 | 22 | 194 |
| 6h59-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) with cdp-dag bound | 0.7726 | 20 | 194 |
| 6wm5-assembly1.cif.gz_C | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii | 0.7701 | 20 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WPG7_9_203_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.7632 | 16 | 194 | 1.20.120.1760 |
| 5d92A02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.7417 | 14 | 200 | 1.20.120.1760 |
| 4o6mB02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.7388 | 19 | 195 | 1.20.120.1760 |
| af_P9WPG7_9_203_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.701 | 16 | 194 | 1.20.120.1760 |
| 5d92A02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.6907 | 14 | 200 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5HE60-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.9601 | 90 | 201 |
GO:0016020
|
| AF-A0A7C5HE60-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.9433 | 90 | 201 |
GO:0016020
|
| AF-A0A3C0TUQ1-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.935 | 82 | 200 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A1F8U2W0-F1-model_v4 | CDP-alcohol phosphatidyltransferase | 0.9028 | 77 | 200 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A3C0TUQ1-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.891 | 82 | 200 |
GO:0008654
GO:0016020 GO:0016780 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar