F489690
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1082 | 623 | 867 | 375 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100079332|Ga0068853_1000793322 |
| Length | 414 |
| Sequence | MPDARRERRRPPRACRACSPGPSGDGCAAPQGFDVTTPAADRPLRVLHAVRAPVGGIFRHILDLANGQADRGHEVGIIADSLTGGERANQALAEIAPRLKLGVHRIAIHREPWPTDALVWARFMHWIRRLKPDVLHGHGAKAGVFIRLRRRTHRAIRVYTPHGGSLHYPPSSAKGKFYSSLERALMNNTDLFLFESAFARDTYQRTIGTPKGLVRCVFNGVTAAEFDPVPRAADATDVVYVGEFRHIKGADLLVDAVARLRADGKPVTLTLAGDGEETAALKAQVARLSLANSVQFIGHVKARHGFSKGKLLVVPSRGDSMPYVVIEAGAAGIPMVAANVGGIPEIFGPFTDALFAPSNIGSAADAIKTAMAEPEAAQARAGEMRERILQHFSQKAMVDGVLAGYRDAFEAARR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 17 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 18 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 19 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 20 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 21 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 22 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 23 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 24 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 25 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 26 | 2791355199 | |||
| 27 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 28 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 29 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 30 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 31 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 32 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 33 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 34 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 35 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 36 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 37 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 38 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 39 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 40 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 41 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 42 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 43 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 44 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 45 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 46 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 47 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 48 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 49 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 50 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 51 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 52 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 53 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 54 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 55 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 56 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 57 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 58 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 59 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 60 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 61 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 62 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 63 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 64 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 65 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 66 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 67 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 68 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 69 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 70 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 71 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 72 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 73 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 74 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 75 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 76 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 77 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 78 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 79 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 80 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 81 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 82 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 83 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 84 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 85 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 86 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 87 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 88 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 89 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 90 | 2904699407 | |||
| 91 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 92 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 93 | 2906610324 | |||
| 94 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 95 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 96 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 97 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 98 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 99 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 100 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 101 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 102 | 2922368715 | |||
| 103 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 104 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 105 | 2922425934 | |||
| 106 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 107 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 108 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 109 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 110 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 111 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 112 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 113 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 114 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 115 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 116 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 117 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 118 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 119 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 120 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 121 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 122 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 123 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 124 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 125 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 126 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 127 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 128 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 129 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 130 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 131 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 132 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 133 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 134 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 135 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 136 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 137 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 138 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 139 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 140 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 141 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 142 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 143 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 144 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 145 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 146 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 147 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 148 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 149 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 150 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 151 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 152 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 153 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 154 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 155 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 156 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 157 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 158 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 159 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 160 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 161 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 162 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 163 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 164 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 165 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 166 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 167 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 168 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 169 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 170 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 171 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 172 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 173 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 174 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 175 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 176 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 177 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 178 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 179 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 180 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 181 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 182 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 183 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 184 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 185 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 186 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 187 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 189 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 190 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 191 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 199 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 201 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 202 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 207 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 209 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 210 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 211 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 212 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 215 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 216 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 217 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 218 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 219 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 220 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 221 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 222 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 223 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 224 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 225 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 226 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 227 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 228 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 229 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 230 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 231 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 232 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 234 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 235 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 236 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 237 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 238 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 239 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 240 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 241 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 242 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 243 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 245 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 246 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 248 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 249 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 250 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 251 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 252 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 263 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 275 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 276 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 277 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 278 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 279 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 280 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 282 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 287 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 289 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 290 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 291 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 340 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 341 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 342 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 343 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 347 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 348 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 349 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 350 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 351 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 352 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 353 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 354 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 355 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 356 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 357 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 358 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 359 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 360 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 361 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 362 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 363 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 364 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 365 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 366 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 367 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 368 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 369 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 370 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 371 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 372 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 373 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 374 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 375 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 376 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 377 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 378 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 379 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 380 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 381 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 382 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 383 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 384 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 385 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 386 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 387 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 388 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 389 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 390 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 391 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 392 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 393 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 394 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 395 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 396 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 397 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 398 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 399 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 400 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 401 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 402 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 403 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 478 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 479 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 480 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 481 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 482 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 483 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 484 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 485 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 486 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 487 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 488 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 489 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 490 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 491 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 492 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 493 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 494 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 495 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 496 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 497 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 498 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 499 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 500 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 501 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 508 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 522 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 523 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 524 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 525 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 526 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 527 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 528 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 529 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 530 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 531 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 532 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 533 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 534 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 535 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 536 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 537 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 538 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 539 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 540 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 541 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 544 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 545 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 548 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 549 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 550 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 551 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 552 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 553 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 554 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 555 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 556 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 557 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 558 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 559 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 560 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 561 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 562 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 563 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 564 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 565 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 566 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 567 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 568 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 569 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 570 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 571 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 572 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 573 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 574 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 575 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 576 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 577 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 578 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 579 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 580 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 581 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 582 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 583 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 584 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 585 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 586 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 587 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 588 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 589 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 590 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 591 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 592 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 593 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 594 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 595 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 596 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 597 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 598 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 599 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 600 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 601 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 602 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 603 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 604 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 605 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 606 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 607 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 608 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 609 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 610 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 611 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 612 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 613 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 614 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 615 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 616 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 617 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 618 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 619 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 620 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 621 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 622 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 623 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.5 |
| Metatranscriptomes | 0 |
| Isolates | 19.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.11 |
| Nodule | 15.99 |
| Rhizoplane | 4.16 |
| Rhizosphere | 57.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007113 | 3300001979 | Bacteria | 4576 |
| 2 | JGI24737J22298_10008019 | 3300001990 | Bacteria | 3548 |
| 3 | JGI25406J46586_10000006 | 3300003203 | Bacteria | 114937 |
| 4 | JGI25153J46596_10011119 | 3300003215 | Bacteria | 4005 |
| 5 | rootH2_10006936 | 3300003320 | Bacteria | 2542 |
| 6 | JGI25160J50197_1002805 | 3300003354 | Bacteria | 7979 |
| 7 | JGI25160J50197_1006702 | 3300003354 | Bacteria | 4626 |
| 8 | JGI25160J50197_1014046 | 3300003354 | Bacteria | 2697 |
| 9 | JGI25404J52841_10009757 | 3300003659 | Bacteria | 2058 |
| 10 | JGI25404J52841_10012436 | 3300003659 | Bacteria | 1843 |
| 11 | JGI25404J52841_10015760 | 3300003659 | Bacteria | 1639 |
| 12 | JGI25404J52841_10017024 | 3300003659 | Bacteria | 1576 |
| 13 | Ga0055531_10007030 | 3300003794 | Bacteria | 6229 |
| 14 | Ga0055531_10011902 | 3300003794 | Bacteria | 4142 |
| 15 | Ga0065165_1001864 | 3300005262 | Bacteria | 20463 |
| 16 | Ga0065165_1003443 | 3300005262 | Bacteria | 11124 |
| 17 | Ga0065165_1009002 | 3300005262 | Bacteria | 4559 |
| 18 | Ga0070683_100035409 | 3300005329 | Bacteria | 4564 |
| 19 | Ga0070683_100037262 | 3300005329 | Bacteria | 4451 |
| 20 | Ga0070683_100052002 | 3300005329 | Bacteria | 3794 |
| 21 | Ga0070666_10088394 | 3300005335 | Bacteria | 2126 |
| 22 | Ga0070680_100043913 | 3300005336 | Bacteria | 3631 |
| 23 | Ga0070680_100064157 | 3300005336 | Bacteria | 3010 |
| 24 | Ga0070680_100141650 | 3300005336 | Bacteria | 2017 |
| 25 | Ga0070680_100144976 | 3300005336 | Bacteria | 1992 |
| 26 | Ga0070682_100204629 | 3300005337 | Bacteria | 1395 |
| 27 | Ga0068868_100093972 | 3300005338 | Bacteria | 2418 |
| 28 | Ga0070660_100079663 | 3300005339 | Bacteria | 2570 |
| 29 | Ga0070660_100122875 | 3300005339 | Bacteria | 2072 |
| 30 | Ga0070661_100164901 | 3300005344 | Bacteria | 1680 |
| 31 | Ga0070668_100025503 | 3300005347 | Bacteria | 4482 |
| 32 | Ga0070669_100107871 | 3300005353 | Bacteria | 2110 |
| 33 | Ga0070671_100024002 | 3300005355 | Bacteria | 4990 |
| 34 | Ga0070659_100024129 | 3300005366 | Bacteria | 4661 |
| 35 | Ga0070659_100024651 | 3300005366 | Bacteria | 4614 |
| 36 | Ga0070659_100028527 | 3300005366 | Bacteria | 4312 |
| 37 | Ga0070667_100191133 | 3300005367 | Bacteria | 1814 |
| 38 | Ga0070709_10000337 | 3300005434 | Bacteria | 29157 |
| 39 | Ga0070709_10009552 | 3300005434 | Bacteria | 5354 |
| 40 | Ga0070714_100003394 | 3300005435 | Bacteria | 11871 |
| 41 | Ga0070714_100047712 | 3300005435 | Bacteria | 3640 |
| 42 | Ga0070714_100080180 | 3300005435 | Bacteria | 2840 |
| 43 | Ga0070713_100013337 | 3300005436 | Bacteria | 6066 |
| 44 | Ga0070713_100056049 | 3300005436 | Bacteria | 3278 |
| 45 | Ga0070710_10000508 | 3300005437 | Bacteria | 18304 |
| 46 | Ga0070710_10026057 | 3300005437 | Bacteria | 3103 |
| 47 | Ga0070711_100001466 | 3300005439 | Bacteria | 12962 |
| 48 | Ga0070711_100025668 | 3300005439 | Bacteria | 3857 |
| 49 | Ga0070711_100235686 | 3300005439 | Bacteria | 1429 |
| 50 | Ga0070663_100009242 | 3300005455 | Bacteria | 6096 |
| 51 | Ga0070663_100011245 | 3300005455 | Bacteria | 5611 |
| 52 | Ga0070663_100038211 | 3300005455 | Bacteria | 3347 |
| 53 | Ga0070663_100094371 | 3300005455 | Bacteria | 2222 |
| 54 | Ga0070678_100014206 | 3300005456 | Bacteria | 5016 |
| 55 | Ga0070662_100042412 | 3300005457 | Bacteria | 3250 |
| 56 | Ga0070662_100150677 | 3300005457 | Bacteria | 1810 |
| 57 | Ga0070681_10149181 | 3300005458 | Bacteria | 2266 |
| 58 | Ga0070681_10239330 | 3300005458 | Bacteria | 1729 |
| 59 | Ga0070681_10309054 | 3300005458 | Bacteria | 1490 |
| 60 | Ga0070699_100206232 | 3300005518 | Bacteria | 1749 |
| 61 | Ga0070679_100053634 | 3300005530 | Bacteria | 4013 |
| 62 | Ga0070679_100071810 | 3300005530 | Bacteria | 3453 |
| 63 | Ga0070684_100001878 | 3300005535 | Bacteria | 15380 |
| 64 | Ga0070697_100008498 | 3300005536 | Bacteria | 8014 |
| 65 | Ga0068853_100033886 | 3300005539 | Bacteria | 4333 |
| 66 | Ga0068853_100079332 | 3300005539 | Bacteria | 2871 |
| 67 | Ga0068853_100116264 | 3300005539 | Bacteria | 2381 |
| 68 | Ga0070672_100107871 | 3300005543 | Bacteria | 2267 |
| 69 | Ga0070665_100013576 | 3300005548 | Bacteria | 8194 |
| 70 | Ga0070665_100059878 | 3300005548 | Bacteria | 3817 |
| 71 | Ga0068855_100031483 | 3300005563 | Bacteria | 6334 |
| 72 | Ga0068855_100047028 | 3300005563 | Bacteria | 5099 |
| 73 | Ga0068855_100094063 | 3300005563 | Bacteria | 3456 |
| 74 | Ga0068855_100211125 | 3300005563 | Bacteria | 2181 |
| 75 | Ga0068855_100285752 | 3300005563 | Bacteria | 1830 |
| 76 | Ga0068857_100010572 | 3300005577 | Bacteria | 8024 |
| 77 | Ga0068857_100041731 | 3300005577 | Bacteria | 4068 |
| 78 | Ga0068857_100052056 | 3300005577 | Bacteria | 3633 |
| 79 | Ga0068857_100231378 | 3300005577 | Bacteria | 1690 |
| 80 | Ga0068854_100114444 | 3300005578 | Bacteria | 2039 |
| 81 | Ga0068854_100115076 | 3300005578 | Bacteria | 2034 |
| 82 | Ga0068856_100001022 | 3300005614 | Bacteria | 29775 |
| 83 | Ga0068856_100055877 | 3300005614 | Bacteria | 3895 |
| 84 | Ga0068856_100079971 | 3300005614 | Bacteria | 3242 |
| 85 | Ga0068856_100092247 | 3300005614 | Bacteria | 3013 |
| 86 | Ga0068856_100239351 | 3300005614 | Bacteria | 1830 |
| 87 | Ga0068852_100007822 | 3300005616 | Bacteria | 7826 |
| 88 | Ga0068852_100008036 | 3300005616 | Bacteria | 7739 |
| 89 | Ga0068852_100158279 | 3300005616 | Bacteria | 2112 |
| 90 | Ga0068859_100223355 | 3300005617 | Bacteria | 1971 |
| 91 | Ga0068864_100046992 | 3300005618 | Bacteria | 3705 |
| 92 | Ga0068861_100011588 | 3300005719 | Bacteria | 6134 |
| 93 | Ga0068851_10052697 | 3300005834 | Bacteria | 2069 |
| 94 | Ga0068870_10147937 | 3300005840 | Bacteria | 1381 |
| 95 | Ga0068863_100108446 | 3300005841 | Bacteria | 2642 |
| 96 | Ga0068858_100143074 | 3300005842 | Bacteria | 2246 |
| 97 | Ga0068860_100000058 | 3300005843 | Bacteria | 197181 |
| 98 | Ga0068862_100125218 | 3300005844 | Bacteria | 2268 |
| 99 | Ga0081455_10001781 | 3300005937 | Bacteria | 26018 |
| 100 | Ga0081455_10006971 | 3300005937 | Bacteria | 12007 |
| 101 | Ga0081455_10008715 | 3300005937 | Bacteria | 10503 |
| 102 | Ga0081455_10011757 | 3300005937 | Bacteria | 8767 |
| 103 | Ga0081455_10065025 | 3300005937 | Bacteria | 3052 |
| 104 | Ga0081455_10067399 | 3300005937 | Bacteria | 2983 |
| 105 | Ga0081538_10020550 | 3300005981 | Bacteria | 4851 |
| 106 | Ga0081540_1001631 | 3300005983 | Bacteria | 19125 |
| 107 | Ga0081540_1004255 | 3300005983 | Bacteria | 10988 |
| 108 | Ga0081540_1004483 | 3300005983 | Bacteria | 10622 |
| 109 | Ga0081540_1024868 | 3300005983 | Bacteria | 3463 |
| 110 | Ga0081540_1028613 | 3300005983 | Bacteria | 3125 |
| 111 | Ga0081540_1036032 | 3300005983 | Bacteria | 2645 |
| 112 | Ga0081540_1048679 | 3300005983 | Bacteria | 2121 |
| 113 | Ga0081540_1049510 | 3300005983 | Bacteria | 2095 |
| 114 | Ga0081539_10000176 | 3300005985 | Bacteria | 150292 |
| 115 | Ga0081539_10000250 | 3300005985 | Bacteria | 125352 |
| 116 | Ga0081539_10073326 | 3300005985 | Bacteria | 1826 |
| 117 | Ga0070717_10001774 | 3300006028 | Bacteria | 15044 |
| 118 | Ga0070717_10076501 | 3300006028 | Bacteria | 2802 |
| 119 | Ga0070717_10177685 | 3300006028 | Bacteria | 1854 |
| 120 | Ga0075365_10000419 | 3300006038 | Bacteria | 15674 |
| 121 | Ga0075365_10062063 | 3300006038 | Bacteria | 2498 |
| 122 | Ga0075365_10068011 | 3300006038 | Bacteria | 2393 |
| 123 | Ga0075365_10075902 | 3300006038 | Bacteria | 2269 |
| 124 | Ga0075365_10163445 | 3300006038 | Bacteria | 1552 |
| 125 | Ga0075368_10032088 | 3300006042 | Bacteria | 2039 |
| 126 | Ga0075363_100011206 | 3300006048 | Bacteria | 4287 |
| 127 | Ga0075363_100014293 | 3300006048 | Bacteria | 3873 |
| 128 | Ga0075363_100022463 | 3300006048 | Bacteria | 3189 |
| 129 | Ga0075363_100069143 | 3300006048 | Bacteria | 1915 |
| 130 | Ga0075364_10024554 | 3300006051 | Bacteria | 3829 |
| 131 | Ga0075364_10036661 | 3300006051 | Bacteria | 3171 |
| 132 | Ga0070715_10015563 | 3300006163 | Bacteria | 2841 |
| 133 | Ga0070716_100043115 | 3300006173 | Bacteria | 2521 |
| 134 | Ga0070712_100028701 | 3300006175 | Bacteria | 3724 |
| 135 | Ga0070712_100054173 | 3300006175 | Bacteria | 2803 |
| 136 | Ga0075367_10001505 | 3300006178 | Bacteria | 10071 |
| 137 | Ga0075367_10017943 | 3300006178 | Bacteria | 3895 |
| 138 | Ga0075369_10015474 | 3300006186 | Bacteria | 3062 |
| 139 | Ga0075366_10023941 | 3300006195 | Bacteria | 3558 |
| 140 | Ga0097621_100130695 | 3300006237 | Bacteria | 2137 |
| 141 | Ga0075434_100224791 | 3300006871 | Bacteria | 1897 |
| 142 | Ga0068865_100063969 | 3300006881 | Bacteria | 2587 |
| 143 | Ga0068865_100076320 | 3300006881 | Bacteria | 2392 |
| 144 | Ga0097620_100223355 | 3300006931 | Bacteria | 1971 |
| 145 | Ga0099825_1030643 | 3300006941 | Bacteria | 2360 |
| 146 | Ga0099824_1004496 | 3300006942 | Bacteria | 20072 |
| 147 | Ga0099822_1012804 | 3300006943 | Bacteria | 9955 |
| 148 | Ga0099823_1037031 | 3300006944 | Bacteria | 3712 |
| 149 | Ga0099794_10030328 | 3300007265 | Bacteria | 2525 |
| 150 | Ga0099794_10032336 | 3300007265 | Bacteria | 2455 |
| 151 | Ga0105240_10002351 | 3300009093 | Bacteria | 30510 |
| 152 | Ga0105240_10043962 | 3300009093 | Bacteria | 5680 |
| 153 | Ga0105240_10077533 | 3300009093 | Bacteria | 4094 |
| 154 | Ga0105240_10214043 | 3300009093 | Bacteria | 2249 |
| 155 | Ga0111539_10163205 | 3300009094 | Bacteria | 2606 |
| 156 | Ga0105245_10057229 | 3300009098 | Bacteria | 3506 |
| 157 | Ga0105245_10064176 | 3300009098 | Bacteria | 3319 |
| 158 | Ga0105245_10118193 | 3300009098 | Bacteria | 2474 |
| 159 | Ga0105247_10070021 | 3300009101 | Bacteria | 2191 |
| 160 | Ga0105247_10197107 | 3300009101 | Bacteria | 1351 |
| 161 | Ga0105243_10054594 | 3300009148 | Bacteria | 3172 |
| 162 | Ga0105243_10229789 | 3300009148 | Bacteria | 1645 |
| 163 | Ga0105241_10022028 | 3300009174 | Bacteria | 4716 |
| 164 | Ga0105241_10093600 | 3300009174 | Bacteria | 2375 |
| 165 | Ga0105248_10044529 | 3300009177 | Bacteria | 4977 |
| 166 | Ga0105248_10063999 | 3300009177 | Bacteria | 4129 |
| 167 | Ga0105237_10009523 | 3300009545 | Bacteria | 10402 |
| 168 | Ga0105237_10028844 | 3300009545 | Bacteria | 5647 |
| 169 | Ga0105237_10029668 | 3300009545 | Bacteria | 5557 |
| 170 | Ga0105237_10035284 | 3300009545 | Bacteria | 5060 |
| 171 | Ga0105237_10043296 | 3300009545 | Bacteria | 4535 |
| 172 | Ga0105237_10050719 | 3300009545 | Bacteria | 4169 |
| 173 | Ga0105237_10107223 | 3300009545 | Bacteria | 2785 |
| 174 | Ga0105237_10130880 | 3300009545 | Bacteria | 2503 |
| 175 | Ga0105237_10219618 | 3300009545 | Bacteria | 1901 |
| 176 | Ga0105237_10289200 | 3300009545 | Bacteria | 1642 |
| 177 | Ga0105237_10301032 | 3300009545 | Bacteria | 1607 |
| 178 | Ga0105238_10014756 | 3300009551 | Bacteria | 7902 |
| 179 | Ga0105238_10022350 | 3300009551 | Bacteria | 6448 |
| 180 | Ga0105238_10041533 | 3300009551 | Bacteria | 4657 |
| 181 | Ga0105238_10115534 | 3300009551 | Bacteria | 2663 |
| 182 | Ga0105238_10251576 | 3300009551 | Bacteria | 1745 |
| 183 | Ga0105238_10438701 | 3300009551 | Bacteria | 1302 |
| 184 | Ga0105249_10122999 | 3300009553 | Bacteria | 2468 |
| 185 | Ga0099796_10005576 | 3300010159 | Bacteria | 3149 |
| 186 | Ga0105239_10036223 | 3300010375 | Bacteria | 5418 |
| 187 | Ga0105239_10115649 | 3300010375 | Bacteria | 2976 |
| 188 | Ga0105239_10214348 | 3300010375 | Bacteria | 2158 |
| 189 | Ga0105239_10333750 | 3300010375 | Bacteria | 1711 |
| 190 | Ga0105239_10382535 | 3300010375 | Bacteria | 1591 |
| 191 | Ga0157370_10087962 | 3300013104 | Bacteria | 2918 |
| 192 | Ga0157370_10095364 | 3300013104 | Bacteria | 2791 |
| 193 | Ga0157369_10486335 | 3300013105 | Bacteria | 1277 |
| 194 | Ga0157374_10028873 | 3300013296 | Bacteria | 5014 |
| 195 | Ga0157378_10003751 | 3300013297 | Bacteria | 13465 |
| 196 | Ga0157378_10080822 | 3300013297 | Bacteria | 2937 |
| 197 | Ga0157378_10087404 | 3300013297 | Bacteria | 2828 |
| 198 | Ga0163162_10118191 | 3300013306 | Bacteria | 2753 |
| 199 | Ga0157372_10052487 | 3300013307 | Bacteria | 4540 |
| 200 | Ga0157372_10130464 | 3300013307 | Bacteria | 2892 |
| 201 | Ga0157375_10013452 | 3300013308 | Bacteria | 7283 |
| 202 | Ga0157375_10068523 | 3300013308 | Bacteria | 3550 |
| 203 | Ga0157375_10572742 | 3300013308 | Bacteria | 1290 |
| 204 | Ga0163163_10008664 | 3300014325 | Bacteria | 9046 |
| 205 | Ga0163163_10094697 | 3300014325 | Bacteria | 3005 |
| 206 | Ga0157379_10139071 | 3300014968 | Bacteria | 2189 |
| 207 | Ga0157379_10163945 | 3300014968 | Bacteria | 2006 |
| 208 | Ga0157376_10014470 | 3300014969 | Bacteria | 5924 |
| 209 | Ga0157376_10286641 | 3300014969 | Bacteria | 1553 |
| 210 | Ga0214544_1000009 | 3300021320 | Bacteria | 285865 |
| 211 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 212 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 213 | Ga0214543_1000013 | 3300021327 | Bacteria | 329117 |
| 214 | Ga0213876_10010209 | 3300021384 | Bacteria | 5044 |
| 215 | Ga0213876_10061558 | 3300021384 | Bacteria | 1980 |
| 216 | Ga0213871_10009469 | 3300021441 | Bacteria | 2183 |
| 217 | Ga0209563_102229 | 3300025230 | Bacteria | 4492 |
| 218 | Ga0207425_1014717 | 3300025245 | Bacteria | 1772 |
| 219 | Ga0209677_102751 | 3300025253 | Bacteria | 6285 |
| 220 | Ga0209148_1000446 | 3300025254 | Bacteria | 45354 |
| 221 | Ga0209148_1009728 | 3300025254 | Bacteria | 1855 |
| 222 | Ga0209233_1006768 | 3300025261 | Bacteria | 3669 |
| 223 | Ga0209233_1009455 | 3300025261 | Bacteria | 2965 |
| 224 | Ga0209233_1014977 | 3300025261 | Bacteria | 2172 |
| 225 | Ga0209455_1001699 | 3300025272 | Bacteria | 9434 |
| 226 | Ga0209455_1003608 | 3300025272 | Bacteria | 5389 |
| 227 | Ga0209455_1008571 | 3300025272 | Bacteria | 2766 |
| 228 | Ga0209564_1003387 | 3300025295 | Bacteria | 10992 |
| 229 | Ga0209564_1007161 | 3300025295 | Bacteria | 5815 |
| 230 | Ga0209758_1000100 | 3300025297 | Bacteria | 227948 |
| 231 | Ga0209758_1001008 | 3300025297 | Bacteria | 37348 |
| 232 | Ga0209758_1001125 | 3300025297 | Bacteria | 34352 |
| 233 | Ga0209758_1002793 | 3300025297 | Bacteria | 17073 |
| 234 | Ga0209758_1003783 | 3300025297 | Bacteria | 13341 |
| 235 | Ga0209758_1005742 | 3300025297 | Bacteria | 9346 |
| 236 | Ga0209758_1007434 | 3300025297 | Bacteria | 7453 |
| 237 | Ga0209758_1015490 | 3300025297 | Bacteria | 3941 |
| 238 | Ga0209758_1018121 | 3300025297 | Bacteria | 3468 |
| 239 | Ga0209758_1035384 | 3300025297 | Bacteria | 1969 |
| 240 | Ga0209256_1011371 | 3300025299 | Bacteria | 3570 |
| 241 | Ga0207426_1001094 | 3300025302 | Bacteria | 25012 |
| 242 | Ga0207426_1002241 | 3300025302 | Bacteria | 12874 |
| 243 | Ga0207426_1011700 | 3300025302 | Bacteria | 3328 |
| 244 | Ga0209257_1006404 | 3300025304 | Bacteria | 7602 |
| 245 | Ga0209257_1020976 | 3300025304 | Bacteria | 2391 |
| 246 | Ga0207656_10011134 | 3300025321 | Bacteria | 3390 |
| 247 | Ga0207692_10001906 | 3300025898 | Bacteria | 7932 |
| 248 | Ga0207642_10059548 | 3300025899 | Bacteria | 1767 |
| 249 | Ga0207710_10005054 | 3300025900 | Bacteria | 5716 |
| 250 | Ga0207710_10005124 | 3300025900 | Bacteria | 5670 |
| 251 | Ga0207710_10049181 | 3300025900 | Bacteria | 1888 |
| 252 | Ga0207710_10074065 | 3300025900 | Bacteria | 1567 |
| 253 | Ga0207680_10034129 | 3300025903 | Bacteria | 2909 |
| 254 | Ga0207680_10089723 | 3300025903 | Bacteria | 1952 |
| 255 | Ga0207647_10035221 | 3300025904 | Bacteria | 3191 |
| 256 | Ga0207685_10016774 | 3300025905 | Bacteria | 2351 |
| 257 | Ga0207685_10041048 | 3300025905 | Bacteria | 1729 |
| 258 | Ga0207699_10000604 | 3300025906 | Bacteria | 17559 |
| 259 | Ga0207699_10016956 | 3300025906 | Bacteria | 3822 |
| 260 | Ga0207699_10113213 | 3300025906 | Bacteria | 1743 |
| 261 | Ga0207643_10162052 | 3300025908 | Bacteria | 1346 |
| 262 | Ga0207705_10258940 | 3300025909 | Bacteria | 1328 |
| 263 | Ga0207654_10012282 | 3300025911 | Bacteria | 4386 |
| 264 | Ga0207654_10036806 | 3300025911 | Bacteria | 2737 |
| 265 | Ga0207707_10216760 | 3300025912 | Bacteria | 1666 |
| 266 | Ga0207707_10290578 | 3300025912 | Bacteria | 1414 |
| 267 | Ga0207695_10000278 | 3300025913 | Bacteria | 127446 |
| 268 | Ga0207695_10001915 | 3300025913 | Bacteria | 32381 |
| 269 | Ga0207695_10155696 | 3300025913 | Bacteria | 2220 |
| 270 | Ga0207671_10008450 | 3300025914 | Bacteria | 8728 |
| 271 | Ga0207671_10011711 | 3300025914 | Bacteria | 7106 |
| 272 | Ga0207671_10018832 | 3300025914 | Bacteria | 5290 |
| 273 | Ga0207671_10060489 | 3300025914 | Bacteria | 2810 |
| 274 | Ga0207671_10105087 | 3300025914 | Bacteria | 2142 |
| 275 | Ga0207671_10131680 | 3300025914 | Bacteria | 1920 |
| 276 | Ga0207671_10298658 | 3300025914 | Bacteria | 1272 |
| 277 | Ga0207693_10003576 | 3300025915 | Bacteria | 13283 |
| 278 | Ga0207693_10026628 | 3300025915 | Bacteria | 4575 |
| 279 | Ga0207663_10004391 | 3300025916 | Bacteria | 7001 |
| 280 | Ga0207660_10013547 | 3300025917 | Bacteria | 5345 |
| 281 | Ga0207660_10131566 | 3300025917 | Bacteria | 1905 |
| 282 | Ga0207660_10173059 | 3300025917 | Bacteria | 1672 |
| 283 | Ga0207660_10203759 | 3300025917 | Bacteria | 1546 |
| 284 | Ga0207657_10002222 | 3300025919 | Bacteria | 21059 |
| 285 | Ga0207657_10011901 | 3300025919 | Bacteria | 8609 |
| 286 | Ga0207657_10155555 | 3300025919 | Bacteria | 1859 |
| 287 | Ga0207657_10208983 | 3300025919 | Bacteria | 1567 |
| 288 | Ga0207649_10148353 | 3300025920 | Bacteria | 1612 |
| 289 | Ga0207652_10108241 | 3300025921 | Bacteria | 2463 |
| 290 | Ga0207652_10126019 | 3300025921 | Bacteria | 2281 |
| 291 | Ga0207694_10001639 | 3300025924 | Bacteria | 18837 |
| 292 | Ga0207694_10120189 | 3300025924 | Bacteria | 2097 |
| 293 | Ga0207694_10327293 | 3300025924 | Bacteria | 1265 |
| 294 | Ga0207687_10089800 | 3300025927 | Bacteria | 2238 |
| 295 | Ga0207687_10121518 | 3300025927 | Bacteria | 1954 |
| 296 | Ga0207687_10146994 | 3300025927 | Bacteria | 1794 |
| 297 | Ga0207700_10000752 | 3300025928 | Bacteria | 18675 |
| 298 | Ga0207700_10024997 | 3300025928 | Bacteria | 4141 |
| 299 | Ga0207700_10083339 | 3300025928 | Bacteria | 2503 |
| 300 | Ga0207700_10173309 | 3300025928 | Bacteria | 1801 |
| 301 | Ga0207664_10006080 | 3300025929 | Bacteria | 8268 |
| 302 | Ga0207664_10040726 | 3300025929 | Bacteria | 3615 |
| 303 | Ga0207664_10071396 | 3300025929 | Bacteria | 2797 |
| 304 | Ga0207690_10193582 | 3300025932 | Bacteria | 1539 |
| 305 | Ga0207706_10017328 | 3300025933 | Bacteria | 6489 |
| 306 | Ga0207706_10043872 | 3300025933 | Bacteria | 3963 |
| 307 | Ga0207706_10100152 | 3300025933 | Bacteria | 2549 |
| 308 | Ga0207709_10059282 | 3300025935 | Bacteria | 2382 |
| 309 | Ga0207669_10112264 | 3300025937 | Bacteria | 1829 |
| 310 | Ga0207704_10042852 | 3300025938 | Bacteria | 2668 |
| 311 | Ga0207704_10087262 | 3300025938 | Bacteria | 2037 |
| 312 | Ga0207665_10001395 | 3300025939 | Bacteria | 16252 |
| 313 | Ga0207665_10046251 | 3300025939 | Bacteria | 2916 |
| 314 | Ga0207665_10116154 | 3300025939 | Bacteria | 1886 |
| 315 | Ga0207691_10030847 | 3300025940 | Bacteria | 5007 |
| 316 | Ga0207711_10276917 | 3300025941 | Bacteria | 1544 |
| 317 | Ga0207711_10342177 | 3300025941 | Bacteria | 1384 |
| 318 | Ga0207689_10048731 | 3300025942 | Bacteria | 3495 |
| 319 | Ga0207661_10001198 | 3300025944 | Bacteria | 17338 |
| 320 | Ga0207661_10250092 | 3300025944 | Bacteria | 1575 |
| 321 | Ga0207667_10003512 | 3300025949 | Bacteria | 19383 |
| 322 | Ga0207667_10045424 | 3300025949 | Bacteria | 4652 |
| 323 | Ga0207667_10065888 | 3300025949 | Bacteria | 3777 |
| 324 | Ga0207667_10081109 | 3300025949 | Bacteria | 3361 |
| 325 | Ga0207667_10086339 | 3300025949 | Bacteria | 3247 |
| 326 | Ga0207667_10411163 | 3300025949 | Bacteria | 1377 |
| 327 | Ga0207712_10106695 | 3300025961 | Bacteria | 2093 |
| 328 | Ga0207668_10066692 | 3300025972 | Bacteria | 2552 |
| 329 | Ga0207640_10022747 | 3300025981 | Bacteria | 3757 |
| 330 | Ga0207677_10105345 | 3300026023 | Bacteria | 2086 |
| 331 | Ga0207703_10110533 | 3300026035 | Bacteria | 2345 |
| 332 | Ga0207703_10131305 | 3300026035 | Bacteria | 2163 |
| 333 | Ga0207678_10018848 | 3300026067 | Bacteria | 6061 |
| 334 | Ga0207678_10069106 | 3300026067 | Bacteria | 3029 |
| 335 | Ga0207678_10132976 | 3300026067 | Bacteria | 2122 |
| 336 | Ga0207678_10178823 | 3300026067 | Bacteria | 1811 |
| 337 | Ga0207678_10315419 | 3300026067 | Bacteria | 1344 |
| 338 | Ga0207708_10026957 | 3300026075 | Bacteria | 4351 |
| 339 | Ga0207708_10044185 | 3300026075 | Bacteria | 3395 |
| 340 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 341 | Ga0207702_10014864 | 3300026078 | Bacteria | 6458 |
| 342 | Ga0207702_10062730 | 3300026078 | Bacteria | 3175 |
| 343 | Ga0207702_10126772 | 3300026078 | Bacteria | 2293 |
| 344 | Ga0207702_10140013 | 3300026078 | Bacteria | 2188 |
| 345 | Ga0207676_10075385 | 3300026095 | Bacteria | 2721 |
| 346 | Ga0207674_10016313 | 3300026116 | Bacteria | 8136 |
| 347 | Ga0207674_10044955 | 3300026116 | Bacteria | 4547 |
| 348 | Ga0207674_10068286 | 3300026116 | Bacteria | 3577 |
| 349 | Ga0207674_10434347 | 3300026116 | Bacteria | 1269 |
| 350 | Ga0207674_10450939 | 3300026116 | Bacteria | 1243 |
| 351 | Ga0207675_100160034 | 3300026118 | Bacteria | 2147 |
| 352 | Ga0207675_100212226 | 3300026118 | Bacteria | 1862 |
| 353 | Ga0207683_10052738 | 3300026121 | Bacteria | 3564 |
| 354 | Ga0207683_10056139 | 3300026121 | Bacteria | 3454 |
| 355 | Ga0207698_10017856 | 3300026142 | Bacteria | 4822 |
| 356 | Ga0207698_10030256 | 3300026142 | Bacteria | 3890 |
| 357 | Ga0207698_10041494 | 3300026142 | Bacteria | 3429 |
| 358 | Ga0207698_10048796 | 3300026142 | Bacteria | 3217 |
| 359 | Ga0209389_1000084 | 3300027296 | Bacteria | 85267 |
| 360 | Ga0209389_1000113 | 3300027296 | Bacteria | 72242 |
| 361 | Ga0209589_1000023 | 3300027357 | Bacteria | 177856 |
| 362 | Ga0209589_1000041 | 3300027357 | Bacteria | 125191 |
| 363 | Ga0209489_100032 | 3300027361 | Bacteria | 177856 |
| 364 | Ga0209489_100070 | 3300027361 | Bacteria | 138580 |
| 365 | Ga0209489_107143 | 3300027361 | Bacteria | 17020 |
| 366 | Ga0209700_100021 | 3300027363 | Bacteria | 230859 |
| 367 | Ga0209700_100040 | 3300027363 | Bacteria | 177856 |
| 368 | Ga0268266_10003050 | 3300028379 | Bacteria | 17142 |
| 369 | Ga0268266_10012507 | 3300028379 | Bacteria | 7335 |
| 370 | Ga0268266_10017618 | 3300028379 | Bacteria | 6091 |
| 371 | Ga0268266_10386438 | 3300028379 | Bacteria | 1321 |
| 372 | Ga0268265_10106090 | 3300028380 | Bacteria | 2281 |
| 373 | Ga0268264_10000022 | 3300028381 | Bacteria | 476624 |
| 374 | Ga0268264_10059682 | 3300028381 | Bacteria | 3196 |
| 375 | Ga0268264_10254651 | 3300028381 | Bacteria | 1632 |
| 376 | Ga0265337_1004278 | 3300028556 | Bacteria | 5955 |
| 377 | Ga0265326_10022991 | 3300028558 | Bacteria | 1783 |
| 378 | Ga0307517_10004643 | 3300028786 | Bacteria | 21044 |
| 379 | Ga0307515_10013142 | 3300028794 | Bacteria | 15495 |
| 380 | Ga0265324_10003894 | 3300029957 | Bacteria | 6954 |
| 381 | Ga0265330_10023016 | 3300031235 | Bacteria | 2831 |
| 382 | Ga0265332_10053903 | 3300031238 | Bacteria | 1725 |
| 383 | Ga0265325_10032658 | 3300031241 | Bacteria | 2777 |
| 384 | Ga0265340_10011316 | 3300031247 | Bacteria | 4745 |
| 385 | Ga0265340_10047250 | 3300031247 | Bacteria | 2097 |
| 386 | Ga0265339_10007490 | 3300031249 | Bacteria | 7047 |
| 387 | Ga0265316_10072256 | 3300031344 | Bacteria | 2658 |
| 388 | Ga0307509_10008409 | 3300031507 | Bacteria | 13174 |
| 389 | Ga0265313_10030588 | 3300031595 | Bacteria | 2770 |
| 390 | Ga0307508_10000038 | 3300031616 | Bacteria | 150186 |
| 391 | Ga0265314_10000937 | 3300031711 | Bacteria | 34281 |
| 392 | Ga0265314_10003315 | 3300031711 | Bacteria | 15703 |
| 393 | Ga0265314_10016661 | 3300031711 | Bacteria | 5795 |
| 394 | Ga0265314_10142735 | 3300031711 | Bacteria | 1478 |
| 395 | Ga0265342_10012895 | 3300031712 | Bacteria | 5637 |
| 396 | Ga0265342_10054311 | 3300031712 | Bacteria | 2380 |
| 397 | Ga0307516_10008870 | 3300031730 | Bacteria | 11292 |
| 398 | Ga0307516_10048871 | 3300031730 | Bacteria | 4161 |
| 399 | Ga0307516_10108446 | 3300031730 | Bacteria | 2583 |
| 400 | Ga0307516_10148099 | 3300031730 | Bacteria | 2111 |
| 401 | Ga0307413_10033046 | 3300031824 | Bacteria | 2940 |
| 402 | Ga0307409_100059109 | 3300031995 | Bacteria | 2981 |
| 403 | Ga0307415_100039397 | 3300032126 | Bacteria | 3123 |
| 404 | Ga0307510_10043585 | 3300033180 | Bacteria | 4875 |
| 405 | Ga0307510_10045521 | 3300033180 | Bacteria | 4735 |
| 406 | Ga0307510_10056016 | 3300033180 | Bacteria | 4111 |
| 407 | Ga0373950_0019305 | 3300034818 | Bacteria | 1189 |
| 408 | Ga0373936_0025159 | 3300035113 | Bacteria | 2326 |
| 409 | Ga0373945_0046245 | 3300035116 | Bacteria | 1587 |
| 410 | Ga0373956_0003375 | 3300035119 | Bacteria | 6431 |
| 411 | Ga0373957_0000100 | 3300035120 | Bacteria | 20828 |
| 412 | Ga0373943_0037456 | 3300035170 | Bacteria | 2328 |
| 413 | Ga0373946_0001312 | 3300035171 | Bacteria | 8599 |
| 414 | Ga0373955_0030199 | 3300035172 | Bacteria | 2826 |
| 415 | Ga0373924_0004454 | 3300035410 | Bacteria | 4894 |
| 416 | Ga0373935_0001438 | 3300035692 | Bacteria | 13198 |
| 417 | Ga0373927_0000225 | 3300035695 | Bacteria | 44840 |
| 418 | Ga0373927_0010994 | 3300035695 | Bacteria | 6028 |
| 419 | Ga0373927_0013017 | 3300035695 | Bacteria | 5533 |
| 420 | Ga0373927_0014783 | 3300035695 | Bacteria | 5161 |
| 421 | Ga0373933_0094015 | 3300035724 | Bacteria | 1853 |
| 422 | Ga0373933_0157716 | 3300035724 | Bacteria | 1440 |
| 423 | Ga0373933_0206285 | 3300035724 | Bacteria | 1258 |
| 424 | Ga0373947_0002889 | 3300035725 | Bacteria | 10257 |
| 425 | Ga0373937_0068873 | 3300036401 | Bacteria | 3262 |
| 426 | Ga0373925_0000711 | 3300037068 | Bacteria | 31078 |
| 427 | Ga0373925_0008511 | 3300037068 | Bacteria | 7477 |
| 428 | Ga0373925_0112522 | 3300037068 | Bacteria | 2105 |
| 429 | Ga0373925_0241309 | 3300037068 | Bacteria | 1447 |
| 430 | Ga0395899_0091019 | 3300037312 | Bacteria | 2211 |
| 431 | Ga0395900_0000860 | 3300037418 | Bacteria | 40028 |
| 432 | Ga0395898_0011543 | 3300037466 | Bacteria | 9176 |
| 433 | Ga0395898_0053862 | 3300037466 | Bacteria | 3928 |
| 434 | Ga0395905_0021990 | 3300037471 | Bacteria | 6033 |
| 435 | Ga0395905_0040874 | 3300037471 | Bacteria | 4350 |
| 436 | Ga0436364_1474553 | 3300037853 | Bacteria | 2070 |
| 437 | Ga0395901_0277399 | 3300038443 | Bacteria | 1742 |
| 438 | Ga0395901_0321556 | 3300038443 | Bacteria | 1601 |
| 439 | Ga0436365_0978478 | 3300039437 | Bacteria | 1881 |
| 440 | Ga0436365_1727745 | 3300039437 | Bacteria | 22987 |
| 441 | Ga0436360_0509368 | 3300039438 | Bacteria | 3790 |
| 442 | Ga0436363_1276889 | 3300039450 | Bacteria | 2712 |
| 443 | Ga0436362_1050878 | 3300039453 | Bacteria | 4244 |
| 444 | Ga0451841_0656306 | 3300041498 | Bacteria | 1919 |
| 445 | Ga0451853_2103515 | 3300041512 | Bacteria | 2022 |
| 446 | Ga0466972_0000660 | 3300044658 | Bacteria | 16624 |
| 447 | Ga0466965_0017918 | 3300044683 | Bacteria | 3387 |
| 448 | Ga0466966_0059106 | 3300044684 | Bacteria | 2421 |
| 449 | Ga0466961_0000488 | 3300044693 | Bacteria | 25223 |
| 450 | Ga0466963_0210833 | 3300044694 | Bacteria | 1359 |
| 451 | Ga0466968_0050276 | 3300044735 | Bacteria | 1778 |
| 452 | Ga0466957_0072150 | 3300044842 | Bacteria | 2137 |
| 453 | Ga0466959_0001793 | 3300045049 | Bacteria | 13423 |
| 454 | Ga0466959_0093609 | 3300045049 | Bacteria | 2156 |
| 455 | Ga0466959_0132905 | 3300045049 | Bacteria | 1763 |
| 456 | Ga0466959_0143044 | 3300045049 | Bacteria | 1689 |
| 457 | Ga0466967_0047594 | 3300045976 | Bacteria | 3739 |
| 458 | Ga0466967_0089021 | 3300045976 | Bacteria | 2802 |
| 459 | Ga0495592_0066499 | 3300046454 | Bacteria | 2637 |
| 460 | Ga0495592_0146137 | 3300046454 | Bacteria | 1639 |
| 461 | Ga0495603_0000960 | 3300046455 | Bacteria | 16606 |
| 462 | Ga0495603_0007153 | 3300046455 | Bacteria | 6702 |
| 463 | Ga0495603_0012975 | 3300046455 | Bacteria | 5037 |
| 464 | Ga0495603_0033100 | 3300046455 | Bacteria | 3110 |
| 465 | Ga0495590_0005096 | 3300046457 | Bacteria | 5239 |
| 466 | Ga0495629_0000179 | 3300046459 | Bacteria | 56885 |
| 467 | Ga0495629_0049950 | 3300046459 | Bacteria | 2931 |
| 468 | Ga0495638_0021546 | 3300046460 | Bacteria | 4244 |
| 469 | Ga0495638_0027548 | 3300046460 | Bacteria | 3677 |
| 470 | Ga0495641_0004740 | 3300046461 | Bacteria | 9474 |
| 471 | Ga0495651_0005780 | 3300046462 | Bacteria | 9439 |
| 472 | Ga0495651_0040742 | 3300046462 | Bacteria | 3610 |
| 473 | Ga0495653_0000905 | 3300046463 | Bacteria | 22949 |
| 474 | Ga0495653_0228077 | 3300046463 | Bacteria | 1248 |
| 475 | Ga0495653_0230588 | 3300046463 | Bacteria | 1239 |
| 476 | Ga0495650_0051198 | 3300046471 | Bacteria | 1703 |
| 477 | Ga0495580_0000280 | 3300046472 | Bacteria | 41385 |
| 478 | Ga0495580_0142639 | 3300046472 | Bacteria | 1660 |
| 479 | Ga0495582_0000061 | 3300046473 | Bacteria | 55522 |
| 480 | Ga0495582_0142529 | 3300046473 | Bacteria | 1359 |
| 481 | Ga0495605_0034250 | 3300046474 | Bacteria | 2572 |
| 482 | Ga0495605_0081593 | 3300046474 | Bacteria | 1512 |
| 483 | Ga0495639_0000102 | 3300046475 | Bacteria | 42249 |
| 484 | Ga0495662_0000746 | 3300046476 | Bacteria | 15602 |
| 485 | Ga0495664_0002105 | 3300046477 | Bacteria | 10644 |
| 486 | Ga0495664_0033559 | 3300046477 | Bacteria | 3016 |
| 487 | Ga0495584_0006929 | 3300046491 | Bacteria | 5923 |
| 488 | Ga0495585_0010422 | 3300046492 | Bacteria | 5533 |
| 489 | Ga0495585_0054163 | 3300046492 | Bacteria | 2218 |
| 490 | Ga0495594_0000378 | 3300046499 | Bacteria | 22340 |
| 491 | Ga0495594_0030178 | 3300046499 | Bacteria | 2932 |
| 492 | Ga0495606_0016261 | 3300046507 | Bacteria | 5681 |
| 493 | Ga0495606_0020685 | 3300046507 | Bacteria | 4843 |
| 494 | Ga0495606_0164223 | 3300046507 | Bacteria | 1293 |
| 495 | Ga0495608_0010907 | 3300046511 | Bacteria | 6331 |
| 496 | Ga0495610_0048914 | 3300046512 | Bacteria | 2073 |
| 497 | Ga0495610_0054023 | 3300046512 | Bacteria | 1942 |
| 498 | Ga0495628_0018385 | 3300046516 | Bacteria | 5791 |
| 499 | Ga0495628_0035270 | 3300046516 | Bacteria | 4021 |
| 500 | Ga0495631_0021684 | 3300046518 | Bacteria | 2990 |
| 501 | Ga0495643_0005874 | 3300046522 | Bacteria | 8209 |
| 502 | Ga0495643_0024835 | 3300046522 | Bacteria | 3396 |
| 503 | Ga0495648_0000160 | 3300046524 | Bacteria | 80523 |
| 504 | Ga0495648_0001196 | 3300046524 | Bacteria | 25992 |
| 505 | Ga0495648_0016227 | 3300046524 | Bacteria | 5373 |
| 506 | Ga0495648_0061143 | 3300046524 | Bacteria | 2238 |
| 507 | Ga0495642_0019910 | 3300046528 | Bacteria | 2631 |
| 508 | Ga0495652_0013145 | 3300046529 | Bacteria | 7452 |
| 509 | Ga0495652_0091685 | 3300046529 | Bacteria | 2483 |
| 510 | Ga0495652_0105206 | 3300046529 | Bacteria | 2281 |
| 511 | Ga0495654_0057793 | 3300046530 | Bacteria | 1873 |
| 512 | Ga0495665_0000261 | 3300046531 | Bacteria | 26625 |
| 513 | Ga0495640_0002042 | 3300046533 | Bacteria | 16096 |
| 514 | Ga0495640_0040304 | 3300046533 | Bacteria | 3271 |
| 515 | Ga0495640_0082595 | 3300046533 | Bacteria | 2133 |
| 516 | Ga0495587_0066032 | 3300046536 | Bacteria | 2111 |
| 517 | Ga0495598_0007033 | 3300046537 | Bacteria | 2564 |
| 518 | Ga0495609_0037053 | 3300046538 | Bacteria | 2200 |
| 519 | Ga0495621_0017023 | 3300046539 | Bacteria | 2342 |
| 520 | Ga0495597_0019441 | 3300046542 | Bacteria | 3179 |
| 521 | Ga0495645_0005022 | 3300046543 | Bacteria | 9067 |
| 522 | Ga0495645_0009332 | 3300046543 | Bacteria | 6862 |
| 523 | Ga0495645_0011286 | 3300046543 | Bacteria | 6282 |
| 524 | Ga0495622_0008215 | 3300046557 | Bacteria | 4836 |
| 525 | Ga0495622_0024903 | 3300046557 | Bacteria | 2794 |
| 526 | Ga0495622_0114175 | 3300046557 | Bacteria | 1235 |
| 527 | Ga0495633_0023884 | 3300046558 | Bacteria | 3025 |
| 528 | Ga0495667_0011404 | 3300046559 | Bacteria | 6015 |
| 529 | Ga0495667_0039154 | 3300046559 | Bacteria | 3154 |
| 530 | Ga0495667_0082045 | 3300046559 | Bacteria | 2095 |
| 531 | Ga0495667_0085530 | 3300046559 | Bacteria | 2047 |
| 532 | Ga0495656_0003069 | 3300046615 | Bacteria | 5612 |
| 533 | Ga0495656_0005194 | 3300046615 | Bacteria | 4489 |
| 534 | Ga0495668_0018347 | 3300046616 | Bacteria | 4042 |
| 535 | Ga0495668_0025430 | 3300046616 | Bacteria | 3364 |
| 536 | Ga0495668_0063801 | 3300046616 | Bacteria | 2028 |
| 537 | Ga0495668_0070808 | 3300046616 | Bacteria | 1917 |
| 538 | Ga0495634_0000161 | 3300046642 | Bacteria | 60925 |
| 539 | Ga0495634_0113048 | 3300046642 | Bacteria | 1744 |
| 540 | Ga0495611_0003326 | 3300046648 | Bacteria | 7104 |
| 541 | Ga0495625_0052926 | 3300046660 | Bacteria | 2905 |
| 542 | Ga0495625_0170346 | 3300046660 | Bacteria | 1454 |
| 543 | Ga0495635_0001102 | 3300046663 | Bacteria | 17952 |
| 544 | Ga0495635_0001598 | 3300046663 | Bacteria | 15235 |
| 545 | Ga0495635_0135687 | 3300046663 | Bacteria | 1677 |
| 546 | Ga0495659_0022883 | 3300046664 | Bacteria | 2118 |
| 547 | Ga0495588_0004167 | 3300046674 | Bacteria | 6374 |
| 548 | Ga0495588_0098627 | 3300046674 | Bacteria | 1534 |
| 549 | Ga0495657_0023663 | 3300046675 | Bacteria | 4387 |
| 550 | Ga0495657_0032132 | 3300046675 | Bacteria | 3665 |
| 551 | Ga0495599_0058148 | 3300046678 | Bacteria | 2419 |
| 552 | Ga0495599_0128534 | 3300046678 | Bacteria | 1574 |
| 553 | Ga0495623_0030541 | 3300046679 | Bacteria | 3466 |
| 554 | Ga0495623_0121585 | 3300046679 | Bacteria | 1571 |
| 555 | Ga0495623_0128826 | 3300046679 | Bacteria | 1517 |
| 556 | Ga0495646_0050411 | 3300046680 | Bacteria | 2523 |
| 557 | Ga0495647_0000205 | 3300046681 | Bacteria | 15996 |
| 558 | Ga0495658_0001114 | 3300046683 | Bacteria | 14225 |
| 559 | Ga0495669_0009267 | 3300046684 | Bacteria | 4148 |
| 560 | Ga0495669_0013439 | 3300046684 | Bacteria | 3488 |
| 561 | Ga0495613_0012105 | 3300046689 | Bacteria | 6412 |
| 562 | Ga0495613_0063836 | 3300046689 | Bacteria | 2694 |
| 563 | Ga0495624_0003890 | 3300046690 | Bacteria | 11008 |
| 564 | Ga0495624_0027953 | 3300046690 | Bacteria | 3687 |
| 565 | Ga0495670_0007362 | 3300046691 | Bacteria | 5409 |
| 566 | Ga0495670_0080042 | 3300046691 | Bacteria | 1663 |
| 567 | Ga0495671_0055927 | 3300046692 | Bacteria | 1954 |
| 568 | Ga0495649_0009550 | 3300046694 | Bacteria | 5754 |
| 569 | Ga0495649_0049185 | 3300046694 | Bacteria | 2290 |
| 570 | Ga0495649_0122831 | 3300046694 | Bacteria | 1372 |
| 571 | Ga0495600_0010669 | 3300046809 | Bacteria | 5708 |
| 572 | Ga0495600_0016431 | 3300046809 | Bacteria | 4696 |
| 573 | Ga0495581_0000255 | 3300047315 | Bacteria | 25578 |
| 574 | Ga0495581_0040997 | 3300047315 | Bacteria | 2679 |
| 575 | Ga0495604_0008729 | 3300047317 | Bacteria | 8010 |
| 576 | Ga0495604_0010435 | 3300047317 | Bacteria | 7360 |
| 577 | Ga0495604_0045012 | 3300047317 | Bacteria | 3445 |
| 578 | Ga0495674_0000117 | 3300047319 | Bacteria | 60130 |
| 579 | Ga0495674_0011652 | 3300047319 | Bacteria | 8292 |
| 580 | Ga0495676_0006968 | 3300047321 | Bacteria | 10372 |
| 581 | Ga0495676_0021084 | 3300047321 | Bacteria | 5703 |
| 582 | Ga0495676_0029179 | 3300047321 | Bacteria | 4699 |
| 583 | Ga0495680_0004171 | 3300047322 | Bacteria | 13893 |
| 584 | Ga0495680_0124694 | 3300047322 | Bacteria | 1898 |
| 585 | Ga0495683_0016976 | 3300047323 | Bacteria | 3775 |
| 586 | Ga0495675_0067391 | 3300047444 | Bacteria | 2261 |
| 587 | Ga0495677_0008483 | 3300047445 | Bacteria | 3816 |
| 588 | Ga0495677_0018395 | 3300047445 | Bacteria | 2533 |
| 589 | Ga0495673_0015016 | 3300047469 | Bacteria | 4007 |
| 590 | Ga0495686_0051583 | 3300047472 | Bacteria | 2581 |
| 591 | Ga0495686_0051720 | 3300047472 | Bacteria | 2577 |
| 592 | Ga0495593_0000086 | 3300047673 | Bacteria | 40986 |
| 593 | Ga0495593_0005818 | 3300047673 | Bacteria | 7270 |
| 594 | Ga0495593_0033461 | 3300047673 | Bacteria | 2799 |
| 595 | Ga0495602_0004737 | 3300048088 | Bacteria | 14223 |
| 596 | Ga0495602_0057792 | 3300048088 | Bacteria | 3400 |
| 597 | Ga0495602_0234343 | 3300048088 | Bacteria | 1377 |
| 598 | Ga0495614_0018614 | 3300048089 | Bacteria | 3008 |
| 599 | Ga0495626_0056236 | 3300048091 | Bacteria | 1802 |
| 600 | Ga0496100_0045674 | 3300048903 | Bacteria | 2812 |
| 601 | Ga0496100_0113533 | 3300048903 | Bacteria | 1886 |
| 602 | Ga0496101_0021499 | 3300048904 | Bacteria | 4433 |
| 603 | Ga0496102_0002395 | 3300048905 | Bacteria | 16005 |
| 604 | Ga0496102_0213821 | 3300048905 | Bacteria | 1818 |
| 605 | Ga0496102_0245913 | 3300048905 | Bacteria | 1686 |
| 606 | Ga0496103_0021272 | 3300048906 | Bacteria | 3902 |
| 607 | Ga0496104_0039154 | 3300048907 | Bacteria | 4438 |
| 608 | Ga0496104_0045194 | 3300048907 | Bacteria | 4141 |
| 609 | Ga0496104_0094983 | 3300048907 | Bacteria | 2852 |
| 610 | Ga0496104_0154915 | 3300048907 | Bacteria | 2199 |
| 611 | Ga0496105_0003203 | 3300048908 | Bacteria | 12051 |
| 612 | Ga0496105_0052703 | 3300048908 | Bacteria | 3360 |
| 613 | Ga0496105_0131830 | 3300048908 | Bacteria | 2060 |
| 614 | Ga0496106_0000546 | 3300048909 | Bacteria | 26747 |
| 615 | Ga0496106_0049188 | 3300048909 | Bacteria | 3176 |
| 616 | Ga0496107_0006071 | 3300048910 | Bacteria | 8293 |
| 617 | Ga0496107_0009700 | 3300048910 | Bacteria | 6675 |
| 618 | Ga0496107_0120047 | 3300048910 | Bacteria | 1936 |
| 619 | Ga0496108_0001487 | 3300048911 | Bacteria | 18522 |
| 620 | Ga0496108_0404095 | 3300048911 | Bacteria | 1193 |
| 621 | Ga0496109_0002290 | 3300048912 | Bacteria | 15920 |
| 622 | Ga0496109_0035755 | 3300048912 | Bacteria | 4483 |
| 623 | Ga0496109_0081686 | 3300048912 | Bacteria | 2978 |
| 624 | Ga0496110_0028694 | 3300048913 | Bacteria | 4782 |
| 625 | Ga0496110_0030245 | 3300048913 | Bacteria | 4666 |
| 626 | Ga0496110_0036833 | 3300048913 | Bacteria | 4250 |
| 627 | Ga0496110_0192481 | 3300048913 | Bacteria | 1852 |
| 628 | Ga0496111_0087417 | 3300048914 | Bacteria | 2281 |
| 629 | Ga0496112_0000079 | 3300048915 | Bacteria | 64101 |
| 630 | Ga0496112_0088109 | 3300048915 | Bacteria | 3071 |
| 631 | Ga0496112_0173714 | 3300048915 | Bacteria | 2120 |
| 632 | Ga0496113_0041046 | 3300048916 | Bacteria | 3412 |
| 633 | Ga0496113_0042654 | 3300048916 | Bacteria | 3353 |
| 634 | Ga0496113_0092663 | 3300048916 | Bacteria | 2331 |
| 635 | Ga0496114_0039704 | 3300048917 | Bacteria | 3895 |
| 636 | Ga0496114_0057168 | 3300048917 | Bacteria | 3256 |
| 637 | Ga0496114_0208632 | 3300048917 | Bacteria | 1713 |
| 638 | Ga0496115_0000788 | 3300048918 | Bacteria | 23274 |
| 639 | Ga0496115_0031854 | 3300048918 | Bacteria | 4157 |
| 640 | Ga0496115_0103468 | 3300048918 | Bacteria | 2336 |
| 641 | Ga0496115_0113682 | 3300048918 | Bacteria | 2225 |
| 642 | Ga0496115_0132161 | 3300048918 | Bacteria | 2057 |
| 643 | Ga0496115_0190376 | 3300048918 | Bacteria | 1695 |
| 644 | Ga0496116_0099348 | 3300048919 | Bacteria | 1743 |
| 645 | Ga0496118_0009864 | 3300048921 | Bacteria | 9553 |
| 646 | Ga0496118_0017185 | 3300048921 | Bacteria | 6599 |
| 647 | Ga0496118_0119680 | 3300048921 | Bacteria | 1721 |
| 648 | Ga0496119_0002628 | 3300048922 | Bacteria | 19497 |
| 649 | Ga0496119_0060982 | 3300048922 | Bacteria | 2255 |
| 650 | Ga0496119_0072540 | 3300048922 | Bacteria | 2011 |
| 651 | Ga0496120_0010435 | 3300048923 | Bacteria | 6482 |
| 652 | Ga0496120_0070150 | 3300048923 | Bacteria | 1928 |
| 653 | Ga0496121_0000495 | 3300048924 | Bacteria | 75339 |
| 654 | Ga0496121_0001789 | 3300048924 | Bacteria | 34756 |
| 655 | Ga0496121_0007340 | 3300048924 | Bacteria | 13328 |
| 656 | Ga0496121_0038986 | 3300048924 | Bacteria | 4196 |
| 657 | Ga0496121_0041310 | 3300048924 | Bacteria | 4032 |
| 658 | Ga0496121_0041730 | 3300048924 | Bacteria | 4005 |
| 659 | Ga0496121_0052341 | 3300048924 | Bacteria | 3430 |
| 660 | Ga0496121_0077388 | 3300048924 | Bacteria | 2649 |
| 661 | Ga0496121_0080315 | 3300048924 | Bacteria | 2586 |
| 662 | Ga0496121_0089588 | 3300048924 | Bacteria | 2408 |
| 663 | Ga0496121_0136742 | 3300048924 | Bacteria | 1824 |
| 664 | Ga0496121_0230387 | 3300048924 | Bacteria | 1298 |
| 665 | Ga0496124_0175761 | 3300048927 | Bacteria | 1653 |
| 666 | Ga0496125_0000756 | 3300048928 | Bacteria | 52960 |
| 667 | Ga0496125_0003979 | 3300048928 | Bacteria | 17384 |
| 668 | Ga0496125_0035568 | 3300048928 | Bacteria | 4365 |
| 669 | Ga0496125_0054112 | 3300048928 | Bacteria | 3283 |
| 670 | Ga0496126_0002315 | 3300048929 | Bacteria | 26122 |
| 671 | Ga0496126_0006416 | 3300048929 | Bacteria | 13114 |
| 672 | Ga0496126_0009623 | 3300048929 | Bacteria | 10249 |
| 673 | Ga0496126_0030943 | 3300048929 | Bacteria | 5063 |
| 674 | Ga0496126_0037866 | 3300048929 | Bacteria | 4493 |
| 675 | Ga0496126_0049932 | 3300048929 | Bacteria | 3816 |
| 676 | Ga0496126_0082610 | 3300048929 | Bacteria | 2838 |
| 677 | Ga0496126_0247566 | 3300048929 | Bacteria | 1486 |
| 678 | Ga0496126_0283948 | 3300048929 | Bacteria | 1370 |
| 679 | Ga0496126_0328033 | 3300048929 | Bacteria | 1257 |
| 680 | Ga0495682_0007216 | 3300049460 | Bacteria | 4436 |
| 681 | Ga0495682_0015674 | 3300049460 | Bacteria | 2872 |
| 682 | Ga0501031_0028515 | 3300049568 | Bacteria | 3639 |
| 683 | Ga0501031_0078035 | 3300049568 | Bacteria | 2157 |
| 684 | Ga0501032_0007357 | 3300049569 | Bacteria | 8046 |
| 685 | Ga0501032_0007780 | 3300049569 | Bacteria | 7815 |
| 686 | Ga0501032_0014183 | 3300049569 | Bacteria | 5645 |
| 687 | Ga0501032_0051663 | 3300049569 | Bacteria | 2771 |
| 688 | Ga0501032_0160873 | 3300049569 | Bacteria | 1474 |
| 689 | Ga0501033_0000313 | 3300049570 | Bacteria | 45940 |
| 690 | Ga0501033_0001956 | 3300049570 | Bacteria | 17932 |
| 691 | Ga0501033_0020816 | 3300049570 | Bacteria | 4951 |
| 692 | Ga0501034_0000175 | 3300049571 | Bacteria | 119465 |
| 693 | Ga0501034_0063889 | 3300049571 | Bacteria | 3695 |
| 694 | Ga0501034_0065198 | 3300049571 | Bacteria | 3654 |
| 695 | Ga0501034_0204542 | 3300049571 | Bacteria | 1931 |
| 696 | Ga0501036_0000032 | 3300049572 | Bacteria | 91370 |
| 697 | Ga0501036_0092834 | 3300049572 | Bacteria | 2550 |
| 698 | Ga0501036_0180825 | 3300049572 | Bacteria | 1775 |
| 699 | Ga0501036_0262814 | 3300049572 | Bacteria | 1446 |
| 700 | Ga0501037_0000415 | 3300049573 | Bacteria | 35219 |
| 701 | Ga0501037_0009384 | 3300049573 | Bacteria | 7180 |
| 702 | Ga0501037_0024822 | 3300049573 | Bacteria | 4431 |
| 703 | Ga0501037_0059114 | 3300049573 | Bacteria | 2797 |
| 704 | Ga0501037_0073701 | 3300049573 | Bacteria | 2482 |
| 705 | Ga0501037_0123227 | 3300049573 | Bacteria | 1862 |
| 706 | Ga0501037_0129459 | 3300049573 | Bacteria | 1810 |
| 707 | Ga0501038_0000114 | 3300049574 | Bacteria | 68140 |
| 708 | Ga0501038_0010298 | 3300049574 | Bacteria | 8554 |
| 709 | Ga0501038_0010663 | 3300049574 | Bacteria | 8403 |
| 710 | Ga0501038_0011901 | 3300049574 | Bacteria | 7942 |
| 711 | Ga0501038_0046908 | 3300049574 | Bacteria | 3744 |
| 712 | Ga0501038_0053939 | 3300049574 | Bacteria | 3458 |
| 713 | Ga0501038_0109579 | 3300049574 | Bacteria | 2288 |
| 714 | Ga0501039_0000078 | 3300049575 | Bacteria | 73768 |
| 715 | Ga0501039_0056463 | 3300049575 | Bacteria | 3041 |
| 716 | Ga0501039_0170436 | 3300049575 | Bacteria | 1711 |
| 717 | Ga0501040_0010883 | 3300049576 | Bacteria | 5946 |
| 718 | Ga0501041_0137478 | 3300049577 | Bacteria | 1523 |
| 719 | Ga0501042_0008806 | 3300049578 | Bacteria | 6691 |
| 720 | Ga0501043_0000220 | 3300049579 | Bacteria | 51696 |
| 721 | Ga0501043_0058864 | 3300049579 | Bacteria | 3015 |
| 722 | Ga0501043_0059836 | 3300049579 | Bacteria | 2989 |
| 723 | Ga0501043_0069641 | 3300049579 | Bacteria | 2763 |
| 724 | Ga0501043_0124712 | 3300049579 | Bacteria | 2019 |
| 725 | Ga0501046_0000176 | 3300049580 | Bacteria | 65273 |
| 726 | Ga0501046_0017167 | 3300049580 | Bacteria | 6048 |
| 727 | Ga0501046_0018872 | 3300049580 | Bacteria | 5727 |
| 728 | Ga0501046_0091234 | 3300049580 | Bacteria | 2343 |
| 729 | Ga0501046_0129766 | 3300049580 | Bacteria | 1912 |
| 730 | Ga0501047_0000085 | 3300049581 | Bacteria | 118617 |
| 731 | Ga0501047_0003015 | 3300049581 | Bacteria | 15979 |
| 732 | Ga0501047_0021690 | 3300049581 | Bacteria | 6167 |
| 733 | Ga0501047_0062758 | 3300049581 | Bacteria | 3584 |
| 734 | Ga0501047_0295067 | 3300049581 | Bacteria | 1464 |
| 735 | Ga0501048_0024136 | 3300049582 | Bacteria | 4439 |
| 736 | Ga0501048_0046571 | 3300049582 | Bacteria | 3095 |
| 737 | Ga0501067_0001860 | 3300049583 | Bacteria | 11596 |
| 738 | Ga0501067_0003942 | 3300049583 | Bacteria | 8194 |
| 739 | Ga0501067_0134372 | 3300049583 | Bacteria | 1377 |
| 740 | Ga0501068_0001393 | 3300049584 | Bacteria | 12838 |
| 741 | Ga0501068_0063934 | 3300049584 | Bacteria | 2238 |
| 742 | Ga0501069_0023817 | 3300049585 | Bacteria | 3338 |
| 743 | Ga0501069_0032539 | 3300049585 | Bacteria | 2870 |
| 744 | Ga0501070_0011262 | 3300049586 | Bacteria | 7553 |
| 745 | Ga0501070_0042730 | 3300049586 | Bacteria | 3775 |
| 746 | Ga0501071_0022700 | 3300049587 | Bacteria | 4377 |
| 747 | Ga0501071_0027300 | 3300049587 | Bacteria | 4016 |
| 748 | Ga0501071_0087434 | 3300049587 | Bacteria | 2287 |
| 749 | Ga0501072_0010680 | 3300049588 | Bacteria | 6992 |
| 750 | Ga0501072_0120351 | 3300049588 | Bacteria | 2091 |
| 751 | Ga0501073_0000026 | 3300049589 | Bacteria | 124358 |
| 752 | Ga0501073_0081545 | 3300049589 | Bacteria | 2250 |
| 753 | Ga0501074_0000878 | 3300049590 | Bacteria | 19194 |
| 754 | Ga0501074_0008344 | 3300049590 | Bacteria | 7510 |
| 755 | Ga0501076_0083862 | 3300049592 | Bacteria | 2560 |
| 756 | Ga0501079_0006752 | 3300049741 | Bacteria | 8631 |
| 757 | Ga0501079_0158453 | 3300049741 | Bacteria | 1764 |
| 758 | Ga0501080_0248879 | 3300049742 | Bacteria | 1621 |
| 759 | Ga0501081_0149601 | 3300049743 | Bacteria | 1677 |
| 760 | Ga0501083_0028305 | 3300049744 | Bacteria | 3862 |
| 761 | Ga0501035_0014167 | 3300049822 | Bacteria | 7357 |
| 762 | Ga0501035_0014525 | 3300049822 | Bacteria | 7268 |
| 763 | Ga0501035_0027709 | 3300049822 | Bacteria | 5178 |
| 764 | Ga0501035_0063093 | 3300049822 | Bacteria | 3296 |
| 765 | Ga0501035_0168085 | 3300049822 | Bacteria | 1895 |
| 766 | Ga0501044_0000061 | 3300049823 | Bacteria | 133207 |
| 767 | Ga0501044_0002968 | 3300049823 | Bacteria | 19271 |
| 768 | Ga0501044_0011007 | 3300049823 | Bacteria | 9818 |
| 769 | Ga0501044_0018826 | 3300049823 | Bacteria | 7395 |
| 770 | Ga0501044_0022791 | 3300049823 | Bacteria | 6669 |
| 771 | Ga0501044_0032967 | 3300049823 | Bacteria | 5444 |
| 772 | Ga0501044_0072096 | 3300049823 | Bacteria | 3512 |
| 773 | Ga0501044_0195234 | 3300049823 | Bacteria | 1985 |
| 774 | Ga0501044_0220866 | 3300049823 | Bacteria | 1845 |
| 775 | Ga0501045_0015070 | 3300049824 | Bacteria | 5487 |
| 776 | nmdc:mga03n38_11708_c1 | 3300050490 | Bacteria | 3278 |
| 777 | nmdc:mga03n38_2075_c1 | 3300050490 | Bacteria | 6061 |
| 778 | nmdc:mga03n38_49491_c1 | 3300050490 | Bacteria | 1869 |
| 779 | nmdc:mga00v17_14353_c1 | 3300050491 | Bacteria | 4418 |
| 780 | nmdc:mga00v17_43318_c1 | 3300050491 | Bacteria | 2710 |
| 781 | nmdc:mga0yw44_12510_c1 | 3300050492 | Bacteria | 4428 |
| 782 | nmdc:mga0yw44_1305_c1 | 3300050492 | Bacteria | 9847 |
| 783 | nmdc:mga0yw44_23019_c1 | 3300050492 | Bacteria | 3504 |
| 784 | nmdc:mga0yw44_40905_c1 | 3300050492 | Bacteria | 2757 |
| 785 | nmdc:mga0yw44_61146_c1 | 3300050492 | Bacteria | 2310 |
| 786 | nmdc:mga06z11_1148_c1 | 3300050494 | Bacteria | 9678 |
| 787 | nmdc:mga06z11_123308_c1 | 3300050494 | Bacteria | 1448 |
| 788 | nmdc:mga06z11_51583_c1 | 3300050494 | Bacteria | 2107 |
| 789 | nmdc:mga07m45_1819_c1 | 3300050496 | Bacteria | 9835 |
| 790 | nmdc:mga07m45_19104_c1 | 3300050496 | Bacteria | 3709 |
| 791 | nmdc:mga07m45_255625_c1 | 3300050496 | Bacteria | 1019 |
| 792 | nmdc:mga07m45_84756_c1 | 3300050496 | Bacteria | 1812 |
| 793 | nmdc:mga05p37_399127_c1 | 3300050507 | Bacteria | 1606 |
| 794 | nmdc:mga08y16_215054_c1 | 3300050511 | Bacteria | 1990 |
| 795 | nmdc:mga08y16_97027_c1 | 3300050511 | Bacteria | 3069 |
| 796 | nmdc:mga0sz30_23235_c1 | 3300050516 | Bacteria | 2520 |
| 797 | nmdc:mga0sz30_42214_c1 | 3300050516 | Bacteria | 1919 |
| 798 | nmdc:mga0sz30_9246_c1 | 3300050516 | Bacteria | 3743 |
| 799 | Ga0495601_0201403 | 3300053077 | Bacteria | 1301 |
| 800 | Ga0495612_0032405 | 3300053078 | Bacteria | 2112 |
| 801 | Ga0500610_0073581 | 3300053079 | Bacteria | 1782 |
| 802 | Ga0500635_0004290 | 3300053080 | Bacteria | 3664 |
| 803 | Ga0500635_0004942 | 3300053080 | Bacteria | 3465 |
| 804 | Ga0495595_0014890 | 3300053084 | Bacteria | 3307 |
| 805 | Ga0495619_0000182 | 3300053085 | Bacteria | 46524 |
| 806 | Ga0495619_0031597 | 3300053085 | Bacteria | 3431 |
| 807 | Ga0500643_000025 | 3300053087 | Bacteria | 259605 |
| 808 | Ga0500651_0018637 | 3300053093 | Bacteria | 4299 |
| 809 | Ga0500566_0000038 | 3300053094 | Bacteria | 66925 |
| 810 | Ga0500566_0000596 | 3300053094 | Bacteria | 20245 |
| 811 | Ga0500566_0042396 | 3300053094 | Bacteria | 2625 |
| 812 | Ga0500640_014775 | 3300053095 | Bacteria | 3255 |
| 813 | Ga0500641_0002804 | 3300053096 | Bacteria | 6174 |
| 814 | Ga0500555_004466 | 3300053103 | Bacteria | 3972 |
| 815 | Ga0500557_000001 | 3300053105 | Bacteria | 241298 |
| 816 | Ga0500572_000010 | 3300053111 | Bacteria | 67071 |
| 817 | Ga0500572_000539 | 3300053111 | Bacteria | 12841 |
| 818 | Ga0500592_009746 | 3300053116 | Bacteria | 1528 |
| 819 | Ga0500595_000143 | 3300053119 | Bacteria | 46542 |
| 820 | Ga0500595_003822 | 3300053119 | Bacteria | 6923 |
| 821 | Ga0500595_005314 | 3300053119 | Bacteria | 5639 |
| 822 | Ga0500595_033870 | 3300053119 | Bacteria | 1692 |
| 823 | Ga0500608_016164 | 3300053122 | Bacteria | 3367 |
| 824 | Ga0500642_0005774 | 3300053130 | Bacteria | 4022 |
| 825 | Ga0500642_0006377 | 3300053130 | Bacteria | 3879 |
| 826 | Ga0500642_0018933 | 3300053130 | Bacteria | 2674 |
| 827 | Ga0500652_000002 | 3300053131 | Bacteria | 273315 |
| 828 | Ga0500655_009783 | 3300053133 | Bacteria | 1731 |
| 829 | Ga0500559_0000917 | 3300053136 | Bacteria | 18754 |
| 830 | Ga0500559_0014387 | 3300053136 | Bacteria | 3343 |
| 831 | Ga0500559_0061944 | 3300053136 | Bacteria | 1669 |
| 832 | Ga0500568_0003461 | 3300053139 | Bacteria | 8786 |
| 833 | Ga0500568_0010830 | 3300053139 | Bacteria | 4253 |
| 834 | Ga0500573_0030373 | 3300053140 | Bacteria | 3117 |
| 835 | Ga0500577_0002448 | 3300053142 | Bacteria | 4749 |
| 836 | Ga0500577_0024659 | 3300053142 | Bacteria | 2025 |
| 837 | Ga0500590_041405 | 3300053148 | Bacteria | 2369 |
| 838 | Ga0500603_000364 | 3300053150 | Bacteria | 11849 |
| 839 | Ga0500603_000550 | 3300053150 | Bacteria | 9467 |
| 840 | Ga0500603_007083 | 3300053150 | Bacteria | 2454 |
| 841 | Ga0500616_0002840 | 3300053153 | Bacteria | 13926 |
| 842 | Ga0500620_040830 | 3300053155 | Bacteria | 1521 |
| 843 | Ga0500627_0034682 | 3300053158 | Bacteria | 2140 |
| 844 | Ga0500630_000751 | 3300053159 | Bacteria | 14857 |
| 845 | Ga0500634_0045659 | 3300053161 | Bacteria | 2370 |
| 846 | Ga0500634_0070970 | 3300053161 | Bacteria | 1822 |
| 847 | Ga0500638_000303 | 3300053162 | Bacteria | 11065 |
| 848 | Ga0500639_000034 | 3300053163 | Bacteria | 66994 |
| 849 | Ga0500639_020006 | 3300053163 | Bacteria | 3530 |
| 850 | Ga0500639_105339 | 3300053163 | Bacteria | 1381 |
| 851 | Ga0500636_0084966 | 3300053177 | Bacteria | 1819 |
| 852 | Ga0500637_0000685 | 3300053178 | Bacteria | 13466 |
| 853 | Ga0500637_0004238 | 3300053178 | Bacteria | 6771 |
| 854 | Ga0500611_013032 | 3300053727 | Bacteria | 1417 |
| 855 | Ga0500625_001418 | 3300053729 | Bacteria | 8169 |
| 856 | Ga0500596_000264 | 3300053735 | Bacteria | 9238 |
| 857 | Ga0500596_005925 | 3300053735 | Bacteria | 2107 |
| 858 | Ga0500596_009734 | 3300053735 | Bacteria | 1494 |
| 859 | Ga0500601_000570 | 3300053737 | Bacteria | 5387 |
| 860 | Ga0501084_0005053 | 3300054114 | Bacteria | 10793 |
| 861 | Ga0501084_0018834 | 3300054114 | Bacteria | 5747 |
| 862 | Ga0500661_000850 | 3300055283 | Bacteria | 5699 |
| 863 | Ga0501082_0014622 | 3300060353 | Bacteria | 6759 |
| 864 | Ga0501082_0098826 | 3300060353 | Bacteria | 2523 |
| 865 | Ga0466962_0054197 | 3300061719 | Bacteria | 1917 |
| 866 | Ga0530510_0064504 | 3300061734 | Bacteria | 2653 |
| 867 | Ga0530510_0225344 | 3300061734 | Bacteria | 1394 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025919 | Ga0207657_10155555 | Ga0207657_101555551 | 320 |
| 2 | 3300050496 | nmdc:mga07m45_255625_c1 | nmdc:mga07m45_255625_c1_11_1009 | 329 |
| 3 | 3300046512 | Ga0495610_0054023 | Ga0495610_0054023_812_1891 | 339 |
| 4 | 3300031730 | Ga0307516_10108446 | Ga0307516_101084462 | 340 |
| 5 | 3300013308 | Ga0157375_10572742 | Ga0157375_105727421 | 343 |
| 6 | 3300006941 | Ga0099825_1030643 | Ga0099825_10306432 | 347 |
| 7 | 3300006942 | Ga0099824_1004496 | Ga0099824_100449620 | 347 |
| 8 | 3300006943 | Ga0099822_1012804 | Ga0099822_10128046 | 347 |
| 9 | 3300006944 | Ga0099823_1037031 | Ga0099823_10370312 | 347 |
| 10 | 3300025272 | Ga0209455_1008571 | Ga0209455_10085712 | 347 |
| 11 | 3300027296 | Ga0209389_1000113 | Ga0209389_10001137 | 347 |
| 12 | 3300027357 | Ga0209589_1000023 | Ga0209589_100002354 | 347 |
| 13 | 3300027361 | Ga0209489_100032 | Ga0209489_10003254 | 347 |
| 14 | 3300027361 | Ga0209489_107143 | Ga0209489_10714314 | 347 |
| 15 | 3300027363 | Ga0209700_100040 | Ga0209700_10004054 | 347 |
| 16 | 3300005337 | Ga0070682_100204629 | Ga0070682_1002046291 | 349 |
| 17 | 3300005614 | Ga0068856_100001022 | Ga0068856_10000102224 | 350 |
| 18 | 3300009545 | Ga0105237_10301032 | Ga0105237_103010321 | 350 |
| 19 | 3300025914 | Ga0207671_10105087 | Ga0207671_101050872 | 350 |
| 20 | 3300005985 | Ga0081539_10073326 | Ga0081539_100733261 | 352 |
| 21 | 3300021441 | Ga0213871_10009469 | Ga0213871_100094691 | 352 |
| 22 | 3300005456 | Ga0070678_100014206 | Ga0070678_1000142063 | 353 |
| 23 | 3300006048 | Ga0075363_100069143 | Ga0075363_1000691432 | 353 |
| 24 | 3300025254 | Ga0209148_1000446 | Ga0209148_100044611 | 353 |
| 25 | 3300025261 | Ga0209233_1014977 | Ga0209233_10149772 | 353 |
| 26 | 3300025272 | Ga0209455_1001699 | Ga0209455_10016997 | 353 |
| 27 | 3300026121 | Ga0207683_10056139 | Ga0207683_100561392 | 353 |
| 28 | 3300005347 | Ga0070668_100025503 | Ga0070668_1000255032 | 354 |
| 29 | 3300005353 | Ga0070669_100107871 | Ga0070669_1001078712 | 354 |
| 30 | 3300005355 | Ga0070671_100024002 | Ga0070671_1000240023 | 354 |
| 31 | 3300005367 | Ga0070667_100191133 | Ga0070667_1001911332 | 354 |
| 32 | 3300005455 | Ga0070663_100094371 | Ga0070663_1000943712 | 354 |
| 33 | 3300005614 | Ga0068856_100092247 | Ga0068856_1000922472 | 354 |
| 34 | 3300006038 | Ga0075365_10163445 | Ga0075365_101634451 | 354 |
| 35 | 3300006042 | Ga0075368_10032088 | Ga0075368_100320882 | 354 |
| 36 | 3300006195 | Ga0075366_10023941 | Ga0075366_100239412 | 354 |
| 37 | 3300009101 | Ga0105247_10197107 | Ga0105247_101971071 | 354 |
| 38 | 3300009148 | Ga0105243_10229789 | Ga0105243_102297892 | 354 |
| 39 | 3300009177 | Ga0105248_10063999 | Ga0105248_100639993 | 354 |
| 40 | 3300025304 | Ga0209257_1020976 | Ga0209257_10209762 | 354 |
| 41 | 3300025904 | Ga0207647_10035221 | Ga0207647_100352212 | 354 |
| 42 | 3300025914 | Ga0207671_10131680 | Ga0207671_101316802 | 354 |
| 43 | 3300025927 | Ga0207687_10146994 | Ga0207687_101469942 | 354 |
| 44 | 3300025941 | Ga0207711_10276917 | Ga0207711_102769172 | 354 |
| 45 | 3300025972 | Ga0207668_10066692 | Ga0207668_100666922 | 354 |
| 46 | 3300026067 | Ga0207678_10178823 | Ga0207678_101788232 | 354 |
| 47 | 3300026078 | Ga0207702_10140013 | Ga0207702_101400132 | 354 |
| 48 | 3300026116 | Ga0207674_10068286 | Ga0207674_100682862 | 354 |
| 49 | 3300028379 | Ga0268266_10017618 | Ga0268266_100176184 | 354 |
| 50 | 3300037853 | Ga0436364_1474553 | Ga0436364_1474553_476_1609 | 354 |
| 51 | 3300039438 | Ga0436360_0509368 | Ga0436360_0509368_1614_2762 | 354 |
| 52 | 3300048918 | Ga0496115_0103468 | Ga0496115_0103468_783_1916 | 354 |
| 53 | 3300048929 | Ga0496126_0009623 | Ga0496126_0009623_5860_6996 | 354 |
| 54 | 3300050494 | nmdc:mga06z11_123308_c1 | nmdc:mga06z11_123308_c1_280_1413 | 354 |
| 55 | 3300003659 | JGI25404J52841_10012436 | JGI25404J52841_100124362 | 355 |
| 56 | 3300005548 | Ga0070665_100059878 | Ga0070665_1000598782 | 355 |
| 57 | 3300005577 | Ga0068857_100052056 | Ga0068857_1000520562 | 355 |
| 58 | 3300005614 | Ga0068856_100055877 | Ga0068856_1000558772 | 355 |
| 59 | 3300005617 | Ga0068859_100223355 | Ga0068859_1002233551 | 355 |
| 60 | 3300005618 | Ga0068864_100046992 | Ga0068864_1000469921 | 355 |
| 61 | 3300005840 | Ga0068870_10147937 | Ga0068870_101479371 | 355 |
| 62 | 3300005841 | Ga0068863_100108446 | Ga0068863_1001084462 | 355 |
| 63 | 3300005844 | Ga0068862_100125218 | Ga0068862_1001252181 | 355 |
| 64 | 3300006931 | Ga0097620_100223355 | Ga0097620_1002233551 | 355 |
| 65 | 3300009098 | Ga0105245_10118193 | Ga0105245_101181932 | 355 |
| 66 | 3300009101 | Ga0105247_10070021 | Ga0105247_100700212 | 355 |
| 67 | 3300025900 | Ga0207710_10005054 | Ga0207710_100050544 | 355 |
| 68 | 3300025900 | Ga0207710_10049181 | Ga0207710_100491811 | 355 |
| 69 | 3300025908 | Ga0207643_10162052 | Ga0207643_101620521 | 355 |
| 70 | 3300025914 | Ga0207671_10060489 | Ga0207671_100604892 | 355 |
| 71 | 3300025914 | Ga0207671_10298658 | Ga0207671_102986581 | 355 |
| 72 | 3300025924 | Ga0207694_10120189 | Ga0207694_101201891 | 355 |
| 73 | 3300025933 | Ga0207706_10100152 | Ga0207706_101001523 | 355 |
| 74 | 3300025942 | Ga0207689_10048731 | Ga0207689_100487311 | 355 |
| 75 | 3300025949 | Ga0207667_10065888 | Ga0207667_100658881 | 355 |
| 76 | 3300026035 | Ga0207703_10131305 | Ga0207703_101313052 | 355 |
| 77 | 3300026075 | Ga0207708_10026957 | Ga0207708_100269573 | 355 |
| 78 | 3300026078 | Ga0207702_10062730 | Ga0207702_100627302 | 355 |
| 79 | 3300028379 | Ga0268266_10012507 | Ga0268266_100125073 | 355 |
| 80 | 3300028381 | Ga0268264_10059682 | Ga0268264_100596821 | 355 |
| 81 | 3300046558 | Ga0495633_0023884 | Ga0495633_0023884_42_1175 | 355 |
| 82 | 3300046691 | Ga0495670_0080042 | Ga0495670_0080042_181_1314 | 355 |
| 83 | 3300048916 | Ga0496113_0092663 | Ga0496113_0092663_213_1346 | 355 |
| 84 | 3300009098 | Ga0105245_10057229 | Ga0105245_100572292 | 356 |
| 85 | 3300009545 | Ga0105237_10107223 | Ga0105237_101072232 | 356 |
| 86 | 3300010375 | Ga0105239_10214348 | Ga0105239_102143482 | 356 |
| 87 | 3300037471 | Ga0395905_0040874 | Ga0395905_0040874_104_1237 | 356 |
| 88 | 3300044684 | Ga0466966_0059106 | Ga0466966_0059106_1229_2398 | 356 |
| 89 | 3300044693 | Ga0466961_0000488 | Ga0466961_0000488_16515_17684 | 356 |
| 90 | 3300045049 | Ga0466959_0001793 | Ga0466959_0001793_8681_9850 | 356 |
| 91 | 3300046522 | Ga0495643_0005874 | Ga0495643_0005874_2038_3207 | 356 |
| 92 | 3300046616 | Ga0495668_0025430 | Ga0495668_0025430_1263_2432 | 356 |
| 93 | 3300048091 | Ga0495626_0056236 | Ga0495626_0056236_352_1521 | 356 |
| 94 | 3300048905 | Ga0496102_0245913 | Ga0496102_0245913_358_1527 | 356 |
| 95 | 3300048906 | Ga0496103_0021272 | Ga0496103_0021272_730_1899 | 356 |
| 96 | 3300048908 | Ga0496105_0131830 | Ga0496105_0131830_106_1275 | 356 |
| 97 | 3300048912 | Ga0496109_0081686 | Ga0496109_0081686_1555_2724 | 356 |
| 98 | 3300048913 | Ga0496110_0036833 | Ga0496110_0036833_512_1681 | 356 |
| 99 | 3300048923 | Ga0496120_0070150 | Ga0496120_0070150_329_1498 | 356 |
| 100 | 3300048928 | Ga0496125_0054112 | Ga0496125_0054112_531_1700 | 356 |
| 101 | 3300050490 | nmdc:mga03n38_49491_c1 | nmdc:mga03n38_49491_c1_271_1440 | 356 |
| 102 | 3300050492 | nmdc:mga0yw44_61146_c1 | nmdc:mga0yw44_61146_c1_492_1661 | 356 |
| 103 | iso_pu_bacteria | 8019538911 | 8019544059 | 356 |
| 104 | 3300005539 | Ga0068853_100033886 | Ga0068853_1000338862 | 357 |
| 105 | 3300009177 | Ga0105248_10044529 | Ga0105248_100445293 | 357 |
| 106 | 3300009545 | Ga0105237_10130880 | Ga0105237_101308802 | 357 |
| 107 | 3300009551 | Ga0105238_10115534 | Ga0105238_101155342 | 357 |
| 108 | 3300010375 | Ga0105239_10115649 | Ga0105239_101156492 | 357 |
| 109 | 3300013308 | Ga0157375_10068523 | Ga0157375_100685232 | 357 |
| 110 | 3300025297 | Ga0209758_1003783 | Ga0209758_10037832 | 357 |
| 111 | 3300044842 | Ga0466957_0072150 | Ga0466957_0072150_317_1435 | 357 |
| 112 | 3300048924 | Ga0496121_0136742 | Ga0496121_0136742_460_1641 | 357 |
| 113 | 3300050496 | nmdc:mga07m45_84756_c1 | nmdc:mga07m45_84756_c1_230_1411 | 357 |
| 114 | 3300005434 | Ga0070709_10009552 | Ga0070709_100095524 | 358 |
| 115 | 3300005436 | Ga0070713_100056049 | Ga0070713_1000560492 | 358 |
| 116 | 3300005437 | Ga0070710_10026057 | Ga0070710_100260573 | 358 |
| 117 | 3300006173 | Ga0070716_100043115 | Ga0070716_1000431151 | 358 |
| 118 | 3300025906 | Ga0207699_10016956 | Ga0207699_100169562 | 358 |
| 119 | 3300025915 | Ga0207693_10003576 | Ga0207693_100035765 | 358 |
| 120 | 3300025928 | Ga0207700_10024997 | Ga0207700_100249972 | 358 |
| 121 | 3300025939 | Ga0207665_10046251 | Ga0207665_100462511 | 358 |
| 122 | 3300048929 | Ga0496126_0247566 | Ga0496126_0247566_154_1293 | 358 |
| 123 | 3300034818 | Ga0373950_0019305 | Ga0373950_0019305_47_1126 | 359 |
| 124 | 3300041498 | Ga0451841_0656306 | Ga0451841_0656306_651_1784 | 359 |
| 125 | 3300044694 | Ga0466963_0210833 | Ga0466963_0210833_242_1321 | 359 |
| 126 | 3300045976 | Ga0466967_0089021 | Ga0466967_0089021_1644_2777 | 359 |
| 127 | 3300053119 | Ga0500595_005314 | Ga0500595_005314_2782_3861 | 359 |
| 128 | 3300005439 | Ga0070711_100025668 | Ga0070711_1000256682 | 360 |
| 129 | 3300046524 | Ga0495648_0000160 | Ga0495648_0000160_2626_3753 | 360 |
| 130 | 3300053119 | Ga0500595_033870 | Ga0500595_033870_468_1649 | 360 |
| 131 | 3300053131 | Ga0500652_000002 | Ga0500652_000002_250688_251869 | 360 |
| 132 | 3300026078 | Ga0207702_10014864 | Ga0207702_100148642 | 361 |
| 133 | 3300050511 | nmdc:mga08y16_215054_c1 | nmdc:mga08y16_215054_c1_680_1813 | 362 |
| 134 | 3300025900 | Ga0207710_10005124 | Ga0207710_100051242 | 363 |
| 135 | 3300033180 | Ga0307510_10056016 | Ga0307510_100560162 | 363 |
| 136 | 3300046461 | Ga0495641_0004740 | Ga0495641_0004740_8346_9437 | 363 |
| 137 | 3300049569 | Ga0501032_0051663 | Ga0501032_0051663_933_2063 | 363 |
| 138 | 3300049571 | Ga0501034_0063889 | Ga0501034_0063889_1130_2260 | 363 |
| 139 | 3300049572 | Ga0501036_0262814 | Ga0501036_0262814_20_1111 | 363 |
| 140 | 3300049574 | Ga0501038_0109579 | Ga0501038_0109579_910_2046 | 363 |
| 141 | 3300049579 | Ga0501043_0058864 | Ga0501043_0058864_799_1929 | 363 |
| 142 | 3300049823 | Ga0501044_0002968 | Ga0501044_0002968_4001_5137 | 363 |
| 143 | 3300049823 | Ga0501044_0032967 | Ga0501044_0032967_4292_5422 | 363 |
| 144 | 3300046559 | Ga0495667_0085530 | Ga0495667_0085530_699_1835 | 364 |
| 145 | 3300006038 | Ga0075365_10075902 | Ga0075365_100759022 | 365 |
| 146 | 3300050492 | nmdc:mga0yw44_12510_c1 | nmdc:mga0yw44_12510_c1_2488_3621 | 365 |
| 147 | iso_pu_bacteria | 8016530956 | 8016535720 | 366 |
| 148 | 3300048924 | Ga0496121_0038986 | Ga0496121_0038986_1688_2857 | 367 |
| 149 | 3300053130 | Ga0500642_0005774 | Ga0500642_0005774_2041_3174 | 367 |
| 150 | 3300049580 | Ga0501046_0129766 | Ga0501046_0129766_111_1244 | 368 |
| 151 | 3300053155 | Ga0500620_040830 | Ga0500620_040830_216_1388 | 368 |
| 152 | 3300031711 | Ga0265314_10000937 | Ga0265314_100009377 | 370 |
| 153 | 3300046460 | Ga0495638_0027548 | Ga0495638_0027548_2054_3223 | 370 |
| 154 | 3300053103 | Ga0500555_004466 | Ga0500555_004466_1087_2256 | 370 |
| 155 | 3300053130 | Ga0500642_0018933 | Ga0500642_0018933_782_1951 | 370 |
| 156 | 3300053133 | Ga0500655_009783 | Ga0500655_009783_417_1586 | 370 |
| 157 | 3300053139 | Ga0500568_0010830 | Ga0500568_0010830_1574_2743 | 370 |
| 158 | 3300053161 | Ga0500634_0045659 | Ga0500634_0045659_543_1712 | 370 |
| 159 | 3300053087 | Ga0500643_000025 | Ga0500643_000025_236765_237934 | 371 |
| 160 | 3300005937 | Ga0081455_10006971 | Ga0081455_100069712 | 372 |
| 161 | 3300009551 | Ga0105238_10438701 | Ga0105238_104387011 | 372 |
| 162 | 3300013296 | Ga0157374_10028873 | Ga0157374_100288732 | 372 |
| 163 | 3300013297 | Ga0157378_10080822 | Ga0157378_100808223 | 372 |
| 164 | 3300013308 | Ga0157375_10013452 | Ga0157375_100134527 | 372 |
| 165 | 3300014325 | Ga0163163_10008664 | Ga0163163_100086643 | 372 |
| 166 | 3300014969 | Ga0157376_10014470 | Ga0157376_100144703 | 372 |
| 167 | 3300035695 | Ga0373927_0010994 | Ga0373927_0010994_4358_5485 | 372 |
| 168 | 3300038443 | Ga0395901_0277399 | Ga0395901_0277399_49_1176 | 372 |
| 169 | 3300041512 | Ga0451853_2103515 | Ga0451853_2103515_237_1364 | 372 |
| 170 | 3300048903 | Ga0496100_0045674 | Ga0496100_0045674_637_1764 | 372 |
| 171 | 3300048904 | Ga0496101_0021499 | Ga0496101_0021499_1220_2347 | 372 |
| 172 | 3300048905 | Ga0496102_0002395 | Ga0496102_0002395_9088_10215 | 372 |
| 173 | 3300048907 | Ga0496104_0094983 | Ga0496104_0094983_253_1380 | 372 |
| 174 | 3300048909 | Ga0496106_0049188 | Ga0496106_0049188_1304_2431 | 372 |
| 175 | 3300048910 | Ga0496107_0120047 | Ga0496107_0120047_190_1317 | 372 |
| 176 | 3300048912 | Ga0496109_0035755 | Ga0496109_0035755_2515_3642 | 372 |
| 177 | 3300048914 | Ga0496111_0087417 | Ga0496111_0087417_386_1513 | 372 |
| 178 | 3300048915 | Ga0496112_0088109 | Ga0496112_0088109_253_1380 | 372 |
| 179 | 3300048916 | Ga0496113_0042654 | Ga0496113_0042654_384_1511 | 372 |
| 180 | 3300048917 | Ga0496114_0057168 | Ga0496114_0057168_1259_2386 | 372 |
| 181 | 3300048918 | Ga0496115_0000788 | Ga0496115_0000788_8055_9182 | 372 |
| 182 | 3300048924 | Ga0496121_0000495 | Ga0496121_0000495_17636_18763 | 372 |
| 183 | 3300053727 | Ga0500611_013032 | Ga0500611_013032_90_1217 | 372 |
| 184 | iso_pu_bacteria | 2507262055 | 2507509414 | 372 |
| 185 | iso_pu_bacteria | 2508501009 | 2508543456 | 372 |
| 186 | iso_pu_bacteria | 2508501042 | 2508698767 | 372 |
| 187 | iso_pu_bacteria | 2508501128 | 2509147224 | 372 |
| 188 | iso_pu_bacteria | 2511231028 | 2511398426 | 372 |
| 189 | iso_pu_bacteria | 2513237092 | 2513628265 | 372 |
| 190 | iso_pu_bacteria | 2513237094 | 2513637978 | 372 |
| 191 | iso_pu_bacteria | 2513237095 | 2513646583 | 372 |
| 192 | iso_pu_bacteria | 2513237101 | 2513691775 | 372 |
| 193 | iso_pu_bacteria | 2513237102 | 2513702027 | 372 |
| 194 | iso_pu_bacteria | 2513237104 | 2513717499 | 372 |
| 195 | iso_pu_bacteria | 2513237137 | 2513858588 | 372 |
| 196 | iso_pu_bacteria | 2513237139 | 2513876390 | 372 |
| 197 | iso_pu_bacteria | 2513237145 | 2513917807 | 372 |
| 198 | iso_pu_bacteria | 2513237161 | 2514010730 | 372 |
| 199 | iso_pu_bacteria | 2517093001 | 2517102072 | 372 |
| 200 | iso_pu_bacteria | 2524023228 | 2524539331 | 372 |
| 201 | iso_pu_bacteria | 2528768022 | 2528855969 | 372 |
| 202 | iso_pu_bacteria | 2617270735 | 2617352242 | 372 |
| 203 | iso_pu_bacteria | 2617270741 | 2617376535 | 372 |
| 204 | iso_pu_bacteria | 2667528175 | 2671117779 | 372 |
| 205 | iso_pu_bacteria | 2721755755 | 2723845810 | 372 |
| 206 | iso_pu_bacteria | 2728368998 | 2728754620 | 372 |
| 207 | iso_pu_bacteria | 2791355196 | 2793064840 | 372 |
| 208 | iso_pu_bacteria | 2791355197 | 2793069987 | 372 |
| 209 | iso_pu_bacteria | 2791355199 | 2793077197 | 372 |
| 210 | iso_pu_bacteria | 2802429603 | 2805920132 | 372 |
| 211 | iso_pu_bacteria | 2816332527 | 2818240224 | 372 |
| 212 | iso_pu_bacteria | 2824600985 | 2824604215 | 372 |
| 213 | iso_pu_bacteria | 2824609381 | 2824613204 | 372 |
| 214 | iso_pu_bacteria | 2824617872 | 2824619765 | 372 |
| 215 | iso_pu_bacteria | 2824626560 | 2824629373 | 372 |
| 216 | iso_pu_bacteria | 2824635225 | 2824641171 | 372 |
| 217 | iso_pu_bacteria | 2824644064 | 2824647134 | 372 |
| 218 | iso_pu_bacteria | 2824653114 | 2824657537 | 372 |
| 219 | iso_pu_bacteria | 2824661429 | 2824666648 | 372 |
| 220 | iso_pu_bacteria | 2824671348 | 2824674706 | 372 |
| 221 | iso_pu_bacteria | 2824679649 | 2824683720 | 372 |
| 222 | iso_pu_bacteria | 2824687955 | 2824692885 | 372 |
| 223 | iso_pu_bacteria | 2824696289 | 2824699179 | 372 |
| 224 | iso_pu_bacteria | 2824704595 | 2824710505 | 372 |
| 225 | iso_pu_bacteria | 2824714736 | 2824717262 | 372 |
| 226 | iso_pu_bacteria | 2824723954 | 2824727520 | 372 |
| 227 | iso_pu_bacteria | 2824732956 | 2824739973 | 372 |
| 228 | iso_pu_bacteria | 2824746037 | 2824749646 | 372 |
| 229 | iso_pu_bacteria | 2824753945 | 2824760200 | 372 |
| 230 | iso_pu_bacteria | 2824763712 | 2824767189 | 372 |
| 231 | iso_pu_bacteria | 2824773399 | 2824780655 | 372 |
| 232 | iso_pu_bacteria | 2838122688 | 2838126613 | 372 |
| 233 | iso_pu_bacteria | 2841941048 | 2841947267 | 372 |
| 234 | iso_pu_bacteria | 2841949485 | 2841950712 | 372 |
| 235 | iso_pu_bacteria | 2841957949 | 2841964400 | 372 |
| 236 | iso_pu_bacteria | 2841966195 | 2841967029 | 372 |
| 237 | iso_pu_bacteria | 2841974524 | 2841975774 | 372 |
| 238 | iso_pu_bacteria | 2841983080 | 2841990141 | 372 |
| 239 | iso_pu_bacteria | 2842038055 | 2842039822 | 372 |
| 240 | iso_pu_bacteria | 2842045827 | 2842047232 | 372 |
| 241 | iso_pu_bacteria | 2844315083 | 2844318318 | 372 |
| 242 | iso_pu_bacteria | 2847930680 | 2847935195 | 372 |
| 243 | iso_pu_bacteria | 2847939898 | 2847945794 | 372 |
| 244 | iso_pu_bacteria | 2849076700 | 2849080065 | 372 |
| 245 | iso_pu_bacteria | 2857509624 | 2857510559 | 372 |
| 246 | iso_pu_bacteria | 2874590934 | 2874597508 | 372 |
| 247 | iso_pu_bacteria | 2874604998 | 2874609540 | 372 |
| 248 | iso_pu_bacteria | 2874612657 | 2874612780 | 372 |
| 249 | iso_pu_bacteria | 2874620515 | 2874627094 | 372 |
| 250 | iso_pu_bacteria | 2874628541 | 2874636324 | 372 |
| 251 | iso_pu_bacteria | 2876761206 | 2876770805 | 372 |
| 252 | iso_pu_bacteria | 2876771140 | 2876777695 | 372 |
| 253 | iso_pu_bacteria | 2876808645 | 2876810959 | 372 |
| 254 | iso_pu_bacteria | 2876818435 | 2876822546 | 372 |
| 255 | iso_pu_bacteria | 2879074833 | 2879078103 | 372 |
| 256 | iso_pu_bacteria | 2879083081 | 2879090159 | 372 |
| 257 | iso_pu_bacteria | 2879099564 | 2879102939 | 372 |
| 258 | iso_pu_bacteria | 2879110137 | 2879115684 | 372 |
| 259 | iso_pu_bacteria | 2879127579 | 2879134556 | 372 |
| 260 | iso_pu_bacteria | 2879142872 | 2879149909 | 372 |
| 261 | iso_pu_bacteria | 2881364244 | 2881366641 | 372 |
| 262 | iso_pu_bacteria | 2881665667 | 2881669605 | 372 |
| 263 | iso_pu_bacteria | 2885366525 | 2885373295 | 372 |
| 264 | iso_pu_bacteria | 2885374607 | 2885374738 | 372 |
| 265 | iso_pu_bacteria | 2888378607 | 2888383255 | 372 |
| 266 | iso_pu_bacteria | 2888388044 | 2888394655 | 372 |
| 267 | iso_pu_bacteria | 2888419890 | 2888423637 | 372 |
| 268 | iso_pu_bacteria | 2889033259 | 2889040652 | 372 |
| 269 | iso_pu_bacteria | 2903727486 | 2903729265 | 372 |
| 270 | iso_pu_bacteria | 2903748898 | 2903750901 | 372 |
| 271 | iso_pu_bacteria | 2904666416 | 2904669795 | 372 |
| 272 | iso_pu_bacteria | 2904699407 | 2904704005 | 372 |
| 273 | iso_pu_bacteria | 2904711408 | 2904717094 | 372 |
| 274 | iso_pu_bacteria | 2906602504 | 2906605211 | 372 |
| 275 | iso_pu_bacteria | 2906610324 | 2906617646 | 372 |
| 276 | iso_pu_bacteria | 2906626472 | 2906631489 | 372 |
| 277 | iso_pu_bacteria | 2906635258 | 2906640859 | 372 |
| 278 | iso_pu_bacteria | 2906643746 | 2906645898 | 372 |
| 279 | iso_pu_bacteria | 2906660503 | 2906661343 | 372 |
| 280 | iso_pu_bacteria | 2908739725 | 2908743536 | 372 |
| 281 | iso_pu_bacteria | 2908775508 | 2908779359 | 372 |
| 282 | iso_pu_bacteria | 2922361189 | 2922367756 | 372 |
| 283 | iso_pu_bacteria | 2922368715 | 2922373418 | 372 |
| 284 | iso_pu_bacteria | 2922386360 | 2922392340 | 372 |
| 285 | iso_pu_bacteria | 2922393267 | 2922395569 | 372 |
| 286 | iso_pu_bacteria | 2922425934 | 2922429343 | 372 |
| 287 | iso_pu_bacteria | 2929615660 | 2929617165 | 372 |
| 288 | iso_pu_bacteria | 2929624759 | 2929626869 | 372 |
| 289 | iso_pu_bacteria | 2932784394 | 2932793189 | 372 |
| 290 | iso_pu_bacteria | 2932794094 | 2932796436 | 372 |
| 291 | iso_pu_bacteria | 2932801729 | 2932808943 | 372 |
| 292 | iso_pu_bacteria | 2932809354 | 2932813028 | 372 |
| 293 | iso_pu_bacteria | 2932818245 | 2932821121 | 372 |
| 294 | iso_pu_bacteria | 2932828146 | 2932836771 | 372 |
| 295 | iso_pu_bacteria | 2933577622 | 2933579122 | 372 |
| 296 | iso_pu_bacteria | 2935608549 | 2935611701 | 372 |
| 297 | iso_pu_bacteria | 2935616580 | 2935621536 | 372 |
| 298 | iso_pu_bacteria | 2935630451 | 2935634082 | 372 |
| 299 | iso_pu_bacteria | 2935638405 | 2935645469 | 372 |
| 300 | iso_pu_bacteria | 2935648319 | 2935651778 | 372 |
| 301 | iso_pu_bacteria | 2935656913 | 2935660588 | 372 |
| 302 | iso_pu_bacteria | 2935665750 | 2935667587 | 372 |
| 303 | iso_pu_bacteria | 2935675223 | 2935681749 | 372 |
| 304 | iso_pu_bacteria | 2935684952 | 2935688335 | 372 |
| 305 | iso_pu_bacteria | 2935694250 | 2935699018 | 372 |
| 306 | iso_pu_bacteria | 2935703347 | 2935706399 | 372 |
| 307 | iso_pu_bacteria | 2935713505 | 2935715354 | 372 |
| 308 | iso_pu_bacteria | 2935722832 | 2935726082 | 372 |
| 309 | iso_pu_bacteria | 2935732158 | 2935734173 | 372 |
| 310 | iso_pu_bacteria | 2935741537 | 2935743552 | 372 |
| 311 | iso_pu_bacteria | 2935750917 | 2935754411 | 372 |
| 312 | iso_pu_bacteria | 2935760218 | 2935768473 | 372 |
| 313 | iso_pu_bacteria | 2935769743 | 2935774087 | 372 |
| 314 | iso_pu_bacteria | 2935777560 | 2935780609 | 372 |
| 315 | iso_pu_bacteria | 2935785616 | 2935789543 | 372 |
| 316 | iso_pu_bacteria | 2935793552 | 2935797320 | 372 |
| 317 | iso_pu_bacteria | 2935801545 | 2935806606 | 372 |
| 318 | iso_pu_bacteria | 2935810662 | 2935813198 | 372 |
| 319 | iso_pu_bacteria | 2935819856 | 2935821179 | 372 |
| 320 | iso_pu_bacteria | 2935827899 | 2935830851 | 372 |
| 321 | iso_pu_bacteria | 2935837841 | 2935840877 | 372 |
| 322 | iso_pu_bacteria | 2935847175 | 2935850561 | 372 |
| 323 | iso_pu_bacteria | 2935855204 | 2935859783 | 372 |
| 324 | iso_pu_bacteria | 2935864058 | 2935869144 | 372 |
| 325 | iso_pu_bacteria | 2935873716 | 2935880663 | 372 |
| 326 | iso_pu_bacteria | 2935883170 | 2935886655 | 372 |
| 327 | iso_pu_bacteria | 2935908558 | 2935914161 | 372 |
| 328 | iso_pu_bacteria | 2935916978 | 2935921331 | 372 |
| 329 | iso_pu_bacteria | 2935926038 | 2935931650 | 372 |
| 330 | iso_pu_bacteria | 2935934488 | 2935940415 | 372 |
| 331 | iso_pu_bacteria | 2935942939 | 2935947760 | 372 |
| 332 | iso_pu_bacteria | 2935951376 | 2935956699 | 372 |
| 333 | iso_pu_bacteria | 2935959822 | 2935965742 | 372 |
| 334 | iso_pu_bacteria | 2935967501 | 2935973492 | 372 |
| 335 | iso_pu_bacteria | 2935975950 | 2935980899 | 372 |
| 336 | iso_pu_bacteria | 2935984226 | 2935990387 | 372 |
| 337 | iso_pu_bacteria | 2935992306 | 2936000939 | 372 |
| 338 | iso_pu_bacteria | 2936002035 | 2936010197 | 372 |
| 339 | iso_pu_bacteria | 2936011229 | 2936014644 | 372 |
| 340 | iso_pu_bacteria | 2936019824 | 2936023559 | 372 |
| 341 | iso_pu_bacteria | 2936028420 | 2936032587 | 372 |
| 342 | iso_pu_bacteria | 2936037263 | 2936043750 | 372 |
| 343 | iso_pu_bacteria | 2936046547 | 2936050385 | 372 |
| 344 | iso_pu_bacteria | 2936055302 | 2936059123 | 372 |
| 345 | iso_pu_bacteria | 2940556831 | 2940560213 | 372 |
| 346 | iso_pu_bacteria | 2941507105 | 2941510973 | 372 |
| 347 | iso_pu_bacteria | 2941515067 | 2941518357 | 372 |
| 348 | iso_pu_bacteria | 2941523033 | 2941527380 | 372 |
| 349 | iso_pu_bacteria | 2941531003 | 2941534074 | 372 |
| 350 | iso_pu_bacteria | 2941538514 | 2941540992 | 372 |
| 351 | iso_pu_bacteria | 3005474847 | 3005479511 | 372 |
| 352 | iso_pu_bacteria | 3005483717 | 3005489399 | 372 |
| 353 | iso_pu_bacteria | 3005506211 | 3005511820 | 372 |
| 354 | iso_pu_bacteria | 3005587118 | 3005588537 | 372 |
| 355 | iso_pu_bacteria | 3005594810 | 3005598410 | 372 |
| 356 | iso_pu_bacteria | 3005710791 | 3005714101 | 372 |
| 357 | iso_pu_bacteria | 3005718088 | 3005721576 | 372 |
| 358 | iso_pu_bacteria | 8006926726 | 8006930861 | 372 |
| 359 | iso_pu_bacteria | 8006933436 | 8006941629 | 372 |
| 360 | iso_pu_bacteria | 8006964411 | 8006971935 | 372 |
| 361 | iso_pu_bacteria | 8006973647 | 8006981339 | 372 |
| 362 | iso_pu_bacteria | 8006984368 | 8006990347 | 372 |
| 363 | iso_pu_bacteria | 8006994254 | 8006996427 | 372 |
| 364 | iso_pu_bacteria | 8016511872 | 8016514260 | 372 |
| 365 | iso_pu_bacteria | 8016522445 | 8016530449 | 372 |
| 366 | iso_pu_bacteria | 8016539877 | 8016540003 | 372 |
| 367 | iso_pu_bacteria | 8016548790 | 8016553232 | 372 |
| 368 | iso_pu_bacteria | 8016557553 | 8016561608 | 372 |
| 369 | iso_pu_bacteria | 8016566248 | 8016574058 | 372 |
| 370 | iso_pu_bacteria | 8016575299 | 8016578173 | 372 |
| 371 | iso_pu_bacteria | 8016583857 | 8016592842 | 372 |
| 372 | iso_pu_bacteria | 8016595262 | 8016599448 | 372 |
| 373 | iso_pu_bacteria | 8016603502 | 8016611541 | 372 |
| 374 | iso_pu_bacteria | 8016613128 | 8016622255 | 372 |
| 375 | iso_pu_bacteria | 8016622563 | 8016627639 | 372 |
| 376 | iso_pu_bacteria | 8016630954 | 8016631856 | 372 |
| 377 | iso_pu_bacteria | 8017057580 | 8017062163 | 372 |
| 378 | iso_pu_bacteria | 8019547302 | 8019554745 | 372 |
| 379 | iso_pu_bacteria | 8019555841 | 8019557550 | 372 |
| 380 | iso_pu_bacteria | 8019565922 | 8019567747 | 372 |
| 381 | iso_pu_bacteria | 8019586578 | 8019589247 | 372 |
| 382 | iso_pu_bacteria | 8019597564 | 8019601984 | 372 |
| 383 | iso_pu_bacteria | 8019608314 | 8019616566 | 372 |
| 384 | iso_pu_bacteria | 8019619141 | 8019627282 | 372 |
| 385 | iso_pu_bacteria | 8019629233 | 8019635289 | 372 |
| 386 | iso_pu_bacteria | 8019638758 | 8019644410 | 372 |
| 387 | iso_pu_bacteria | 8019648815 | 8019657447 | 372 |
| 388 | iso_pu_bacteria | 8019659431 | 8019663128 | 372 |
| 389 | iso_pu_bacteria | 8019668869 | 8019672727 | 372 |
| 390 | iso_pu_bacteria | 8019687851 | 8019689168 | 372 |
| 391 | iso_pu_bacteria | 8055742211 | 8055747220 | 372 |
| 392 | iso_pu_bacteria | 8056673599 | 8056674570 | 372 |
| 393 | iso_pu_bacteria | 8056689827 | 8056690225 | 372 |
| 394 | iso_pu_bacteria | 8056967851 | 8056972678 | 372 |
| 395 | 3300005329 | Ga0070683_100037262 | Ga0070683_1000372623 | 373 |
| 396 | 3300005336 | Ga0070680_100064157 | Ga0070680_1000641572 | 373 |
| 397 | 3300005435 | Ga0070714_100080180 | Ga0070714_1000801802 | 373 |
| 398 | 3300005458 | Ga0070681_10149181 | Ga0070681_101491812 | 373 |
| 399 | 3300005530 | Ga0070679_100053634 | Ga0070679_1000536342 | 373 |
| 400 | 3300005535 | Ga0070684_100001878 | Ga0070684_10000187810 | 373 |
| 401 | 3300009545 | Ga0105237_10028844 | Ga0105237_100288442 | 373 |
| 402 | 3300009551 | Ga0105238_10014756 | Ga0105238_100147563 | 373 |
| 403 | 3300010375 | Ga0105239_10333750 | Ga0105239_103337502 | 373 |
| 404 | 3300021384 | Ga0213876_10010209 | Ga0213876_100102092 | 373 |
| 405 | 3300025912 | Ga0207707_10290578 | Ga0207707_102905781 | 373 |
| 406 | 3300025917 | Ga0207660_10131566 | Ga0207660_101315661 | 373 |
| 407 | 3300025917 | Ga0207660_10173059 | Ga0207660_101730591 | 373 |
| 408 | 3300025921 | Ga0207652_10108241 | Ga0207652_101082412 | 373 |
| 409 | 3300025921 | Ga0207652_10126019 | Ga0207652_101260192 | 373 |
| 410 | 3300025929 | Ga0207664_10071396 | Ga0207664_100713962 | 373 |
| 411 | 3300025944 | Ga0207661_10001198 | Ga0207661_100011982 | 373 |
| 412 | 3300026118 | Ga0207675_100160034 | Ga0207675_1001600342 | 373 |
| 413 | 3300028380 | Ga0268265_10106090 | Ga0268265_101060902 | 373 |
| 414 | 3300037466 | Ga0395898_0053862 | Ga0395898_0053862_1709_2863 | 373 |
| 415 | 3300045976 | Ga0466967_0047594 | Ga0466967_0047594_1782_2918 | 373 |
| 416 | 3300046462 | Ga0495651_0040742 | Ga0495651_0040742_1121_2251 | 373 |
| 417 | 3300046543 | Ga0495645_0005022 | Ga0495645_0005022_5615_6745 | 373 |
| 418 | 3300046678 | Ga0495599_0128534 | Ga0495599_0128534_416_1546 | 373 |
| 419 | 3300048913 | Ga0496110_0030245 | Ga0496110_0030245_1101_2258 | 373 |
| 420 | 3300053078 | Ga0495612_0032405 | Ga0495612_0032405_368_1498 | 373 |
| 421 | 3300003203 | JGI25406J46586_10000006 | JGI25406J46586_10000006119 | 374 |
| 422 | 3300003215 | JGI25153J46596_10011119 | JGI25153J46596_100111192 | 374 |
| 423 | 3300003320 | rootH2_10006936 | rootH2_100069362 | 374 |
| 424 | 3300003354 | JGI25160J50197_1002805 | JGI25160J50197_10028052 | 374 |
| 425 | 3300003354 | JGI25160J50197_1006702 | JGI25160J50197_10067022 | 374 |
| 426 | 3300003354 | JGI25160J50197_1014046 | JGI25160J50197_10140462 | 374 |
| 427 | 3300003659 | JGI25404J52841_10009757 | JGI25404J52841_100097572 | 374 |
| 428 | 3300003659 | JGI25404J52841_10015760 | JGI25404J52841_100157601 | 374 |
| 429 | 3300003659 | JGI25404J52841_10017024 | JGI25404J52841_100170241 | 374 |
| 430 | 3300003794 | Ga0055531_10007030 | Ga0055531_100070302 | 374 |
| 431 | 3300003794 | Ga0055531_10011902 | Ga0055531_100119022 | 374 |
| 432 | 3300005262 | Ga0065165_1001864 | Ga0065165_10018642 | 374 |
| 433 | 3300005262 | Ga0065165_1003443 | Ga0065165_10034432 | 374 |
| 434 | 3300005262 | Ga0065165_1009002 | Ga0065165_10090022 | 374 |
| 435 | 3300005329 | Ga0070683_100035409 | Ga0070683_1000354096 | 374 |
| 436 | 3300005329 | Ga0070683_100052002 | Ga0070683_1000520023 | 374 |
| 437 | 3300005335 | Ga0070666_10088394 | Ga0070666_100883942 | 374 |
| 438 | 3300005336 | Ga0070680_100043913 | Ga0070680_1000439134 | 374 |
| 439 | 3300005336 | Ga0070680_100141650 | Ga0070680_1001416502 | 374 |
| 440 | 3300005336 | Ga0070680_100144976 | Ga0070680_1001449762 | 374 |
| 441 | 3300005338 | Ga0068868_100093972 | Ga0068868_1000939721 | 374 |
| 442 | 3300005339 | Ga0070660_100079663 | Ga0070660_1000796632 | 374 |
| 443 | 3300005339 | Ga0070660_100122875 | Ga0070660_1001228752 | 374 |
| 444 | 3300005344 | Ga0070661_100164901 | Ga0070661_1001649011 | 374 |
| 445 | 3300005366 | Ga0070659_100024129 | Ga0070659_1000241293 | 374 |
| 446 | 3300005366 | Ga0070659_100024651 | Ga0070659_1000246513 | 374 |
| 447 | 3300005366 | Ga0070659_100028527 | Ga0070659_1000285273 | 374 |
| 448 | 3300005434 | Ga0070709_10000337 | Ga0070709_100003379 | 374 |
| 449 | 3300005435 | Ga0070714_100003394 | Ga0070714_1000033949 | 374 |
| 450 | 3300005435 | Ga0070714_100047712 | Ga0070714_1000477123 | 374 |
| 451 | 3300005436 | Ga0070713_100013337 | Ga0070713_1000133372 | 374 |
| 452 | 3300005437 | Ga0070710_10000508 | Ga0070710_100005083 | 374 |
| 453 | 3300005439 | Ga0070711_100001466 | Ga0070711_10000146610 | 374 |
| 454 | 3300005439 | Ga0070711_100235686 | Ga0070711_1002356861 | 374 |
| 455 | 3300005455 | Ga0070663_100009242 | Ga0070663_1000092428 | 374 |
| 456 | 3300005455 | Ga0070663_100011245 | Ga0070663_1000112452 | 374 |
| 457 | 3300005457 | Ga0070662_100150677 | Ga0070662_1001506772 | 374 |
| 458 | 3300005458 | Ga0070681_10239330 | Ga0070681_102393302 | 374 |
| 459 | 3300005458 | Ga0070681_10309054 | Ga0070681_103090542 | 374 |
| 460 | 3300005518 | Ga0070699_100206232 | Ga0070699_1002062322 | 374 |
| 461 | 3300005530 | Ga0070679_100071810 | Ga0070679_1000718104 | 374 |
| 462 | 3300005536 | Ga0070697_100008498 | Ga0070697_1000084984 | 374 |
| 463 | 3300005539 | Ga0068853_100116264 | Ga0068853_1001162642 | 374 |
| 464 | 3300005543 | Ga0070672_100107871 | Ga0070672_1001078712 | 374 |
| 465 | 3300005548 | Ga0070665_100013576 | Ga0070665_1000135765 | 374 |
| 466 | 3300005563 | Ga0068855_100047028 | Ga0068855_1000470282 | 374 |
| 467 | 3300005563 | Ga0068855_100094063 | Ga0068855_1000940632 | 374 |
| 468 | 3300005563 | Ga0068855_100211125 | Ga0068855_1002111252 | 374 |
| 469 | 3300005577 | Ga0068857_100041731 | Ga0068857_1000417314 | 374 |
| 470 | 3300005578 | Ga0068854_100115076 | Ga0068854_1001150762 | 374 |
| 471 | 3300005616 | Ga0068852_100007822 | Ga0068852_1000078222 | 374 |
| 472 | 3300005616 | Ga0068852_100008036 | Ga0068852_1000080365 | 374 |
| 473 | 3300005616 | Ga0068852_100158279 | Ga0068852_1001582791 | 374 |
| 474 | 3300005719 | Ga0068861_100011588 | Ga0068861_1000115884 | 374 |
| 475 | 3300005842 | Ga0068858_100143074 | Ga0068858_1001430742 | 374 |
| 476 | 3300005843 | Ga0068860_100000058 | Ga0068860_10000005817 | 374 |
| 477 | 3300005937 | Ga0081455_10001781 | Ga0081455_100017812 | 374 |
| 478 | 3300005937 | Ga0081455_10008715 | Ga0081455_100087153 | 374 |
| 479 | 3300005937 | Ga0081455_10011757 | Ga0081455_100117576 | 374 |
| 480 | 3300005937 | Ga0081455_10065025 | Ga0081455_100650252 | 374 |
| 481 | 3300005937 | Ga0081455_10067399 | Ga0081455_100673992 | 374 |
| 482 | 3300005981 | Ga0081538_10020550 | Ga0081538_100205503 | 374 |
| 483 | 3300005983 | Ga0081540_1001631 | Ga0081540_10016312 | 374 |
| 484 | 3300005983 | Ga0081540_1004255 | Ga0081540_10042554 | 374 |
| 485 | 3300005983 | Ga0081540_1004483 | Ga0081540_100448310 | 374 |
| 486 | 3300005983 | Ga0081540_1024868 | Ga0081540_10248682 | 374 |
| 487 | 3300005983 | Ga0081540_1028613 | Ga0081540_10286132 | 374 |
| 488 | 3300005983 | Ga0081540_1036032 | Ga0081540_10360322 | 374 |
| 489 | 3300005983 | Ga0081540_1048679 | Ga0081540_10486791 | 374 |
| 490 | 3300005983 | Ga0081540_1049510 | Ga0081540_10495102 | 374 |
| 491 | 3300005985 | Ga0081539_10000176 | Ga0081539_100001762 | 374 |
| 492 | 3300005985 | Ga0081539_10000250 | Ga0081539_10000250126 | 374 |
| 493 | 3300006028 | Ga0070717_10001774 | Ga0070717_1000177415 | 374 |
| 494 | 3300006028 | Ga0070717_10076501 | Ga0070717_100765012 | 374 |
| 495 | 3300006028 | Ga0070717_10177685 | Ga0070717_101776852 | 374 |
| 496 | 3300006038 | Ga0075365_10000419 | Ga0075365_100004192 | 374 |
| 497 | 3300006038 | Ga0075365_10062063 | Ga0075365_100620632 | 374 |
| 498 | 3300006038 | Ga0075365_10068011 | Ga0075365_100680113 | 374 |
| 499 | 3300006048 | Ga0075363_100011206 | Ga0075363_1000112063 | 374 |
| 500 | 3300006048 | Ga0075363_100014293 | Ga0075363_1000142933 | 374 |
| 501 | 3300006051 | Ga0075364_10024554 | Ga0075364_100245542 | 374 |
| 502 | 3300006051 | Ga0075364_10036661 | Ga0075364_100366612 | 374 |
| 503 | 3300006163 | Ga0070715_10015563 | Ga0070715_100155632 | 374 |
| 504 | 3300006175 | Ga0070712_100028701 | Ga0070712_1000287012 | 374 |
| 505 | 3300006175 | Ga0070712_100054173 | Ga0070712_1000541733 | 374 |
| 506 | 3300006178 | Ga0075367_10001505 | Ga0075367_100015058 | 374 |
| 507 | 3300006178 | Ga0075367_10017943 | Ga0075367_100179432 | 374 |
| 508 | 3300006186 | Ga0075369_10015474 | Ga0075369_100154742 | 374 |
| 509 | 3300006237 | Ga0097621_100130695 | Ga0097621_1001306952 | 374 |
| 510 | 3300006871 | Ga0075434_100224791 | Ga0075434_1002247911 | 374 |
| 511 | 3300006881 | Ga0068865_100063969 | Ga0068865_1000639691 | 374 |
| 512 | 3300006881 | Ga0068865_100076320 | Ga0068865_1000763202 | 374 |
| 513 | 3300007265 | Ga0099794_10030328 | Ga0099794_100303282 | 374 |
| 514 | 3300007265 | Ga0099794_10032336 | Ga0099794_100323363 | 374 |
| 515 | 3300009093 | Ga0105240_10002351 | Ga0105240_100023512 | 374 |
| 516 | 3300009093 | Ga0105240_10214043 | Ga0105240_102140431 | 374 |
| 517 | 3300009094 | Ga0111539_10163205 | Ga0111539_101632052 | 374 |
| 518 | 3300009098 | Ga0105245_10064176 | Ga0105245_100641763 | 374 |
| 519 | 3300009148 | Ga0105243_10054594 | Ga0105243_100545942 | 374 |
| 520 | 3300009174 | Ga0105241_10093600 | Ga0105241_100936002 | 374 |
| 521 | 3300009545 | Ga0105237_10029668 | Ga0105237_100296682 | 374 |
| 522 | 3300009545 | Ga0105237_10035284 | Ga0105237_100352846 | 374 |
| 523 | 3300009545 | Ga0105237_10050719 | Ga0105237_100507193 | 374 |
| 524 | 3300009551 | Ga0105238_10041533 | Ga0105238_100415335 | 374 |
| 525 | 3300009551 | Ga0105238_10251576 | Ga0105238_102515762 | 374 |
| 526 | 3300009553 | Ga0105249_10122999 | Ga0105249_101229992 | 374 |
| 527 | 3300010159 | Ga0099796_10005576 | Ga0099796_100055762 | 374 |
| 528 | 3300013104 | Ga0157370_10087962 | Ga0157370_100879622 | 374 |
| 529 | 3300013104 | Ga0157370_10095364 | Ga0157370_100953642 | 374 |
| 530 | 3300013297 | Ga0157378_10003751 | Ga0157378_1000375110 | 374 |
| 531 | 3300013297 | Ga0157378_10087404 | Ga0157378_100874042 | 374 |
| 532 | 3300013306 | Ga0163162_10118191 | Ga0163162_101181911 | 374 |
| 533 | 3300013307 | Ga0157372_10052487 | Ga0157372_100524872 | 374 |
| 534 | 3300013307 | Ga0157372_10130464 | Ga0157372_101304642 | 374 |
| 535 | 3300014325 | Ga0163163_10094697 | Ga0163163_100946972 | 374 |
| 536 | 3300014968 | Ga0157379_10139071 | Ga0157379_101390711 | 374 |
| 537 | 3300014968 | Ga0157379_10163945 | Ga0157379_101639452 | 374 |
| 538 | 3300014969 | Ga0157376_10286641 | Ga0157376_102866411 | 374 |
| 539 | 3300021320 | Ga0214544_1000009 | Ga0214544_1000009136 | 374 |
| 540 | 3300021321 | Ga0214542_1000002 | Ga0214542_1000002578 | 374 |
| 541 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002142 | 374 |
| 542 | 3300021327 | Ga0214543_1000013 | Ga0214543_1000013180 | 374 |
| 543 | 3300021384 | Ga0213876_10061558 | Ga0213876_100615582 | 374 |
| 544 | 3300025230 | Ga0209563_102229 | Ga0209563_1022292 | 374 |
| 545 | 3300025245 | Ga0207425_1014717 | Ga0207425_10147172 | 374 |
| 546 | 3300025253 | Ga0209677_102751 | Ga0209677_1027515 | 374 |
| 547 | 3300025254 | Ga0209148_1009728 | Ga0209148_10097281 | 374 |
| 548 | 3300025261 | Ga0209233_1006768 | Ga0209233_10067681 | 374 |
| 549 | 3300025261 | Ga0209233_1009455 | Ga0209233_10094552 | 374 |
| 550 | 3300025272 | Ga0209455_1003608 | Ga0209455_10036084 | 374 |
| 551 | 3300025295 | Ga0209564_1003387 | Ga0209564_10033872 | 374 |
| 552 | 3300025295 | Ga0209564_1007161 | Ga0209564_10071612 | 374 |
| 553 | 3300025297 | Ga0209758_1000100 | Ga0209758_100010035 | 374 |
| 554 | 3300025297 | Ga0209758_1001008 | Ga0209758_10010086 | 374 |
| 555 | 3300025297 | Ga0209758_1001125 | Ga0209758_10011256 | 374 |
| 556 | 3300025297 | Ga0209758_1002793 | Ga0209758_10027936 | 374 |
| 557 | 3300025297 | Ga0209758_1005742 | Ga0209758_10057424 | 374 |
| 558 | 3300025297 | Ga0209758_1007434 | Ga0209758_10074341 | 374 |
| 559 | 3300025297 | Ga0209758_1015490 | Ga0209758_10154904 | 374 |
| 560 | 3300025297 | Ga0209758_1018121 | Ga0209758_10181212 | 374 |
| 561 | 3300025297 | Ga0209758_1035384 | Ga0209758_10353842 | 374 |
| 562 | 3300025299 | Ga0209256_1011371 | Ga0209256_10113712 | 374 |
| 563 | 3300025302 | Ga0207426_1001094 | Ga0207426_100109425 | 374 |
| 564 | 3300025302 | Ga0207426_1002241 | Ga0207426_10022412 | 374 |
| 565 | 3300025302 | Ga0207426_1011700 | Ga0207426_10117002 | 374 |
| 566 | 3300025304 | Ga0209257_1006404 | Ga0209257_10064046 | 374 |
| 567 | 3300025898 | Ga0207692_10001906 | Ga0207692_100019063 | 374 |
| 568 | 3300025899 | Ga0207642_10059548 | Ga0207642_100595482 | 374 |
| 569 | 3300025900 | Ga0207710_10074065 | Ga0207710_100740652 | 374 |
| 570 | 3300025903 | Ga0207680_10034129 | Ga0207680_100341292 | 374 |
| 571 | 3300025903 | Ga0207680_10089723 | Ga0207680_100897232 | 374 |
| 572 | 3300025905 | Ga0207685_10016774 | Ga0207685_100167742 | 374 |
| 573 | 3300025905 | Ga0207685_10041048 | Ga0207685_100410482 | 374 |
| 574 | 3300025906 | Ga0207699_10000604 | Ga0207699_100006046 | 374 |
| 575 | 3300025906 | Ga0207699_10113213 | Ga0207699_101132132 | 374 |
| 576 | 3300025909 | Ga0207705_10258940 | Ga0207705_102589401 | 374 |
| 577 | 3300025911 | Ga0207654_10012282 | Ga0207654_100122822 | 374 |
| 578 | 3300025912 | Ga0207707_10216760 | Ga0207707_102167602 | 374 |
| 579 | 3300025913 | Ga0207695_10000278 | Ga0207695_1000027887 | 374 |
| 580 | 3300025913 | Ga0207695_10155696 | Ga0207695_101556962 | 374 |
| 581 | 3300025914 | Ga0207671_10008450 | Ga0207671_100084506 | 374 |
| 582 | 3300025914 | Ga0207671_10011711 | Ga0207671_100117116 | 374 |
| 583 | 3300025915 | Ga0207693_10026628 | Ga0207693_100266282 | 374 |
| 584 | 3300025916 | Ga0207663_10004391 | Ga0207663_100043912 | 374 |
| 585 | 3300025917 | Ga0207660_10013547 | Ga0207660_100135472 | 374 |
| 586 | 3300025917 | Ga0207660_10203759 | Ga0207660_102037592 | 374 |
| 587 | 3300025919 | Ga0207657_10002222 | Ga0207657_100022228 | 374 |
| 588 | 3300025919 | Ga0207657_10011901 | Ga0207657_100119011 | 374 |
| 589 | 3300025919 | Ga0207657_10208983 | Ga0207657_102089832 | 374 |
| 590 | 3300025920 | Ga0207649_10148353 | Ga0207649_101483531 | 374 |
| 591 | 3300025924 | Ga0207694_10327293 | Ga0207694_103272931 | 374 |
| 592 | 3300025927 | Ga0207687_10089800 | Ga0207687_100898001 | 374 |
| 593 | 3300025927 | Ga0207687_10121518 | Ga0207687_101215181 | 374 |
| 594 | 3300025928 | Ga0207700_10000752 | Ga0207700_100007525 | 374 |
| 595 | 3300025928 | Ga0207700_10083339 | Ga0207700_100833392 | 374 |
| 596 | 3300025928 | Ga0207700_10173309 | Ga0207700_101733092 | 374 |
| 597 | 3300025929 | Ga0207664_10006080 | Ga0207664_100060805 | 374 |
| 598 | 3300025929 | Ga0207664_10040726 | Ga0207664_100407262 | 374 |
| 599 | 3300025932 | Ga0207690_10193582 | Ga0207690_101935822 | 374 |
| 600 | 3300025933 | Ga0207706_10043872 | Ga0207706_100438722 | 374 |
| 601 | 3300025935 | Ga0207709_10059282 | Ga0207709_100592821 | 374 |
| 602 | 3300025937 | Ga0207669_10112264 | Ga0207669_101122642 | 374 |
| 603 | 3300025938 | Ga0207704_10042852 | Ga0207704_100428522 | 374 |
| 604 | 3300025938 | Ga0207704_10087262 | Ga0207704_100872622 | 374 |
| 605 | 3300025939 | Ga0207665_10001395 | Ga0207665_100013956 | 374 |
| 606 | 3300025939 | Ga0207665_10116154 | Ga0207665_101161542 | 374 |
| 607 | 3300025940 | Ga0207691_10030847 | Ga0207691_100308474 | 374 |
| 608 | 3300025944 | Ga0207661_10250092 | Ga0207661_102500922 | 374 |
| 609 | 3300025949 | Ga0207667_10003512 | Ga0207667_1000351221 | 374 |
| 610 | 3300025949 | Ga0207667_10081109 | Ga0207667_100811092 | 374 |
| 611 | 3300025949 | Ga0207667_10411163 | Ga0207667_104111632 | 374 |
| 612 | 3300025961 | Ga0207712_10106695 | Ga0207712_101066952 | 374 |
| 613 | 3300026023 | Ga0207677_10105345 | Ga0207677_101053451 | 374 |
| 614 | 3300026035 | Ga0207703_10110533 | Ga0207703_101105332 | 374 |
| 615 | 3300026067 | Ga0207678_10018848 | Ga0207678_100188485 | 374 |
| 616 | 3300026067 | Ga0207678_10069106 | Ga0207678_100691062 | 374 |
| 617 | 3300026067 | Ga0207678_10132976 | Ga0207678_101329763 | 374 |
| 618 | 3300026075 | Ga0207708_10044185 | Ga0207708_100441852 | 374 |
| 619 | 3300026095 | Ga0207676_10075385 | Ga0207676_100753852 | 374 |
| 620 | 3300026116 | Ga0207674_10044955 | Ga0207674_100449554 | 374 |
| 621 | 3300026116 | Ga0207674_10434347 | Ga0207674_104343471 | 374 |
| 622 | 3300026118 | Ga0207675_100212226 | Ga0207675_1002122262 | 374 |
| 623 | 3300026121 | Ga0207683_10052738 | Ga0207683_100527382 | 374 |
| 624 | 3300026142 | Ga0207698_10017856 | Ga0207698_100178563 | 374 |
| 625 | 3300026142 | Ga0207698_10030256 | Ga0207698_100302562 | 374 |
| 626 | 3300026142 | Ga0207698_10048796 | Ga0207698_100487963 | 374 |
| 627 | 3300027296 | Ga0209389_1000084 | Ga0209389_100008414 | 374 |
| 628 | 3300027357 | Ga0209589_1000041 | Ga0209589_100004153 | 374 |
| 629 | 3300027361 | Ga0209489_100070 | Ga0209489_10007075 | 374 |
| 630 | 3300027363 | Ga0209700_100021 | Ga0209700_100021149 | 374 |
| 631 | 3300028379 | Ga0268266_10003050 | Ga0268266_1000305010 | 374 |
| 632 | 3300028379 | Ga0268266_10386438 | Ga0268266_103864382 | 374 |
| 633 | 3300028381 | Ga0268264_10000022 | Ga0268264_10000022280 | 374 |
| 634 | 3300028381 | Ga0268264_10254651 | Ga0268264_102546512 | 374 |
| 635 | 3300028786 | Ga0307517_10004643 | Ga0307517_100046433 | 374 |
| 636 | 3300028794 | Ga0307515_10013142 | Ga0307515_100131424 | 374 |
| 637 | 3300031235 | Ga0265330_10023016 | Ga0265330_100230162 | 374 |
| 638 | 3300031238 | Ga0265332_10053903 | Ga0265332_100539032 | 374 |
| 639 | 3300031241 | Ga0265325_10032658 | Ga0265325_100326581 | 374 |
| 640 | 3300031247 | Ga0265340_10011316 | Ga0265340_100113162 | 374 |
| 641 | 3300031247 | Ga0265340_10047250 | Ga0265340_100472502 | 374 |
| 642 | 3300031249 | Ga0265339_10007490 | Ga0265339_100074905 | 374 |
| 643 | 3300031344 | Ga0265316_10072256 | Ga0265316_100722562 | 374 |
| 644 | 3300031507 | Ga0307509_10008409 | Ga0307509_100084095 | 374 |
| 645 | 3300031595 | Ga0265313_10030588 | Ga0265313_100305882 | 374 |
| 646 | 3300031616 | Ga0307508_10000038 | Ga0307508_10000038101 | 374 |
| 647 | 3300031711 | Ga0265314_10003315 | Ga0265314_100033156 | 374 |
| 648 | 3300031711 | Ga0265314_10016661 | Ga0265314_100166614 | 374 |
| 649 | 3300031711 | Ga0265314_10142735 | Ga0265314_101427352 | 374 |
| 650 | 3300031712 | Ga0265342_10012895 | Ga0265342_100128952 | 374 |
| 651 | 3300031712 | Ga0265342_10054311 | Ga0265342_100543112 | 374 |
| 652 | 3300031730 | Ga0307516_10008870 | Ga0307516_100088708 | 374 |
| 653 | 3300031730 | Ga0307516_10048871 | Ga0307516_100488712 | 374 |
| 654 | 3300031730 | Ga0307516_10148099 | Ga0307516_101480991 | 374 |
| 655 | 3300031824 | Ga0307413_10033046 | Ga0307413_100330462 | 374 |
| 656 | 3300031995 | Ga0307409_100059109 | Ga0307409_1000591092 | 374 |
| 657 | 3300033180 | Ga0307510_10043585 | Ga0307510_100435853 | 374 |
| 658 | 3300033180 | Ga0307510_10045521 | Ga0307510_100455214 | 374 |
| 659 | 3300035119 | Ga0373956_0003375 | Ga0373956_0003375_632_1765 | 374 |
| 660 | 3300035120 | Ga0373957_0000100 | Ga0373957_0000100_19489_20622 | 374 |
| 661 | 3300035170 | Ga0373943_0037456 | Ga0373943_0037456_1130_2263 | 374 |
| 662 | 3300035172 | Ga0373955_0030199 | Ga0373955_0030199_1396_2529 | 374 |
| 663 | 3300035410 | Ga0373924_0004454 | Ga0373924_0004454_2210_3343 | 374 |
| 664 | 3300035695 | Ga0373927_0013017 | Ga0373927_0013017_4146_5279 | 374 |
| 665 | 3300035695 | Ga0373927_0014783 | Ga0373927_0014783_3107_4240 | 374 |
| 666 | 3300035724 | Ga0373933_0157716 | Ga0373933_0157716_98_1234 | 374 |
| 667 | 3300035724 | Ga0373933_0206285 | Ga0373933_0206285_43_1176 | 374 |
| 668 | 3300037068 | Ga0373925_0008511 | Ga0373925_0008511_1433_2566 | 374 |
| 669 | 3300037068 | Ga0373925_0112522 | Ga0373925_0112522_543_1676 | 374 |
| 670 | 3300037068 | Ga0373925_0241309 | Ga0373925_0241309_87_1220 | 374 |
| 671 | 3300037312 | Ga0395899_0091019 | Ga0395899_0091019_524_1657 | 374 |
| 672 | 3300037418 | Ga0395900_0000860 | Ga0395900_0000860_16546_17679 | 374 |
| 673 | 3300037466 | Ga0395898_0011543 | Ga0395898_0011543_682_1815 | 374 |
| 674 | 3300037471 | Ga0395905_0021990 | Ga0395905_0021990_3531_4664 | 374 |
| 675 | 3300038443 | Ga0395901_0321556 | Ga0395901_0321556_277_1410 | 374 |
| 676 | 3300039437 | Ga0436365_0978478 | Ga0436365_0978478_209_1342 | 374 |
| 677 | 3300039437 | Ga0436365_1727745 | Ga0436365_1727745_11791_12924 | 374 |
| 678 | 3300039450 | Ga0436363_1276889 | Ga0436363_1276889_427_1560 | 374 |
| 679 | 3300039453 | Ga0436362_1050878 | Ga0436362_1050878_1828_2961 | 374 |
| 680 | 3300044658 | Ga0466972_0000660 | Ga0466972_0000660_10597_11730 | 374 |
| 681 | 3300044683 | Ga0466965_0017918 | Ga0466965_0017918_1181_2314 | 374 |
| 682 | 3300044735 | Ga0466968_0050276 | Ga0466968_0050276_610_1743 | 374 |
| 683 | 3300045049 | Ga0466959_0132905 | Ga0466959_0132905_410_1543 | 374 |
| 684 | 3300045049 | Ga0466959_0143044 | Ga0466959_0143044_296_1432 | 374 |
| 685 | 3300046455 | Ga0495603_0007153 | Ga0495603_0007153_2206_3339 | 374 |
| 686 | 3300046455 | Ga0495603_0012975 | Ga0495603_0012975_3632_4765 | 374 |
| 687 | 3300046455 | Ga0495603_0033100 | Ga0495603_0033100_1727_2863 | 374 |
| 688 | 3300046457 | Ga0495590_0005096 | Ga0495590_0005096_392_1525 | 374 |
| 689 | 3300046459 | Ga0495629_0049950 | Ga0495629_0049950_749_1882 | 374 |
| 690 | 3300046460 | Ga0495638_0021546 | Ga0495638_0021546_33_1166 | 374 |
| 691 | 3300046463 | Ga0495653_0000905 | Ga0495653_0000905_205_1338 | 374 |
| 692 | 3300046463 | Ga0495653_0228077 | Ga0495653_0228077_12_1145 | 374 |
| 693 | 3300046463 | Ga0495653_0230588 | Ga0495653_0230588_34_1167 | 374 |
| 694 | 3300046471 | Ga0495650_0051198 | Ga0495650_0051198_196_1329 | 374 |
| 695 | 3300046472 | Ga0495580_0142639 | Ga0495580_0142639_15_1148 | 374 |
| 696 | 3300046473 | Ga0495582_0142529 | Ga0495582_0142529_173_1306 | 374 |
| 697 | 3300046474 | Ga0495605_0034250 | Ga0495605_0034250_812_1945 | 374 |
| 698 | 3300046477 | Ga0495664_0033559 | Ga0495664_0033559_1312_2445 | 374 |
| 699 | 3300046491 | Ga0495584_0006929 | Ga0495584_0006929_4382_5515 | 374 |
| 700 | 3300046492 | Ga0495585_0010422 | Ga0495585_0010422_185_1318 | 374 |
| 701 | 3300046492 | Ga0495585_0054163 | Ga0495585_0054163_263_1396 | 374 |
| 702 | 3300046499 | Ga0495594_0030178 | Ga0495594_0030178_643_1776 | 374 |
| 703 | 3300046507 | Ga0495606_0016261 | Ga0495606_0016261_4157_5290 | 374 |
| 704 | 3300046507 | Ga0495606_0020685 | Ga0495606_0020685_3575_4705 | 374 |
| 705 | 3300046507 | Ga0495606_0164223 | Ga0495606_0164223_74_1210 | 374 |
| 706 | 3300046512 | Ga0495610_0048914 | Ga0495610_0048914_316_1449 | 374 |
| 707 | 3300046518 | Ga0495631_0021684 | Ga0495631_0021684_1565_2698 | 374 |
| 708 | 3300046522 | Ga0495643_0024835 | Ga0495643_0024835_912_2045 | 374 |
| 709 | 3300046524 | Ga0495648_0001196 | Ga0495648_0001196_6267_7400 | 374 |
| 710 | 3300046524 | Ga0495648_0016227 | Ga0495648_0016227_4104_5237 | 374 |
| 711 | 3300046528 | Ga0495642_0019910 | Ga0495642_0019910_1484_2617 | 374 |
| 712 | 3300046529 | Ga0495652_0013145 | Ga0495652_0013145_1010_2143 | 374 |
| 713 | 3300046530 | Ga0495654_0057793 | Ga0495654_0057793_536_1669 | 374 |
| 714 | 3300046536 | Ga0495587_0066032 | Ga0495587_0066032_648_1781 | 374 |
| 715 | 3300046537 | Ga0495598_0007033 | Ga0495598_0007033_31_1164 | 374 |
| 716 | 3300046538 | Ga0495609_0037053 | Ga0495609_0037053_408_1541 | 374 |
| 717 | 3300046539 | Ga0495621_0017023 | Ga0495621_0017023_953_2086 | 374 |
| 718 | 3300046542 | Ga0495597_0019441 | Ga0495597_0019441_22_1155 | 374 |
| 719 | 3300046543 | Ga0495645_0009332 | Ga0495645_0009332_5011_6144 | 374 |
| 720 | 3300046557 | Ga0495622_0114175 | Ga0495622_0114175_56_1189 | 374 |
| 721 | 3300046559 | Ga0495667_0082045 | Ga0495667_0082045_530_1663 | 374 |
| 722 | 3300046615 | Ga0495656_0003069 | Ga0495656_0003069_4326_5459 | 374 |
| 723 | 3300046615 | Ga0495656_0005194 | Ga0495656_0005194_22_1155 | 374 |
| 724 | 3300046616 | Ga0495668_0018347 | Ga0495668_0018347_520_1653 | 374 |
| 725 | 3300046616 | Ga0495668_0063801 | Ga0495668_0063801_30_1163 | 374 |
| 726 | 3300046616 | Ga0495668_0070808 | Ga0495668_0070808_612_1745 | 374 |
| 727 | 3300046642 | Ga0495634_0113048 | Ga0495634_0113048_43_1176 | 374 |
| 728 | 3300046648 | Ga0495611_0003326 | Ga0495611_0003326_4153_5286 | 374 |
| 729 | 3300046660 | Ga0495625_0052926 | Ga0495625_0052926_215_1348 | 374 |
| 730 | 3300046663 | Ga0495635_0001598 | Ga0495635_0001598_13820_14953 | 374 |
| 731 | 3300046664 | Ga0495659_0022883 | Ga0495659_0022883_844_1977 | 374 |
| 732 | 3300046674 | Ga0495588_0004167 | Ga0495588_0004167_2114_3247 | 374 |
| 733 | 3300046675 | Ga0495657_0032132 | Ga0495657_0032132_2322_3455 | 374 |
| 734 | 3300046679 | Ga0495623_0121585 | Ga0495623_0121585_141_1277 | 374 |
| 735 | 3300046679 | Ga0495623_0128826 | Ga0495623_0128826_303_1436 | 374 |
| 736 | 3300046680 | Ga0495646_0050411 | Ga0495646_0050411_1289_2422 | 374 |
| 737 | 3300046684 | Ga0495669_0009267 | Ga0495669_0009267_1725_2858 | 374 |
| 738 | 3300046684 | Ga0495669_0013439 | Ga0495669_0013439_1557_2690 | 374 |
| 739 | 3300046691 | Ga0495670_0007362 | Ga0495670_0007362_3107_4240 | 374 |
| 740 | 3300046692 | Ga0495671_0055927 | Ga0495671_0055927_378_1511 | 374 |
| 741 | 3300046694 | Ga0495649_0009550 | Ga0495649_0009550_3323_4456 | 374 |
| 742 | 3300046694 | Ga0495649_0122831 | Ga0495649_0122831_26_1159 | 374 |
| 743 | 3300047317 | Ga0495604_0008729 | Ga0495604_0008729_6575_7708 | 374 |
| 744 | 3300047319 | Ga0495674_0011652 | Ga0495674_0011652_1792_2925 | 374 |
| 745 | 3300047321 | Ga0495676_0029179 | Ga0495676_0029179_582_1715 | 374 |
| 746 | 3300047322 | Ga0495680_0124694 | Ga0495680_0124694_303_1436 | 374 |
| 747 | 3300047323 | Ga0495683_0016976 | Ga0495683_0016976_1683_2816 | 374 |
| 748 | 3300047444 | Ga0495675_0067391 | Ga0495675_0067391_303_1436 | 374 |
| 749 | 3300047445 | Ga0495677_0008483 | Ga0495677_0008483_895_2028 | 374 |
| 750 | 3300047445 | Ga0495677_0018395 | Ga0495677_0018395_535_1668 | 374 |
| 751 | 3300047469 | Ga0495673_0015016 | Ga0495673_0015016_2163_3296 | 374 |
| 752 | 3300047472 | Ga0495686_0051583 | Ga0495686_0051583_772_1905 | 374 |
| 753 | 3300047472 | Ga0495686_0051720 | Ga0495686_0051720_399_1532 | 374 |
| 754 | 3300047673 | Ga0495593_0005818 | Ga0495593_0005818_5965_7098 | 374 |
| 755 | 3300047673 | Ga0495593_0033461 | Ga0495593_0033461_1567_2700 | 374 |
| 756 | 3300048088 | Ga0495602_0234343 | Ga0495602_0234343_221_1354 | 374 |
| 757 | 3300048903 | Ga0496100_0113533 | Ga0496100_0113533_210_1343 | 374 |
| 758 | 3300048905 | Ga0496102_0213821 | Ga0496102_0213821_247_1377 | 374 |
| 759 | 3300048907 | Ga0496104_0039154 | Ga0496104_0039154_398_1531 | 374 |
| 760 | 3300048907 | Ga0496104_0045194 | Ga0496104_0045194_1962_3095 | 374 |
| 761 | 3300048908 | Ga0496105_0052703 | Ga0496105_0052703_799_1932 | 374 |
| 762 | 3300048909 | Ga0496106_0000546 | Ga0496106_0000546_19987_21120 | 374 |
| 763 | 3300048910 | Ga0496107_0006071 | Ga0496107_0006071_4096_5229 | 374 |
| 764 | 3300048911 | Ga0496108_0001487 | Ga0496108_0001487_7888_9021 | 374 |
| 765 | 3300048911 | Ga0496108_0404095 | Ga0496108_0404095_33_1166 | 374 |
| 766 | 3300048912 | Ga0496109_0002290 | Ga0496109_0002290_6650_7783 | 374 |
| 767 | 3300048913 | Ga0496110_0028694 | Ga0496110_0028694_753_1886 | 374 |
| 768 | 3300048913 | Ga0496110_0192481 | Ga0496110_0192481_439_1572 | 374 |
| 769 | 3300048915 | Ga0496112_0000079 | Ga0496112_0000079_28805_29938 | 374 |
| 770 | 3300048915 | Ga0496112_0173714 | Ga0496112_0173714_950_2083 | 374 |
| 771 | 3300048916 | Ga0496113_0041046 | Ga0496113_0041046_1375_2508 | 374 |
| 772 | 3300048917 | Ga0496114_0039704 | Ga0496114_0039704_1278_2411 | 374 |
| 773 | 3300048917 | Ga0496114_0208632 | Ga0496114_0208632_64_1197 | 374 |
| 774 | 3300048918 | Ga0496115_0031854 | Ga0496115_0031854_1069_2202 | 374 |
| 775 | 3300048918 | Ga0496115_0113682 | Ga0496115_0113682_68_1201 | 374 |
| 776 | 3300048919 | Ga0496116_0099348 | Ga0496116_0099348_418_1551 | 374 |
| 777 | 3300048921 | Ga0496118_0009864 | Ga0496118_0009864_1752_2885 | 374 |
| 778 | 3300048921 | Ga0496118_0017185 | Ga0496118_0017185_1739_2872 | 374 |
| 779 | 3300048922 | Ga0496119_0060982 | Ga0496119_0060982_669_1802 | 374 |
| 780 | 3300048922 | Ga0496119_0072540 | Ga0496119_0072540_537_1670 | 374 |
| 781 | 3300048924 | Ga0496121_0007340 | Ga0496121_0007340_11723_12856 | 374 |
| 782 | 3300048924 | Ga0496121_0041310 | Ga0496121_0041310_2082_3215 | 374 |
| 783 | 3300048924 | Ga0496121_0041730 | Ga0496121_0041730_798_1931 | 374 |
| 784 | 3300048924 | Ga0496121_0052341 | Ga0496121_0052341_1250_2383 | 374 |
| 785 | 3300048924 | Ga0496121_0080315 | Ga0496121_0080315_1377_2510 | 374 |
| 786 | 3300048927 | Ga0496124_0175761 | Ga0496124_0175761_207_1337 | 374 |
| 787 | 3300048928 | Ga0496125_0000756 | Ga0496125_0000756_51351_52484 | 374 |
| 788 | 3300048928 | Ga0496125_0003979 | Ga0496125_0003979_8684_9817 | 374 |
| 789 | 3300048929 | Ga0496126_0006416 | Ga0496126_0006416_7164_8297 | 374 |
| 790 | 3300048929 | Ga0496126_0030943 | Ga0496126_0030943_2615_3760 | 374 |
| 791 | 3300048929 | Ga0496126_0037866 | Ga0496126_0037866_326_1459 | 374 |
| 792 | 3300048929 | Ga0496126_0049932 | Ga0496126_0049932_828_1961 | 374 |
| 793 | 3300048929 | Ga0496126_0082610 | Ga0496126_0082610_104_1237 | 374 |
| 794 | 3300048929 | Ga0496126_0328033 | Ga0496126_0328033_76_1209 | 374 |
| 795 | 3300049460 | Ga0495682_0007216 | Ga0495682_0007216_1704_2837 | 374 |
| 796 | 3300049568 | Ga0501031_0028515 | Ga0501031_0028515_121_1254 | 374 |
| 797 | 3300049568 | Ga0501031_0078035 | Ga0501031_0078035_390_1523 | 374 |
| 798 | 3300049569 | Ga0501032_0007357 | Ga0501032_0007357_2754_3887 | 374 |
| 799 | 3300049569 | Ga0501032_0007780 | Ga0501032_0007780_1818_2951 | 374 |
| 800 | 3300049569 | Ga0501032_0014183 | Ga0501032_0014183_1936_3069 | 374 |
| 801 | 3300049569 | Ga0501032_0160873 | Ga0501032_0160873_34_1167 | 374 |
| 802 | 3300049570 | Ga0501033_0000313 | Ga0501033_0000313_203_1336 | 374 |
| 803 | 3300049570 | Ga0501033_0001956 | Ga0501033_0001956_16584_17717 | 374 |
| 804 | 3300049570 | Ga0501033_0020816 | Ga0501033_0020816_897_2030 | 374 |
| 805 | 3300049571 | Ga0501034_0000175 | Ga0501034_0000175_117925_119058 | 374 |
| 806 | 3300049571 | Ga0501034_0065198 | Ga0501034_0065198_2218_3351 | 374 |
| 807 | 3300049571 | Ga0501034_0204542 | Ga0501034_0204542_108_1241 | 374 |
| 808 | 3300049572 | Ga0501036_0000032 | Ga0501036_0000032_39441_40574 | 374 |
| 809 | 3300049572 | Ga0501036_0092834 | Ga0501036_0092834_296_1429 | 374 |
| 810 | 3300049572 | Ga0501036_0180825 | Ga0501036_0180825_561_1691 | 374 |
| 811 | 3300049573 | Ga0501037_0000415 | Ga0501037_0000415_33726_34859 | 374 |
| 812 | 3300049573 | Ga0501037_0009384 | Ga0501037_0009384_216_1349 | 374 |
| 813 | 3300049573 | Ga0501037_0024822 | Ga0501037_0024822_1470_2603 | 374 |
| 814 | 3300049573 | Ga0501037_0059114 | Ga0501037_0059114_1144_2277 | 374 |
| 815 | 3300049573 | Ga0501037_0073701 | Ga0501037_0073701_284_1414 | 374 |
| 816 | 3300049573 | Ga0501037_0123227 | Ga0501037_0123227_452_1585 | 374 |
| 817 | 3300049573 | Ga0501037_0129459 | Ga0501037_0129459_374_1507 | 374 |
| 818 | 3300049574 | Ga0501038_0000114 | Ga0501038_0000114_14118_15251 | 374 |
| 819 | 3300049574 | Ga0501038_0010298 | Ga0501038_0010298_2016_3149 | 374 |
| 820 | 3300049574 | Ga0501038_0010663 | Ga0501038_0010663_5081_6214 | 374 |
| 821 | 3300049574 | Ga0501038_0011901 | Ga0501038_0011901_5142_6272 | 374 |
| 822 | 3300049574 | Ga0501038_0046908 | Ga0501038_0046908_1474_2607 | 374 |
| 823 | 3300049574 | Ga0501038_0053939 | Ga0501038_0053939_1936_3069 | 374 |
| 824 | 3300049575 | Ga0501039_0000078 | Ga0501039_0000078_30536_31669 | 374 |
| 825 | 3300049575 | Ga0501039_0056463 | Ga0501039_0056463_549_1682 | 374 |
| 826 | 3300049575 | Ga0501039_0170436 | Ga0501039_0170436_430_1563 | 374 |
| 827 | 3300049576 | Ga0501040_0010883 | Ga0501040_0010883_1798_2931 | 374 |
| 828 | 3300049577 | Ga0501041_0137478 | Ga0501041_0137478_319_1452 | 374 |
| 829 | 3300049578 | Ga0501042_0008806 | Ga0501042_0008806_540_1673 | 374 |
| 830 | 3300049579 | Ga0501043_0000220 | Ga0501043_0000220_2074_3207 | 374 |
| 831 | 3300049579 | Ga0501043_0059836 | Ga0501043_0059836_1799_2932 | 374 |
| 832 | 3300049579 | Ga0501043_0069641 | Ga0501043_0069641_945_2078 | 374 |
| 833 | 3300049579 | Ga0501043_0124712 | Ga0501043_0124712_672_1805 | 374 |
| 834 | 3300049580 | Ga0501046_0000176 | Ga0501046_0000176_63690_64823 | 374 |
| 835 | 3300049580 | Ga0501046_0017167 | Ga0501046_0017167_216_1349 | 374 |
| 836 | 3300049580 | Ga0501046_0018872 | Ga0501046_0018872_1658_2788 | 374 |
| 837 | 3300049580 | Ga0501046_0091234 | Ga0501046_0091234_1015_2148 | 374 |
| 838 | 3300049581 | Ga0501047_0000085 | Ga0501047_0000085_92505_93638 | 374 |
| 839 | 3300049581 | Ga0501047_0003015 | Ga0501047_0003015_13872_15002 | 374 |
| 840 | 3300049581 | Ga0501047_0021690 | Ga0501047_0021690_3674_4807 | 374 |
| 841 | 3300049581 | Ga0501047_0062758 | Ga0501047_0062758_560_1693 | 374 |
| 842 | 3300049581 | Ga0501047_0295067 | Ga0501047_0295067_289_1422 | 374 |
| 843 | 3300049582 | Ga0501048_0024136 | Ga0501048_0024136_1117_2250 | 374 |
| 844 | 3300049582 | Ga0501048_0046571 | Ga0501048_0046571_1576_2709 | 374 |
| 845 | 3300049583 | Ga0501067_0001860 | Ga0501067_0001860_10013_11146 | 374 |
| 846 | 3300049583 | Ga0501067_0003942 | Ga0501067_0003942_6060_7193 | 374 |
| 847 | 3300049584 | Ga0501068_0001393 | Ga0501068_0001393_11244_12377 | 374 |
| 848 | 3300049584 | Ga0501068_0063934 | Ga0501068_0063934_992_2125 | 374 |
| 849 | 3300049585 | Ga0501069_0023817 | Ga0501069_0023817_1838_2971 | 374 |
| 850 | 3300049585 | Ga0501069_0032539 | Ga0501069_0032539_504_1637 | 374 |
| 851 | 3300049586 | Ga0501070_0011262 | Ga0501070_0011262_6034_7167 | 374 |
| 852 | 3300049586 | Ga0501070_0042730 | Ga0501070_0042730_171_1304 | 374 |
| 853 | 3300049587 | Ga0501071_0022700 | Ga0501071_0022700_2243_3376 | 374 |
| 854 | 3300049587 | Ga0501071_0027300 | Ga0501071_0027300_2588_3721 | 374 |
| 855 | 3300049587 | Ga0501071_0087434 | Ga0501071_0087434_501_1634 | 374 |
| 856 | 3300049588 | Ga0501072_0010680 | Ga0501072_0010680_1562_2695 | 374 |
| 857 | 3300049588 | Ga0501072_0120351 | Ga0501072_0120351_676_1809 | 374 |
| 858 | 3300049589 | Ga0501073_0000026 | Ga0501073_0000026_96208_97341 | 374 |
| 859 | 3300049589 | Ga0501073_0081545 | Ga0501073_0081545_515_1648 | 374 |
| 860 | 3300049590 | Ga0501074_0000878 | Ga0501074_0000878_17527_18660 | 374 |
| 861 | 3300049590 | Ga0501074_0008344 | Ga0501074_0008344_5287_6420 | 374 |
| 862 | 3300049592 | Ga0501076_0083862 | Ga0501076_0083862_547_1680 | 374 |
| 863 | 3300049741 | Ga0501079_0006752 | Ga0501079_0006752_1716_2849 | 374 |
| 864 | 3300049741 | Ga0501079_0158453 | Ga0501079_0158453_469_1602 | 374 |
| 865 | 3300049742 | Ga0501080_0248879 | Ga0501080_0248879_320_1453 | 374 |
| 866 | 3300049743 | Ga0501081_0149601 | Ga0501081_0149601_360_1493 | 374 |
| 867 | 3300049744 | Ga0501083_0028305 | Ga0501083_0028305_2687_3820 | 374 |
| 868 | 3300049822 | Ga0501035_0014167 | Ga0501035_0014167_6009_7142 | 374 |
| 869 | 3300049822 | Ga0501035_0014525 | Ga0501035_0014525_4891_6024 | 374 |
| 870 | 3300049822 | Ga0501035_0027709 | Ga0501035_0027709_3783_4916 | 374 |
| 871 | 3300049822 | Ga0501035_0063093 | Ga0501035_0063093_1754_2887 | 374 |
| 872 | 3300049822 | Ga0501035_0168085 | Ga0501035_0168085_386_1519 | 374 |
| 873 | 3300049823 | Ga0501044_0000061 | Ga0501044_0000061_77711_78844 | 374 |
| 874 | 3300049823 | Ga0501044_0011007 | Ga0501044_0011007_4492_5625 | 374 |
| 875 | 3300049823 | Ga0501044_0018826 | Ga0501044_0018826_3512_4645 | 374 |
| 876 | 3300049823 | Ga0501044_0072096 | Ga0501044_0072096_1648_2781 | 374 |
| 877 | 3300049823 | Ga0501044_0195234 | Ga0501044_0195234_642_1775 | 374 |
| 878 | 3300049823 | Ga0501044_0220866 | Ga0501044_0220866_298_1431 | 374 |
| 879 | 3300049824 | Ga0501045_0015070 | Ga0501045_0015070_1799_2932 | 374 |
| 880 | 3300050490 | nmdc:mga03n38_11708_c1 | nmdc:mga03n38_11708_c1_113_1246 | 374 |
| 881 | 3300050490 | nmdc:mga03n38_2075_c1 | nmdc:mga03n38_2075_c1_4698_5831 | 374 |
| 882 | 3300050491 | nmdc:mga00v17_14353_c1 | nmdc:mga00v17_14353_c1_2067_3200 | 374 |
| 883 | 3300050491 | nmdc:mga00v17_43318_c1 | nmdc:mga00v17_43318_c1_285_1418 | 374 |
| 884 | 3300050492 | nmdc:mga0yw44_1305_c1 | nmdc:mga0yw44_1305_c1_1389_2522 | 374 |
| 885 | 3300050492 | nmdc:mga0yw44_23019_c1 | nmdc:mga0yw44_23019_c1_1575_2708 | 374 |
| 886 | 3300050492 | nmdc:mga0yw44_40905_c1 | nmdc:mga0yw44_40905_c1_797_1930 | 374 |
| 887 | 3300050494 | nmdc:mga06z11_51583_c1 | nmdc:mga06z11_51583_c1_849_1982 | 374 |
| 888 | 3300050496 | nmdc:mga07m45_1819_c1 | nmdc:mga07m45_1819_c1_5204_6337 | 374 |
| 889 | 3300050496 | nmdc:mga07m45_19104_c1 | nmdc:mga07m45_19104_c1_1399_2532 | 374 |
| 890 | 3300050507 | nmdc:mga05p37_399127_c1 | nmdc:mga05p37_399127_c1_448_1581 | 374 |
| 891 | 3300050511 | nmdc:mga08y16_97027_c1 | nmdc:mga08y16_97027_c1_1445_2578 | 374 |
| 892 | 3300050516 | nmdc:mga0sz30_42214_c1 | nmdc:mga0sz30_42214_c1_686_1819 | 374 |
| 893 | 3300050516 | nmdc:mga0sz30_9246_c1 | nmdc:mga0sz30_9246_c1_598_1731 | 374 |
| 894 | 3300053077 | Ga0495601_0201403 | Ga0495601_0201403_27_1160 | 374 |
| 895 | 3300053079 | Ga0500610_0073581 | Ga0500610_0073581_438_1571 | 374 |
| 896 | 3300053080 | Ga0500635_0004290 | Ga0500635_0004290_1278_2411 | 374 |
| 897 | 3300053080 | Ga0500635_0004942 | Ga0500635_0004942_2147_3280 | 374 |
| 898 | 3300053084 | Ga0495595_0014890 | Ga0495595_0014890_614_1747 | 374 |
| 899 | 3300053085 | Ga0495619_0000182 | Ga0495619_0000182_37628_38761 | 374 |
| 900 | 3300053093 | Ga0500651_0018637 | Ga0500651_0018637_398_1531 | 374 |
| 901 | 3300053094 | Ga0500566_0000038 | Ga0500566_0000038_41908_43083 | 374 |
| 902 | 3300053094 | Ga0500566_0000596 | Ga0500566_0000596_10465_11598 | 374 |
| 903 | 3300053094 | Ga0500566_0042396 | Ga0500566_0042396_266_1402 | 374 |
| 904 | 3300053095 | Ga0500640_014775 | Ga0500640_014775_1100_2275 | 374 |
| 905 | 3300053096 | Ga0500641_0002804 | Ga0500641_0002804_2089_3222 | 374 |
| 906 | 3300053105 | Ga0500557_000001 | Ga0500557_000001_12520_13653 | 374 |
| 907 | 3300053111 | Ga0500572_000010 | Ga0500572_000010_24325_25500 | 374 |
| 908 | 3300053111 | Ga0500572_000539 | Ga0500572_000539_4363_5496 | 374 |
| 909 | 3300053116 | Ga0500592_009746 | Ga0500592_009746_79_1212 | 374 |
| 910 | 3300053119 | Ga0500595_000143 | Ga0500595_000143_25973_27109 | 374 |
| 911 | 3300053119 | Ga0500595_003822 | Ga0500595_003822_4706_5839 | 374 |
| 912 | 3300053122 | Ga0500608_016164 | Ga0500608_016164_817_1992 | 374 |
| 913 | 3300053130 | Ga0500642_0006377 | Ga0500642_0006377_2608_3741 | 374 |
| 914 | 3300053136 | Ga0500559_0000917 | Ga0500559_0000917_9527_10660 | 374 |
| 915 | 3300053136 | Ga0500559_0014387 | Ga0500559_0014387_1209_2384 | 374 |
| 916 | 3300053136 | Ga0500559_0061944 | Ga0500559_0061944_336_1469 | 374 |
| 917 | 3300053139 | Ga0500568_0003461 | Ga0500568_0003461_7032_8165 | 374 |
| 918 | 3300053140 | Ga0500573_0030373 | Ga0500573_0030373_383_1516 | 374 |
| 919 | 3300053142 | Ga0500577_0002448 | Ga0500577_0002448_2199_3326 | 374 |
| 920 | 3300053142 | Ga0500577_0024659 | Ga0500577_0024659_553_1686 | 374 |
| 921 | 3300053148 | Ga0500590_041405 | Ga0500590_041405_233_1408 | 374 |
| 922 | 3300053150 | Ga0500603_000364 | Ga0500603_000364_5190_6323 | 374 |
| 923 | 3300053150 | Ga0500603_000550 | Ga0500603_000550_984_2159 | 374 |
| 924 | 3300053150 | Ga0500603_007083 | Ga0500603_007083_65_1198 | 374 |
| 925 | 3300053153 | Ga0500616_0002840 | Ga0500616_0002840_2702_3835 | 374 |
| 926 | 3300053158 | Ga0500627_0034682 | Ga0500627_0034682_51_1184 | 374 |
| 927 | 3300053159 | Ga0500630_000751 | Ga0500630_000751_1831_3006 | 374 |
| 928 | 3300053161 | Ga0500634_0070970 | Ga0500634_0070970_33_1166 | 374 |
| 929 | 3300053162 | Ga0500638_000303 | Ga0500638_000303_3229_4365 | 374 |
| 930 | 3300053163 | Ga0500639_000034 | Ga0500639_000034_41591_42766 | 374 |
| 931 | 3300053163 | Ga0500639_020006 | Ga0500639_020006_1165_2298 | 374 |
| 932 | 3300053163 | Ga0500639_105339 | Ga0500639_105339_37_1170 | 374 |
| 933 | 3300053177 | Ga0500636_0084966 | Ga0500636_0084966_591_1724 | 374 |
| 934 | 3300053178 | Ga0500637_0000685 | Ga0500637_0000685_8326_9462 | 374 |
| 935 | 3300053178 | Ga0500637_0004238 | Ga0500637_0004238_3821_4954 | 374 |
| 936 | 3300053729 | Ga0500625_001418 | Ga0500625_001418_6844_7977 | 374 |
| 937 | 3300053735 | Ga0500596_000264 | Ga0500596_000264_6214_7389 | 374 |
| 938 | 3300053735 | Ga0500596_005925 | Ga0500596_005925_234_1367 | 374 |
| 939 | 3300053735 | Ga0500596_009734 | Ga0500596_009734_169_1302 | 374 |
| 940 | 3300054114 | Ga0501084_0005053 | Ga0501084_0005053_3806_4939 | 374 |
| 941 | 3300054114 | Ga0501084_0018834 | Ga0501084_0018834_4254_5387 | 374 |
| 942 | 3300055283 | Ga0500661_000850 | Ga0500661_000850_3221_4357 | 374 |
| 943 | 3300060353 | Ga0501082_0014622 | Ga0501082_0014622_3888_5021 | 374 |
| 944 | 3300060353 | Ga0501082_0098826 | Ga0501082_0098826_1102_2235 | 374 |
| 945 | 3300061734 | Ga0530510_0064504 | Ga0530510_0064504_1091_2224 | 374 |
| 946 | 3300013105 | Ga0157369_10486335 | Ga0157369_104863351 | 375 |
| 947 | 3300045049 | Ga0466959_0093609 | Ga0466959_0093609_788_1924 | 375 |
| 948 | 3300048924 | Ga0496121_0089588 | Ga0496121_0089588_367_1506 | 375 |
| 949 | 3300050516 | nmdc:mga0sz30_23235_c1 | nmdc:mga0sz30_23235_c1_176_1303 | 375 |
| 950 | 3300061719 | Ga0466962_0054197 | Ga0466962_0054197_572_1708 | 375 |
| 951 | 3300005539 | Ga0068853_100079332 | Ga0068853_1000793322 | 376 |
| 952 | 3300005563 | Ga0068855_100031483 | Ga0068855_1000314831 | 376 |
| 953 | 3300006048 | Ga0075363_100022463 | Ga0075363_1000224631 | 376 |
| 954 | 3300009545 | Ga0105237_10043296 | Ga0105237_100432962 | 376 |
| 955 | 3300009545 | Ga0105237_10219618 | Ga0105237_102196181 | 376 |
| 956 | 3300010375 | Ga0105239_10036223 | Ga0105239_100362232 | 376 |
| 957 | 3300025914 | Ga0207671_10018832 | Ga0207671_100188324 | 376 |
| 958 | 3300025941 | Ga0207711_10342177 | Ga0207711_103421771 | 376 |
| 959 | 3300025949 | Ga0207667_10086339 | Ga0207667_100863392 | 376 |
| 960 | 3300026067 | Ga0207678_10315419 | Ga0207678_103154192 | 376 |
| 961 | 3300028556 | Ga0265337_1004278 | Ga0265337_10042782 | 376 |
| 962 | 3300028558 | Ga0265326_10022991 | Ga0265326_100229911 | 376 |
| 963 | 3300029957 | Ga0265324_10003894 | Ga0265324_100038942 | 376 |
| 964 | 3300032126 | Ga0307415_100039397 | Ga0307415_1000393972 | 376 |
| 965 | 3300035113 | Ga0373936_0025159 | Ga0373936_0025159_289_1437 | 376 |
| 966 | 3300035116 | Ga0373945_0046245 | Ga0373945_0046245_110_1258 | 376 |
| 967 | 3300035171 | Ga0373946_0001312 | Ga0373946_0001312_5997_7145 | 376 |
| 968 | 3300035692 | Ga0373935_0001438 | Ga0373935_0001438_10853_12001 | 376 |
| 969 | 3300035695 | Ga0373927_0000225 | Ga0373927_0000225_36073_37221 | 376 |
| 970 | 3300035724 | Ga0373933_0094015 | Ga0373933_0094015_677_1825 | 376 |
| 971 | 3300035725 | Ga0373947_0002889 | Ga0373947_0002889_2448_3596 | 376 |
| 972 | 3300036401 | Ga0373937_0068873 | Ga0373937_0068873_1688_2836 | 376 |
| 973 | 3300037068 | Ga0373925_0000711 | Ga0373925_0000711_27843_28991 | 376 |
| 974 | 3300046454 | Ga0495592_0066499 | Ga0495592_0066499_239_1408 | 376 |
| 975 | 3300046454 | Ga0495592_0146137 | Ga0495592_0146137_258_1406 | 376 |
| 976 | 3300046455 | Ga0495603_0000960 | Ga0495603_0000960_4980_6128 | 376 |
| 977 | 3300046459 | Ga0495629_0000179 | Ga0495629_0000179_7883_9031 | 376 |
| 978 | 3300046462 | Ga0495651_0005780 | Ga0495651_0005780_3831_5000 | 376 |
| 979 | 3300046472 | Ga0495580_0000280 | Ga0495580_0000280_6531_7679 | 376 |
| 980 | 3300046473 | Ga0495582_0000061 | Ga0495582_0000061_6532_7680 | 376 |
| 981 | 3300046474 | Ga0495605_0081593 | Ga0495605_0081593_78_1247 | 376 |
| 982 | 3300046475 | Ga0495639_0000102 | Ga0495639_0000102_34587_35735 | 376 |
| 983 | 3300046476 | Ga0495662_0000746 | Ga0495662_0000746_13055_14203 | 376 |
| 984 | 3300046477 | Ga0495664_0002105 | Ga0495664_0002105_1824_2972 | 376 |
| 985 | 3300046499 | Ga0495594_0000378 | Ga0495594_0000378_1959_3107 | 376 |
| 986 | 3300046511 | Ga0495608_0010907 | Ga0495608_0010907_5051_6220 | 376 |
| 987 | 3300046516 | Ga0495628_0018385 | Ga0495628_0018385_3396_4565 | 376 |
| 988 | 3300046516 | Ga0495628_0035270 | Ga0495628_0035270_2116_3264 | 376 |
| 989 | 3300046524 | Ga0495648_0061143 | Ga0495648_0061143_215_1384 | 376 |
| 990 | 3300046529 | Ga0495652_0091685 | Ga0495652_0091685_538_1707 | 376 |
| 991 | 3300046529 | Ga0495652_0105206 | Ga0495652_0105206_122_1270 | 376 |
| 992 | 3300046531 | Ga0495665_0000261 | Ga0495665_0000261_18946_20094 | 376 |
| 993 | 3300046533 | Ga0495640_0002042 | Ga0495640_0002042_6920_8068 | 376 |
| 994 | 3300046533 | Ga0495640_0040304 | Ga0495640_0040304_1321_2490 | 376 |
| 995 | 3300046533 | Ga0495640_0082595 | Ga0495640_0082595_439_1608 | 376 |
| 996 | 3300046543 | Ga0495645_0011286 | Ga0495645_0011286_3602_4771 | 376 |
| 997 | 3300046557 | Ga0495622_0008215 | Ga0495622_0008215_184_1332 | 376 |
| 998 | 3300046557 | Ga0495622_0024903 | Ga0495622_0024903_262_1431 | 376 |
| 999 | 3300046559 | Ga0495667_0011404 | Ga0495667_0011404_4494_5663 | 376 |
| 1000 | 3300046559 | Ga0495667_0039154 | Ga0495667_0039154_1499_2647 | 376 |
| 1001 | 3300046642 | Ga0495634_0000161 | Ga0495634_0000161_22586_23734 | 376 |
| 1002 | 3300046660 | Ga0495625_0170346 | Ga0495625_0170346_189_1358 | 376 |
| 1003 | 3300046663 | Ga0495635_0001102 | Ga0495635_0001102_10276_11424 | 376 |
| 1004 | 3300046663 | Ga0495635_0135687 | Ga0495635_0135687_51_1220 | 376 |
| 1005 | 3300046674 | Ga0495588_0098627 | Ga0495588_0098627_145_1314 | 376 |
| 1006 | 3300046675 | Ga0495657_0023663 | Ga0495657_0023663_3153_4322 | 376 |
| 1007 | 3300046678 | Ga0495599_0058148 | Ga0495599_0058148_721_1890 | 376 |
| 1008 | 3300046679 | Ga0495623_0030541 | Ga0495623_0030541_416_1585 | 376 |
| 1009 | 3300046681 | Ga0495647_0000205 | Ga0495647_0000205_8345_9493 | 376 |
| 1010 | 3300046683 | Ga0495658_0001114 | Ga0495658_0001114_5971_7119 | 376 |
| 1011 | 3300046689 | Ga0495613_0012105 | Ga0495613_0012105_3232_4380 | 376 |
| 1012 | 3300046689 | Ga0495613_0063836 | Ga0495613_0063836_800_1969 | 376 |
| 1013 | 3300046690 | Ga0495624_0003890 | Ga0495624_0003890_2111_3259 | 376 |
| 1014 | 3300046690 | Ga0495624_0027953 | Ga0495624_0027953_194_1363 | 376 |
| 1015 | 3300046694 | Ga0495649_0049185 | Ga0495649_0049185_239_1408 | 376 |
| 1016 | 3300046809 | Ga0495600_0010669 | Ga0495600_0010669_4447_5616 | 376 |
| 1017 | 3300046809 | Ga0495600_0016431 | Ga0495600_0016431_1926_3095 | 376 |
| 1018 | 3300047315 | Ga0495581_0000255 | Ga0495581_0000255_4042_5190 | 376 |
| 1019 | 3300047315 | Ga0495581_0040997 | Ga0495581_0040997_53_1222 | 376 |
| 1020 | 3300047317 | Ga0495604_0010435 | Ga0495604_0010435_4456_5625 | 376 |
| 1021 | 3300047317 | Ga0495604_0045012 | Ga0495604_0045012_1394_2563 | 376 |
| 1022 | 3300047319 | Ga0495674_0000117 | Ga0495674_0000117_22862_24010 | 376 |
| 1023 | 3300047321 | Ga0495676_0006968 | Ga0495676_0006968_1778_2926 | 376 |
| 1024 | 3300047321 | Ga0495676_0021084 | Ga0495676_0021084_257_1426 | 376 |
| 1025 | 3300047322 | Ga0495680_0004171 | Ga0495680_0004171_9960_11129 | 376 |
| 1026 | 3300047673 | Ga0495593_0000086 | Ga0495593_0000086_39046_40194 | 376 |
| 1027 | 3300048088 | Ga0495602_0004737 | Ga0495602_0004737_8999_10168 | 376 |
| 1028 | 3300048088 | Ga0495602_0057792 | Ga0495602_0057792_1155_2324 | 376 |
| 1029 | 3300048089 | Ga0495614_0018614 | Ga0495614_0018614_1824_2972 | 376 |
| 1030 | 3300048907 | Ga0496104_0154915 | Ga0496104_0154915_148_1317 | 376 |
| 1031 | 3300048908 | Ga0496105_0003203 | Ga0496105_0003203_10140_11309 | 376 |
| 1032 | 3300048910 | Ga0496107_0009700 | Ga0496107_0009700_3356_4498 | 376 |
| 1033 | 3300048918 | Ga0496115_0132161 | Ga0496115_0132161_146_1315 | 376 |
| 1034 | 3300048918 | Ga0496115_0190376 | Ga0496115_0190376_393_1538 | 376 |
| 1035 | 3300048921 | Ga0496118_0119680 | Ga0496118_0119680_49_1218 | 376 |
| 1036 | 3300048922 | Ga0496119_0002628 | Ga0496119_0002628_11905_13074 | 376 |
| 1037 | 3300048923 | Ga0496120_0010435 | Ga0496120_0010435_2240_3409 | 376 |
| 1038 | 3300048924 | Ga0496121_0001789 | Ga0496121_0001789_6409_7551 | 376 |
| 1039 | 3300048924 | Ga0496121_0077388 | Ga0496121_0077388_43_1212 | 376 |
| 1040 | 3300048924 | Ga0496121_0230387 | Ga0496121_0230387_134_1279 | 376 |
| 1041 | 3300048928 | Ga0496125_0035568 | Ga0496125_0035568_182_1351 | 376 |
| 1042 | 3300048929 | Ga0496126_0002315 | Ga0496126_0002315_13494_14636 | 376 |
| 1043 | 3300048929 | Ga0496126_0283948 | Ga0496126_0283948_175_1344 | 376 |
| 1044 | 3300049460 | Ga0495682_0015674 | Ga0495682_0015674_76_1245 | 376 |
| 1045 | 3300049583 | Ga0501067_0134372 | Ga0501067_0134372_162_1310 | 376 |
| 1046 | 3300049823 | Ga0501044_0022791 | Ga0501044_0022791_3468_4613 | 376 |
| 1047 | 3300050494 | nmdc:mga06z11_1148_c1 | nmdc:mga06z11_1148_c1_6477_7637 | 376 |
| 1048 | 3300053085 | Ga0495619_0031597 | Ga0495619_0031597_1256_2404 | 376 |
| 1049 | 3300053737 | Ga0500601_000570 | Ga0500601_000570_1764_2933 | 376 |
| 1050 | 3300061734 | Ga0530510_0225344 | Ga0530510_0225344_161_1309 | 376 |
| 1051 | iso_pu_bacteria | 2904690495 | 2904696521 | 376 |
| 1052 | iso_pu_bacteria | 2908756301 | 2908760375 | 376 |
| 1053 | 3300001979 | JGI24740J21852_10007113 | JGI24740J21852_100071134 | 377 |
| 1054 | 3300001990 | JGI24737J22298_10008019 | JGI24737J22298_100080192 | 377 |
| 1055 | 3300005455 | Ga0070663_100038211 | Ga0070663_1000382111 | 377 |
| 1056 | 3300005457 | Ga0070662_100042412 | Ga0070662_1000424121 | 377 |
| 1057 | 3300005563 | Ga0068855_100285752 | Ga0068855_1002857522 | 377 |
| 1058 | 3300005577 | Ga0068857_100010572 | Ga0068857_1000105728 | 377 |
| 1059 | 3300005577 | Ga0068857_100231378 | Ga0068857_1002313782 | 377 |
| 1060 | 3300005578 | Ga0068854_100114444 | Ga0068854_1001144442 | 377 |
| 1061 | 3300005614 | Ga0068856_100079971 | Ga0068856_1000799712 | 377 |
| 1062 | 3300005614 | Ga0068856_100239351 | Ga0068856_1002393512 | 377 |
| 1063 | 3300005834 | Ga0068851_10052697 | Ga0068851_100526972 | 377 |
| 1064 | 3300009093 | Ga0105240_10043962 | Ga0105240_100439622 | 377 |
| 1065 | 3300009093 | Ga0105240_10077533 | Ga0105240_100775333 | 377 |
| 1066 | 3300009174 | Ga0105241_10022028 | Ga0105241_100220282 | 377 |
| 1067 | 3300009545 | Ga0105237_10009523 | Ga0105237_100095236 | 377 |
| 1068 | 3300009545 | Ga0105237_10289200 | Ga0105237_102892002 | 377 |
| 1069 | 3300009551 | Ga0105238_10022350 | Ga0105238_100223506 | 377 |
| 1070 | 3300010375 | Ga0105239_10382535 | Ga0105239_103825352 | 377 |
| 1071 | 3300025321 | Ga0207656_10011134 | Ga0207656_100111342 | 377 |
| 1072 | 3300025911 | Ga0207654_10036806 | Ga0207654_100368062 | 377 |
| 1073 | 3300025913 | Ga0207695_10001915 | Ga0207695_1000191528 | 377 |
| 1074 | 3300025924 | Ga0207694_10001639 | Ga0207694_100016392 | 377 |
| 1075 | 3300025933 | Ga0207706_10017328 | Ga0207706_100173285 | 377 |
| 1076 | 3300025949 | Ga0207667_10045424 | Ga0207667_100454242 | 377 |
| 1077 | 3300025981 | Ga0207640_10022747 | Ga0207640_100227473 | 377 |
| 1078 | 3300026078 | Ga0207702_10000005 | Ga0207702_100000052 | 377 |
| 1079 | 3300026078 | Ga0207702_10126772 | Ga0207702_101267722 | 377 |
| 1080 | 3300026116 | Ga0207674_10016313 | Ga0207674_100163132 | 377 |
| 1081 | 3300026116 | Ga0207674_10450939 | Ga0207674_104509391 | 377 |
| 1082 | 3300026142 | Ga0207698_10041494 | Ga0207698_100414942 | 377 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qhp-assembly2.cif.gz_B | crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori | 0.8759 | 201 | 355 |
| 3qhp-assembly2.cif.gz_B | crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori | 0.86 | 201 | 355 |
| 2jjm-assembly1.cif.gz_B | crystal structure of a family gt4 glycosyltransferase from bacillus anthracis orf ba1558. | 0.8518 | 10 | 373 |
| 3qhp-assembly1.cif.gz_A | crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori | 0.8462 | 200 | 355 |
| 2jjm-assembly1.cif.gz_B | crystal structure of a family gt4 glycosyltransferase from bacillus anthracis orf ba1558. | 0.8452 | 10 | 373 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WMZ3_200_365_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9079 | 204 | 357 | 3.40.50.2000 |
| af_P9WMY9_212_374_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9041 | 197 | 353 | 3.40.50.2000 |
| af_Q59002_191_368_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8998 | 198 | 357 | 3.40.50.2000 |
| af_Q2G0L3_321_481_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8988 | 205 | 355 | 3.40.50.2000 |
| 5d00A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8837 | 197 | 357 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A848Y305-F1-model_v4 | Glycosyltransferase family 4 protein | 0.9534 | 70 | 377 |
GO:0016757
|
| AF-A0A519YLP5-F1-model_v4 | deleted | 0.95 | 7 | 364 |
|
| AF-A0A519XZA0-F1-model_v4 | deleted | 0.9441 | 4 | 266 |
|
| AF-A0A4V1VJ67-F1-model_v4 | Glycosyltransferase | 0.943 | 246 | 376 |
GO:0016757
|
| AF-A0A2V5CDN7-F1-model_v4 | deleted | 0.9364 | 5 | 375 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar