F489690

General Info

Members Datasets Scaffolds Average Seq Length
1082 623 867 375

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100079332|Ga0068853_1000793322
Length 414
Sequence MPDARRERRRPPRACRACSPGPSGDGCAAPQGFDVTTPAADRPLRVLHAVRAPVGGIFRHILDLANGQADRGHEVGIIADSLTGGERANQALAEIAPRLKLGVHRIAIHREPWPTDALVWARFMHWIRRLKPDVLHGHGAKAGVFIRLRRRTHRAIRVYTPHGGSLHYPPSSAKGKFYSSLERALMNNTDLFLFESAFARDTYQRTIGTPKGLVRCVFNGVTAAEFDPVPRAADATDVVYVGEFRHIKGADLLVDAVARLRADGKPVTLTLAGDGEETAALKAQVARLSLANSVQFIGHVKARHGFSKGKLLVVPSRGDSMPYVVIEAGAAGIPMVAANVGGIPEIFGPFTDALFAPSNIGSAADAIKTAMAEPEAAQARAGEMRERILQHFSQKAMVDGVLAGYRDAFEAARR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
21 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
22 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
23 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
24 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
25 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
26 2791355199
27 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
28 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
29 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
30 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
31 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
32 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
33 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
34 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
35 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
36 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
37 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
38 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
39 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
40 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
41 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
42 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
43 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
44 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
45 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
46 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
47 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
48 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
49 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
50 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
51 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
52 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
53 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
54 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
55 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
56 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
57 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
58 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
59 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
60 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
61 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
62 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
63 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
64 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
65 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
66 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
67 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
68 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
69 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
70 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
71 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
72 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
73 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
74 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
75 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
76 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
77 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
78 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
79 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
80 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
81 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
82 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
83 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
84 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
85 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
86 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
87 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
88 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
89 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
90 2904699407
91 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
92 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
93 2906610324
94 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
95 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
96 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
97 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
98 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
99 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
100 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
101 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
102 2922368715
103 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
104 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
105 2922425934
106 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
107 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
108 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
109 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
110 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
111 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
112 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
113 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
114 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
115 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
116 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
117 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
118 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
119 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
120 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
121 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
122 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
123 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
124 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
125 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
126 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
127 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
128 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
129 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
130 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
131 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
132 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
133 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
134 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
135 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
136 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
137 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
138 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
139 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
140 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
141 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
142 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
143 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
144 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
145 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
146 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
147 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
148 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
149 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
150 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
151 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
152 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
153 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
154 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
155 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
156 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
157 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
158 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
159 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
160 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
161 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
162 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
163 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
164 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
165 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
166 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
167 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
168 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
169 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
170 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
171 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
172 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
173 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
174 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
175 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
176 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
177 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
178 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
179 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
180 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
181 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
182 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
183 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
184 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
185 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
186 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
187 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
188 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
189 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
190 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
191 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
192 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
193 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
194 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
195 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
196 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
197 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
198 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
199 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
200 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
201 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
202 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
203 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
204 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
205 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
206 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
207 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
208 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
209 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
210 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
211 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
212 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
213 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
214 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
215 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
216 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
217 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
218 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
219 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
220 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
221 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
222 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
223 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
224 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
225 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
226 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
227 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
228 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
229 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
230 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
231 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
232 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
233 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
234 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
235 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
236 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
237 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
238 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
239 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
240 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
241 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
242 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
243 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
244 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
245 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
246 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
247 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
248 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
249 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
250 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
251 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
252 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
253 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
254 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
255 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
256 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
257 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
258 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
259 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
260 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
261 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
262 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
263 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
264 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
265 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
266 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
267 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
268 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
269 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
270 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
271 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
272 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
273 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
274 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
275 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
276 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
277 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
278 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
279 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
280 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
282 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
285 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
287 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
288 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
289 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
290 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
340 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
341 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
342 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
343 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
347 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
348 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
349 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
350 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
351 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
352 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
353 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
354 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
355 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
356 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
357 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
358 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
359 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
360 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
361 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
362 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
363 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
364 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
365 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
366 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
367 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
368 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
369 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
370 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
371 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
372 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
373 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
374 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
375 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
376 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
377 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
378 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
379 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
380 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
381 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
382 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
383 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
384 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
385 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
386 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
387 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
388 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
389 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
390 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
391 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
392 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
393 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
394 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
395 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
396 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
397 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
398 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
399 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
400 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
401 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
402 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
403 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
404 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
405 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
406 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
407 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
408 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
409 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
410 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
411 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
412 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
413 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
414 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
415 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
416 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
417 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
418 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
419 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
420 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
421 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
422 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
423 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
424 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
425 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
426 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
427 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
428 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
429 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
430 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
431 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
432 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
433 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
434 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
435 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
436 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
437 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
438 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
439 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
440 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
441 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
442 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
443 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
444 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
445 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
446 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
447 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
448 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
449 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
450 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
451 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
452 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
453 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
454 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
455 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
456 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
457 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
458 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
459 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
460 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
461 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
462 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
463 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
464 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
465 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
466 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
467 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
468 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
469 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
470 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
471 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
472 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
473 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
474 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
475 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
476 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
477 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
478 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
479 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
480 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
481 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
482 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
483 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
484 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
485 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
486 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
487 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
488 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
489 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
490 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
491 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
492 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
493 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
494 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
495 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
496 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
497 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
498 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
499 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
500 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
501 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
502 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
503 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
504 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
505 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
506 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
511 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
513 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
514 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
515 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
518 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
519 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
520 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
521 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
522 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
523 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
524 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
525 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
526 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
527 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
528 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
529 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
530 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
531 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
532 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
533 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
534 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
535 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
536 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
537 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
538 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
539 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
540 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
541 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
542 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
543 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
544 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
545 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
546 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
547 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
548 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
549 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
550 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
551 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
552 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
553 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
554 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
555 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
556 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
557 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
558 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
559 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
560 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
561 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
562 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
563 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
564 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
565 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
566 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
567 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
568 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
569 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
570 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
571 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
572 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
573 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
574 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
575 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
576 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
577 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
578 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
579 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
580 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
581 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
582 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
583 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
584 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
585 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
586 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
587 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
588 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
589 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
590 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
591 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
592 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
593 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
594 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
595 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
596 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
597 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
598 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
599 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
600 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
601 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
602 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
603 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
604 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
605 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
606 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
607 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
608 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
609 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
610 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
611 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
612 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
613 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
614 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
615 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
616 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
617 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
618 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
619 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
620 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
621 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
622 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
623 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.5
Metatranscriptomes 0
Isolates 19.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.11
Nodule 15.99
Rhizoplane 4.16
Rhizosphere 57.3
Stem 0
Stem Tuber 0
Unclassified 10.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007113 3300001979 Bacteria 4576
2 JGI24737J22298_10008019 3300001990 Bacteria 3548
3 JGI25406J46586_10000006 3300003203 Bacteria 114937
4 JGI25153J46596_10011119 3300003215 Bacteria 4005
5 rootH2_10006936 3300003320 Bacteria 2542
6 JGI25160J50197_1002805 3300003354 Bacteria 7979
7 JGI25160J50197_1006702 3300003354 Bacteria 4626
8 JGI25160J50197_1014046 3300003354 Bacteria 2697
9 JGI25404J52841_10009757 3300003659 Bacteria 2058
10 JGI25404J52841_10012436 3300003659 Bacteria 1843
11 JGI25404J52841_10015760 3300003659 Bacteria 1639
12 JGI25404J52841_10017024 3300003659 Bacteria 1576
13 Ga0055531_10007030 3300003794 Bacteria 6229
14 Ga0055531_10011902 3300003794 Bacteria 4142
15 Ga0065165_1001864 3300005262 Bacteria 20463
16 Ga0065165_1003443 3300005262 Bacteria 11124
17 Ga0065165_1009002 3300005262 Bacteria 4559
18 Ga0070683_100035409 3300005329 Bacteria 4564
19 Ga0070683_100037262 3300005329 Bacteria 4451
20 Ga0070683_100052002 3300005329 Bacteria 3794
21 Ga0070666_10088394 3300005335 Bacteria 2126
22 Ga0070680_100043913 3300005336 Bacteria 3631
23 Ga0070680_100064157 3300005336 Bacteria 3010
24 Ga0070680_100141650 3300005336 Bacteria 2017
25 Ga0070680_100144976 3300005336 Bacteria 1992
26 Ga0070682_100204629 3300005337 Bacteria 1395
27 Ga0068868_100093972 3300005338 Bacteria 2418
28 Ga0070660_100079663 3300005339 Bacteria 2570
29 Ga0070660_100122875 3300005339 Bacteria 2072
30 Ga0070661_100164901 3300005344 Bacteria 1680
31 Ga0070668_100025503 3300005347 Bacteria 4482
32 Ga0070669_100107871 3300005353 Bacteria 2110
33 Ga0070671_100024002 3300005355 Bacteria 4990
34 Ga0070659_100024129 3300005366 Bacteria 4661
35 Ga0070659_100024651 3300005366 Bacteria 4614
36 Ga0070659_100028527 3300005366 Bacteria 4312
37 Ga0070667_100191133 3300005367 Bacteria 1814
38 Ga0070709_10000337 3300005434 Bacteria 29157
39 Ga0070709_10009552 3300005434 Bacteria 5354
40 Ga0070714_100003394 3300005435 Bacteria 11871
41 Ga0070714_100047712 3300005435 Bacteria 3640
42 Ga0070714_100080180 3300005435 Bacteria 2840
43 Ga0070713_100013337 3300005436 Bacteria 6066
44 Ga0070713_100056049 3300005436 Bacteria 3278
45 Ga0070710_10000508 3300005437 Bacteria 18304
46 Ga0070710_10026057 3300005437 Bacteria 3103
47 Ga0070711_100001466 3300005439 Bacteria 12962
48 Ga0070711_100025668 3300005439 Bacteria 3857
49 Ga0070711_100235686 3300005439 Bacteria 1429
50 Ga0070663_100009242 3300005455 Bacteria 6096
51 Ga0070663_100011245 3300005455 Bacteria 5611
52 Ga0070663_100038211 3300005455 Bacteria 3347
53 Ga0070663_100094371 3300005455 Bacteria 2222
54 Ga0070678_100014206 3300005456 Bacteria 5016
55 Ga0070662_100042412 3300005457 Bacteria 3250
56 Ga0070662_100150677 3300005457 Bacteria 1810
57 Ga0070681_10149181 3300005458 Bacteria 2266
58 Ga0070681_10239330 3300005458 Bacteria 1729
59 Ga0070681_10309054 3300005458 Bacteria 1490
60 Ga0070699_100206232 3300005518 Bacteria 1749
61 Ga0070679_100053634 3300005530 Bacteria 4013
62 Ga0070679_100071810 3300005530 Bacteria 3453
63 Ga0070684_100001878 3300005535 Bacteria 15380
64 Ga0070697_100008498 3300005536 Bacteria 8014
65 Ga0068853_100033886 3300005539 Bacteria 4333
66 Ga0068853_100079332 3300005539 Bacteria 2871
67 Ga0068853_100116264 3300005539 Bacteria 2381
68 Ga0070672_100107871 3300005543 Bacteria 2267
69 Ga0070665_100013576 3300005548 Bacteria 8194
70 Ga0070665_100059878 3300005548 Bacteria 3817
71 Ga0068855_100031483 3300005563 Bacteria 6334
72 Ga0068855_100047028 3300005563 Bacteria 5099
73 Ga0068855_100094063 3300005563 Bacteria 3456
74 Ga0068855_100211125 3300005563 Bacteria 2181
75 Ga0068855_100285752 3300005563 Bacteria 1830
76 Ga0068857_100010572 3300005577 Bacteria 8024
77 Ga0068857_100041731 3300005577 Bacteria 4068
78 Ga0068857_100052056 3300005577 Bacteria 3633
79 Ga0068857_100231378 3300005577 Bacteria 1690
80 Ga0068854_100114444 3300005578 Bacteria 2039
81 Ga0068854_100115076 3300005578 Bacteria 2034
82 Ga0068856_100001022 3300005614 Bacteria 29775
83 Ga0068856_100055877 3300005614 Bacteria 3895
84 Ga0068856_100079971 3300005614 Bacteria 3242
85 Ga0068856_100092247 3300005614 Bacteria 3013
86 Ga0068856_100239351 3300005614 Bacteria 1830
87 Ga0068852_100007822 3300005616 Bacteria 7826
88 Ga0068852_100008036 3300005616 Bacteria 7739
89 Ga0068852_100158279 3300005616 Bacteria 2112
90 Ga0068859_100223355 3300005617 Bacteria 1971
91 Ga0068864_100046992 3300005618 Bacteria 3705
92 Ga0068861_100011588 3300005719 Bacteria 6134
93 Ga0068851_10052697 3300005834 Bacteria 2069
94 Ga0068870_10147937 3300005840 Bacteria 1381
95 Ga0068863_100108446 3300005841 Bacteria 2642
96 Ga0068858_100143074 3300005842 Bacteria 2246
97 Ga0068860_100000058 3300005843 Bacteria 197181
98 Ga0068862_100125218 3300005844 Bacteria 2268
99 Ga0081455_10001781 3300005937 Bacteria 26018
100 Ga0081455_10006971 3300005937 Bacteria 12007
101 Ga0081455_10008715 3300005937 Bacteria 10503
102 Ga0081455_10011757 3300005937 Bacteria 8767
103 Ga0081455_10065025 3300005937 Bacteria 3052
104 Ga0081455_10067399 3300005937 Bacteria 2983
105 Ga0081538_10020550 3300005981 Bacteria 4851
106 Ga0081540_1001631 3300005983 Bacteria 19125
107 Ga0081540_1004255 3300005983 Bacteria 10988
108 Ga0081540_1004483 3300005983 Bacteria 10622
109 Ga0081540_1024868 3300005983 Bacteria 3463
110 Ga0081540_1028613 3300005983 Bacteria 3125
111 Ga0081540_1036032 3300005983 Bacteria 2645
112 Ga0081540_1048679 3300005983 Bacteria 2121
113 Ga0081540_1049510 3300005983 Bacteria 2095
114 Ga0081539_10000176 3300005985 Bacteria 150292
115 Ga0081539_10000250 3300005985 Bacteria 125352
116 Ga0081539_10073326 3300005985 Bacteria 1826
117 Ga0070717_10001774 3300006028 Bacteria 15044
118 Ga0070717_10076501 3300006028 Bacteria 2802
119 Ga0070717_10177685 3300006028 Bacteria 1854
120 Ga0075365_10000419 3300006038 Bacteria 15674
121 Ga0075365_10062063 3300006038 Bacteria 2498
122 Ga0075365_10068011 3300006038 Bacteria 2393
123 Ga0075365_10075902 3300006038 Bacteria 2269
124 Ga0075365_10163445 3300006038 Bacteria 1552
125 Ga0075368_10032088 3300006042 Bacteria 2039
126 Ga0075363_100011206 3300006048 Bacteria 4287
127 Ga0075363_100014293 3300006048 Bacteria 3873
128 Ga0075363_100022463 3300006048 Bacteria 3189
129 Ga0075363_100069143 3300006048 Bacteria 1915
130 Ga0075364_10024554 3300006051 Bacteria 3829
131 Ga0075364_10036661 3300006051 Bacteria 3171
132 Ga0070715_10015563 3300006163 Bacteria 2841
133 Ga0070716_100043115 3300006173 Bacteria 2521
134 Ga0070712_100028701 3300006175 Bacteria 3724
135 Ga0070712_100054173 3300006175 Bacteria 2803
136 Ga0075367_10001505 3300006178 Bacteria 10071
137 Ga0075367_10017943 3300006178 Bacteria 3895
138 Ga0075369_10015474 3300006186 Bacteria 3062
139 Ga0075366_10023941 3300006195 Bacteria 3558
140 Ga0097621_100130695 3300006237 Bacteria 2137
141 Ga0075434_100224791 3300006871 Bacteria 1897
142 Ga0068865_100063969 3300006881 Bacteria 2587
143 Ga0068865_100076320 3300006881 Bacteria 2392
144 Ga0097620_100223355 3300006931 Bacteria 1971
145 Ga0099825_1030643 3300006941 Bacteria 2360
146 Ga0099824_1004496 3300006942 Bacteria 20072
147 Ga0099822_1012804 3300006943 Bacteria 9955
148 Ga0099823_1037031 3300006944 Bacteria 3712
149 Ga0099794_10030328 3300007265 Bacteria 2525
150 Ga0099794_10032336 3300007265 Bacteria 2455
151 Ga0105240_10002351 3300009093 Bacteria 30510
152 Ga0105240_10043962 3300009093 Bacteria 5680
153 Ga0105240_10077533 3300009093 Bacteria 4094
154 Ga0105240_10214043 3300009093 Bacteria 2249
155 Ga0111539_10163205 3300009094 Bacteria 2606
156 Ga0105245_10057229 3300009098 Bacteria 3506
157 Ga0105245_10064176 3300009098 Bacteria 3319
158 Ga0105245_10118193 3300009098 Bacteria 2474
159 Ga0105247_10070021 3300009101 Bacteria 2191
160 Ga0105247_10197107 3300009101 Bacteria 1351
161 Ga0105243_10054594 3300009148 Bacteria 3172
162 Ga0105243_10229789 3300009148 Bacteria 1645
163 Ga0105241_10022028 3300009174 Bacteria 4716
164 Ga0105241_10093600 3300009174 Bacteria 2375
165 Ga0105248_10044529 3300009177 Bacteria 4977
166 Ga0105248_10063999 3300009177 Bacteria 4129
167 Ga0105237_10009523 3300009545 Bacteria 10402
168 Ga0105237_10028844 3300009545 Bacteria 5647
169 Ga0105237_10029668 3300009545 Bacteria 5557
170 Ga0105237_10035284 3300009545 Bacteria 5060
171 Ga0105237_10043296 3300009545 Bacteria 4535
172 Ga0105237_10050719 3300009545 Bacteria 4169
173 Ga0105237_10107223 3300009545 Bacteria 2785
174 Ga0105237_10130880 3300009545 Bacteria 2503
175 Ga0105237_10219618 3300009545 Bacteria 1901
176 Ga0105237_10289200 3300009545 Bacteria 1642
177 Ga0105237_10301032 3300009545 Bacteria 1607
178 Ga0105238_10014756 3300009551 Bacteria 7902
179 Ga0105238_10022350 3300009551 Bacteria 6448
180 Ga0105238_10041533 3300009551 Bacteria 4657
181 Ga0105238_10115534 3300009551 Bacteria 2663
182 Ga0105238_10251576 3300009551 Bacteria 1745
183 Ga0105238_10438701 3300009551 Bacteria 1302
184 Ga0105249_10122999 3300009553 Bacteria 2468
185 Ga0099796_10005576 3300010159 Bacteria 3149
186 Ga0105239_10036223 3300010375 Bacteria 5418
187 Ga0105239_10115649 3300010375 Bacteria 2976
188 Ga0105239_10214348 3300010375 Bacteria 2158
189 Ga0105239_10333750 3300010375 Bacteria 1711
190 Ga0105239_10382535 3300010375 Bacteria 1591
191 Ga0157370_10087962 3300013104 Bacteria 2918
192 Ga0157370_10095364 3300013104 Bacteria 2791
193 Ga0157369_10486335 3300013105 Bacteria 1277
194 Ga0157374_10028873 3300013296 Bacteria 5014
195 Ga0157378_10003751 3300013297 Bacteria 13465
196 Ga0157378_10080822 3300013297 Bacteria 2937
197 Ga0157378_10087404 3300013297 Bacteria 2828
198 Ga0163162_10118191 3300013306 Bacteria 2753
199 Ga0157372_10052487 3300013307 Bacteria 4540
200 Ga0157372_10130464 3300013307 Bacteria 2892
201 Ga0157375_10013452 3300013308 Bacteria 7283
202 Ga0157375_10068523 3300013308 Bacteria 3550
203 Ga0157375_10572742 3300013308 Bacteria 1290
204 Ga0163163_10008664 3300014325 Bacteria 9046
205 Ga0163163_10094697 3300014325 Bacteria 3005
206 Ga0157379_10139071 3300014968 Bacteria 2189
207 Ga0157379_10163945 3300014968 Bacteria 2006
208 Ga0157376_10014470 3300014969 Bacteria 5924
209 Ga0157376_10286641 3300014969 Bacteria 1553
210 Ga0214544_1000009 3300021320 Bacteria 285865
211 Ga0214542_1000002 3300021321 Bacteria 720798
212 Ga0214545_1000002 3300021324 Bacteria 727485
213 Ga0214543_1000013 3300021327 Bacteria 329117
214 Ga0213876_10010209 3300021384 Bacteria 5044
215 Ga0213876_10061558 3300021384 Bacteria 1980
216 Ga0213871_10009469 3300021441 Bacteria 2183
217 Ga0209563_102229 3300025230 Bacteria 4492
218 Ga0207425_1014717 3300025245 Bacteria 1772
219 Ga0209677_102751 3300025253 Bacteria 6285
220 Ga0209148_1000446 3300025254 Bacteria 45354
221 Ga0209148_1009728 3300025254 Bacteria 1855
222 Ga0209233_1006768 3300025261 Bacteria 3669
223 Ga0209233_1009455 3300025261 Bacteria 2965
224 Ga0209233_1014977 3300025261 Bacteria 2172
225 Ga0209455_1001699 3300025272 Bacteria 9434
226 Ga0209455_1003608 3300025272 Bacteria 5389
227 Ga0209455_1008571 3300025272 Bacteria 2766
228 Ga0209564_1003387 3300025295 Bacteria 10992
229 Ga0209564_1007161 3300025295 Bacteria 5815
230 Ga0209758_1000100 3300025297 Bacteria 227948
231 Ga0209758_1001008 3300025297 Bacteria 37348
232 Ga0209758_1001125 3300025297 Bacteria 34352
233 Ga0209758_1002793 3300025297 Bacteria 17073
234 Ga0209758_1003783 3300025297 Bacteria 13341
235 Ga0209758_1005742 3300025297 Bacteria 9346
236 Ga0209758_1007434 3300025297 Bacteria 7453
237 Ga0209758_1015490 3300025297 Bacteria 3941
238 Ga0209758_1018121 3300025297 Bacteria 3468
239 Ga0209758_1035384 3300025297 Bacteria 1969
240 Ga0209256_1011371 3300025299 Bacteria 3570
241 Ga0207426_1001094 3300025302 Bacteria 25012
242 Ga0207426_1002241 3300025302 Bacteria 12874
243 Ga0207426_1011700 3300025302 Bacteria 3328
244 Ga0209257_1006404 3300025304 Bacteria 7602
245 Ga0209257_1020976 3300025304 Bacteria 2391
246 Ga0207656_10011134 3300025321 Bacteria 3390
247 Ga0207692_10001906 3300025898 Bacteria 7932
248 Ga0207642_10059548 3300025899 Bacteria 1767
249 Ga0207710_10005054 3300025900 Bacteria 5716
250 Ga0207710_10005124 3300025900 Bacteria 5670
251 Ga0207710_10049181 3300025900 Bacteria 1888
252 Ga0207710_10074065 3300025900 Bacteria 1567
253 Ga0207680_10034129 3300025903 Bacteria 2909
254 Ga0207680_10089723 3300025903 Bacteria 1952
255 Ga0207647_10035221 3300025904 Bacteria 3191
256 Ga0207685_10016774 3300025905 Bacteria 2351
257 Ga0207685_10041048 3300025905 Bacteria 1729
258 Ga0207699_10000604 3300025906 Bacteria 17559
259 Ga0207699_10016956 3300025906 Bacteria 3822
260 Ga0207699_10113213 3300025906 Bacteria 1743
261 Ga0207643_10162052 3300025908 Bacteria 1346
262 Ga0207705_10258940 3300025909 Bacteria 1328
263 Ga0207654_10012282 3300025911 Bacteria 4386
264 Ga0207654_10036806 3300025911 Bacteria 2737
265 Ga0207707_10216760 3300025912 Bacteria 1666
266 Ga0207707_10290578 3300025912 Bacteria 1414
267 Ga0207695_10000278 3300025913 Bacteria 127446
268 Ga0207695_10001915 3300025913 Bacteria 32381
269 Ga0207695_10155696 3300025913 Bacteria 2220
270 Ga0207671_10008450 3300025914 Bacteria 8728
271 Ga0207671_10011711 3300025914 Bacteria 7106
272 Ga0207671_10018832 3300025914 Bacteria 5290
273 Ga0207671_10060489 3300025914 Bacteria 2810
274 Ga0207671_10105087 3300025914 Bacteria 2142
275 Ga0207671_10131680 3300025914 Bacteria 1920
276 Ga0207671_10298658 3300025914 Bacteria 1272
277 Ga0207693_10003576 3300025915 Bacteria 13283
278 Ga0207693_10026628 3300025915 Bacteria 4575
279 Ga0207663_10004391 3300025916 Bacteria 7001
280 Ga0207660_10013547 3300025917 Bacteria 5345
281 Ga0207660_10131566 3300025917 Bacteria 1905
282 Ga0207660_10173059 3300025917 Bacteria 1672
283 Ga0207660_10203759 3300025917 Bacteria 1546
284 Ga0207657_10002222 3300025919 Bacteria 21059
285 Ga0207657_10011901 3300025919 Bacteria 8609
286 Ga0207657_10155555 3300025919 Bacteria 1859
287 Ga0207657_10208983 3300025919 Bacteria 1567
288 Ga0207649_10148353 3300025920 Bacteria 1612
289 Ga0207652_10108241 3300025921 Bacteria 2463
290 Ga0207652_10126019 3300025921 Bacteria 2281
291 Ga0207694_10001639 3300025924 Bacteria 18837
292 Ga0207694_10120189 3300025924 Bacteria 2097
293 Ga0207694_10327293 3300025924 Bacteria 1265
294 Ga0207687_10089800 3300025927 Bacteria 2238
295 Ga0207687_10121518 3300025927 Bacteria 1954
296 Ga0207687_10146994 3300025927 Bacteria 1794
297 Ga0207700_10000752 3300025928 Bacteria 18675
298 Ga0207700_10024997 3300025928 Bacteria 4141
299 Ga0207700_10083339 3300025928 Bacteria 2503
300 Ga0207700_10173309 3300025928 Bacteria 1801
301 Ga0207664_10006080 3300025929 Bacteria 8268
302 Ga0207664_10040726 3300025929 Bacteria 3615
303 Ga0207664_10071396 3300025929 Bacteria 2797
304 Ga0207690_10193582 3300025932 Bacteria 1539
305 Ga0207706_10017328 3300025933 Bacteria 6489
306 Ga0207706_10043872 3300025933 Bacteria 3963
307 Ga0207706_10100152 3300025933 Bacteria 2549
308 Ga0207709_10059282 3300025935 Bacteria 2382
309 Ga0207669_10112264 3300025937 Bacteria 1829
310 Ga0207704_10042852 3300025938 Bacteria 2668
311 Ga0207704_10087262 3300025938 Bacteria 2037
312 Ga0207665_10001395 3300025939 Bacteria 16252
313 Ga0207665_10046251 3300025939 Bacteria 2916
314 Ga0207665_10116154 3300025939 Bacteria 1886
315 Ga0207691_10030847 3300025940 Bacteria 5007
316 Ga0207711_10276917 3300025941 Bacteria 1544
317 Ga0207711_10342177 3300025941 Bacteria 1384
318 Ga0207689_10048731 3300025942 Bacteria 3495
319 Ga0207661_10001198 3300025944 Bacteria 17338
320 Ga0207661_10250092 3300025944 Bacteria 1575
321 Ga0207667_10003512 3300025949 Bacteria 19383
322 Ga0207667_10045424 3300025949 Bacteria 4652
323 Ga0207667_10065888 3300025949 Bacteria 3777
324 Ga0207667_10081109 3300025949 Bacteria 3361
325 Ga0207667_10086339 3300025949 Bacteria 3247
326 Ga0207667_10411163 3300025949 Bacteria 1377
327 Ga0207712_10106695 3300025961 Bacteria 2093
328 Ga0207668_10066692 3300025972 Bacteria 2552
329 Ga0207640_10022747 3300025981 Bacteria 3757
330 Ga0207677_10105345 3300026023 Bacteria 2086
331 Ga0207703_10110533 3300026035 Bacteria 2345
332 Ga0207703_10131305 3300026035 Bacteria 2163
333 Ga0207678_10018848 3300026067 Bacteria 6061
334 Ga0207678_10069106 3300026067 Bacteria 3029
335 Ga0207678_10132976 3300026067 Bacteria 2122
336 Ga0207678_10178823 3300026067 Bacteria 1811
337 Ga0207678_10315419 3300026067 Bacteria 1344
338 Ga0207708_10026957 3300026075 Bacteria 4351
339 Ga0207708_10044185 3300026075 Bacteria 3395
340 Ga0207702_10000005 3300026078 Bacteria 420296
341 Ga0207702_10014864 3300026078 Bacteria 6458
342 Ga0207702_10062730 3300026078 Bacteria 3175
343 Ga0207702_10126772 3300026078 Bacteria 2293
344 Ga0207702_10140013 3300026078 Bacteria 2188
345 Ga0207676_10075385 3300026095 Bacteria 2721
346 Ga0207674_10016313 3300026116 Bacteria 8136
347 Ga0207674_10044955 3300026116 Bacteria 4547
348 Ga0207674_10068286 3300026116 Bacteria 3577
349 Ga0207674_10434347 3300026116 Bacteria 1269
350 Ga0207674_10450939 3300026116 Bacteria 1243
351 Ga0207675_100160034 3300026118 Bacteria 2147
352 Ga0207675_100212226 3300026118 Bacteria 1862
353 Ga0207683_10052738 3300026121 Bacteria 3564
354 Ga0207683_10056139 3300026121 Bacteria 3454
355 Ga0207698_10017856 3300026142 Bacteria 4822
356 Ga0207698_10030256 3300026142 Bacteria 3890
357 Ga0207698_10041494 3300026142 Bacteria 3429
358 Ga0207698_10048796 3300026142 Bacteria 3217
359 Ga0209389_1000084 3300027296 Bacteria 85267
360 Ga0209389_1000113 3300027296 Bacteria 72242
361 Ga0209589_1000023 3300027357 Bacteria 177856
362 Ga0209589_1000041 3300027357 Bacteria 125191
363 Ga0209489_100032 3300027361 Bacteria 177856
364 Ga0209489_100070 3300027361 Bacteria 138580
365 Ga0209489_107143 3300027361 Bacteria 17020
366 Ga0209700_100021 3300027363 Bacteria 230859
367 Ga0209700_100040 3300027363 Bacteria 177856
368 Ga0268266_10003050 3300028379 Bacteria 17142
369 Ga0268266_10012507 3300028379 Bacteria 7335
370 Ga0268266_10017618 3300028379 Bacteria 6091
371 Ga0268266_10386438 3300028379 Bacteria 1321
372 Ga0268265_10106090 3300028380 Bacteria 2281
373 Ga0268264_10000022 3300028381 Bacteria 476624
374 Ga0268264_10059682 3300028381 Bacteria 3196
375 Ga0268264_10254651 3300028381 Bacteria 1632
376 Ga0265337_1004278 3300028556 Bacteria 5955
377 Ga0265326_10022991 3300028558 Bacteria 1783
378 Ga0307517_10004643 3300028786 Bacteria 21044
379 Ga0307515_10013142 3300028794 Bacteria 15495
380 Ga0265324_10003894 3300029957 Bacteria 6954
381 Ga0265330_10023016 3300031235 Bacteria 2831
382 Ga0265332_10053903 3300031238 Bacteria 1725
383 Ga0265325_10032658 3300031241 Bacteria 2777
384 Ga0265340_10011316 3300031247 Bacteria 4745
385 Ga0265340_10047250 3300031247 Bacteria 2097
386 Ga0265339_10007490 3300031249 Bacteria 7047
387 Ga0265316_10072256 3300031344 Bacteria 2658
388 Ga0307509_10008409 3300031507 Bacteria 13174
389 Ga0265313_10030588 3300031595 Bacteria 2770
390 Ga0307508_10000038 3300031616 Bacteria 150186
391 Ga0265314_10000937 3300031711 Bacteria 34281
392 Ga0265314_10003315 3300031711 Bacteria 15703
393 Ga0265314_10016661 3300031711 Bacteria 5795
394 Ga0265314_10142735 3300031711 Bacteria 1478
395 Ga0265342_10012895 3300031712 Bacteria 5637
396 Ga0265342_10054311 3300031712 Bacteria 2380
397 Ga0307516_10008870 3300031730 Bacteria 11292
398 Ga0307516_10048871 3300031730 Bacteria 4161
399 Ga0307516_10108446 3300031730 Bacteria 2583
400 Ga0307516_10148099 3300031730 Bacteria 2111
401 Ga0307413_10033046 3300031824 Bacteria 2940
402 Ga0307409_100059109 3300031995 Bacteria 2981
403 Ga0307415_100039397 3300032126 Bacteria 3123
404 Ga0307510_10043585 3300033180 Bacteria 4875
405 Ga0307510_10045521 3300033180 Bacteria 4735
406 Ga0307510_10056016 3300033180 Bacteria 4111
407 Ga0373950_0019305 3300034818 Bacteria 1189
408 Ga0373936_0025159 3300035113 Bacteria 2326
409 Ga0373945_0046245 3300035116 Bacteria 1587
410 Ga0373956_0003375 3300035119 Bacteria 6431
411 Ga0373957_0000100 3300035120 Bacteria 20828
412 Ga0373943_0037456 3300035170 Bacteria 2328
413 Ga0373946_0001312 3300035171 Bacteria 8599
414 Ga0373955_0030199 3300035172 Bacteria 2826
415 Ga0373924_0004454 3300035410 Bacteria 4894
416 Ga0373935_0001438 3300035692 Bacteria 13198
417 Ga0373927_0000225 3300035695 Bacteria 44840
418 Ga0373927_0010994 3300035695 Bacteria 6028
419 Ga0373927_0013017 3300035695 Bacteria 5533
420 Ga0373927_0014783 3300035695 Bacteria 5161
421 Ga0373933_0094015 3300035724 Bacteria 1853
422 Ga0373933_0157716 3300035724 Bacteria 1440
423 Ga0373933_0206285 3300035724 Bacteria 1258
424 Ga0373947_0002889 3300035725 Bacteria 10257
425 Ga0373937_0068873 3300036401 Bacteria 3262
426 Ga0373925_0000711 3300037068 Bacteria 31078
427 Ga0373925_0008511 3300037068 Bacteria 7477
428 Ga0373925_0112522 3300037068 Bacteria 2105
429 Ga0373925_0241309 3300037068 Bacteria 1447
430 Ga0395899_0091019 3300037312 Bacteria 2211
431 Ga0395900_0000860 3300037418 Bacteria 40028
432 Ga0395898_0011543 3300037466 Bacteria 9176
433 Ga0395898_0053862 3300037466 Bacteria 3928
434 Ga0395905_0021990 3300037471 Bacteria 6033
435 Ga0395905_0040874 3300037471 Bacteria 4350
436 Ga0436364_1474553 3300037853 Bacteria 2070
437 Ga0395901_0277399 3300038443 Bacteria 1742
438 Ga0395901_0321556 3300038443 Bacteria 1601
439 Ga0436365_0978478 3300039437 Bacteria 1881
440 Ga0436365_1727745 3300039437 Bacteria 22987
441 Ga0436360_0509368 3300039438 Bacteria 3790
442 Ga0436363_1276889 3300039450 Bacteria 2712
443 Ga0436362_1050878 3300039453 Bacteria 4244
444 Ga0451841_0656306 3300041498 Bacteria 1919
445 Ga0451853_2103515 3300041512 Bacteria 2022
446 Ga0466972_0000660 3300044658 Bacteria 16624
447 Ga0466965_0017918 3300044683 Bacteria 3387
448 Ga0466966_0059106 3300044684 Bacteria 2421
449 Ga0466961_0000488 3300044693 Bacteria 25223
450 Ga0466963_0210833 3300044694 Bacteria 1359
451 Ga0466968_0050276 3300044735 Bacteria 1778
452 Ga0466957_0072150 3300044842 Bacteria 2137
453 Ga0466959_0001793 3300045049 Bacteria 13423
454 Ga0466959_0093609 3300045049 Bacteria 2156
455 Ga0466959_0132905 3300045049 Bacteria 1763
456 Ga0466959_0143044 3300045049 Bacteria 1689
457 Ga0466967_0047594 3300045976 Bacteria 3739
458 Ga0466967_0089021 3300045976 Bacteria 2802
459 Ga0495592_0066499 3300046454 Bacteria 2637
460 Ga0495592_0146137 3300046454 Bacteria 1639
461 Ga0495603_0000960 3300046455 Bacteria 16606
462 Ga0495603_0007153 3300046455 Bacteria 6702
463 Ga0495603_0012975 3300046455 Bacteria 5037
464 Ga0495603_0033100 3300046455 Bacteria 3110
465 Ga0495590_0005096 3300046457 Bacteria 5239
466 Ga0495629_0000179 3300046459 Bacteria 56885
467 Ga0495629_0049950 3300046459 Bacteria 2931
468 Ga0495638_0021546 3300046460 Bacteria 4244
469 Ga0495638_0027548 3300046460 Bacteria 3677
470 Ga0495641_0004740 3300046461 Bacteria 9474
471 Ga0495651_0005780 3300046462 Bacteria 9439
472 Ga0495651_0040742 3300046462 Bacteria 3610
473 Ga0495653_0000905 3300046463 Bacteria 22949
474 Ga0495653_0228077 3300046463 Bacteria 1248
475 Ga0495653_0230588 3300046463 Bacteria 1239
476 Ga0495650_0051198 3300046471 Bacteria 1703
477 Ga0495580_0000280 3300046472 Bacteria 41385
478 Ga0495580_0142639 3300046472 Bacteria 1660
479 Ga0495582_0000061 3300046473 Bacteria 55522
480 Ga0495582_0142529 3300046473 Bacteria 1359
481 Ga0495605_0034250 3300046474 Bacteria 2572
482 Ga0495605_0081593 3300046474 Bacteria 1512
483 Ga0495639_0000102 3300046475 Bacteria 42249
484 Ga0495662_0000746 3300046476 Bacteria 15602
485 Ga0495664_0002105 3300046477 Bacteria 10644
486 Ga0495664_0033559 3300046477 Bacteria 3016
487 Ga0495584_0006929 3300046491 Bacteria 5923
488 Ga0495585_0010422 3300046492 Bacteria 5533
489 Ga0495585_0054163 3300046492 Bacteria 2218
490 Ga0495594_0000378 3300046499 Bacteria 22340
491 Ga0495594_0030178 3300046499 Bacteria 2932
492 Ga0495606_0016261 3300046507 Bacteria 5681
493 Ga0495606_0020685 3300046507 Bacteria 4843
494 Ga0495606_0164223 3300046507 Bacteria 1293
495 Ga0495608_0010907 3300046511 Bacteria 6331
496 Ga0495610_0048914 3300046512 Bacteria 2073
497 Ga0495610_0054023 3300046512 Bacteria 1942
498 Ga0495628_0018385 3300046516 Bacteria 5791
499 Ga0495628_0035270 3300046516 Bacteria 4021
500 Ga0495631_0021684 3300046518 Bacteria 2990
501 Ga0495643_0005874 3300046522 Bacteria 8209
502 Ga0495643_0024835 3300046522 Bacteria 3396
503 Ga0495648_0000160 3300046524 Bacteria 80523
504 Ga0495648_0001196 3300046524 Bacteria 25992
505 Ga0495648_0016227 3300046524 Bacteria 5373
506 Ga0495648_0061143 3300046524 Bacteria 2238
507 Ga0495642_0019910 3300046528 Bacteria 2631
508 Ga0495652_0013145 3300046529 Bacteria 7452
509 Ga0495652_0091685 3300046529 Bacteria 2483
510 Ga0495652_0105206 3300046529 Bacteria 2281
511 Ga0495654_0057793 3300046530 Bacteria 1873
512 Ga0495665_0000261 3300046531 Bacteria 26625
513 Ga0495640_0002042 3300046533 Bacteria 16096
514 Ga0495640_0040304 3300046533 Bacteria 3271
515 Ga0495640_0082595 3300046533 Bacteria 2133
516 Ga0495587_0066032 3300046536 Bacteria 2111
517 Ga0495598_0007033 3300046537 Bacteria 2564
518 Ga0495609_0037053 3300046538 Bacteria 2200
519 Ga0495621_0017023 3300046539 Bacteria 2342
520 Ga0495597_0019441 3300046542 Bacteria 3179
521 Ga0495645_0005022 3300046543 Bacteria 9067
522 Ga0495645_0009332 3300046543 Bacteria 6862
523 Ga0495645_0011286 3300046543 Bacteria 6282
524 Ga0495622_0008215 3300046557 Bacteria 4836
525 Ga0495622_0024903 3300046557 Bacteria 2794
526 Ga0495622_0114175 3300046557 Bacteria 1235
527 Ga0495633_0023884 3300046558 Bacteria 3025
528 Ga0495667_0011404 3300046559 Bacteria 6015
529 Ga0495667_0039154 3300046559 Bacteria 3154
530 Ga0495667_0082045 3300046559 Bacteria 2095
531 Ga0495667_0085530 3300046559 Bacteria 2047
532 Ga0495656_0003069 3300046615 Bacteria 5612
533 Ga0495656_0005194 3300046615 Bacteria 4489
534 Ga0495668_0018347 3300046616 Bacteria 4042
535 Ga0495668_0025430 3300046616 Bacteria 3364
536 Ga0495668_0063801 3300046616 Bacteria 2028
537 Ga0495668_0070808 3300046616 Bacteria 1917
538 Ga0495634_0000161 3300046642 Bacteria 60925
539 Ga0495634_0113048 3300046642 Bacteria 1744
540 Ga0495611_0003326 3300046648 Bacteria 7104
541 Ga0495625_0052926 3300046660 Bacteria 2905
542 Ga0495625_0170346 3300046660 Bacteria 1454
543 Ga0495635_0001102 3300046663 Bacteria 17952
544 Ga0495635_0001598 3300046663 Bacteria 15235
545 Ga0495635_0135687 3300046663 Bacteria 1677
546 Ga0495659_0022883 3300046664 Bacteria 2118
547 Ga0495588_0004167 3300046674 Bacteria 6374
548 Ga0495588_0098627 3300046674 Bacteria 1534
549 Ga0495657_0023663 3300046675 Bacteria 4387
550 Ga0495657_0032132 3300046675 Bacteria 3665
551 Ga0495599_0058148 3300046678 Bacteria 2419
552 Ga0495599_0128534 3300046678 Bacteria 1574
553 Ga0495623_0030541 3300046679 Bacteria 3466
554 Ga0495623_0121585 3300046679 Bacteria 1571
555 Ga0495623_0128826 3300046679 Bacteria 1517
556 Ga0495646_0050411 3300046680 Bacteria 2523
557 Ga0495647_0000205 3300046681 Bacteria 15996
558 Ga0495658_0001114 3300046683 Bacteria 14225
559 Ga0495669_0009267 3300046684 Bacteria 4148
560 Ga0495669_0013439 3300046684 Bacteria 3488
561 Ga0495613_0012105 3300046689 Bacteria 6412
562 Ga0495613_0063836 3300046689 Bacteria 2694
563 Ga0495624_0003890 3300046690 Bacteria 11008
564 Ga0495624_0027953 3300046690 Bacteria 3687
565 Ga0495670_0007362 3300046691 Bacteria 5409
566 Ga0495670_0080042 3300046691 Bacteria 1663
567 Ga0495671_0055927 3300046692 Bacteria 1954
568 Ga0495649_0009550 3300046694 Bacteria 5754
569 Ga0495649_0049185 3300046694 Bacteria 2290
570 Ga0495649_0122831 3300046694 Bacteria 1372
571 Ga0495600_0010669 3300046809 Bacteria 5708
572 Ga0495600_0016431 3300046809 Bacteria 4696
573 Ga0495581_0000255 3300047315 Bacteria 25578
574 Ga0495581_0040997 3300047315 Bacteria 2679
575 Ga0495604_0008729 3300047317 Bacteria 8010
576 Ga0495604_0010435 3300047317 Bacteria 7360
577 Ga0495604_0045012 3300047317 Bacteria 3445
578 Ga0495674_0000117 3300047319 Bacteria 60130
579 Ga0495674_0011652 3300047319 Bacteria 8292
580 Ga0495676_0006968 3300047321 Bacteria 10372
581 Ga0495676_0021084 3300047321 Bacteria 5703
582 Ga0495676_0029179 3300047321 Bacteria 4699
583 Ga0495680_0004171 3300047322 Bacteria 13893
584 Ga0495680_0124694 3300047322 Bacteria 1898
585 Ga0495683_0016976 3300047323 Bacteria 3775
586 Ga0495675_0067391 3300047444 Bacteria 2261
587 Ga0495677_0008483 3300047445 Bacteria 3816
588 Ga0495677_0018395 3300047445 Bacteria 2533
589 Ga0495673_0015016 3300047469 Bacteria 4007
590 Ga0495686_0051583 3300047472 Bacteria 2581
591 Ga0495686_0051720 3300047472 Bacteria 2577
592 Ga0495593_0000086 3300047673 Bacteria 40986
593 Ga0495593_0005818 3300047673 Bacteria 7270
594 Ga0495593_0033461 3300047673 Bacteria 2799
595 Ga0495602_0004737 3300048088 Bacteria 14223
596 Ga0495602_0057792 3300048088 Bacteria 3400
597 Ga0495602_0234343 3300048088 Bacteria 1377
598 Ga0495614_0018614 3300048089 Bacteria 3008
599 Ga0495626_0056236 3300048091 Bacteria 1802
600 Ga0496100_0045674 3300048903 Bacteria 2812
601 Ga0496100_0113533 3300048903 Bacteria 1886
602 Ga0496101_0021499 3300048904 Bacteria 4433
603 Ga0496102_0002395 3300048905 Bacteria 16005
604 Ga0496102_0213821 3300048905 Bacteria 1818
605 Ga0496102_0245913 3300048905 Bacteria 1686
606 Ga0496103_0021272 3300048906 Bacteria 3902
607 Ga0496104_0039154 3300048907 Bacteria 4438
608 Ga0496104_0045194 3300048907 Bacteria 4141
609 Ga0496104_0094983 3300048907 Bacteria 2852
610 Ga0496104_0154915 3300048907 Bacteria 2199
611 Ga0496105_0003203 3300048908 Bacteria 12051
612 Ga0496105_0052703 3300048908 Bacteria 3360
613 Ga0496105_0131830 3300048908 Bacteria 2060
614 Ga0496106_0000546 3300048909 Bacteria 26747
615 Ga0496106_0049188 3300048909 Bacteria 3176
616 Ga0496107_0006071 3300048910 Bacteria 8293
617 Ga0496107_0009700 3300048910 Bacteria 6675
618 Ga0496107_0120047 3300048910 Bacteria 1936
619 Ga0496108_0001487 3300048911 Bacteria 18522
620 Ga0496108_0404095 3300048911 Bacteria 1193
621 Ga0496109_0002290 3300048912 Bacteria 15920
622 Ga0496109_0035755 3300048912 Bacteria 4483
623 Ga0496109_0081686 3300048912 Bacteria 2978
624 Ga0496110_0028694 3300048913 Bacteria 4782
625 Ga0496110_0030245 3300048913 Bacteria 4666
626 Ga0496110_0036833 3300048913 Bacteria 4250
627 Ga0496110_0192481 3300048913 Bacteria 1852
628 Ga0496111_0087417 3300048914 Bacteria 2281
629 Ga0496112_0000079 3300048915 Bacteria 64101
630 Ga0496112_0088109 3300048915 Bacteria 3071
631 Ga0496112_0173714 3300048915 Bacteria 2120
632 Ga0496113_0041046 3300048916 Bacteria 3412
633 Ga0496113_0042654 3300048916 Bacteria 3353
634 Ga0496113_0092663 3300048916 Bacteria 2331
635 Ga0496114_0039704 3300048917 Bacteria 3895
636 Ga0496114_0057168 3300048917 Bacteria 3256
637 Ga0496114_0208632 3300048917 Bacteria 1713
638 Ga0496115_0000788 3300048918 Bacteria 23274
639 Ga0496115_0031854 3300048918 Bacteria 4157
640 Ga0496115_0103468 3300048918 Bacteria 2336
641 Ga0496115_0113682 3300048918 Bacteria 2225
642 Ga0496115_0132161 3300048918 Bacteria 2057
643 Ga0496115_0190376 3300048918 Bacteria 1695
644 Ga0496116_0099348 3300048919 Bacteria 1743
645 Ga0496118_0009864 3300048921 Bacteria 9553
646 Ga0496118_0017185 3300048921 Bacteria 6599
647 Ga0496118_0119680 3300048921 Bacteria 1721
648 Ga0496119_0002628 3300048922 Bacteria 19497
649 Ga0496119_0060982 3300048922 Bacteria 2255
650 Ga0496119_0072540 3300048922 Bacteria 2011
651 Ga0496120_0010435 3300048923 Bacteria 6482
652 Ga0496120_0070150 3300048923 Bacteria 1928
653 Ga0496121_0000495 3300048924 Bacteria 75339
654 Ga0496121_0001789 3300048924 Bacteria 34756
655 Ga0496121_0007340 3300048924 Bacteria 13328
656 Ga0496121_0038986 3300048924 Bacteria 4196
657 Ga0496121_0041310 3300048924 Bacteria 4032
658 Ga0496121_0041730 3300048924 Bacteria 4005
659 Ga0496121_0052341 3300048924 Bacteria 3430
660 Ga0496121_0077388 3300048924 Bacteria 2649
661 Ga0496121_0080315 3300048924 Bacteria 2586
662 Ga0496121_0089588 3300048924 Bacteria 2408
663 Ga0496121_0136742 3300048924 Bacteria 1824
664 Ga0496121_0230387 3300048924 Bacteria 1298
665 Ga0496124_0175761 3300048927 Bacteria 1653
666 Ga0496125_0000756 3300048928 Bacteria 52960
667 Ga0496125_0003979 3300048928 Bacteria 17384
668 Ga0496125_0035568 3300048928 Bacteria 4365
669 Ga0496125_0054112 3300048928 Bacteria 3283
670 Ga0496126_0002315 3300048929 Bacteria 26122
671 Ga0496126_0006416 3300048929 Bacteria 13114
672 Ga0496126_0009623 3300048929 Bacteria 10249
673 Ga0496126_0030943 3300048929 Bacteria 5063
674 Ga0496126_0037866 3300048929 Bacteria 4493
675 Ga0496126_0049932 3300048929 Bacteria 3816
676 Ga0496126_0082610 3300048929 Bacteria 2838
677 Ga0496126_0247566 3300048929 Bacteria 1486
678 Ga0496126_0283948 3300048929 Bacteria 1370
679 Ga0496126_0328033 3300048929 Bacteria 1257
680 Ga0495682_0007216 3300049460 Bacteria 4436
681 Ga0495682_0015674 3300049460 Bacteria 2872
682 Ga0501031_0028515 3300049568 Bacteria 3639
683 Ga0501031_0078035 3300049568 Bacteria 2157
684 Ga0501032_0007357 3300049569 Bacteria 8046
685 Ga0501032_0007780 3300049569 Bacteria 7815
686 Ga0501032_0014183 3300049569 Bacteria 5645
687 Ga0501032_0051663 3300049569 Bacteria 2771
688 Ga0501032_0160873 3300049569 Bacteria 1474
689 Ga0501033_0000313 3300049570 Bacteria 45940
690 Ga0501033_0001956 3300049570 Bacteria 17932
691 Ga0501033_0020816 3300049570 Bacteria 4951
692 Ga0501034_0000175 3300049571 Bacteria 119465
693 Ga0501034_0063889 3300049571 Bacteria 3695
694 Ga0501034_0065198 3300049571 Bacteria 3654
695 Ga0501034_0204542 3300049571 Bacteria 1931
696 Ga0501036_0000032 3300049572 Bacteria 91370
697 Ga0501036_0092834 3300049572 Bacteria 2550
698 Ga0501036_0180825 3300049572 Bacteria 1775
699 Ga0501036_0262814 3300049572 Bacteria 1446
700 Ga0501037_0000415 3300049573 Bacteria 35219
701 Ga0501037_0009384 3300049573 Bacteria 7180
702 Ga0501037_0024822 3300049573 Bacteria 4431
703 Ga0501037_0059114 3300049573 Bacteria 2797
704 Ga0501037_0073701 3300049573 Bacteria 2482
705 Ga0501037_0123227 3300049573 Bacteria 1862
706 Ga0501037_0129459 3300049573 Bacteria 1810
707 Ga0501038_0000114 3300049574 Bacteria 68140
708 Ga0501038_0010298 3300049574 Bacteria 8554
709 Ga0501038_0010663 3300049574 Bacteria 8403
710 Ga0501038_0011901 3300049574 Bacteria 7942
711 Ga0501038_0046908 3300049574 Bacteria 3744
712 Ga0501038_0053939 3300049574 Bacteria 3458
713 Ga0501038_0109579 3300049574 Bacteria 2288
714 Ga0501039_0000078 3300049575 Bacteria 73768
715 Ga0501039_0056463 3300049575 Bacteria 3041
716 Ga0501039_0170436 3300049575 Bacteria 1711
717 Ga0501040_0010883 3300049576 Bacteria 5946
718 Ga0501041_0137478 3300049577 Bacteria 1523
719 Ga0501042_0008806 3300049578 Bacteria 6691
720 Ga0501043_0000220 3300049579 Bacteria 51696
721 Ga0501043_0058864 3300049579 Bacteria 3015
722 Ga0501043_0059836 3300049579 Bacteria 2989
723 Ga0501043_0069641 3300049579 Bacteria 2763
724 Ga0501043_0124712 3300049579 Bacteria 2019
725 Ga0501046_0000176 3300049580 Bacteria 65273
726 Ga0501046_0017167 3300049580 Bacteria 6048
727 Ga0501046_0018872 3300049580 Bacteria 5727
728 Ga0501046_0091234 3300049580 Bacteria 2343
729 Ga0501046_0129766 3300049580 Bacteria 1912
730 Ga0501047_0000085 3300049581 Bacteria 118617
731 Ga0501047_0003015 3300049581 Bacteria 15979
732 Ga0501047_0021690 3300049581 Bacteria 6167
733 Ga0501047_0062758 3300049581 Bacteria 3584
734 Ga0501047_0295067 3300049581 Bacteria 1464
735 Ga0501048_0024136 3300049582 Bacteria 4439
736 Ga0501048_0046571 3300049582 Bacteria 3095
737 Ga0501067_0001860 3300049583 Bacteria 11596
738 Ga0501067_0003942 3300049583 Bacteria 8194
739 Ga0501067_0134372 3300049583 Bacteria 1377
740 Ga0501068_0001393 3300049584 Bacteria 12838
741 Ga0501068_0063934 3300049584 Bacteria 2238
742 Ga0501069_0023817 3300049585 Bacteria 3338
743 Ga0501069_0032539 3300049585 Bacteria 2870
744 Ga0501070_0011262 3300049586 Bacteria 7553
745 Ga0501070_0042730 3300049586 Bacteria 3775
746 Ga0501071_0022700 3300049587 Bacteria 4377
747 Ga0501071_0027300 3300049587 Bacteria 4016
748 Ga0501071_0087434 3300049587 Bacteria 2287
749 Ga0501072_0010680 3300049588 Bacteria 6992
750 Ga0501072_0120351 3300049588 Bacteria 2091
751 Ga0501073_0000026 3300049589 Bacteria 124358
752 Ga0501073_0081545 3300049589 Bacteria 2250
753 Ga0501074_0000878 3300049590 Bacteria 19194
754 Ga0501074_0008344 3300049590 Bacteria 7510
755 Ga0501076_0083862 3300049592 Bacteria 2560
756 Ga0501079_0006752 3300049741 Bacteria 8631
757 Ga0501079_0158453 3300049741 Bacteria 1764
758 Ga0501080_0248879 3300049742 Bacteria 1621
759 Ga0501081_0149601 3300049743 Bacteria 1677
760 Ga0501083_0028305 3300049744 Bacteria 3862
761 Ga0501035_0014167 3300049822 Bacteria 7357
762 Ga0501035_0014525 3300049822 Bacteria 7268
763 Ga0501035_0027709 3300049822 Bacteria 5178
764 Ga0501035_0063093 3300049822 Bacteria 3296
765 Ga0501035_0168085 3300049822 Bacteria 1895
766 Ga0501044_0000061 3300049823 Bacteria 133207
767 Ga0501044_0002968 3300049823 Bacteria 19271
768 Ga0501044_0011007 3300049823 Bacteria 9818
769 Ga0501044_0018826 3300049823 Bacteria 7395
770 Ga0501044_0022791 3300049823 Bacteria 6669
771 Ga0501044_0032967 3300049823 Bacteria 5444
772 Ga0501044_0072096 3300049823 Bacteria 3512
773 Ga0501044_0195234 3300049823 Bacteria 1985
774 Ga0501044_0220866 3300049823 Bacteria 1845
775 Ga0501045_0015070 3300049824 Bacteria 5487
776 nmdc:mga03n38_11708_c1 3300050490 Bacteria 3278
777 nmdc:mga03n38_2075_c1 3300050490 Bacteria 6061
778 nmdc:mga03n38_49491_c1 3300050490 Bacteria 1869
779 nmdc:mga00v17_14353_c1 3300050491 Bacteria 4418
780 nmdc:mga00v17_43318_c1 3300050491 Bacteria 2710
781 nmdc:mga0yw44_12510_c1 3300050492 Bacteria 4428
782 nmdc:mga0yw44_1305_c1 3300050492 Bacteria 9847
783 nmdc:mga0yw44_23019_c1 3300050492 Bacteria 3504
784 nmdc:mga0yw44_40905_c1 3300050492 Bacteria 2757
785 nmdc:mga0yw44_61146_c1 3300050492 Bacteria 2310
786 nmdc:mga06z11_1148_c1 3300050494 Bacteria 9678
787 nmdc:mga06z11_123308_c1 3300050494 Bacteria 1448
788 nmdc:mga06z11_51583_c1 3300050494 Bacteria 2107
789 nmdc:mga07m45_1819_c1 3300050496 Bacteria 9835
790 nmdc:mga07m45_19104_c1 3300050496 Bacteria 3709
791 nmdc:mga07m45_255625_c1 3300050496 Bacteria 1019
792 nmdc:mga07m45_84756_c1 3300050496 Bacteria 1812
793 nmdc:mga05p37_399127_c1 3300050507 Bacteria 1606
794 nmdc:mga08y16_215054_c1 3300050511 Bacteria 1990
795 nmdc:mga08y16_97027_c1 3300050511 Bacteria 3069
796 nmdc:mga0sz30_23235_c1 3300050516 Bacteria 2520
797 nmdc:mga0sz30_42214_c1 3300050516 Bacteria 1919
798 nmdc:mga0sz30_9246_c1 3300050516 Bacteria 3743
799 Ga0495601_0201403 3300053077 Bacteria 1301
800 Ga0495612_0032405 3300053078 Bacteria 2112
801 Ga0500610_0073581 3300053079 Bacteria 1782
802 Ga0500635_0004290 3300053080 Bacteria 3664
803 Ga0500635_0004942 3300053080 Bacteria 3465
804 Ga0495595_0014890 3300053084 Bacteria 3307
805 Ga0495619_0000182 3300053085 Bacteria 46524
806 Ga0495619_0031597 3300053085 Bacteria 3431
807 Ga0500643_000025 3300053087 Bacteria 259605
808 Ga0500651_0018637 3300053093 Bacteria 4299
809 Ga0500566_0000038 3300053094 Bacteria 66925
810 Ga0500566_0000596 3300053094 Bacteria 20245
811 Ga0500566_0042396 3300053094 Bacteria 2625
812 Ga0500640_014775 3300053095 Bacteria 3255
813 Ga0500641_0002804 3300053096 Bacteria 6174
814 Ga0500555_004466 3300053103 Bacteria 3972
815 Ga0500557_000001 3300053105 Bacteria 241298
816 Ga0500572_000010 3300053111 Bacteria 67071
817 Ga0500572_000539 3300053111 Bacteria 12841
818 Ga0500592_009746 3300053116 Bacteria 1528
819 Ga0500595_000143 3300053119 Bacteria 46542
820 Ga0500595_003822 3300053119 Bacteria 6923
821 Ga0500595_005314 3300053119 Bacteria 5639
822 Ga0500595_033870 3300053119 Bacteria 1692
823 Ga0500608_016164 3300053122 Bacteria 3367
824 Ga0500642_0005774 3300053130 Bacteria 4022
825 Ga0500642_0006377 3300053130 Bacteria 3879
826 Ga0500642_0018933 3300053130 Bacteria 2674
827 Ga0500652_000002 3300053131 Bacteria 273315
828 Ga0500655_009783 3300053133 Bacteria 1731
829 Ga0500559_0000917 3300053136 Bacteria 18754
830 Ga0500559_0014387 3300053136 Bacteria 3343
831 Ga0500559_0061944 3300053136 Bacteria 1669
832 Ga0500568_0003461 3300053139 Bacteria 8786
833 Ga0500568_0010830 3300053139 Bacteria 4253
834 Ga0500573_0030373 3300053140 Bacteria 3117
835 Ga0500577_0002448 3300053142 Bacteria 4749
836 Ga0500577_0024659 3300053142 Bacteria 2025
837 Ga0500590_041405 3300053148 Bacteria 2369
838 Ga0500603_000364 3300053150 Bacteria 11849
839 Ga0500603_000550 3300053150 Bacteria 9467
840 Ga0500603_007083 3300053150 Bacteria 2454
841 Ga0500616_0002840 3300053153 Bacteria 13926
842 Ga0500620_040830 3300053155 Bacteria 1521
843 Ga0500627_0034682 3300053158 Bacteria 2140
844 Ga0500630_000751 3300053159 Bacteria 14857
845 Ga0500634_0045659 3300053161 Bacteria 2370
846 Ga0500634_0070970 3300053161 Bacteria 1822
847 Ga0500638_000303 3300053162 Bacteria 11065
848 Ga0500639_000034 3300053163 Bacteria 66994
849 Ga0500639_020006 3300053163 Bacteria 3530
850 Ga0500639_105339 3300053163 Bacteria 1381
851 Ga0500636_0084966 3300053177 Bacteria 1819
852 Ga0500637_0000685 3300053178 Bacteria 13466
853 Ga0500637_0004238 3300053178 Bacteria 6771
854 Ga0500611_013032 3300053727 Bacteria 1417
855 Ga0500625_001418 3300053729 Bacteria 8169
856 Ga0500596_000264 3300053735 Bacteria 9238
857 Ga0500596_005925 3300053735 Bacteria 2107
858 Ga0500596_009734 3300053735 Bacteria 1494
859 Ga0500601_000570 3300053737 Bacteria 5387
860 Ga0501084_0005053 3300054114 Bacteria 10793
861 Ga0501084_0018834 3300054114 Bacteria 5747
862 Ga0500661_000850 3300055283 Bacteria 5699
863 Ga0501082_0014622 3300060353 Bacteria 6759
864 Ga0501082_0098826 3300060353 Bacteria 2523
865 Ga0466962_0054197 3300061719 Bacteria 1917
866 Ga0530510_0064504 3300061734 Bacteria 2653
867 Ga0530510_0225344 3300061734 Bacteria 1394

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025919 Ga0207657_10155555 Ga0207657_101555551 320
2 3300050496 nmdc:mga07m45_255625_c1 nmdc:mga07m45_255625_c1_11_1009 329
3 3300046512 Ga0495610_0054023 Ga0495610_0054023_812_1891 339
4 3300031730 Ga0307516_10108446 Ga0307516_101084462 340
5 3300013308 Ga0157375_10572742 Ga0157375_105727421 343
6 3300006941 Ga0099825_1030643 Ga0099825_10306432 347
7 3300006942 Ga0099824_1004496 Ga0099824_100449620 347
8 3300006943 Ga0099822_1012804 Ga0099822_10128046 347
9 3300006944 Ga0099823_1037031 Ga0099823_10370312 347
10 3300025272 Ga0209455_1008571 Ga0209455_10085712 347
11 3300027296 Ga0209389_1000113 Ga0209389_10001137 347
12 3300027357 Ga0209589_1000023 Ga0209589_100002354 347
13 3300027361 Ga0209489_100032 Ga0209489_10003254 347
14 3300027361 Ga0209489_107143 Ga0209489_10714314 347
15 3300027363 Ga0209700_100040 Ga0209700_10004054 347
16 3300005337 Ga0070682_100204629 Ga0070682_1002046291 349
17 3300005614 Ga0068856_100001022 Ga0068856_10000102224 350
18 3300009545 Ga0105237_10301032 Ga0105237_103010321 350
19 3300025914 Ga0207671_10105087 Ga0207671_101050872 350
20 3300005985 Ga0081539_10073326 Ga0081539_100733261 352
21 3300021441 Ga0213871_10009469 Ga0213871_100094691 352
22 3300005456 Ga0070678_100014206 Ga0070678_1000142063 353
23 3300006048 Ga0075363_100069143 Ga0075363_1000691432 353
24 3300025254 Ga0209148_1000446 Ga0209148_100044611 353
25 3300025261 Ga0209233_1014977 Ga0209233_10149772 353
26 3300025272 Ga0209455_1001699 Ga0209455_10016997 353
27 3300026121 Ga0207683_10056139 Ga0207683_100561392 353
28 3300005347 Ga0070668_100025503 Ga0070668_1000255032 354
29 3300005353 Ga0070669_100107871 Ga0070669_1001078712 354
30 3300005355 Ga0070671_100024002 Ga0070671_1000240023 354
31 3300005367 Ga0070667_100191133 Ga0070667_1001911332 354
32 3300005455 Ga0070663_100094371 Ga0070663_1000943712 354
33 3300005614 Ga0068856_100092247 Ga0068856_1000922472 354
34 3300006038 Ga0075365_10163445 Ga0075365_101634451 354
35 3300006042 Ga0075368_10032088 Ga0075368_100320882 354
36 3300006195 Ga0075366_10023941 Ga0075366_100239412 354
37 3300009101 Ga0105247_10197107 Ga0105247_101971071 354
38 3300009148 Ga0105243_10229789 Ga0105243_102297892 354
39 3300009177 Ga0105248_10063999 Ga0105248_100639993 354
40 3300025304 Ga0209257_1020976 Ga0209257_10209762 354
41 3300025904 Ga0207647_10035221 Ga0207647_100352212 354
42 3300025914 Ga0207671_10131680 Ga0207671_101316802 354
43 3300025927 Ga0207687_10146994 Ga0207687_101469942 354
44 3300025941 Ga0207711_10276917 Ga0207711_102769172 354
45 3300025972 Ga0207668_10066692 Ga0207668_100666922 354
46 3300026067 Ga0207678_10178823 Ga0207678_101788232 354
47 3300026078 Ga0207702_10140013 Ga0207702_101400132 354
48 3300026116 Ga0207674_10068286 Ga0207674_100682862 354
49 3300028379 Ga0268266_10017618 Ga0268266_100176184 354
50 3300037853 Ga0436364_1474553 Ga0436364_1474553_476_1609 354
51 3300039438 Ga0436360_0509368 Ga0436360_0509368_1614_2762 354
52 3300048918 Ga0496115_0103468 Ga0496115_0103468_783_1916 354
53 3300048929 Ga0496126_0009623 Ga0496126_0009623_5860_6996 354
54 3300050494 nmdc:mga06z11_123308_c1 nmdc:mga06z11_123308_c1_280_1413 354
55 3300003659 JGI25404J52841_10012436 JGI25404J52841_100124362 355
56 3300005548 Ga0070665_100059878 Ga0070665_1000598782 355
57 3300005577 Ga0068857_100052056 Ga0068857_1000520562 355
58 3300005614 Ga0068856_100055877 Ga0068856_1000558772 355
59 3300005617 Ga0068859_100223355 Ga0068859_1002233551 355
60 3300005618 Ga0068864_100046992 Ga0068864_1000469921 355
61 3300005840 Ga0068870_10147937 Ga0068870_101479371 355
62 3300005841 Ga0068863_100108446 Ga0068863_1001084462 355
63 3300005844 Ga0068862_100125218 Ga0068862_1001252181 355
64 3300006931 Ga0097620_100223355 Ga0097620_1002233551 355
65 3300009098 Ga0105245_10118193 Ga0105245_101181932 355
66 3300009101 Ga0105247_10070021 Ga0105247_100700212 355
67 3300025900 Ga0207710_10005054 Ga0207710_100050544 355
68 3300025900 Ga0207710_10049181 Ga0207710_100491811 355
69 3300025908 Ga0207643_10162052 Ga0207643_101620521 355
70 3300025914 Ga0207671_10060489 Ga0207671_100604892 355
71 3300025914 Ga0207671_10298658 Ga0207671_102986581 355
72 3300025924 Ga0207694_10120189 Ga0207694_101201891 355
73 3300025933 Ga0207706_10100152 Ga0207706_101001523 355
74 3300025942 Ga0207689_10048731 Ga0207689_100487311 355
75 3300025949 Ga0207667_10065888 Ga0207667_100658881 355
76 3300026035 Ga0207703_10131305 Ga0207703_101313052 355
77 3300026075 Ga0207708_10026957 Ga0207708_100269573 355
78 3300026078 Ga0207702_10062730 Ga0207702_100627302 355
79 3300028379 Ga0268266_10012507 Ga0268266_100125073 355
80 3300028381 Ga0268264_10059682 Ga0268264_100596821 355
81 3300046558 Ga0495633_0023884 Ga0495633_0023884_42_1175 355
82 3300046691 Ga0495670_0080042 Ga0495670_0080042_181_1314 355
83 3300048916 Ga0496113_0092663 Ga0496113_0092663_213_1346 355
84 3300009098 Ga0105245_10057229 Ga0105245_100572292 356
85 3300009545 Ga0105237_10107223 Ga0105237_101072232 356
86 3300010375 Ga0105239_10214348 Ga0105239_102143482 356
87 3300037471 Ga0395905_0040874 Ga0395905_0040874_104_1237 356
88 3300044684 Ga0466966_0059106 Ga0466966_0059106_1229_2398 356
89 3300044693 Ga0466961_0000488 Ga0466961_0000488_16515_17684 356
90 3300045049 Ga0466959_0001793 Ga0466959_0001793_8681_9850 356
91 3300046522 Ga0495643_0005874 Ga0495643_0005874_2038_3207 356
92 3300046616 Ga0495668_0025430 Ga0495668_0025430_1263_2432 356
93 3300048091 Ga0495626_0056236 Ga0495626_0056236_352_1521 356
94 3300048905 Ga0496102_0245913 Ga0496102_0245913_358_1527 356
95 3300048906 Ga0496103_0021272 Ga0496103_0021272_730_1899 356
96 3300048908 Ga0496105_0131830 Ga0496105_0131830_106_1275 356
97 3300048912 Ga0496109_0081686 Ga0496109_0081686_1555_2724 356
98 3300048913 Ga0496110_0036833 Ga0496110_0036833_512_1681 356
99 3300048923 Ga0496120_0070150 Ga0496120_0070150_329_1498 356
100 3300048928 Ga0496125_0054112 Ga0496125_0054112_531_1700 356
101 3300050490 nmdc:mga03n38_49491_c1 nmdc:mga03n38_49491_c1_271_1440 356
102 3300050492 nmdc:mga0yw44_61146_c1 nmdc:mga0yw44_61146_c1_492_1661 356
103 iso_pu_bacteria 8019538911 8019544059 356
104 3300005539 Ga0068853_100033886 Ga0068853_1000338862 357
105 3300009177 Ga0105248_10044529 Ga0105248_100445293 357
106 3300009545 Ga0105237_10130880 Ga0105237_101308802 357
107 3300009551 Ga0105238_10115534 Ga0105238_101155342 357
108 3300010375 Ga0105239_10115649 Ga0105239_101156492 357
109 3300013308 Ga0157375_10068523 Ga0157375_100685232 357
110 3300025297 Ga0209758_1003783 Ga0209758_10037832 357
111 3300044842 Ga0466957_0072150 Ga0466957_0072150_317_1435 357
112 3300048924 Ga0496121_0136742 Ga0496121_0136742_460_1641 357
113 3300050496 nmdc:mga07m45_84756_c1 nmdc:mga07m45_84756_c1_230_1411 357
114 3300005434 Ga0070709_10009552 Ga0070709_100095524 358
115 3300005436 Ga0070713_100056049 Ga0070713_1000560492 358
116 3300005437 Ga0070710_10026057 Ga0070710_100260573 358
117 3300006173 Ga0070716_100043115 Ga0070716_1000431151 358
118 3300025906 Ga0207699_10016956 Ga0207699_100169562 358
119 3300025915 Ga0207693_10003576 Ga0207693_100035765 358
120 3300025928 Ga0207700_10024997 Ga0207700_100249972 358
121 3300025939 Ga0207665_10046251 Ga0207665_100462511 358
122 3300048929 Ga0496126_0247566 Ga0496126_0247566_154_1293 358
123 3300034818 Ga0373950_0019305 Ga0373950_0019305_47_1126 359
124 3300041498 Ga0451841_0656306 Ga0451841_0656306_651_1784 359
125 3300044694 Ga0466963_0210833 Ga0466963_0210833_242_1321 359
126 3300045976 Ga0466967_0089021 Ga0466967_0089021_1644_2777 359
127 3300053119 Ga0500595_005314 Ga0500595_005314_2782_3861 359
128 3300005439 Ga0070711_100025668 Ga0070711_1000256682 360
129 3300046524 Ga0495648_0000160 Ga0495648_0000160_2626_3753 360
130 3300053119 Ga0500595_033870 Ga0500595_033870_468_1649 360
131 3300053131 Ga0500652_000002 Ga0500652_000002_250688_251869 360
132 3300026078 Ga0207702_10014864 Ga0207702_100148642 361
133 3300050511 nmdc:mga08y16_215054_c1 nmdc:mga08y16_215054_c1_680_1813 362
134 3300025900 Ga0207710_10005124 Ga0207710_100051242 363
135 3300033180 Ga0307510_10056016 Ga0307510_100560162 363
136 3300046461 Ga0495641_0004740 Ga0495641_0004740_8346_9437 363
137 3300049569 Ga0501032_0051663 Ga0501032_0051663_933_2063 363
138 3300049571 Ga0501034_0063889 Ga0501034_0063889_1130_2260 363
139 3300049572 Ga0501036_0262814 Ga0501036_0262814_20_1111 363
140 3300049574 Ga0501038_0109579 Ga0501038_0109579_910_2046 363
141 3300049579 Ga0501043_0058864 Ga0501043_0058864_799_1929 363
142 3300049823 Ga0501044_0002968 Ga0501044_0002968_4001_5137 363
143 3300049823 Ga0501044_0032967 Ga0501044_0032967_4292_5422 363
144 3300046559 Ga0495667_0085530 Ga0495667_0085530_699_1835 364
145 3300006038 Ga0075365_10075902 Ga0075365_100759022 365
146 3300050492 nmdc:mga0yw44_12510_c1 nmdc:mga0yw44_12510_c1_2488_3621 365
147 iso_pu_bacteria 8016530956 8016535720 366
148 3300048924 Ga0496121_0038986 Ga0496121_0038986_1688_2857 367
149 3300053130 Ga0500642_0005774 Ga0500642_0005774_2041_3174 367
150 3300049580 Ga0501046_0129766 Ga0501046_0129766_111_1244 368
151 3300053155 Ga0500620_040830 Ga0500620_040830_216_1388 368
152 3300031711 Ga0265314_10000937 Ga0265314_100009377 370
153 3300046460 Ga0495638_0027548 Ga0495638_0027548_2054_3223 370
154 3300053103 Ga0500555_004466 Ga0500555_004466_1087_2256 370
155 3300053130 Ga0500642_0018933 Ga0500642_0018933_782_1951 370
156 3300053133 Ga0500655_009783 Ga0500655_009783_417_1586 370
157 3300053139 Ga0500568_0010830 Ga0500568_0010830_1574_2743 370
158 3300053161 Ga0500634_0045659 Ga0500634_0045659_543_1712 370
159 3300053087 Ga0500643_000025 Ga0500643_000025_236765_237934 371
160 3300005937 Ga0081455_10006971 Ga0081455_100069712 372
161 3300009551 Ga0105238_10438701 Ga0105238_104387011 372
162 3300013296 Ga0157374_10028873 Ga0157374_100288732 372
163 3300013297 Ga0157378_10080822 Ga0157378_100808223 372
164 3300013308 Ga0157375_10013452 Ga0157375_100134527 372
165 3300014325 Ga0163163_10008664 Ga0163163_100086643 372
166 3300014969 Ga0157376_10014470 Ga0157376_100144703 372
167 3300035695 Ga0373927_0010994 Ga0373927_0010994_4358_5485 372
168 3300038443 Ga0395901_0277399 Ga0395901_0277399_49_1176 372
169 3300041512 Ga0451853_2103515 Ga0451853_2103515_237_1364 372
170 3300048903 Ga0496100_0045674 Ga0496100_0045674_637_1764 372
171 3300048904 Ga0496101_0021499 Ga0496101_0021499_1220_2347 372
172 3300048905 Ga0496102_0002395 Ga0496102_0002395_9088_10215 372
173 3300048907 Ga0496104_0094983 Ga0496104_0094983_253_1380 372
174 3300048909 Ga0496106_0049188 Ga0496106_0049188_1304_2431 372
175 3300048910 Ga0496107_0120047 Ga0496107_0120047_190_1317 372
176 3300048912 Ga0496109_0035755 Ga0496109_0035755_2515_3642 372
177 3300048914 Ga0496111_0087417 Ga0496111_0087417_386_1513 372
178 3300048915 Ga0496112_0088109 Ga0496112_0088109_253_1380 372
179 3300048916 Ga0496113_0042654 Ga0496113_0042654_384_1511 372
180 3300048917 Ga0496114_0057168 Ga0496114_0057168_1259_2386 372
181 3300048918 Ga0496115_0000788 Ga0496115_0000788_8055_9182 372
182 3300048924 Ga0496121_0000495 Ga0496121_0000495_17636_18763 372
183 3300053727 Ga0500611_013032 Ga0500611_013032_90_1217 372
184 iso_pu_bacteria 2507262055 2507509414 372
185 iso_pu_bacteria 2508501009 2508543456 372
186 iso_pu_bacteria 2508501042 2508698767 372
187 iso_pu_bacteria 2508501128 2509147224 372
188 iso_pu_bacteria 2511231028 2511398426 372
189 iso_pu_bacteria 2513237092 2513628265 372
190 iso_pu_bacteria 2513237094 2513637978 372
191 iso_pu_bacteria 2513237095 2513646583 372
192 iso_pu_bacteria 2513237101 2513691775 372
193 iso_pu_bacteria 2513237102 2513702027 372
194 iso_pu_bacteria 2513237104 2513717499 372
195 iso_pu_bacteria 2513237137 2513858588 372
196 iso_pu_bacteria 2513237139 2513876390 372
197 iso_pu_bacteria 2513237145 2513917807 372
198 iso_pu_bacteria 2513237161 2514010730 372
199 iso_pu_bacteria 2517093001 2517102072 372
200 iso_pu_bacteria 2524023228 2524539331 372
201 iso_pu_bacteria 2528768022 2528855969 372
202 iso_pu_bacteria 2617270735 2617352242 372
203 iso_pu_bacteria 2617270741 2617376535 372
204 iso_pu_bacteria 2667528175 2671117779 372
205 iso_pu_bacteria 2721755755 2723845810 372
206 iso_pu_bacteria 2728368998 2728754620 372
207 iso_pu_bacteria 2791355196 2793064840 372
208 iso_pu_bacteria 2791355197 2793069987 372
209 iso_pu_bacteria 2791355199 2793077197 372
210 iso_pu_bacteria 2802429603 2805920132 372
211 iso_pu_bacteria 2816332527 2818240224 372
212 iso_pu_bacteria 2824600985 2824604215 372
213 iso_pu_bacteria 2824609381 2824613204 372
214 iso_pu_bacteria 2824617872 2824619765 372
215 iso_pu_bacteria 2824626560 2824629373 372
216 iso_pu_bacteria 2824635225 2824641171 372
217 iso_pu_bacteria 2824644064 2824647134 372
218 iso_pu_bacteria 2824653114 2824657537 372
219 iso_pu_bacteria 2824661429 2824666648 372
220 iso_pu_bacteria 2824671348 2824674706 372
221 iso_pu_bacteria 2824679649 2824683720 372
222 iso_pu_bacteria 2824687955 2824692885 372
223 iso_pu_bacteria 2824696289 2824699179 372
224 iso_pu_bacteria 2824704595 2824710505 372
225 iso_pu_bacteria 2824714736 2824717262 372
226 iso_pu_bacteria 2824723954 2824727520 372
227 iso_pu_bacteria 2824732956 2824739973 372
228 iso_pu_bacteria 2824746037 2824749646 372
229 iso_pu_bacteria 2824753945 2824760200 372
230 iso_pu_bacteria 2824763712 2824767189 372
231 iso_pu_bacteria 2824773399 2824780655 372
232 iso_pu_bacteria 2838122688 2838126613 372
233 iso_pu_bacteria 2841941048 2841947267 372
234 iso_pu_bacteria 2841949485 2841950712 372
235 iso_pu_bacteria 2841957949 2841964400 372
236 iso_pu_bacteria 2841966195 2841967029 372
237 iso_pu_bacteria 2841974524 2841975774 372
238 iso_pu_bacteria 2841983080 2841990141 372
239 iso_pu_bacteria 2842038055 2842039822 372
240 iso_pu_bacteria 2842045827 2842047232 372
241 iso_pu_bacteria 2844315083 2844318318 372
242 iso_pu_bacteria 2847930680 2847935195 372
243 iso_pu_bacteria 2847939898 2847945794 372
244 iso_pu_bacteria 2849076700 2849080065 372
245 iso_pu_bacteria 2857509624 2857510559 372
246 iso_pu_bacteria 2874590934 2874597508 372
247 iso_pu_bacteria 2874604998 2874609540 372
248 iso_pu_bacteria 2874612657 2874612780 372
249 iso_pu_bacteria 2874620515 2874627094 372
250 iso_pu_bacteria 2874628541 2874636324 372
251 iso_pu_bacteria 2876761206 2876770805 372
252 iso_pu_bacteria 2876771140 2876777695 372
253 iso_pu_bacteria 2876808645 2876810959 372
254 iso_pu_bacteria 2876818435 2876822546 372
255 iso_pu_bacteria 2879074833 2879078103 372
256 iso_pu_bacteria 2879083081 2879090159 372
257 iso_pu_bacteria 2879099564 2879102939 372
258 iso_pu_bacteria 2879110137 2879115684 372
259 iso_pu_bacteria 2879127579 2879134556 372
260 iso_pu_bacteria 2879142872 2879149909 372
261 iso_pu_bacteria 2881364244 2881366641 372
262 iso_pu_bacteria 2881665667 2881669605 372
263 iso_pu_bacteria 2885366525 2885373295 372
264 iso_pu_bacteria 2885374607 2885374738 372
265 iso_pu_bacteria 2888378607 2888383255 372
266 iso_pu_bacteria 2888388044 2888394655 372
267 iso_pu_bacteria 2888419890 2888423637 372
268 iso_pu_bacteria 2889033259 2889040652 372
269 iso_pu_bacteria 2903727486 2903729265 372
270 iso_pu_bacteria 2903748898 2903750901 372
271 iso_pu_bacteria 2904666416 2904669795 372
272 iso_pu_bacteria 2904699407 2904704005 372
273 iso_pu_bacteria 2904711408 2904717094 372
274 iso_pu_bacteria 2906602504 2906605211 372
275 iso_pu_bacteria 2906610324 2906617646 372
276 iso_pu_bacteria 2906626472 2906631489 372
277 iso_pu_bacteria 2906635258 2906640859 372
278 iso_pu_bacteria 2906643746 2906645898 372
279 iso_pu_bacteria 2906660503 2906661343 372
280 iso_pu_bacteria 2908739725 2908743536 372
281 iso_pu_bacteria 2908775508 2908779359 372
282 iso_pu_bacteria 2922361189 2922367756 372
283 iso_pu_bacteria 2922368715 2922373418 372
284 iso_pu_bacteria 2922386360 2922392340 372
285 iso_pu_bacteria 2922393267 2922395569 372
286 iso_pu_bacteria 2922425934 2922429343 372
287 iso_pu_bacteria 2929615660 2929617165 372
288 iso_pu_bacteria 2929624759 2929626869 372
289 iso_pu_bacteria 2932784394 2932793189 372
290 iso_pu_bacteria 2932794094 2932796436 372
291 iso_pu_bacteria 2932801729 2932808943 372
292 iso_pu_bacteria 2932809354 2932813028 372
293 iso_pu_bacteria 2932818245 2932821121 372
294 iso_pu_bacteria 2932828146 2932836771 372
295 iso_pu_bacteria 2933577622 2933579122 372
296 iso_pu_bacteria 2935608549 2935611701 372
297 iso_pu_bacteria 2935616580 2935621536 372
298 iso_pu_bacteria 2935630451 2935634082 372
299 iso_pu_bacteria 2935638405 2935645469 372
300 iso_pu_bacteria 2935648319 2935651778 372
301 iso_pu_bacteria 2935656913 2935660588 372
302 iso_pu_bacteria 2935665750 2935667587 372
303 iso_pu_bacteria 2935675223 2935681749 372
304 iso_pu_bacteria 2935684952 2935688335 372
305 iso_pu_bacteria 2935694250 2935699018 372
306 iso_pu_bacteria 2935703347 2935706399 372
307 iso_pu_bacteria 2935713505 2935715354 372
308 iso_pu_bacteria 2935722832 2935726082 372
309 iso_pu_bacteria 2935732158 2935734173 372
310 iso_pu_bacteria 2935741537 2935743552 372
311 iso_pu_bacteria 2935750917 2935754411 372
312 iso_pu_bacteria 2935760218 2935768473 372
313 iso_pu_bacteria 2935769743 2935774087 372
314 iso_pu_bacteria 2935777560 2935780609 372
315 iso_pu_bacteria 2935785616 2935789543 372
316 iso_pu_bacteria 2935793552 2935797320 372
317 iso_pu_bacteria 2935801545 2935806606 372
318 iso_pu_bacteria 2935810662 2935813198 372
319 iso_pu_bacteria 2935819856 2935821179 372
320 iso_pu_bacteria 2935827899 2935830851 372
321 iso_pu_bacteria 2935837841 2935840877 372
322 iso_pu_bacteria 2935847175 2935850561 372
323 iso_pu_bacteria 2935855204 2935859783 372
324 iso_pu_bacteria 2935864058 2935869144 372
325 iso_pu_bacteria 2935873716 2935880663 372
326 iso_pu_bacteria 2935883170 2935886655 372
327 iso_pu_bacteria 2935908558 2935914161 372
328 iso_pu_bacteria 2935916978 2935921331 372
329 iso_pu_bacteria 2935926038 2935931650 372
330 iso_pu_bacteria 2935934488 2935940415 372
331 iso_pu_bacteria 2935942939 2935947760 372
332 iso_pu_bacteria 2935951376 2935956699 372
333 iso_pu_bacteria 2935959822 2935965742 372
334 iso_pu_bacteria 2935967501 2935973492 372
335 iso_pu_bacteria 2935975950 2935980899 372
336 iso_pu_bacteria 2935984226 2935990387 372
337 iso_pu_bacteria 2935992306 2936000939 372
338 iso_pu_bacteria 2936002035 2936010197 372
339 iso_pu_bacteria 2936011229 2936014644 372
340 iso_pu_bacteria 2936019824 2936023559 372
341 iso_pu_bacteria 2936028420 2936032587 372
342 iso_pu_bacteria 2936037263 2936043750 372
343 iso_pu_bacteria 2936046547 2936050385 372
344 iso_pu_bacteria 2936055302 2936059123 372
345 iso_pu_bacteria 2940556831 2940560213 372
346 iso_pu_bacteria 2941507105 2941510973 372
347 iso_pu_bacteria 2941515067 2941518357 372
348 iso_pu_bacteria 2941523033 2941527380 372
349 iso_pu_bacteria 2941531003 2941534074 372
350 iso_pu_bacteria 2941538514 2941540992 372
351 iso_pu_bacteria 3005474847 3005479511 372
352 iso_pu_bacteria 3005483717 3005489399 372
353 iso_pu_bacteria 3005506211 3005511820 372
354 iso_pu_bacteria 3005587118 3005588537 372
355 iso_pu_bacteria 3005594810 3005598410 372
356 iso_pu_bacteria 3005710791 3005714101 372
357 iso_pu_bacteria 3005718088 3005721576 372
358 iso_pu_bacteria 8006926726 8006930861 372
359 iso_pu_bacteria 8006933436 8006941629 372
360 iso_pu_bacteria 8006964411 8006971935 372
361 iso_pu_bacteria 8006973647 8006981339 372
362 iso_pu_bacteria 8006984368 8006990347 372
363 iso_pu_bacteria 8006994254 8006996427 372
364 iso_pu_bacteria 8016511872 8016514260 372
365 iso_pu_bacteria 8016522445 8016530449 372
366 iso_pu_bacteria 8016539877 8016540003 372
367 iso_pu_bacteria 8016548790 8016553232 372
368 iso_pu_bacteria 8016557553 8016561608 372
369 iso_pu_bacteria 8016566248 8016574058 372
370 iso_pu_bacteria 8016575299 8016578173 372
371 iso_pu_bacteria 8016583857 8016592842 372
372 iso_pu_bacteria 8016595262 8016599448 372
373 iso_pu_bacteria 8016603502 8016611541 372
374 iso_pu_bacteria 8016613128 8016622255 372
375 iso_pu_bacteria 8016622563 8016627639 372
376 iso_pu_bacteria 8016630954 8016631856 372
377 iso_pu_bacteria 8017057580 8017062163 372
378 iso_pu_bacteria 8019547302 8019554745 372
379 iso_pu_bacteria 8019555841 8019557550 372
380 iso_pu_bacteria 8019565922 8019567747 372
381 iso_pu_bacteria 8019586578 8019589247 372
382 iso_pu_bacteria 8019597564 8019601984 372
383 iso_pu_bacteria 8019608314 8019616566 372
384 iso_pu_bacteria 8019619141 8019627282 372
385 iso_pu_bacteria 8019629233 8019635289 372
386 iso_pu_bacteria 8019638758 8019644410 372
387 iso_pu_bacteria 8019648815 8019657447 372
388 iso_pu_bacteria 8019659431 8019663128 372
389 iso_pu_bacteria 8019668869 8019672727 372
390 iso_pu_bacteria 8019687851 8019689168 372
391 iso_pu_bacteria 8055742211 8055747220 372
392 iso_pu_bacteria 8056673599 8056674570 372
393 iso_pu_bacteria 8056689827 8056690225 372
394 iso_pu_bacteria 8056967851 8056972678 372
395 3300005329 Ga0070683_100037262 Ga0070683_1000372623 373
396 3300005336 Ga0070680_100064157 Ga0070680_1000641572 373
397 3300005435 Ga0070714_100080180 Ga0070714_1000801802 373
398 3300005458 Ga0070681_10149181 Ga0070681_101491812 373
399 3300005530 Ga0070679_100053634 Ga0070679_1000536342 373
400 3300005535 Ga0070684_100001878 Ga0070684_10000187810 373
401 3300009545 Ga0105237_10028844 Ga0105237_100288442 373
402 3300009551 Ga0105238_10014756 Ga0105238_100147563 373
403 3300010375 Ga0105239_10333750 Ga0105239_103337502 373
404 3300021384 Ga0213876_10010209 Ga0213876_100102092 373
405 3300025912 Ga0207707_10290578 Ga0207707_102905781 373
406 3300025917 Ga0207660_10131566 Ga0207660_101315661 373
407 3300025917 Ga0207660_10173059 Ga0207660_101730591 373
408 3300025921 Ga0207652_10108241 Ga0207652_101082412 373
409 3300025921 Ga0207652_10126019 Ga0207652_101260192 373
410 3300025929 Ga0207664_10071396 Ga0207664_100713962 373
411 3300025944 Ga0207661_10001198 Ga0207661_100011982 373
412 3300026118 Ga0207675_100160034 Ga0207675_1001600342 373
413 3300028380 Ga0268265_10106090 Ga0268265_101060902 373
414 3300037466 Ga0395898_0053862 Ga0395898_0053862_1709_2863 373
415 3300045976 Ga0466967_0047594 Ga0466967_0047594_1782_2918 373
416 3300046462 Ga0495651_0040742 Ga0495651_0040742_1121_2251 373
417 3300046543 Ga0495645_0005022 Ga0495645_0005022_5615_6745 373
418 3300046678 Ga0495599_0128534 Ga0495599_0128534_416_1546 373
419 3300048913 Ga0496110_0030245 Ga0496110_0030245_1101_2258 373
420 3300053078 Ga0495612_0032405 Ga0495612_0032405_368_1498 373
421 3300003203 JGI25406J46586_10000006 JGI25406J46586_10000006119 374
422 3300003215 JGI25153J46596_10011119 JGI25153J46596_100111192 374
423 3300003320 rootH2_10006936 rootH2_100069362 374
424 3300003354 JGI25160J50197_1002805 JGI25160J50197_10028052 374
425 3300003354 JGI25160J50197_1006702 JGI25160J50197_10067022 374
426 3300003354 JGI25160J50197_1014046 JGI25160J50197_10140462 374
427 3300003659 JGI25404J52841_10009757 JGI25404J52841_100097572 374
428 3300003659 JGI25404J52841_10015760 JGI25404J52841_100157601 374
429 3300003659 JGI25404J52841_10017024 JGI25404J52841_100170241 374
430 3300003794 Ga0055531_10007030 Ga0055531_100070302 374
431 3300003794 Ga0055531_10011902 Ga0055531_100119022 374
432 3300005262 Ga0065165_1001864 Ga0065165_10018642 374
433 3300005262 Ga0065165_1003443 Ga0065165_10034432 374
434 3300005262 Ga0065165_1009002 Ga0065165_10090022 374
435 3300005329 Ga0070683_100035409 Ga0070683_1000354096 374
436 3300005329 Ga0070683_100052002 Ga0070683_1000520023 374
437 3300005335 Ga0070666_10088394 Ga0070666_100883942 374
438 3300005336 Ga0070680_100043913 Ga0070680_1000439134 374
439 3300005336 Ga0070680_100141650 Ga0070680_1001416502 374
440 3300005336 Ga0070680_100144976 Ga0070680_1001449762 374
441 3300005338 Ga0068868_100093972 Ga0068868_1000939721 374
442 3300005339 Ga0070660_100079663 Ga0070660_1000796632 374
443 3300005339 Ga0070660_100122875 Ga0070660_1001228752 374
444 3300005344 Ga0070661_100164901 Ga0070661_1001649011 374
445 3300005366 Ga0070659_100024129 Ga0070659_1000241293 374
446 3300005366 Ga0070659_100024651 Ga0070659_1000246513 374
447 3300005366 Ga0070659_100028527 Ga0070659_1000285273 374
448 3300005434 Ga0070709_10000337 Ga0070709_100003379 374
449 3300005435 Ga0070714_100003394 Ga0070714_1000033949 374
450 3300005435 Ga0070714_100047712 Ga0070714_1000477123 374
451 3300005436 Ga0070713_100013337 Ga0070713_1000133372 374
452 3300005437 Ga0070710_10000508 Ga0070710_100005083 374
453 3300005439 Ga0070711_100001466 Ga0070711_10000146610 374
454 3300005439 Ga0070711_100235686 Ga0070711_1002356861 374
455 3300005455 Ga0070663_100009242 Ga0070663_1000092428 374
456 3300005455 Ga0070663_100011245 Ga0070663_1000112452 374
457 3300005457 Ga0070662_100150677 Ga0070662_1001506772 374
458 3300005458 Ga0070681_10239330 Ga0070681_102393302 374
459 3300005458 Ga0070681_10309054 Ga0070681_103090542 374
460 3300005518 Ga0070699_100206232 Ga0070699_1002062322 374
461 3300005530 Ga0070679_100071810 Ga0070679_1000718104 374
462 3300005536 Ga0070697_100008498 Ga0070697_1000084984 374
463 3300005539 Ga0068853_100116264 Ga0068853_1001162642 374
464 3300005543 Ga0070672_100107871 Ga0070672_1001078712 374
465 3300005548 Ga0070665_100013576 Ga0070665_1000135765 374
466 3300005563 Ga0068855_100047028 Ga0068855_1000470282 374
467 3300005563 Ga0068855_100094063 Ga0068855_1000940632 374
468 3300005563 Ga0068855_100211125 Ga0068855_1002111252 374
469 3300005577 Ga0068857_100041731 Ga0068857_1000417314 374
470 3300005578 Ga0068854_100115076 Ga0068854_1001150762 374
471 3300005616 Ga0068852_100007822 Ga0068852_1000078222 374
472 3300005616 Ga0068852_100008036 Ga0068852_1000080365 374
473 3300005616 Ga0068852_100158279 Ga0068852_1001582791 374
474 3300005719 Ga0068861_100011588 Ga0068861_1000115884 374
475 3300005842 Ga0068858_100143074 Ga0068858_1001430742 374
476 3300005843 Ga0068860_100000058 Ga0068860_10000005817 374
477 3300005937 Ga0081455_10001781 Ga0081455_100017812 374
478 3300005937 Ga0081455_10008715 Ga0081455_100087153 374
479 3300005937 Ga0081455_10011757 Ga0081455_100117576 374
480 3300005937 Ga0081455_10065025 Ga0081455_100650252 374
481 3300005937 Ga0081455_10067399 Ga0081455_100673992 374
482 3300005981 Ga0081538_10020550 Ga0081538_100205503 374
483 3300005983 Ga0081540_1001631 Ga0081540_10016312 374
484 3300005983 Ga0081540_1004255 Ga0081540_10042554 374
485 3300005983 Ga0081540_1004483 Ga0081540_100448310 374
486 3300005983 Ga0081540_1024868 Ga0081540_10248682 374
487 3300005983 Ga0081540_1028613 Ga0081540_10286132 374
488 3300005983 Ga0081540_1036032 Ga0081540_10360322 374
489 3300005983 Ga0081540_1048679 Ga0081540_10486791 374
490 3300005983 Ga0081540_1049510 Ga0081540_10495102 374
491 3300005985 Ga0081539_10000176 Ga0081539_100001762 374
492 3300005985 Ga0081539_10000250 Ga0081539_10000250126 374
493 3300006028 Ga0070717_10001774 Ga0070717_1000177415 374
494 3300006028 Ga0070717_10076501 Ga0070717_100765012 374
495 3300006028 Ga0070717_10177685 Ga0070717_101776852 374
496 3300006038 Ga0075365_10000419 Ga0075365_100004192 374
497 3300006038 Ga0075365_10062063 Ga0075365_100620632 374
498 3300006038 Ga0075365_10068011 Ga0075365_100680113 374
499 3300006048 Ga0075363_100011206 Ga0075363_1000112063 374
500 3300006048 Ga0075363_100014293 Ga0075363_1000142933 374
501 3300006051 Ga0075364_10024554 Ga0075364_100245542 374
502 3300006051 Ga0075364_10036661 Ga0075364_100366612 374
503 3300006163 Ga0070715_10015563 Ga0070715_100155632 374
504 3300006175 Ga0070712_100028701 Ga0070712_1000287012 374
505 3300006175 Ga0070712_100054173 Ga0070712_1000541733 374
506 3300006178 Ga0075367_10001505 Ga0075367_100015058 374
507 3300006178 Ga0075367_10017943 Ga0075367_100179432 374
508 3300006186 Ga0075369_10015474 Ga0075369_100154742 374
509 3300006237 Ga0097621_100130695 Ga0097621_1001306952 374
510 3300006871 Ga0075434_100224791 Ga0075434_1002247911 374
511 3300006881 Ga0068865_100063969 Ga0068865_1000639691 374
512 3300006881 Ga0068865_100076320 Ga0068865_1000763202 374
513 3300007265 Ga0099794_10030328 Ga0099794_100303282 374
514 3300007265 Ga0099794_10032336 Ga0099794_100323363 374
515 3300009093 Ga0105240_10002351 Ga0105240_100023512 374
516 3300009093 Ga0105240_10214043 Ga0105240_102140431 374
517 3300009094 Ga0111539_10163205 Ga0111539_101632052 374
518 3300009098 Ga0105245_10064176 Ga0105245_100641763 374
519 3300009148 Ga0105243_10054594 Ga0105243_100545942 374
520 3300009174 Ga0105241_10093600 Ga0105241_100936002 374
521 3300009545 Ga0105237_10029668 Ga0105237_100296682 374
522 3300009545 Ga0105237_10035284 Ga0105237_100352846 374
523 3300009545 Ga0105237_10050719 Ga0105237_100507193 374
524 3300009551 Ga0105238_10041533 Ga0105238_100415335 374
525 3300009551 Ga0105238_10251576 Ga0105238_102515762 374
526 3300009553 Ga0105249_10122999 Ga0105249_101229992 374
527 3300010159 Ga0099796_10005576 Ga0099796_100055762 374
528 3300013104 Ga0157370_10087962 Ga0157370_100879622 374
529 3300013104 Ga0157370_10095364 Ga0157370_100953642 374
530 3300013297 Ga0157378_10003751 Ga0157378_1000375110 374
531 3300013297 Ga0157378_10087404 Ga0157378_100874042 374
532 3300013306 Ga0163162_10118191 Ga0163162_101181911 374
533 3300013307 Ga0157372_10052487 Ga0157372_100524872 374
534 3300013307 Ga0157372_10130464 Ga0157372_101304642 374
535 3300014325 Ga0163163_10094697 Ga0163163_100946972 374
536 3300014968 Ga0157379_10139071 Ga0157379_101390711 374
537 3300014968 Ga0157379_10163945 Ga0157379_101639452 374
538 3300014969 Ga0157376_10286641 Ga0157376_102866411 374
539 3300021320 Ga0214544_1000009 Ga0214544_1000009136 374
540 3300021321 Ga0214542_1000002 Ga0214542_1000002578 374
541 3300021324 Ga0214545_1000002 Ga0214545_1000002142 374
542 3300021327 Ga0214543_1000013 Ga0214543_1000013180 374
543 3300021384 Ga0213876_10061558 Ga0213876_100615582 374
544 3300025230 Ga0209563_102229 Ga0209563_1022292 374
545 3300025245 Ga0207425_1014717 Ga0207425_10147172 374
546 3300025253 Ga0209677_102751 Ga0209677_1027515 374
547 3300025254 Ga0209148_1009728 Ga0209148_10097281 374
548 3300025261 Ga0209233_1006768 Ga0209233_10067681 374
549 3300025261 Ga0209233_1009455 Ga0209233_10094552 374
550 3300025272 Ga0209455_1003608 Ga0209455_10036084 374
551 3300025295 Ga0209564_1003387 Ga0209564_10033872 374
552 3300025295 Ga0209564_1007161 Ga0209564_10071612 374
553 3300025297 Ga0209758_1000100 Ga0209758_100010035 374
554 3300025297 Ga0209758_1001008 Ga0209758_10010086 374
555 3300025297 Ga0209758_1001125 Ga0209758_10011256 374
556 3300025297 Ga0209758_1002793 Ga0209758_10027936 374
557 3300025297 Ga0209758_1005742 Ga0209758_10057424 374
558 3300025297 Ga0209758_1007434 Ga0209758_10074341 374
559 3300025297 Ga0209758_1015490 Ga0209758_10154904 374
560 3300025297 Ga0209758_1018121 Ga0209758_10181212 374
561 3300025297 Ga0209758_1035384 Ga0209758_10353842 374
562 3300025299 Ga0209256_1011371 Ga0209256_10113712 374
563 3300025302 Ga0207426_1001094 Ga0207426_100109425 374
564 3300025302 Ga0207426_1002241 Ga0207426_10022412 374
565 3300025302 Ga0207426_1011700 Ga0207426_10117002 374
566 3300025304 Ga0209257_1006404 Ga0209257_10064046 374
567 3300025898 Ga0207692_10001906 Ga0207692_100019063 374
568 3300025899 Ga0207642_10059548 Ga0207642_100595482 374
569 3300025900 Ga0207710_10074065 Ga0207710_100740652 374
570 3300025903 Ga0207680_10034129 Ga0207680_100341292 374
571 3300025903 Ga0207680_10089723 Ga0207680_100897232 374
572 3300025905 Ga0207685_10016774 Ga0207685_100167742 374
573 3300025905 Ga0207685_10041048 Ga0207685_100410482 374
574 3300025906 Ga0207699_10000604 Ga0207699_100006046 374
575 3300025906 Ga0207699_10113213 Ga0207699_101132132 374
576 3300025909 Ga0207705_10258940 Ga0207705_102589401 374
577 3300025911 Ga0207654_10012282 Ga0207654_100122822 374
578 3300025912 Ga0207707_10216760 Ga0207707_102167602 374
579 3300025913 Ga0207695_10000278 Ga0207695_1000027887 374
580 3300025913 Ga0207695_10155696 Ga0207695_101556962 374
581 3300025914 Ga0207671_10008450 Ga0207671_100084506 374
582 3300025914 Ga0207671_10011711 Ga0207671_100117116 374
583 3300025915 Ga0207693_10026628 Ga0207693_100266282 374
584 3300025916 Ga0207663_10004391 Ga0207663_100043912 374
585 3300025917 Ga0207660_10013547 Ga0207660_100135472 374
586 3300025917 Ga0207660_10203759 Ga0207660_102037592 374
587 3300025919 Ga0207657_10002222 Ga0207657_100022228 374
588 3300025919 Ga0207657_10011901 Ga0207657_100119011 374
589 3300025919 Ga0207657_10208983 Ga0207657_102089832 374
590 3300025920 Ga0207649_10148353 Ga0207649_101483531 374
591 3300025924 Ga0207694_10327293 Ga0207694_103272931 374
592 3300025927 Ga0207687_10089800 Ga0207687_100898001 374
593 3300025927 Ga0207687_10121518 Ga0207687_101215181 374
594 3300025928 Ga0207700_10000752 Ga0207700_100007525 374
595 3300025928 Ga0207700_10083339 Ga0207700_100833392 374
596 3300025928 Ga0207700_10173309 Ga0207700_101733092 374
597 3300025929 Ga0207664_10006080 Ga0207664_100060805 374
598 3300025929 Ga0207664_10040726 Ga0207664_100407262 374
599 3300025932 Ga0207690_10193582 Ga0207690_101935822 374
600 3300025933 Ga0207706_10043872 Ga0207706_100438722 374
601 3300025935 Ga0207709_10059282 Ga0207709_100592821 374
602 3300025937 Ga0207669_10112264 Ga0207669_101122642 374
603 3300025938 Ga0207704_10042852 Ga0207704_100428522 374
604 3300025938 Ga0207704_10087262 Ga0207704_100872622 374
605 3300025939 Ga0207665_10001395 Ga0207665_100013956 374
606 3300025939 Ga0207665_10116154 Ga0207665_101161542 374
607 3300025940 Ga0207691_10030847 Ga0207691_100308474 374
608 3300025944 Ga0207661_10250092 Ga0207661_102500922 374
609 3300025949 Ga0207667_10003512 Ga0207667_1000351221 374
610 3300025949 Ga0207667_10081109 Ga0207667_100811092 374
611 3300025949 Ga0207667_10411163 Ga0207667_104111632 374
612 3300025961 Ga0207712_10106695 Ga0207712_101066952 374
613 3300026023 Ga0207677_10105345 Ga0207677_101053451 374
614 3300026035 Ga0207703_10110533 Ga0207703_101105332 374
615 3300026067 Ga0207678_10018848 Ga0207678_100188485 374
616 3300026067 Ga0207678_10069106 Ga0207678_100691062 374
617 3300026067 Ga0207678_10132976 Ga0207678_101329763 374
618 3300026075 Ga0207708_10044185 Ga0207708_100441852 374
619 3300026095 Ga0207676_10075385 Ga0207676_100753852 374
620 3300026116 Ga0207674_10044955 Ga0207674_100449554 374
621 3300026116 Ga0207674_10434347 Ga0207674_104343471 374
622 3300026118 Ga0207675_100212226 Ga0207675_1002122262 374
623 3300026121 Ga0207683_10052738 Ga0207683_100527382 374
624 3300026142 Ga0207698_10017856 Ga0207698_100178563 374
625 3300026142 Ga0207698_10030256 Ga0207698_100302562 374
626 3300026142 Ga0207698_10048796 Ga0207698_100487963 374
627 3300027296 Ga0209389_1000084 Ga0209389_100008414 374
628 3300027357 Ga0209589_1000041 Ga0209589_100004153 374
629 3300027361 Ga0209489_100070 Ga0209489_10007075 374
630 3300027363 Ga0209700_100021 Ga0209700_100021149 374
631 3300028379 Ga0268266_10003050 Ga0268266_1000305010 374
632 3300028379 Ga0268266_10386438 Ga0268266_103864382 374
633 3300028381 Ga0268264_10000022 Ga0268264_10000022280 374
634 3300028381 Ga0268264_10254651 Ga0268264_102546512 374
635 3300028786 Ga0307517_10004643 Ga0307517_100046433 374
636 3300028794 Ga0307515_10013142 Ga0307515_100131424 374
637 3300031235 Ga0265330_10023016 Ga0265330_100230162 374
638 3300031238 Ga0265332_10053903 Ga0265332_100539032 374
639 3300031241 Ga0265325_10032658 Ga0265325_100326581 374
640 3300031247 Ga0265340_10011316 Ga0265340_100113162 374
641 3300031247 Ga0265340_10047250 Ga0265340_100472502 374
642 3300031249 Ga0265339_10007490 Ga0265339_100074905 374
643 3300031344 Ga0265316_10072256 Ga0265316_100722562 374
644 3300031507 Ga0307509_10008409 Ga0307509_100084095 374
645 3300031595 Ga0265313_10030588 Ga0265313_100305882 374
646 3300031616 Ga0307508_10000038 Ga0307508_10000038101 374
647 3300031711 Ga0265314_10003315 Ga0265314_100033156 374
648 3300031711 Ga0265314_10016661 Ga0265314_100166614 374
649 3300031711 Ga0265314_10142735 Ga0265314_101427352 374
650 3300031712 Ga0265342_10012895 Ga0265342_100128952 374
651 3300031712 Ga0265342_10054311 Ga0265342_100543112 374
652 3300031730 Ga0307516_10008870 Ga0307516_100088708 374
653 3300031730 Ga0307516_10048871 Ga0307516_100488712 374
654 3300031730 Ga0307516_10148099 Ga0307516_101480991 374
655 3300031824 Ga0307413_10033046 Ga0307413_100330462 374
656 3300031995 Ga0307409_100059109 Ga0307409_1000591092 374
657 3300033180 Ga0307510_10043585 Ga0307510_100435853 374
658 3300033180 Ga0307510_10045521 Ga0307510_100455214 374
659 3300035119 Ga0373956_0003375 Ga0373956_0003375_632_1765 374
660 3300035120 Ga0373957_0000100 Ga0373957_0000100_19489_20622 374
661 3300035170 Ga0373943_0037456 Ga0373943_0037456_1130_2263 374
662 3300035172 Ga0373955_0030199 Ga0373955_0030199_1396_2529 374
663 3300035410 Ga0373924_0004454 Ga0373924_0004454_2210_3343 374
664 3300035695 Ga0373927_0013017 Ga0373927_0013017_4146_5279 374
665 3300035695 Ga0373927_0014783 Ga0373927_0014783_3107_4240 374
666 3300035724 Ga0373933_0157716 Ga0373933_0157716_98_1234 374
667 3300035724 Ga0373933_0206285 Ga0373933_0206285_43_1176 374
668 3300037068 Ga0373925_0008511 Ga0373925_0008511_1433_2566 374
669 3300037068 Ga0373925_0112522 Ga0373925_0112522_543_1676 374
670 3300037068 Ga0373925_0241309 Ga0373925_0241309_87_1220 374
671 3300037312 Ga0395899_0091019 Ga0395899_0091019_524_1657 374
672 3300037418 Ga0395900_0000860 Ga0395900_0000860_16546_17679 374
673 3300037466 Ga0395898_0011543 Ga0395898_0011543_682_1815 374
674 3300037471 Ga0395905_0021990 Ga0395905_0021990_3531_4664 374
675 3300038443 Ga0395901_0321556 Ga0395901_0321556_277_1410 374
676 3300039437 Ga0436365_0978478 Ga0436365_0978478_209_1342 374
677 3300039437 Ga0436365_1727745 Ga0436365_1727745_11791_12924 374
678 3300039450 Ga0436363_1276889 Ga0436363_1276889_427_1560 374
679 3300039453 Ga0436362_1050878 Ga0436362_1050878_1828_2961 374
680 3300044658 Ga0466972_0000660 Ga0466972_0000660_10597_11730 374
681 3300044683 Ga0466965_0017918 Ga0466965_0017918_1181_2314 374
682 3300044735 Ga0466968_0050276 Ga0466968_0050276_610_1743 374
683 3300045049 Ga0466959_0132905 Ga0466959_0132905_410_1543 374
684 3300045049 Ga0466959_0143044 Ga0466959_0143044_296_1432 374
685 3300046455 Ga0495603_0007153 Ga0495603_0007153_2206_3339 374
686 3300046455 Ga0495603_0012975 Ga0495603_0012975_3632_4765 374
687 3300046455 Ga0495603_0033100 Ga0495603_0033100_1727_2863 374
688 3300046457 Ga0495590_0005096 Ga0495590_0005096_392_1525 374
689 3300046459 Ga0495629_0049950 Ga0495629_0049950_749_1882 374
690 3300046460 Ga0495638_0021546 Ga0495638_0021546_33_1166 374
691 3300046463 Ga0495653_0000905 Ga0495653_0000905_205_1338 374
692 3300046463 Ga0495653_0228077 Ga0495653_0228077_12_1145 374
693 3300046463 Ga0495653_0230588 Ga0495653_0230588_34_1167 374
694 3300046471 Ga0495650_0051198 Ga0495650_0051198_196_1329 374
695 3300046472 Ga0495580_0142639 Ga0495580_0142639_15_1148 374
696 3300046473 Ga0495582_0142529 Ga0495582_0142529_173_1306 374
697 3300046474 Ga0495605_0034250 Ga0495605_0034250_812_1945 374
698 3300046477 Ga0495664_0033559 Ga0495664_0033559_1312_2445 374
699 3300046491 Ga0495584_0006929 Ga0495584_0006929_4382_5515 374
700 3300046492 Ga0495585_0010422 Ga0495585_0010422_185_1318 374
701 3300046492 Ga0495585_0054163 Ga0495585_0054163_263_1396 374
702 3300046499 Ga0495594_0030178 Ga0495594_0030178_643_1776 374
703 3300046507 Ga0495606_0016261 Ga0495606_0016261_4157_5290 374
704 3300046507 Ga0495606_0020685 Ga0495606_0020685_3575_4705 374
705 3300046507 Ga0495606_0164223 Ga0495606_0164223_74_1210 374
706 3300046512 Ga0495610_0048914 Ga0495610_0048914_316_1449 374
707 3300046518 Ga0495631_0021684 Ga0495631_0021684_1565_2698 374
708 3300046522 Ga0495643_0024835 Ga0495643_0024835_912_2045 374
709 3300046524 Ga0495648_0001196 Ga0495648_0001196_6267_7400 374
710 3300046524 Ga0495648_0016227 Ga0495648_0016227_4104_5237 374
711 3300046528 Ga0495642_0019910 Ga0495642_0019910_1484_2617 374
712 3300046529 Ga0495652_0013145 Ga0495652_0013145_1010_2143 374
713 3300046530 Ga0495654_0057793 Ga0495654_0057793_536_1669 374
714 3300046536 Ga0495587_0066032 Ga0495587_0066032_648_1781 374
715 3300046537 Ga0495598_0007033 Ga0495598_0007033_31_1164 374
716 3300046538 Ga0495609_0037053 Ga0495609_0037053_408_1541 374
717 3300046539 Ga0495621_0017023 Ga0495621_0017023_953_2086 374
718 3300046542 Ga0495597_0019441 Ga0495597_0019441_22_1155 374
719 3300046543 Ga0495645_0009332 Ga0495645_0009332_5011_6144 374
720 3300046557 Ga0495622_0114175 Ga0495622_0114175_56_1189 374
721 3300046559 Ga0495667_0082045 Ga0495667_0082045_530_1663 374
722 3300046615 Ga0495656_0003069 Ga0495656_0003069_4326_5459 374
723 3300046615 Ga0495656_0005194 Ga0495656_0005194_22_1155 374
724 3300046616 Ga0495668_0018347 Ga0495668_0018347_520_1653 374
725 3300046616 Ga0495668_0063801 Ga0495668_0063801_30_1163 374
726 3300046616 Ga0495668_0070808 Ga0495668_0070808_612_1745 374
727 3300046642 Ga0495634_0113048 Ga0495634_0113048_43_1176 374
728 3300046648 Ga0495611_0003326 Ga0495611_0003326_4153_5286 374
729 3300046660 Ga0495625_0052926 Ga0495625_0052926_215_1348 374
730 3300046663 Ga0495635_0001598 Ga0495635_0001598_13820_14953 374
731 3300046664 Ga0495659_0022883 Ga0495659_0022883_844_1977 374
732 3300046674 Ga0495588_0004167 Ga0495588_0004167_2114_3247 374
733 3300046675 Ga0495657_0032132 Ga0495657_0032132_2322_3455 374
734 3300046679 Ga0495623_0121585 Ga0495623_0121585_141_1277 374
735 3300046679 Ga0495623_0128826 Ga0495623_0128826_303_1436 374
736 3300046680 Ga0495646_0050411 Ga0495646_0050411_1289_2422 374
737 3300046684 Ga0495669_0009267 Ga0495669_0009267_1725_2858 374
738 3300046684 Ga0495669_0013439 Ga0495669_0013439_1557_2690 374
739 3300046691 Ga0495670_0007362 Ga0495670_0007362_3107_4240 374
740 3300046692 Ga0495671_0055927 Ga0495671_0055927_378_1511 374
741 3300046694 Ga0495649_0009550 Ga0495649_0009550_3323_4456 374
742 3300046694 Ga0495649_0122831 Ga0495649_0122831_26_1159 374
743 3300047317 Ga0495604_0008729 Ga0495604_0008729_6575_7708 374
744 3300047319 Ga0495674_0011652 Ga0495674_0011652_1792_2925 374
745 3300047321 Ga0495676_0029179 Ga0495676_0029179_582_1715 374
746 3300047322 Ga0495680_0124694 Ga0495680_0124694_303_1436 374
747 3300047323 Ga0495683_0016976 Ga0495683_0016976_1683_2816 374
748 3300047444 Ga0495675_0067391 Ga0495675_0067391_303_1436 374
749 3300047445 Ga0495677_0008483 Ga0495677_0008483_895_2028 374
750 3300047445 Ga0495677_0018395 Ga0495677_0018395_535_1668 374
751 3300047469 Ga0495673_0015016 Ga0495673_0015016_2163_3296 374
752 3300047472 Ga0495686_0051583 Ga0495686_0051583_772_1905 374
753 3300047472 Ga0495686_0051720 Ga0495686_0051720_399_1532 374
754 3300047673 Ga0495593_0005818 Ga0495593_0005818_5965_7098 374
755 3300047673 Ga0495593_0033461 Ga0495593_0033461_1567_2700 374
756 3300048088 Ga0495602_0234343 Ga0495602_0234343_221_1354 374
757 3300048903 Ga0496100_0113533 Ga0496100_0113533_210_1343 374
758 3300048905 Ga0496102_0213821 Ga0496102_0213821_247_1377 374
759 3300048907 Ga0496104_0039154 Ga0496104_0039154_398_1531 374
760 3300048907 Ga0496104_0045194 Ga0496104_0045194_1962_3095 374
761 3300048908 Ga0496105_0052703 Ga0496105_0052703_799_1932 374
762 3300048909 Ga0496106_0000546 Ga0496106_0000546_19987_21120 374
763 3300048910 Ga0496107_0006071 Ga0496107_0006071_4096_5229 374
764 3300048911 Ga0496108_0001487 Ga0496108_0001487_7888_9021 374
765 3300048911 Ga0496108_0404095 Ga0496108_0404095_33_1166 374
766 3300048912 Ga0496109_0002290 Ga0496109_0002290_6650_7783 374
767 3300048913 Ga0496110_0028694 Ga0496110_0028694_753_1886 374
768 3300048913 Ga0496110_0192481 Ga0496110_0192481_439_1572 374
769 3300048915 Ga0496112_0000079 Ga0496112_0000079_28805_29938 374
770 3300048915 Ga0496112_0173714 Ga0496112_0173714_950_2083 374
771 3300048916 Ga0496113_0041046 Ga0496113_0041046_1375_2508 374
772 3300048917 Ga0496114_0039704 Ga0496114_0039704_1278_2411 374
773 3300048917 Ga0496114_0208632 Ga0496114_0208632_64_1197 374
774 3300048918 Ga0496115_0031854 Ga0496115_0031854_1069_2202 374
775 3300048918 Ga0496115_0113682 Ga0496115_0113682_68_1201 374
776 3300048919 Ga0496116_0099348 Ga0496116_0099348_418_1551 374
777 3300048921 Ga0496118_0009864 Ga0496118_0009864_1752_2885 374
778 3300048921 Ga0496118_0017185 Ga0496118_0017185_1739_2872 374
779 3300048922 Ga0496119_0060982 Ga0496119_0060982_669_1802 374
780 3300048922 Ga0496119_0072540 Ga0496119_0072540_537_1670 374
781 3300048924 Ga0496121_0007340 Ga0496121_0007340_11723_12856 374
782 3300048924 Ga0496121_0041310 Ga0496121_0041310_2082_3215 374
783 3300048924 Ga0496121_0041730 Ga0496121_0041730_798_1931 374
784 3300048924 Ga0496121_0052341 Ga0496121_0052341_1250_2383 374
785 3300048924 Ga0496121_0080315 Ga0496121_0080315_1377_2510 374
786 3300048927 Ga0496124_0175761 Ga0496124_0175761_207_1337 374
787 3300048928 Ga0496125_0000756 Ga0496125_0000756_51351_52484 374
788 3300048928 Ga0496125_0003979 Ga0496125_0003979_8684_9817 374
789 3300048929 Ga0496126_0006416 Ga0496126_0006416_7164_8297 374
790 3300048929 Ga0496126_0030943 Ga0496126_0030943_2615_3760 374
791 3300048929 Ga0496126_0037866 Ga0496126_0037866_326_1459 374
792 3300048929 Ga0496126_0049932 Ga0496126_0049932_828_1961 374
793 3300048929 Ga0496126_0082610 Ga0496126_0082610_104_1237 374
794 3300048929 Ga0496126_0328033 Ga0496126_0328033_76_1209 374
795 3300049460 Ga0495682_0007216 Ga0495682_0007216_1704_2837 374
796 3300049568 Ga0501031_0028515 Ga0501031_0028515_121_1254 374
797 3300049568 Ga0501031_0078035 Ga0501031_0078035_390_1523 374
798 3300049569 Ga0501032_0007357 Ga0501032_0007357_2754_3887 374
799 3300049569 Ga0501032_0007780 Ga0501032_0007780_1818_2951 374
800 3300049569 Ga0501032_0014183 Ga0501032_0014183_1936_3069 374
801 3300049569 Ga0501032_0160873 Ga0501032_0160873_34_1167 374
802 3300049570 Ga0501033_0000313 Ga0501033_0000313_203_1336 374
803 3300049570 Ga0501033_0001956 Ga0501033_0001956_16584_17717 374
804 3300049570 Ga0501033_0020816 Ga0501033_0020816_897_2030 374
805 3300049571 Ga0501034_0000175 Ga0501034_0000175_117925_119058 374
806 3300049571 Ga0501034_0065198 Ga0501034_0065198_2218_3351 374
807 3300049571 Ga0501034_0204542 Ga0501034_0204542_108_1241 374
808 3300049572 Ga0501036_0000032 Ga0501036_0000032_39441_40574 374
809 3300049572 Ga0501036_0092834 Ga0501036_0092834_296_1429 374
810 3300049572 Ga0501036_0180825 Ga0501036_0180825_561_1691 374
811 3300049573 Ga0501037_0000415 Ga0501037_0000415_33726_34859 374
812 3300049573 Ga0501037_0009384 Ga0501037_0009384_216_1349 374
813 3300049573 Ga0501037_0024822 Ga0501037_0024822_1470_2603 374
814 3300049573 Ga0501037_0059114 Ga0501037_0059114_1144_2277 374
815 3300049573 Ga0501037_0073701 Ga0501037_0073701_284_1414 374
816 3300049573 Ga0501037_0123227 Ga0501037_0123227_452_1585 374
817 3300049573 Ga0501037_0129459 Ga0501037_0129459_374_1507 374
818 3300049574 Ga0501038_0000114 Ga0501038_0000114_14118_15251 374
819 3300049574 Ga0501038_0010298 Ga0501038_0010298_2016_3149 374
820 3300049574 Ga0501038_0010663 Ga0501038_0010663_5081_6214 374
821 3300049574 Ga0501038_0011901 Ga0501038_0011901_5142_6272 374
822 3300049574 Ga0501038_0046908 Ga0501038_0046908_1474_2607 374
823 3300049574 Ga0501038_0053939 Ga0501038_0053939_1936_3069 374
824 3300049575 Ga0501039_0000078 Ga0501039_0000078_30536_31669 374
825 3300049575 Ga0501039_0056463 Ga0501039_0056463_549_1682 374
826 3300049575 Ga0501039_0170436 Ga0501039_0170436_430_1563 374
827 3300049576 Ga0501040_0010883 Ga0501040_0010883_1798_2931 374
828 3300049577 Ga0501041_0137478 Ga0501041_0137478_319_1452 374
829 3300049578 Ga0501042_0008806 Ga0501042_0008806_540_1673 374
830 3300049579 Ga0501043_0000220 Ga0501043_0000220_2074_3207 374
831 3300049579 Ga0501043_0059836 Ga0501043_0059836_1799_2932 374
832 3300049579 Ga0501043_0069641 Ga0501043_0069641_945_2078 374
833 3300049579 Ga0501043_0124712 Ga0501043_0124712_672_1805 374
834 3300049580 Ga0501046_0000176 Ga0501046_0000176_63690_64823 374
835 3300049580 Ga0501046_0017167 Ga0501046_0017167_216_1349 374
836 3300049580 Ga0501046_0018872 Ga0501046_0018872_1658_2788 374
837 3300049580 Ga0501046_0091234 Ga0501046_0091234_1015_2148 374
838 3300049581 Ga0501047_0000085 Ga0501047_0000085_92505_93638 374
839 3300049581 Ga0501047_0003015 Ga0501047_0003015_13872_15002 374
840 3300049581 Ga0501047_0021690 Ga0501047_0021690_3674_4807 374
841 3300049581 Ga0501047_0062758 Ga0501047_0062758_560_1693 374
842 3300049581 Ga0501047_0295067 Ga0501047_0295067_289_1422 374
843 3300049582 Ga0501048_0024136 Ga0501048_0024136_1117_2250 374
844 3300049582 Ga0501048_0046571 Ga0501048_0046571_1576_2709 374
845 3300049583 Ga0501067_0001860 Ga0501067_0001860_10013_11146 374
846 3300049583 Ga0501067_0003942 Ga0501067_0003942_6060_7193 374
847 3300049584 Ga0501068_0001393 Ga0501068_0001393_11244_12377 374
848 3300049584 Ga0501068_0063934 Ga0501068_0063934_992_2125 374
849 3300049585 Ga0501069_0023817 Ga0501069_0023817_1838_2971 374
850 3300049585 Ga0501069_0032539 Ga0501069_0032539_504_1637 374
851 3300049586 Ga0501070_0011262 Ga0501070_0011262_6034_7167 374
852 3300049586 Ga0501070_0042730 Ga0501070_0042730_171_1304 374
853 3300049587 Ga0501071_0022700 Ga0501071_0022700_2243_3376 374
854 3300049587 Ga0501071_0027300 Ga0501071_0027300_2588_3721 374
855 3300049587 Ga0501071_0087434 Ga0501071_0087434_501_1634 374
856 3300049588 Ga0501072_0010680 Ga0501072_0010680_1562_2695 374
857 3300049588 Ga0501072_0120351 Ga0501072_0120351_676_1809 374
858 3300049589 Ga0501073_0000026 Ga0501073_0000026_96208_97341 374
859 3300049589 Ga0501073_0081545 Ga0501073_0081545_515_1648 374
860 3300049590 Ga0501074_0000878 Ga0501074_0000878_17527_18660 374
861 3300049590 Ga0501074_0008344 Ga0501074_0008344_5287_6420 374
862 3300049592 Ga0501076_0083862 Ga0501076_0083862_547_1680 374
863 3300049741 Ga0501079_0006752 Ga0501079_0006752_1716_2849 374
864 3300049741 Ga0501079_0158453 Ga0501079_0158453_469_1602 374
865 3300049742 Ga0501080_0248879 Ga0501080_0248879_320_1453 374
866 3300049743 Ga0501081_0149601 Ga0501081_0149601_360_1493 374
867 3300049744 Ga0501083_0028305 Ga0501083_0028305_2687_3820 374
868 3300049822 Ga0501035_0014167 Ga0501035_0014167_6009_7142 374
869 3300049822 Ga0501035_0014525 Ga0501035_0014525_4891_6024 374
870 3300049822 Ga0501035_0027709 Ga0501035_0027709_3783_4916 374
871 3300049822 Ga0501035_0063093 Ga0501035_0063093_1754_2887 374
872 3300049822 Ga0501035_0168085 Ga0501035_0168085_386_1519 374
873 3300049823 Ga0501044_0000061 Ga0501044_0000061_77711_78844 374
874 3300049823 Ga0501044_0011007 Ga0501044_0011007_4492_5625 374
875 3300049823 Ga0501044_0018826 Ga0501044_0018826_3512_4645 374
876 3300049823 Ga0501044_0072096 Ga0501044_0072096_1648_2781 374
877 3300049823 Ga0501044_0195234 Ga0501044_0195234_642_1775 374
878 3300049823 Ga0501044_0220866 Ga0501044_0220866_298_1431 374
879 3300049824 Ga0501045_0015070 Ga0501045_0015070_1799_2932 374
880 3300050490 nmdc:mga03n38_11708_c1 nmdc:mga03n38_11708_c1_113_1246 374
881 3300050490 nmdc:mga03n38_2075_c1 nmdc:mga03n38_2075_c1_4698_5831 374
882 3300050491 nmdc:mga00v17_14353_c1 nmdc:mga00v17_14353_c1_2067_3200 374
883 3300050491 nmdc:mga00v17_43318_c1 nmdc:mga00v17_43318_c1_285_1418 374
884 3300050492 nmdc:mga0yw44_1305_c1 nmdc:mga0yw44_1305_c1_1389_2522 374
885 3300050492 nmdc:mga0yw44_23019_c1 nmdc:mga0yw44_23019_c1_1575_2708 374
886 3300050492 nmdc:mga0yw44_40905_c1 nmdc:mga0yw44_40905_c1_797_1930 374
887 3300050494 nmdc:mga06z11_51583_c1 nmdc:mga06z11_51583_c1_849_1982 374
888 3300050496 nmdc:mga07m45_1819_c1 nmdc:mga07m45_1819_c1_5204_6337 374
889 3300050496 nmdc:mga07m45_19104_c1 nmdc:mga07m45_19104_c1_1399_2532 374
890 3300050507 nmdc:mga05p37_399127_c1 nmdc:mga05p37_399127_c1_448_1581 374
891 3300050511 nmdc:mga08y16_97027_c1 nmdc:mga08y16_97027_c1_1445_2578 374
892 3300050516 nmdc:mga0sz30_42214_c1 nmdc:mga0sz30_42214_c1_686_1819 374
893 3300050516 nmdc:mga0sz30_9246_c1 nmdc:mga0sz30_9246_c1_598_1731 374
894 3300053077 Ga0495601_0201403 Ga0495601_0201403_27_1160 374
895 3300053079 Ga0500610_0073581 Ga0500610_0073581_438_1571 374
896 3300053080 Ga0500635_0004290 Ga0500635_0004290_1278_2411 374
897 3300053080 Ga0500635_0004942 Ga0500635_0004942_2147_3280 374
898 3300053084 Ga0495595_0014890 Ga0495595_0014890_614_1747 374
899 3300053085 Ga0495619_0000182 Ga0495619_0000182_37628_38761 374
900 3300053093 Ga0500651_0018637 Ga0500651_0018637_398_1531 374
901 3300053094 Ga0500566_0000038 Ga0500566_0000038_41908_43083 374
902 3300053094 Ga0500566_0000596 Ga0500566_0000596_10465_11598 374
903 3300053094 Ga0500566_0042396 Ga0500566_0042396_266_1402 374
904 3300053095 Ga0500640_014775 Ga0500640_014775_1100_2275 374
905 3300053096 Ga0500641_0002804 Ga0500641_0002804_2089_3222 374
906 3300053105 Ga0500557_000001 Ga0500557_000001_12520_13653 374
907 3300053111 Ga0500572_000010 Ga0500572_000010_24325_25500 374
908 3300053111 Ga0500572_000539 Ga0500572_000539_4363_5496 374
909 3300053116 Ga0500592_009746 Ga0500592_009746_79_1212 374
910 3300053119 Ga0500595_000143 Ga0500595_000143_25973_27109 374
911 3300053119 Ga0500595_003822 Ga0500595_003822_4706_5839 374
912 3300053122 Ga0500608_016164 Ga0500608_016164_817_1992 374
913 3300053130 Ga0500642_0006377 Ga0500642_0006377_2608_3741 374
914 3300053136 Ga0500559_0000917 Ga0500559_0000917_9527_10660 374
915 3300053136 Ga0500559_0014387 Ga0500559_0014387_1209_2384 374
916 3300053136 Ga0500559_0061944 Ga0500559_0061944_336_1469 374
917 3300053139 Ga0500568_0003461 Ga0500568_0003461_7032_8165 374
918 3300053140 Ga0500573_0030373 Ga0500573_0030373_383_1516 374
919 3300053142 Ga0500577_0002448 Ga0500577_0002448_2199_3326 374
920 3300053142 Ga0500577_0024659 Ga0500577_0024659_553_1686 374
921 3300053148 Ga0500590_041405 Ga0500590_041405_233_1408 374
922 3300053150 Ga0500603_000364 Ga0500603_000364_5190_6323 374
923 3300053150 Ga0500603_000550 Ga0500603_000550_984_2159 374
924 3300053150 Ga0500603_007083 Ga0500603_007083_65_1198 374
925 3300053153 Ga0500616_0002840 Ga0500616_0002840_2702_3835 374
926 3300053158 Ga0500627_0034682 Ga0500627_0034682_51_1184 374
927 3300053159 Ga0500630_000751 Ga0500630_000751_1831_3006 374
928 3300053161 Ga0500634_0070970 Ga0500634_0070970_33_1166 374
929 3300053162 Ga0500638_000303 Ga0500638_000303_3229_4365 374
930 3300053163 Ga0500639_000034 Ga0500639_000034_41591_42766 374
931 3300053163 Ga0500639_020006 Ga0500639_020006_1165_2298 374
932 3300053163 Ga0500639_105339 Ga0500639_105339_37_1170 374
933 3300053177 Ga0500636_0084966 Ga0500636_0084966_591_1724 374
934 3300053178 Ga0500637_0000685 Ga0500637_0000685_8326_9462 374
935 3300053178 Ga0500637_0004238 Ga0500637_0004238_3821_4954 374
936 3300053729 Ga0500625_001418 Ga0500625_001418_6844_7977 374
937 3300053735 Ga0500596_000264 Ga0500596_000264_6214_7389 374
938 3300053735 Ga0500596_005925 Ga0500596_005925_234_1367 374
939 3300053735 Ga0500596_009734 Ga0500596_009734_169_1302 374
940 3300054114 Ga0501084_0005053 Ga0501084_0005053_3806_4939 374
941 3300054114 Ga0501084_0018834 Ga0501084_0018834_4254_5387 374
942 3300055283 Ga0500661_000850 Ga0500661_000850_3221_4357 374
943 3300060353 Ga0501082_0014622 Ga0501082_0014622_3888_5021 374
944 3300060353 Ga0501082_0098826 Ga0501082_0098826_1102_2235 374
945 3300061734 Ga0530510_0064504 Ga0530510_0064504_1091_2224 374
946 3300013105 Ga0157369_10486335 Ga0157369_104863351 375
947 3300045049 Ga0466959_0093609 Ga0466959_0093609_788_1924 375
948 3300048924 Ga0496121_0089588 Ga0496121_0089588_367_1506 375
949 3300050516 nmdc:mga0sz30_23235_c1 nmdc:mga0sz30_23235_c1_176_1303 375
950 3300061719 Ga0466962_0054197 Ga0466962_0054197_572_1708 375
951 3300005539 Ga0068853_100079332 Ga0068853_1000793322 376
952 3300005563 Ga0068855_100031483 Ga0068855_1000314831 376
953 3300006048 Ga0075363_100022463 Ga0075363_1000224631 376
954 3300009545 Ga0105237_10043296 Ga0105237_100432962 376
955 3300009545 Ga0105237_10219618 Ga0105237_102196181 376
956 3300010375 Ga0105239_10036223 Ga0105239_100362232 376
957 3300025914 Ga0207671_10018832 Ga0207671_100188324 376
958 3300025941 Ga0207711_10342177 Ga0207711_103421771 376
959 3300025949 Ga0207667_10086339 Ga0207667_100863392 376
960 3300026067 Ga0207678_10315419 Ga0207678_103154192 376
961 3300028556 Ga0265337_1004278 Ga0265337_10042782 376
962 3300028558 Ga0265326_10022991 Ga0265326_100229911 376
963 3300029957 Ga0265324_10003894 Ga0265324_100038942 376
964 3300032126 Ga0307415_100039397 Ga0307415_1000393972 376
965 3300035113 Ga0373936_0025159 Ga0373936_0025159_289_1437 376
966 3300035116 Ga0373945_0046245 Ga0373945_0046245_110_1258 376
967 3300035171 Ga0373946_0001312 Ga0373946_0001312_5997_7145 376
968 3300035692 Ga0373935_0001438 Ga0373935_0001438_10853_12001 376
969 3300035695 Ga0373927_0000225 Ga0373927_0000225_36073_37221 376
970 3300035724 Ga0373933_0094015 Ga0373933_0094015_677_1825 376
971 3300035725 Ga0373947_0002889 Ga0373947_0002889_2448_3596 376
972 3300036401 Ga0373937_0068873 Ga0373937_0068873_1688_2836 376
973 3300037068 Ga0373925_0000711 Ga0373925_0000711_27843_28991 376
974 3300046454 Ga0495592_0066499 Ga0495592_0066499_239_1408 376
975 3300046454 Ga0495592_0146137 Ga0495592_0146137_258_1406 376
976 3300046455 Ga0495603_0000960 Ga0495603_0000960_4980_6128 376
977 3300046459 Ga0495629_0000179 Ga0495629_0000179_7883_9031 376
978 3300046462 Ga0495651_0005780 Ga0495651_0005780_3831_5000 376
979 3300046472 Ga0495580_0000280 Ga0495580_0000280_6531_7679 376
980 3300046473 Ga0495582_0000061 Ga0495582_0000061_6532_7680 376
981 3300046474 Ga0495605_0081593 Ga0495605_0081593_78_1247 376
982 3300046475 Ga0495639_0000102 Ga0495639_0000102_34587_35735 376
983 3300046476 Ga0495662_0000746 Ga0495662_0000746_13055_14203 376
984 3300046477 Ga0495664_0002105 Ga0495664_0002105_1824_2972 376
985 3300046499 Ga0495594_0000378 Ga0495594_0000378_1959_3107 376
986 3300046511 Ga0495608_0010907 Ga0495608_0010907_5051_6220 376
987 3300046516 Ga0495628_0018385 Ga0495628_0018385_3396_4565 376
988 3300046516 Ga0495628_0035270 Ga0495628_0035270_2116_3264 376
989 3300046524 Ga0495648_0061143 Ga0495648_0061143_215_1384 376
990 3300046529 Ga0495652_0091685 Ga0495652_0091685_538_1707 376
991 3300046529 Ga0495652_0105206 Ga0495652_0105206_122_1270 376
992 3300046531 Ga0495665_0000261 Ga0495665_0000261_18946_20094 376
993 3300046533 Ga0495640_0002042 Ga0495640_0002042_6920_8068 376
994 3300046533 Ga0495640_0040304 Ga0495640_0040304_1321_2490 376
995 3300046533 Ga0495640_0082595 Ga0495640_0082595_439_1608 376
996 3300046543 Ga0495645_0011286 Ga0495645_0011286_3602_4771 376
997 3300046557 Ga0495622_0008215 Ga0495622_0008215_184_1332 376
998 3300046557 Ga0495622_0024903 Ga0495622_0024903_262_1431 376
999 3300046559 Ga0495667_0011404 Ga0495667_0011404_4494_5663 376
1000 3300046559 Ga0495667_0039154 Ga0495667_0039154_1499_2647 376
1001 3300046642 Ga0495634_0000161 Ga0495634_0000161_22586_23734 376
1002 3300046660 Ga0495625_0170346 Ga0495625_0170346_189_1358 376
1003 3300046663 Ga0495635_0001102 Ga0495635_0001102_10276_11424 376
1004 3300046663 Ga0495635_0135687 Ga0495635_0135687_51_1220 376
1005 3300046674 Ga0495588_0098627 Ga0495588_0098627_145_1314 376
1006 3300046675 Ga0495657_0023663 Ga0495657_0023663_3153_4322 376
1007 3300046678 Ga0495599_0058148 Ga0495599_0058148_721_1890 376
1008 3300046679 Ga0495623_0030541 Ga0495623_0030541_416_1585 376
1009 3300046681 Ga0495647_0000205 Ga0495647_0000205_8345_9493 376
1010 3300046683 Ga0495658_0001114 Ga0495658_0001114_5971_7119 376
1011 3300046689 Ga0495613_0012105 Ga0495613_0012105_3232_4380 376
1012 3300046689 Ga0495613_0063836 Ga0495613_0063836_800_1969 376
1013 3300046690 Ga0495624_0003890 Ga0495624_0003890_2111_3259 376
1014 3300046690 Ga0495624_0027953 Ga0495624_0027953_194_1363 376
1015 3300046694 Ga0495649_0049185 Ga0495649_0049185_239_1408 376
1016 3300046809 Ga0495600_0010669 Ga0495600_0010669_4447_5616 376
1017 3300046809 Ga0495600_0016431 Ga0495600_0016431_1926_3095 376
1018 3300047315 Ga0495581_0000255 Ga0495581_0000255_4042_5190 376
1019 3300047315 Ga0495581_0040997 Ga0495581_0040997_53_1222 376
1020 3300047317 Ga0495604_0010435 Ga0495604_0010435_4456_5625 376
1021 3300047317 Ga0495604_0045012 Ga0495604_0045012_1394_2563 376
1022 3300047319 Ga0495674_0000117 Ga0495674_0000117_22862_24010 376
1023 3300047321 Ga0495676_0006968 Ga0495676_0006968_1778_2926 376
1024 3300047321 Ga0495676_0021084 Ga0495676_0021084_257_1426 376
1025 3300047322 Ga0495680_0004171 Ga0495680_0004171_9960_11129 376
1026 3300047673 Ga0495593_0000086 Ga0495593_0000086_39046_40194 376
1027 3300048088 Ga0495602_0004737 Ga0495602_0004737_8999_10168 376
1028 3300048088 Ga0495602_0057792 Ga0495602_0057792_1155_2324 376
1029 3300048089 Ga0495614_0018614 Ga0495614_0018614_1824_2972 376
1030 3300048907 Ga0496104_0154915 Ga0496104_0154915_148_1317 376
1031 3300048908 Ga0496105_0003203 Ga0496105_0003203_10140_11309 376
1032 3300048910 Ga0496107_0009700 Ga0496107_0009700_3356_4498 376
1033 3300048918 Ga0496115_0132161 Ga0496115_0132161_146_1315 376
1034 3300048918 Ga0496115_0190376 Ga0496115_0190376_393_1538 376
1035 3300048921 Ga0496118_0119680 Ga0496118_0119680_49_1218 376
1036 3300048922 Ga0496119_0002628 Ga0496119_0002628_11905_13074 376
1037 3300048923 Ga0496120_0010435 Ga0496120_0010435_2240_3409 376
1038 3300048924 Ga0496121_0001789 Ga0496121_0001789_6409_7551 376
1039 3300048924 Ga0496121_0077388 Ga0496121_0077388_43_1212 376
1040 3300048924 Ga0496121_0230387 Ga0496121_0230387_134_1279 376
1041 3300048928 Ga0496125_0035568 Ga0496125_0035568_182_1351 376
1042 3300048929 Ga0496126_0002315 Ga0496126_0002315_13494_14636 376
1043 3300048929 Ga0496126_0283948 Ga0496126_0283948_175_1344 376
1044 3300049460 Ga0495682_0015674 Ga0495682_0015674_76_1245 376
1045 3300049583 Ga0501067_0134372 Ga0501067_0134372_162_1310 376
1046 3300049823 Ga0501044_0022791 Ga0501044_0022791_3468_4613 376
1047 3300050494 nmdc:mga06z11_1148_c1 nmdc:mga06z11_1148_c1_6477_7637 376
1048 3300053085 Ga0495619_0031597 Ga0495619_0031597_1256_2404 376
1049 3300053737 Ga0500601_000570 Ga0500601_000570_1764_2933 376
1050 3300061734 Ga0530510_0225344 Ga0530510_0225344_161_1309 376
1051 iso_pu_bacteria 2904690495 2904696521 376
1052 iso_pu_bacteria 2908756301 2908760375 376
1053 3300001979 JGI24740J21852_10007113 JGI24740J21852_100071134 377
1054 3300001990 JGI24737J22298_10008019 JGI24737J22298_100080192 377
1055 3300005455 Ga0070663_100038211 Ga0070663_1000382111 377
1056 3300005457 Ga0070662_100042412 Ga0070662_1000424121 377
1057 3300005563 Ga0068855_100285752 Ga0068855_1002857522 377
1058 3300005577 Ga0068857_100010572 Ga0068857_1000105728 377
1059 3300005577 Ga0068857_100231378 Ga0068857_1002313782 377
1060 3300005578 Ga0068854_100114444 Ga0068854_1001144442 377
1061 3300005614 Ga0068856_100079971 Ga0068856_1000799712 377
1062 3300005614 Ga0068856_100239351 Ga0068856_1002393512 377
1063 3300005834 Ga0068851_10052697 Ga0068851_100526972 377
1064 3300009093 Ga0105240_10043962 Ga0105240_100439622 377
1065 3300009093 Ga0105240_10077533 Ga0105240_100775333 377
1066 3300009174 Ga0105241_10022028 Ga0105241_100220282 377
1067 3300009545 Ga0105237_10009523 Ga0105237_100095236 377
1068 3300009545 Ga0105237_10289200 Ga0105237_102892002 377
1069 3300009551 Ga0105238_10022350 Ga0105238_100223506 377
1070 3300010375 Ga0105239_10382535 Ga0105239_103825352 377
1071 3300025321 Ga0207656_10011134 Ga0207656_100111342 377
1072 3300025911 Ga0207654_10036806 Ga0207654_100368062 377
1073 3300025913 Ga0207695_10001915 Ga0207695_1000191528 377
1074 3300025924 Ga0207694_10001639 Ga0207694_100016392 377
1075 3300025933 Ga0207706_10017328 Ga0207706_100173285 377
1076 3300025949 Ga0207667_10045424 Ga0207667_100454242 377
1077 3300025981 Ga0207640_10022747 Ga0207640_100227473 377
1078 3300026078 Ga0207702_10000005 Ga0207702_100000052 377
1079 3300026078 Ga0207702_10126772 Ga0207702_101267722 377
1080 3300026116 Ga0207674_10016313 Ga0207674_100163132 377
1081 3300026116 Ga0207674_10450939 Ga0207674_104509391 377
1082 3300026142 Ga0207698_10041494 Ga0207698_100414942 377

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

222

387

0.92

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

54

225

0.92

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

235

373

0.91

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

55

220

0.89

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

49

401

0.79

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

246

403

0.76

PF13477

Glyco_trans_4_2

Glycosyl transferase 4-like

58

196

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8759 201 355
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.86 201 355
2jjm-assembly1.cif.gz_B crystal structure of a family gt4 glycosyltransferase from bacillus anthracis orf ba1558. 0.8518 10 373
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8462 200 355
2jjm-assembly1.cif.gz_B crystal structure of a family gt4 glycosyltransferase from bacillus anthracis orf ba1558. 0.8452 10 373
ID Description Score Start End Superfamily
af_P9WMZ3_200_365_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9079 204 357 3.40.50.2000
af_P9WMY9_212_374_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9041 197 353 3.40.50.2000
af_Q59002_191_368_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8998 198 357 3.40.50.2000
af_Q2G0L3_321_481_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8988 205 355 3.40.50.2000
5d00A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8837 197 357 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A848Y305-F1-model_v4 Glycosyltransferase family 4 protein 0.9534 70 377 GO:0016757
AF-A0A519YLP5-F1-model_v4 deleted 0.95 7 364
AF-A0A519XZA0-F1-model_v4 deleted 0.9441 4 266
AF-A0A4V1VJ67-F1-model_v4 Glycosyltransferase 0.943 246 376 GO:0016757
AF-A0A2V5CDN7-F1-model_v4 deleted 0.9364 5 375

Feature Viewer

pLDDT pTM Quality
92.18 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map