F489670

General Info

Members Datasets Scaffolds Average Seq Length
1080 355 2160 260

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0664010|Ga0496112_0664010_98_931
Length 277
Sequence MVEAPVHMPDIAGSKPPGLSVFFPAYNDSGTIASMVIRAVQAAAALTPDYEVIVVNDGSADATAEIADELARTYPHVRVIHHPKNRGYGGALQTGFRSATKDLIFYTDGDAQYDPSEMALLWERASAGDVDLVNGYKISRSDPLHRIFIGRFYHHTVKMLFGLRVRDVDCDFRLMRRAIFDRIQLEKNSGVICLELMKKIHDAGFRIAEVPVHHYHRAYGKSQFFNFGRIFRTGIDVMKLWYALVIRRDHLKAPQSASLPAADQAQPASAPPRHSGS

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
202 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
203 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
204 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
205 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
212 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
217 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
218 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
234 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
237 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
238 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
239 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
240 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
241 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
242 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
312 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
313 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
314 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
315 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
316 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
325 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
326 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
327 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
328 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
329 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
330 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
331 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
334 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
335 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
336 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
337 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
338 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
339 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
340 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
341 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
342 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
345 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
346 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
347 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
348 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
349 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
350 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
351 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
352 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
353 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
354 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
355 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.09
Nodule 0
Rhizoplane 3.7
Rhizosphere 90.93
Stem 0
Stem Tuber 0
Unclassified 4.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0664010 3300048915 Bacteria 972
2 JGI25406J46586_10015538 3300003203 Bacteria 3206
3 JGI25406J46586_10022530 3300003203 Bacteria 2506
4 Ga0065712_10072264 3300005290 Bacteria 4834
5 Ga0065715_10001036 3300005293 Bacteria 8463
6 Ga0065715_10020859 3300005293 Bacteria 1626
7 Ga0065715_10035369 3300005293 Bacteria 1382
8 Ga0065715_10095018 3300005293 Unclassified 4185
9 Ga0065715_10283855 3300005293 Bacteria 1079
10 Ga0065715_10315830 3300005293 Bacteria 1011
11 Ga0065715_10319977 3300005293 Bacteria 1004
12 Ga0065715_10409354 3300005293 Bacteria 869
13 Ga0065707_10235415 3300005295 Unclassified 1174
14 Ga0070676_10000699 3300005328 Bacteria 16384
15 Ga0070676_10003338 3300005328 Bacteria 8349
16 Ga0070676_10123310 3300005328 Bacteria 1629
17 Ga0070676_10246354 3300005328 Bacteria 1191
18 Ga0070690_100015022 3300005330 Bacteria 4608
19 Ga0070690_100040093 3300005330 Bacteria 2961
20 Ga0070690_100102108 3300005330 Bacteria 1902
21 Ga0070690_100193128 3300005330 Bacteria 1413
22 Ga0070670_100001016 3300005331 Bacteria 22144
23 Ga0070670_100040631 3300005331 Bacteria 3998
24 Ga0070670_100042068 3300005331 Bacteria 3927
25 Ga0070670_100055469 3300005331 Bacteria 3401
26 Ga0070670_100081085 3300005331 Bacteria 2788
27 Ga0070677_10002373 3300005333 Bacteria 6013
28 Ga0070677_10013001 3300005333 Bacteria 2902
29 Ga0068869_100008375 3300005334 Bacteria 6663
30 Ga0068869_100085703 3300005334 Bacteria 2360
31 Ga0068869_100103915 3300005334 Bacteria 2153
32 Ga0068869_100143786 3300005334 Bacteria 1844
33 Ga0070666_10003461 3300005335 Bacteria 9565
34 Ga0070666_10012053 3300005335 Bacteria 5443
35 Ga0070666_10015679 3300005335 Bacteria 4836
36 Ga0070680_100163370 3300005336 Bacteria 1872
37 Ga0070680_100238110 3300005336 Unclassified 1538
38 Ga0070682_100424888 3300005337 Unclassified 1011
39 Ga0068868_100168700 3300005338 Bacteria 1811
40 Ga0068868_100203898 3300005338 Bacteria 1650
41 Ga0068868_100221627 3300005338 Bacteria 1584
42 Ga0068868_100251403 3300005338 Bacteria 1488
43 Ga0070660_100009277 3300005339 Bacteria 6916
44 Ga0070660_100401862 3300005339 Bacteria 1133
45 Ga0070689_100000517 3300005340 Bacteria 22784
46 Ga0070689_100003815 3300005340 Bacteria 10095
47 Ga0070689_100008478 3300005340 Archaea 7243
48 Ga0070689_100243427 3300005340 Bacteria 1482
49 Ga0070691_10003375 3300005341 Bacteria 7177
50 Ga0070687_100002053 3300005343 Bacteria 7401
51 Ga0070687_100123621 3300005343 Bacteria 1484
52 Ga0070687_100248588 3300005343 Bacteria 1104
53 Ga0070661_100011720 3300005344 Bacteria 6117
54 Ga0070661_100279927 3300005344 Bacteria 1294
55 Ga0070692_10162969 3300005345 Bacteria 1279
56 Ga0070668_100066232 3300005347 Bacteria 2803
57 Ga0070668_100072278 3300005347 Bacteria 2688
58 Ga0070668_100175406 3300005347 Bacteria 1747
59 Ga0070668_100587627 3300005347 Unclassified 973
60 Ga0070669_100000591 3300005353 Bacteria 26963
61 Ga0070669_100000645 3300005353 Bacteria 25815
62 Ga0070669_100010354 3300005353 Bacteria 6621
63 Ga0070669_100040011 3300005353 Bacteria 3407
64 Ga0070669_100059073 3300005353 Bacteria 2816
65 Ga0070675_100004466 3300005354 Bacteria 10667
66 Ga0070675_100025109 3300005354 Bacteria 4775
67 Ga0070675_100076331 3300005354 Bacteria 2787
68 Ga0070675_100092816 3300005354 Bacteria 2531
69 Ga0070675_100352190 3300005354 Bacteria 1306
70 Ga0070675_100397862 3300005354 Bacteria 1228
71 Ga0070671_100026568 3300005355 Bacteria 4759
72 Ga0070671_100028649 3300005355 Bacteria 4587
73 Ga0070671_100067896 3300005355 Bacteria 2973
74 Ga0070671_100154711 3300005355 Unclassified 1937
75 Ga0070674_100039604 3300005356 Bacteria 3184
76 Ga0070674_100060461 3300005356 Bacteria 2641
77 Ga0070674_100069454 3300005356 Bacteria 2485
78 Ga0070674_100074754 3300005356 Bacteria 2405
79 Ga0070674_100099952 3300005356 Bacteria 2111
80 Ga0070674_100120634 3300005356 Bacteria 1940
81 Ga0070674_100122838 3300005356 Bacteria 1924
82 Ga0070674_100134190 3300005356 Bacteria 1850
83 Ga0070674_100177652 3300005356 Bacteria 1628
84 Ga0070673_100002709 3300005364 Bacteria 10860
85 Ga0070673_100024349 3300005364 Bacteria 4438
86 Ga0070673_100209931 3300005364 Unclassified 1681
87 Ga0070673_100247929 3300005364 Bacteria 1551
88 Ga0070673_100519781 3300005364 Bacteria 1079
89 Ga0070688_100001469 3300005365 Bacteria 11704
90 Ga0070688_100028770 3300005365 Bacteria 3321
91 Ga0070688_100043186 3300005365 Bacteria 2776
92 Ga0070659_100043100 3300005366 Bacteria 3529
93 Ga0070659_100054719 3300005366 Bacteria 3144
94 Ga0070659_100055807 3300005366 Bacteria 3114
95 Ga0070667_100059563 3300005367 Bacteria 3230
96 Ga0070667_100215783 3300005367 Bacteria 1707
97 Ga0070667_100468684 3300005367 Unclassified 1152
98 Ga0070703_10027150 3300005406 Unclassified 1705
99 Ga0070709_10157666 3300005434 Bacteria 1575
100 Ga0070709_10424685 3300005434 Bacteria 997
101 Ga0070713_100003818 3300005436 Bacteria 9970
102 Ga0070713_100009874 3300005436 Bacteria 6867
103 Ga0070701_10009060 3300005438 Bacteria 4344
104 Ga0070711_100308825 3300005439 Bacteria 1260
105 Ga0070705_100009633 3300005440 Bacteria 4808
106 Ga0070705_100102680 3300005440 Bacteria 1809
107 Ga0070700_100002313 3300005441 Bacteria 9696
108 Ga0070700_100002426 3300005441 Bacteria 9493
109 Ga0070700_100052394 3300005441 Bacteria 2544
110 Ga0070700_100155791 3300005441 Bacteria 1567
111 Ga0070694_100012406 3300005444 Bacteria 5296
112 Ga0070694_100018659 3300005444 Bacteria 4405
113 Ga0070694_100078519 3300005444 Bacteria 2290
114 Ga0070694_100242924 3300005444 Unclassified 1359
115 Ga0070708_100571426 3300005445 Bacteria 1066
116 Ga0070663_100299350 3300005455 Bacteria 1287
117 Ga0070678_100026473 3300005456 Bacteria 3922
118 Ga0070678_100342926 3300005456 Bacteria 1282
119 Ga0070662_100015165 3300005457 Bacteria 5156
120 Ga0070662_100063821 3300005457 Bacteria 2695
121 Ga0070662_100206525 3300005457 Bacteria 1561
122 Ga0070662_100207204 3300005457 Bacteria 1559
123 Ga0070662_100473580 3300005457 Bacteria 1042
124 Ga0070681_10027541 3300005458 Bacteria 5714
125 Ga0070681_10143006 3300005458 Bacteria 2321
126 Ga0068867_100006297 3300005459 Bacteria 8396
127 Ga0068867_100039829 3300005459 Bacteria 3427
128 Ga0068867_100192114 3300005459 Bacteria 1630
129 Ga0068867_100388741 3300005459 Bacteria 1174
130 Ga0070685_10013390 3300005466 Bacteria 4324
131 Ga0070685_10052315 3300005466 Bacteria 2363
132 Ga0070706_100170716 3300005467 Bacteria 2031
133 Ga0070706_100424677 3300005467 Bacteria 1237
134 Ga0070707_100565133 3300005468 Unclassified 1099
135 Ga0070698_100019157 3300005471 Bacteria 7194
136 Ga0070698_100029466 3300005471 Bacteria 5699
137 Ga0070698_100338087 3300005471 Bacteria 1437
138 Ga0070699_100004383 3300005518 Bacteria 12471
139 Ga0070699_100100960 3300005518 Bacteria 2529
140 Ga0070699_100354679 3300005518 Bacteria 1322
141 Ga0070679_100371541 3300005530 Bacteria 1377
142 Ga0070679_100499912 3300005530 Bacteria 1160
143 Ga0070684_100000477 3300005535 Bacteria 27392
144 Ga0070697_100126882 3300005536 Bacteria 2137
145 Ga0070697_100220374 3300005536 Bacteria 1617
146 Ga0070672_100002400 3300005543 Bacteria 11863
147 Ga0070672_100011951 3300005543 Bacteria 6070
148 Ga0070672_100012234 3300005543 Bacteria 6014
149 Ga0070672_100038500 3300005543 Bacteria 3654
150 Ga0070672_100232445 3300005543 Unclassified 1549
151 Ga0070672_100318609 3300005543 Bacteria 1321
152 Ga0070686_100000389 3300005544 Bacteria 28031
153 Ga0070686_100003096 3300005544 Bacteria 9114
154 Ga0070686_100033493 3300005544 Bacteria 3157
155 Ga0070686_100036243 3300005544 Bacteria 3053
156 Ga0070686_100078537 3300005544 Bacteria 2179
157 Ga0070686_100083742 3300005544 Bacteria 2118
158 Ga0070695_100009348 3300005545 Bacteria 5832
159 Ga0070695_100049143 3300005545 Bacteria 2700
160 Ga0070695_100057909 3300005545 Bacteria 2504
161 Ga0070696_100012876 3300005546 Bacteria 5613
162 Ga0070696_100014340 3300005546 Bacteria 5315
163 Ga0070696_100215476 3300005546 Bacteria 1439
164 Ga0070693_100007306 3300005547 Bacteria 5396
165 Ga0070693_100192481 3300005547 Bacteria 1320
166 Ga0070665_100001535 3300005548 Bacteria 26671
167 Ga0070665_100005335 3300005548 Bacteria 13281
168 Ga0070665_100005633 3300005548 Bacteria 12877
169 Ga0070665_100008373 3300005548 Bacteria 10462
170 Ga0070665_100085824 3300005548 Bacteria 3154
171 Ga0070665_100106956 3300005548 Bacteria 2799
172 Ga0070665_100379017 3300005548 Unclassified 1422
173 Ga0070704_100003916 3300005549 Bacteria 8569
174 Ga0070704_100027985 3300005549 Bacteria 3745
175 Ga0070704_100098999 3300005549 Bacteria 2192
176 Ga0070704_100111800 3300005549 Bacteria 2080
177 Ga0070704_100139263 3300005549 Unclassified 1892
178 Ga0070704_100200768 3300005549 Bacteria 1609
179 Ga0070664_100003519 3300005564 Bacteria 12645
180 Ga0070664_100009326 3300005564 Bacteria 7961
181 Ga0070664_100076942 3300005564 Bacteria 2868
182 Ga0070664_100110241 3300005564 Bacteria 2401
183 Ga0070664_100249581 3300005564 Unclassified 1595
184 Ga0070664_100313462 3300005564 Bacteria 1420
185 Ga0070664_100393841 3300005564 Bacteria 1266
186 Ga0068857_100096802 3300005577 Bacteria 2645
187 Ga0068854_100011771 3300005578 Bacteria 5710
188 Ga0070702_100000153 3300005615 Bacteria 21550
189 Ga0070702_100003347 3300005615 Bacteria 7156
190 Ga0068852_100027908 3300005616 Bacteria 4609
191 Ga0068852_100121419 3300005616 Bacteria 2393
192 Ga0068859_100009133 3300005617 Bacteria 10008
193 Ga0068859_100061100 3300005617 Bacteria 3797
194 Ga0068859_100132466 3300005617 Bacteria 2565
195 Ga0068859_100177605 3300005617 Bacteria 2211
196 Ga0068859_100619761 3300005617 Bacteria 1175
197 Ga0068859_100929507 3300005617 Bacteria 954
198 Ga0068864_100073503 3300005618 Bacteria 2981
199 Ga0068864_100112163 3300005618 Bacteria 2430
200 Ga0068864_100463425 3300005618 Bacteria 1214
201 Ga0068864_100568097 3300005618 Bacteria 1098
202 Ga0068866_10065409 3300005718 Bacteria 1902
203 Ga0068866_10090423 3300005718 Unclassified 1666
204 Ga0068866_10111231 3300005718 Bacteria 1529
205 Ga0068861_100009190 3300005719 Bacteria 6816
206 Ga0068861_100083880 3300005719 Bacteria 2500
207 Ga0068861_100130736 3300005719 Bacteria 2037
208 Ga0068861_100154374 3300005719 Bacteria 1887
209 Ga0068861_100182574 3300005719 Unclassified 1748
210 Ga0068861_100200630 3300005719 Bacteria 1674
211 Ga0068861_100376429 3300005719 Bacteria 1253
212 Ga0068870_10000595 3300005840 Bacteria 13754
213 Ga0068863_100017949 3300005841 Bacteria 6771
214 Ga0068863_100032784 3300005841 Bacteria 4949
215 Ga0068863_100088220 3300005841 Bacteria 2939
216 Ga0068863_100148469 3300005841 Bacteria 2243
217 Ga0068863_100394296 3300005841 Bacteria 1353
218 Ga0068858_100001189 3300005842 Bacteria 26942
219 Ga0068858_100017801 3300005842 Bacteria 6652
220 Ga0068858_100019692 3300005842 Bacteria 6309
221 Ga0068858_100027736 3300005842 Bacteria 5261
222 Ga0068858_100190894 3300005842 Bacteria 1936
223 Ga0068858_100227263 3300005842 Bacteria 1768
224 Ga0068858_100452093 3300005842 Bacteria 1238
225 Ga0068858_100466951 3300005842 Bacteria 1217
226 Ga0068858_100489109 3300005842 Unclassified 1188
227 Ga0068860_100041890 3300005843 Bacteria 4375
228 Ga0068860_100045691 3300005843 Bacteria 4176
229 Ga0068860_100084173 3300005843 Bacteria 3025
230 Ga0068860_100246502 3300005843 Bacteria 1739
231 Ga0068860_100291226 3300005843 Bacteria 1598
232 Ga0068862_100021603 3300005844 Bacteria 5381
233 Ga0068862_100035062 3300005844 Bacteria 4247
234 Ga0068862_100039812 3300005844 Bacteria 3994
235 Ga0068862_100075599 3300005844 Bacteria 2913
236 Ga0068862_100153880 3300005844 Bacteria 2048
237 Ga0081455_10032819 3300005937 Bacteria 4673
238 Ga0081455_10073814 3300005937 Bacteria 2819
239 Ga0081455_10291937 3300005937 Bacteria 1173
240 Ga0081539_10000093 3300005985 Bacteria 207314
241 Ga0081539_10001136 3300005985 Bacteria 48290
242 Ga0081539_10003103 3300005985 Bacteria 21299
243 Ga0075365_10002173 3300006038 Bacteria 9441
244 Ga0075365_10021174 3300006038 Bacteria 4051
245 Ga0075365_10056678 3300006038 Bacteria 2605
246 Ga0075365_10112448 3300006038 Bacteria 1873
247 Ga0075368_10020078 3300006042 Bacteria 2527
248 Ga0075368_10024598 3300006042 Bacteria 2307
249 Ga0075368_10028924 3300006042 Bacteria 2142
250 Ga0075368_10088457 3300006042 Bacteria 1266
251 Ga0075363_100127959 3300006048 Bacteria 1423
252 Ga0075363_100238987 3300006048 Bacteria 1044
253 Ga0075364_10009904 3300006051 Bacteria 5733
254 Ga0075364_10023890 3300006051 Bacteria 3874
255 Ga0075364_10103221 3300006051 Bacteria 1899
256 Ga0075364_10160607 3300006051 Bacteria 1517
257 Ga0070715_10201112 3300006163 Bacteria 1012
258 Ga0070716_100110759 3300006173 Bacteria 1701
259 Ga0070712_100131373 3300006175 Bacteria 1898
260 Ga0070712_100505892 3300006175 Bacteria 1013
261 Ga0075362_10003766 3300006177 Bacteria 5366
262 Ga0075367_10060806 3300006178 Bacteria 2253
263 Ga0075367_10066530 3300006178 Bacteria 2159
264 Ga0075367_10101200 3300006178 Bacteria 1762
265 Ga0075367_10112733 3300006178 Bacteria 1670
266 Ga0075366_10021446 3300006195 Bacteria 3754
267 Ga0075366_10039560 3300006195 Bacteria 2788
268 Ga0075366_10081945 3300006195 Bacteria 1928
269 Ga0075366_10148078 3300006195 Bacteria 1421
270 Ga0075366_10210792 3300006195 Unclassified 1183
271 Ga0097621_100001459 3300006237 Bacteria 16171
272 Ga0097621_100005845 3300006237 Bacteria 8690
273 Ga0097621_100025087 3300006237 Bacteria 4662
274 Ga0097621_100050591 3300006237 Bacteria 3379
275 Ga0097621_100065705 3300006237 Bacteria 2986
276 Ga0097621_100099369 3300006237 Bacteria 2446
277 Ga0097621_100155239 3300006237 Bacteria 1964
278 Ga0075370_10002195 3300006353 Bacteria 8964
279 Ga0075370_10023697 3300006353 Bacteria 3383
280 Ga0068871_100002675 3300006358 Bacteria 12162
281 Ga0068871_100005949 3300006358 Bacteria 8586
282 Ga0068871_100010750 3300006358 Bacteria 6694
283 Ga0068871_100022423 3300006358 Bacteria 4866
284 Ga0068871_100169400 3300006358 Unclassified 1871
285 Ga0068871_100231118 3300006358 Bacteria 1605
286 Ga0075428_100000185 3300006844 Bacteria 58526
287 Ga0075428_100001280 3300006844 Bacteria 26808
288 Ga0075428_100004357 3300006844 Bacteria 15615
289 Ga0075428_100012430 3300006844 Bacteria 9470
290 Ga0075428_100121536 3300006844 Unclassified 2844
291 Ga0075428_100158834 3300006844 Bacteria 2454
292 Ga0075428_100215809 3300006844 Bacteria 2073
293 Ga0075430_100003870 3300006846 Bacteria 12607
294 Ga0075430_100144788 3300006846 Bacteria 1979
295 Ga0075430_100417418 3300006846 Bacteria 1107
296 Ga0075431_100004193 3300006847 Bacteria 14107
297 Ga0075431_100007134 3300006847 Bacteria 11102
298 Ga0075431_100021410 3300006847 Bacteria 6611
299 Ga0075431_100025437 3300006847 Bacteria 6067
300 Ga0075431_100054199 3300006847 Bacteria 4135
301 Ga0075433_10006599 3300006852 Bacteria 9186
302 Ga0075433_10006822 3300006852 Bacteria 9050
303 Ga0075433_10021172 3300006852 Bacteria 5449
304 Ga0075433_10045217 3300006852 Bacteria 3827
305 Ga0075433_10243586 3300006852 Bacteria 1596
306 Ga0075433_10244947 3300006852 Bacteria 1591
307 Ga0075433_10422450 3300006852 Bacteria 1176
308 Ga0075434_100000731 3300006871 Bacteria 25794
309 Ga0075434_100002369 3300006871 Bacteria 16520
310 Ga0075434_100018881 3300006871 Bacteria 6665
311 Ga0075434_100111355 3300006871 Bacteria 2748
312 Ga0075434_100213999 3300006871 Bacteria 1947
313 Ga0075434_100275507 3300006871 Bacteria 1702
314 Ga0075434_100281364 3300006871 Bacteria 1683
315 Ga0075434_100436809 3300006871 Bacteria 1330
316 Ga0075434_100694607 3300006871 Unclassified 1035
317 Ga0075429_100004068 3300006880 Bacteria 12535
318 Ga0075429_100005224 3300006880 Bacteria 11168
319 Ga0075429_100005784 3300006880 Bacteria 10672
320 Ga0075429_100037163 3300006880 Bacteria 4239
321 Ga0075429_100143628 3300006880 Bacteria 2089
322 Ga0075429_100271988 3300006880 Bacteria 1484
323 Ga0068865_100005643 3300006881 Bacteria 7595
324 Ga0068865_100109767 3300006881 Bacteria 2033
325 Ga0068865_100187416 3300006881 Bacteria 1597
326 Ga0075436_100001874 3300006914 Bacteria 14448
327 Ga0075436_100020831 3300006914 Bacteria 4498
328 Ga0075436_100029447 3300006914 Bacteria 3776
329 Ga0075436_100043595 3300006914 Bacteria 3093
330 Ga0075436_100070091 3300006914 Bacteria 2423
331 Ga0097620_100009133 3300006931 Bacteria 10008
332 Ga0097620_100061101 3300006931 Bacteria 3797
333 Ga0097620_100132466 3300006931 Bacteria 2565
334 Ga0097620_100177630 3300006931 Bacteria 2211
335 Ga0097620_100619814 3300006931 Bacteria 1175
336 Ga0075435_100000052 3300007076 Bacteria 58955
337 Ga0075435_100000404 3300007076 Bacteria 26487
338 Ga0075435_100007864 3300007076 Bacteria 7627
339 Ga0075435_100014460 3300007076 Bacteria 5899
340 Ga0075435_100015716 3300007076 Bacteria 5694
341 Ga0075435_100046358 3300007076 Bacteria 3486
342 Ga0075435_100065047 3300007076 Bacteria 2964
343 Ga0075435_100114815 3300007076 Bacteria 2241
344 Ga0075435_100155452 3300007076 Bacteria 1924
345 Ga0099794_10258794 3300007265 Bacteria 898
346 Ga0105240_10068347 3300009093 Bacteria 4400
347 Ga0105240_10288659 3300009093 Bacteria 1882
348 Ga0105240_10360668 3300009093 Bacteria 1646
349 Ga0105240_10561917 3300009093 Bacteria 1261
350 Ga0111539_10000160 3300009094 Bacteria 76643
351 Ga0111539_10000270 3300009094 Bacteria 62014
352 Ga0111539_10000324 3300009094 Bacteria 58406
353 Ga0111539_10000602 3300009094 Bacteria 46554
354 Ga0111539_10005052 3300009094 Bacteria 17138
355 Ga0111539_10006977 3300009094 Bacteria 14496
356 Ga0111539_10007299 3300009094 Bacteria 14152
357 Ga0111539_10029312 3300009094 Bacteria 6706
358 Ga0111539_10502604 3300009094 Bacteria 1412
359 Ga0111539_10565095 3300009094 Bacteria 1325
360 Ga0105245_10011551 3300009098 Bacteria 7692
361 Ga0105245_10015209 3300009098 Bacteria 6704
362 Ga0105245_10123419 3300009098 Bacteria 2422
363 Ga0105245_10209428 3300009098 Bacteria 1876
364 Ga0105247_10043414 3300009101 Bacteria 2754
365 Ga0105247_10057544 3300009101 Bacteria 2404
366 Ga0114129_10000307 3300009147 Bacteria 57086
367 Ga0114129_10000371 3300009147 Bacteria 52193
368 Ga0114129_10000408 3300009147 Bacteria 50625
369 Ga0114129_10000789 3300009147 Bacteria 40604
370 Ga0114129_10004725 3300009147 Bacteria 19236
371 Ga0114129_10006465 3300009147 Bacteria 16620
372 Ga0114129_10011453 3300009147 Bacteria 12629
373 Ga0114129_10020006 3300009147 Bacteria 9527
374 Ga0114129_10020472 3300009147 Bacteria 9409
375 Ga0114129_10022026 3300009147 Bacteria 9044
376 Ga0114129_10030915 3300009147 Bacteria 7573
377 Ga0114129_10031216 3300009147 Bacteria 7534
378 Ga0114129_10074121 3300009147 Bacteria 4741
379 Ga0114129_10148326 3300009147 Bacteria 3212
380 Ga0114129_10200198 3300009147 Bacteria 2706
381 Ga0114129_10418583 3300009147 Unclassified 1763
382 Ga0105243_10442003 3300009148 Bacteria 1218
383 Ga0105243_10471200 3300009148 Bacteria 1183
384 Ga0105242_10009242 3300009176 Bacteria 7563
385 Ga0105242_10020681 3300009176 Bacteria 5162
386 Ga0105242_10523736 3300009176 Bacteria 1131
387 Ga0105242_10530069 3300009176 Bacteria 1125
388 Ga0105248_10010543 3300009177 Bacteria 10181
389 Ga0105248_10012969 3300009177 Bacteria 9187
390 Ga0105248_10022913 3300009177 Bacteria 6935
391 Ga0105248_10172186 3300009177 Bacteria 2440
392 Ga0105248_10191287 3300009177 Bacteria 2306
393 Ga0105248_10191801 3300009177 Bacteria 2303
394 Ga0105248_10223161 3300009177 Bacteria 2121
395 Ga0105248_10360339 3300009177 Bacteria 1637
396 Ga0105248_10384033 3300009177 Bacteria 1581
397 Ga0105248_10430608 3300009177 Bacteria 1486
398 Ga0105248_10780467 3300009177 Bacteria 1078
399 Ga0105248_10894066 3300009177 Bacteria 1003
400 Ga0105237_10201661 3300009545 Bacteria 1990
401 Ga0105237_10285526 3300009545 Bacteria 1653
402 Ga0105238_10160440 3300009551 Bacteria 2224
403 Ga0105238_10268597 3300009551 Bacteria 1686
404 Ga0105249_10000566 3300009553 Bacteria 33999
405 Ga0105249_10000918 3300009553 Bacteria 26060
406 Ga0105249_10230538 3300009553 Bacteria 1826
407 Ga0105249_10444465 3300009553 Bacteria 1334
408 Ga0105249_10594646 3300009553 Bacteria 1160
409 Ga0105249_10637468 3300009553 Bacteria 1123
410 Ga0105249_10715971 3300009553 Bacteria 1062
411 Ga0105239_10085300 3300010375 Bacteria 3480
412 Ga0105239_10400230 3300010375 Bacteria 1554
413 Ga0105246_10509033 3300011119 Bacteria 1024
414 Ga0157374_10002073 3300013296 Bacteria 16874
415 Ga0157374_10223806 3300013296 Bacteria 1847
416 Ga0157374_10770819 3300013296 Bacteria 977
417 Ga0157378_10493534 3300013297 Bacteria 1222
418 Ga0157378_11016120 3300013297 Unclassified 864
419 Ga0157372_10695483 3300013307 Bacteria 1183
420 Ga0157372_10794315 3300013307 Bacteria 1100
421 Ga0157372_10926064 3300013307 Bacteria 1011
422 Ga0157375_10103262 3300013308 Bacteria 2937
423 Ga0157375_10149827 3300013308 Bacteria 2467
424 Ga0157375_10268731 3300013308 Bacteria 1867
425 Ga0163163_10000071 3300014325 Bacteria 112778
426 Ga0163163_10078230 3300014325 Bacteria 3303
427 Ga0163163_10117686 3300014325 Bacteria 2689
428 Ga0163163_10120836 3300014325 Bacteria 2653
429 Ga0163163_10417712 3300014325 Bacteria 1400
430 Ga0157380_10035610 3300014326 Bacteria 3845
431 Ga0157380_10037774 3300014326 Bacteria 3744
432 Ga0157380_10069645 3300014326 Bacteria 2840
433 Ga0157380_10197045 3300014326 Bacteria 1784
434 Ga0157377_10001507 3300014745 Bacteria 10096
435 Ga0157377_10096147 3300014745 Bacteria 1757
436 Ga0157379_10016646 3300014968 Bacteria 6465
437 Ga0157379_10033107 3300014968 Bacteria 4608
438 Ga0157379_10033243 3300014968 Bacteria 4600
439 Ga0157379_10040072 3300014968 Bacteria 4180
440 Ga0157379_10069759 3300014968 Bacteria 3144
441 Ga0157379_10145939 3300014968 Unclassified 2134
442 Ga0157379_10398244 3300014968 Bacteria 1265
443 Ga0157376_10013740 3300014969 Bacteria 6053
444 Ga0157376_10019635 3300014969 Bacteria 5214
445 Ga0157376_10034156 3300014969 Bacteria 4104
446 Ga0157376_10036751 3300014969 Bacteria 3970
447 Ga0157376_10139965 3300014969 Bacteria 2170
448 Ga0157376_10160865 3300014969 Bacteria 2035
449 Ga0157376_10371677 3300014969 Bacteria 1374
450 Ga0163161_10044735 3300017792 Unclassified 3190
451 Ga0163161_10167423 3300017792 Bacteria 1679
452 Ga0213876_10297227 3300021384 Bacteria 858
453 Ga0207697_10000081 3300025315 Bacteria 42074
454 Ga0207697_10000859 3300025315 Bacteria 17191
455 Ga0207682_10008568 3300025893 Bacteria 4043
456 Ga0207642_10098770 3300025899 Bacteria 1460
457 Ga0207688_10000175 3300025901 Bacteria 28328
458 Ga0207688_10001748 3300025901 Bacteria 11531
459 Ga0207688_10018656 3300025901 Bacteria 3772
460 Ga0207680_10046274 3300025903 Bacteria 2571
461 Ga0207680_10103540 3300025903 Bacteria 1833
462 Ga0207680_10109081 3300025903 Bacteria 1792
463 Ga0207680_10140434 3300025903 Bacteria 1601
464 Ga0207647_10272875 3300025904 Bacteria 966
465 Ga0207685_10022549 3300025905 Bacteria 2130
466 Ga0207699_10049246 3300025906 Bacteria 2480
467 Ga0207699_10209141 3300025906 Bacteria 1326
468 Ga0207699_10222896 3300025906 Bacteria 1288
469 Ga0207645_10000703 3300025907 Bacteria 27863
470 Ga0207645_10004989 3300025907 Bacteria 9726
471 Ga0207645_10152359 3300025907 Bacteria 1510
472 Ga0207643_10000659 3300025908 Bacteria 21561
473 Ga0207705_10086298 3300025909 Bacteria 2294
474 Ga0207684_10549427 3300025910 Bacteria 988
475 Ga0207654_10210555 3300025911 Bacteria 1284
476 Ga0207707_10083906 3300025912 Bacteria 2782
477 Ga0207707_10097772 3300025912 Bacteria 2566
478 Ga0207707_10101584 3300025912 Bacteria 2514
479 Ga0207695_10018579 3300025913 Bacteria 8032
480 Ga0207695_10177268 3300025913 Bacteria 2053
481 Ga0207695_10317340 3300025913 Bacteria 1448
482 Ga0207693_10154494 3300025915 Bacteria 1805
483 Ga0207693_10310462 3300025915 Bacteria 1235
484 Ga0207660_10304050 3300025917 Bacteria 1270
485 Ga0207662_10004326 3300025918 Bacteria 7460
486 Ga0207662_10020071 3300025918 Bacteria 3811
487 Ga0207662_10096985 3300025918 Bacteria 1822
488 Ga0207662_10242752 3300025918 Bacteria 1180
489 Ga0207657_10006288 3300025919 Bacteria 12343
490 Ga0207657_10017295 3300025919 Bacteria 6920
491 Ga0207649_10005670 3300025920 Bacteria 6761
492 Ga0207649_10099616 3300025920 Bacteria 1920
493 Ga0207649_10147959 3300025920 Bacteria 1614
494 Ga0207652_10062611 3300025921 Unclassified 3215
495 Ga0207652_10211423 3300025921 Bacteria 1746
496 Ga0207652_10279023 3300025921 Bacteria 1507
497 Ga0207646_10082584 3300025922 Bacteria 2873
498 Ga0207646_10149029 3300025922 Bacteria 2109
499 Ga0207646_10390099 3300025922 Bacteria 1258
500 Ga0207681_10012612 3300025923 Bacteria 5217
501 Ga0207681_10025744 3300025923 Bacteria 3787
502 Ga0207681_10029262 3300025923 Bacteria 3576
503 Ga0207681_10059030 3300025923 Bacteria 2629
504 Ga0207681_10146370 3300025923 Bacteria 1765
505 Ga0207681_10165064 3300025923 Bacteria 1673
506 Ga0207694_10098691 3300025924 Bacteria 2313
507 Ga0207650_10011892 3300025925 Bacteria 5997
508 Ga0207650_10012937 3300025925 Bacteria 5769
509 Ga0207650_10019245 3300025925 Bacteria 4794
510 Ga0207650_10028123 3300025925 Bacteria 4029
511 Ga0207650_10446301 3300025925 Bacteria 1076
512 Ga0207659_10000076 3300025926 Bacteria 62373
513 Ga0207659_10068404 3300025926 Bacteria 2583
514 Ga0207659_10071645 3300025926 Bacteria 2531
515 Ga0207659_10146415 3300025926 Bacteria 1840
516 Ga0207687_10008761 3300025927 Bacteria 6612
517 Ga0207687_10009881 3300025927 Bacteria 6247
518 Ga0207687_10015618 3300025927 Bacteria 4981
519 Ga0207687_10133970 3300025927 Bacteria 1871
520 Ga0207700_10009310 3300025928 Bacteria 6130
521 Ga0207700_10058994 3300025928 Bacteria 2901
522 Ga0207644_10017765 3300025931 Bacteria 4809
523 Ga0207644_10291733 3300025931 Bacteria 1312
524 Ga0207690_10078652 3300025932 Unclassified 2296
525 Ga0207690_10096208 3300025932 Bacteria 2105
526 Ga0207690_10103263 3300025932 Bacteria 2040
527 Ga0207706_10000390 3300025933 Bacteria 47471
528 Ga0207706_10110408 3300025933 Bacteria 2419
529 Ga0207706_10155393 3300025933 Bacteria 2012
530 Ga0207706_10175131 3300025933 Bacteria 1885
531 Ga0207706_10227850 3300025933 Bacteria 1631
532 Ga0207686_10004368 3300025934 Bacteria 7578
533 Ga0207686_10036898 3300025934 Bacteria 2946
534 Ga0207686_10061435 3300025934 Bacteria 2382
535 Ga0207686_10347347 3300025934 Bacteria 1116
536 Ga0207709_10121233 3300025935 Bacteria 1766
537 Ga0207709_10461773 3300025935 Bacteria 983
538 Ga0207670_10009139 3300025936 Bacteria 5636
539 Ga0207670_10013055 3300025936 Bacteria 4884
540 Ga0207670_10038538 3300025936 Bacteria 3123
541 Ga0207669_10035712 3300025937 Bacteria 2832
542 Ga0207669_10112105 3300025937 Bacteria 1830
543 Ga0207669_10322452 3300025937 Bacteria 1183
544 Ga0207704_10047884 3300025938 Bacteria 2559
545 Ga0207704_10143113 3300025938 Bacteria 1676
546 Ga0207704_10200631 3300025938 Bacteria 1459
547 Ga0207704_10285283 3300025938 Bacteria 1257
548 Ga0207665_10091023 3300025939 Bacteria 2114
549 Ga0207665_10114905 3300025939 Bacteria 1895
550 Ga0207691_10000697 3300025940 Bacteria 33255
551 Ga0207691_10002569 3300025940 Bacteria 17738
552 Ga0207691_10020421 3300025940 Bacteria 6261
553 Ga0207691_10039583 3300025940 Bacteria 4361
554 Ga0207691_10163529 3300025940 Bacteria 1951
555 Ga0207691_10262368 3300025940 Bacteria 1489
556 Ga0207711_10027843 3300025941 Bacteria 4750
557 Ga0207711_10036296 3300025941 Bacteria 4182
558 Ga0207711_10041623 3300025941 Bacteria 3912
559 Ga0207711_10054644 3300025941 Bacteria 3428
560 Ga0207711_10144198 3300025941 Bacteria 2145
561 Ga0207711_10326840 3300025941 Bacteria 1418
562 Ga0207689_10000944 3300025942 Bacteria 27922
563 Ga0207689_10067247 3300025942 Bacteria 2945
564 Ga0207689_10086106 3300025942 Bacteria 2583
565 Ga0207689_10113331 3300025942 Bacteria 2229
566 Ga0207689_10389015 3300025942 Unclassified 1162
567 Ga0207661_10003683 3300025944 Bacteria 10680
568 Ga0207661_10061119 3300025944 Bacteria 3043
569 Ga0207679_10005900 3300025945 Bacteria 7703
570 Ga0207679_10043847 3300025945 Bacteria 3224
571 Ga0207679_10070629 3300025945 Bacteria 2631
572 Ga0207679_10279712 3300025945 Bacteria 1431
573 Ga0207679_10532296 3300025945 Bacteria 1052
574 Ga0207679_10584383 3300025945 Bacteria 1005
575 Ga0207679_10601693 3300025945 Bacteria 991
576 Ga0207667_10197969 3300025949 Bacteria 2061
577 Ga0207667_10303444 3300025949 Bacteria 1631
578 Ga0207651_10094385 3300025960 Bacteria 2199
579 Ga0207651_10111545 3300025960 Bacteria 2054
580 Ga0207651_10193448 3300025960 Bacteria 1624
581 Ga0207651_10331209 3300025960 Bacteria 1276
582 Ga0207712_10004445 3300025961 Bacteria 8855
583 Ga0207712_10112409 3300025961 Bacteria 2045
584 Ga0207668_10556849 3300025972 Unclassified 994
585 Ga0207640_10014136 3300025981 Bacteria 4589
586 Ga0207640_10135048 3300025981 Bacteria 1789
587 Ga0207658_10160739 3300025986 Bacteria 1841
588 Ga0207658_10169872 3300025986 Unclassified 1796
589 Ga0207658_10207407 3300025986 Bacteria 1640
590 Ga0207677_10022830 3300026023 Bacteria 3852
591 Ga0207677_10254720 3300026023 Bacteria 1427
592 Ga0207677_10322929 3300026023 Bacteria 1283
593 Ga0207703_10010663 3300026035 Bacteria 7178
594 Ga0207703_10021021 3300026035 Bacteria 5107
595 Ga0207703_10029019 3300026035 Bacteria 4364
596 Ga0207703_10459459 3300026035 Unclassified 1191
597 Ga0207678_10065926 3300026067 Bacteria 3109
598 Ga0207678_10281377 3300026067 Bacteria 1428
599 Ga0207708_10011104 3300026075 Bacteria 6698
600 Ga0207708_10014977 3300026075 Bacteria 5810
601 Ga0207708_10040632 3300026075 Bacteria 3545
602 Ga0207708_10072715 3300026075 Bacteria 2635
603 Ga0207708_10078829 3300026075 Bacteria 2530
604 Ga0207641_10002582 3300026088 Bacteria 16638
605 Ga0207641_10062303 3300026088 Bacteria 3182
606 Ga0207641_10374948 3300026088 Bacteria 1361
607 Ga0207641_10428486 3300026088 Bacteria 1275
608 Ga0207648_10021176 3300026089 Bacteria 5846
609 Ga0207648_10027253 3300026089 Bacteria 5075
610 Ga0207648_10042395 3300026089 Bacteria 3994
611 Ga0207648_10115208 3300026089 Bacteria 2362
612 Ga0207676_10074204 3300026095 Bacteria 2740
613 Ga0207676_10142786 3300026095 Bacteria 2052
614 Ga0207674_10097183 3300026116 Bacteria 2929
615 Ga0207675_100012476 3300026118 Bacteria 7937
616 Ga0207675_100028140 3300026118 Bacteria 5233
617 Ga0207675_100039984 3300026118 Bacteria 4376
618 Ga0207675_100062193 3300026118 Bacteria 3486
619 Ga0207675_100081642 3300026118 Bacteria 3031
620 Ga0207675_100118864 3300026118 Bacteria 2499
621 Ga0207675_100255325 3300026118 Bacteria 1698
622 Ga0207675_100321225 3300026118 Bacteria 1511
623 Ga0207683_10016293 3300026121 Bacteria 6325
624 Ga0207683_10026021 3300026121 Bacteria 5053
625 Ga0207683_10027273 3300026121 Bacteria 4936
626 Ga0207683_10289932 3300026121 Bacteria 1496
627 Ga0207698_10056713 3300026142 Bacteria 3026
628 Ga0207698_10091757 3300026142 Bacteria 2487
629 Ga0207698_10520351 3300026142 Bacteria 1161
630 Ga0210002_1020821 3300027617 Bacteria 1058
631 Ga0209813_10023393 3300027866 Bacteria 1757
632 Ga0209813_10061765 3300027866 Unclassified 1197
633 Ga0209813_10164781 3300027866 Bacteria 802
634 Ga0207428_10000234 3300027907 Bacteria 76592
635 Ga0207428_10002148 3300027907 Bacteria 19811
636 Ga0207428_10003192 3300027907 Bacteria 16044
637 Ga0207428_10004284 3300027907 Bacteria 13648
638 Ga0207428_10006859 3300027907 Bacteria 10436
639 Ga0207428_10043674 3300027907 Bacteria 3619
640 Ga0207428_10084691 3300027907 Bacteria 2470
641 Ga0268266_10003216 3300028379 Bacteria 16509
642 Ga0268266_10018204 3300028379 Bacteria 5989
643 Ga0268266_10061556 3300028379 Bacteria 3237
644 Ga0268266_10177379 3300028379 Bacteria 1938
645 Ga0268266_10178464 3300028379 Bacteria 1932
646 Ga0268265_10010002 3300028380 Bacteria 6404
647 Ga0268265_10016423 3300028380 Bacteria 5085
648 Ga0268265_10045899 3300028380 Bacteria 3263
649 Ga0268265_10254066 3300028380 Bacteria 1559
650 Ga0268265_10488479 3300028380 Bacteria 1158
651 Ga0268264_10351211 3300028381 Bacteria 1404
652 Ga0268264_10789036 3300028381 Bacteria 948
653 Ga0307408_100033103 3300031548 Bacteria 3608
654 Ga0307408_100070154 3300031548 Bacteria 2586
655 Ga0307408_100076075 3300031548 Bacteria 2496
656 Ga0307408_100377185 3300031548 Bacteria 1211
657 Ga0316579_10011360 3300031691 Bacteria 3783
658 Ga0307405_10022391 3300031731 Bacteria 3572
659 Ga0307405_10081961 3300031731 Bacteria 2110
660 Ga0307405_10627299 3300031731 Unclassified 881
661 Ga0316577_10000194 3300031733 Bacteria 20273
662 Ga0316577_10004072 3300031733 Bacteria 7491
663 Ga0307413_10010814 3300031824 Bacteria 4450
664 Ga0307413_10050111 3300031824 Bacteria 2507
665 Ga0307413_10068850 3300031824 Bacteria 2219
666 Ga0307413_10069376 3300031824 Bacteria 2212
667 Ga0307413_10073723 3300031824 Bacteria 2159
668 Ga0307406_10021479 3300031901 Bacteria 3818
669 Ga0307406_10335548 3300031901 Bacteria 1175
670 Ga0307407_10002148 3300031903 Bacteria 7581
671 Ga0307412_10028114 3300031911 Bacteria 3514
672 Ga0307412_10371039 3300031911 Bacteria 1155
673 Ga0307412_10550212 3300031911 Bacteria 969
674 Ga0307409_100006545 3300031995 Bacteria 6861
675 Ga0307409_100038377 3300031995 Bacteria 3542
676 Ga0307409_100207498 3300031995 Bacteria 1758
677 Ga0307416_100018870 3300032002 Bacteria 4874
678 Ga0307416_100034559 3300032002 Bacteria 3848
679 Ga0307416_100072405 3300032002 Bacteria 2868
680 Ga0307416_100184566 3300032002 Bacteria 1959
681 Ga0307416_100318293 3300032002 Bacteria 1556
682 Ga0307414_10031537 3300032004 Bacteria 3478
683 Ga0307414_10112709 3300032004 Bacteria 2074
684 Ga0307411_10041048 3300032005 Bacteria 2941
685 Ga0307411_10059648 3300032005 Bacteria 2530
686 Ga0307411_10121440 3300032005 Bacteria 1891
687 Ga0307415_100020627 3300032126 Bacteria 4028
688 Ga0307415_100060077 3300032126 Bacteria 2625
689 Ga0373930_0000070 3300034816 Bacteria 9941
690 Ga0373948_0000676 3300034817 Bacteria 4431
691 Ga0373950_0003893 3300034818 Bacteria 2165
692 Ga0373958_0006887 3300034819 Bacteria 1789
693 Ga0373938_0001388 3300034957 Bacteria 3874
694 Ga0373926_0037133 3300035083 Bacteria 1732
695 Ga0373926_0074564 3300035083 Bacteria 1250
696 Ga0373928_0008320 3300035084 Bacteria 2012
697 Ga0373929_0003681 3300035085 Bacteria 2753
698 Ga0373934_0000325 3300035086 Bacteria 16805
699 Ga0373934_0086123 3300035086 Bacteria 1264
700 Ga0373949_0000540 3300035090 Bacteria 12471
701 Ga0373952_0001255 3300035092 Bacteria 4629
702 Ga0373932_0003989 3300035112 Bacteria 3515
703 Ga0373936_0044519 3300035113 Bacteria 1786
704 Ga0373936_0066437 3300035113 Bacteria 1481
705 Ga0373953_0025499 3300035117 Bacteria 2259
706 Ga0373954_0189699 3300035118 Bacteria 1009
707 Ga0373956_0009905 3300035119 Bacteria 3885
708 Ga0373957_0007056 3300035120 Bacteria 3573
709 Ga0373960_0000470 3300035121 Bacteria 7983
710 Ga0373943_0054183 3300035170 Bacteria 1983
711 Ga0373943_0227867 3300035170 Bacteria 1040
712 Ga0373955_0058876 3300035172 Bacteria 2114
713 Ga0373942_0000397 3300035207 Bacteria 12081
714 Ga0373961_0011080 3300035241 Bacteria 2234
715 Ga0373962_0090827 3300035242 Bacteria 940
716 Ga0373931_0000745 3300035691 Bacteria 13573
717 Ga0373935_0442684 3300035692 Bacteria 938
718 Ga0373933_0005577 3300035724 Bacteria 6858
719 Ga0373947_0203923 3300035725 Bacteria 1295
720 Ga0373947_0263588 3300035725 Bacteria 1142
721 Ga0373937_0000553 3300036401 Bacteria 33171
722 Ga0373937_0005022 3300036401 Bacteria 11259
723 Ga0373937_0114119 3300036401 Bacteria 2514
724 Ga0373937_0439337 3300036401 Bacteria 1239
725 Ga0373937_0726072 3300036401 Bacteria 940
726 Ga0373937_0797426 3300036401 Unclassified 892
727 Ga0316584_0006761 3300036712 Bacteria 7780
728 Ga0373925_0001772 3300037068 Bacteria 18014
729 Ga0373925_0036314 3300037068 Bacteria 3637
730 Ga0373925_0079081 3300037068 Bacteria 2498
731 Ga0373925_0290622 3300037068 Bacteria 1318
732 Ga0395898_0713306 3300037466 Bacteria 945
733 Ga0436365_0346005 3300039437 Bacteria 2732
734 Ga0436365_1288414 3300039437 Bacteria 1532
735 Ga0439461_0012567 3300041410 Unclassified 1587
736 Ga0451807_2029552 3300041486 Bacteria 1224
737 Ga0439431_0072600 3300041997 Bacteria 919
738 Ga0439450_018574 3300042008 Bacteria 1462
739 Ga0439456_014218 3300042013 Unclassified 1660
740 Ga0450894_010868 3300042131 Unclassified 1184
741 Ga0450907_035473 3300042146 Bacteria 851
742 Ga0439446_0079516 3300042156 Bacteria 1014
743 Ga0439435_0001535 3300042436 Bacteria 4306
744 Ga0439435_0020723 3300042436 Bacteria 1699
745 Ga0439435_0022221 3300042436 Bacteria 1654
746 Ga0450916_003120 3300042530 Bacteria 1803
747 Ga0451577_0136756 3300042876 Bacteria 2200
748 Ga0439440_0085735 3300042993 Bacteria 839
749 Ga0466963_0048074 3300044694 Bacteria 2817
750 Ga0453684_0025392 3300044712 Bacteria 8605
751 Ga0453684_0373285 3300044712 Bacteria 1603
752 Ga0451576_0035534 3300045051 Bacteria 5285
753 Ga0451576_0042362 3300045051 Bacteria 4806
754 Ga0451576_0548526 3300045051 Bacteria 1214
755 Ga0466967_0096933 3300045976 Bacteria 2691
756 Ga0495603_0049212 3300046455 Bacteria 2509
757 Ga0495629_0030437 3300046459 Bacteria 3827
758 Ga0495638_0013639 3300046460 Bacteria 5521
759 Ga0495639_0037509 3300046475 Bacteria 2173
760 Ga0495662_0095080 3300046476 Bacteria 1456
761 Ga0495664_0067363 3300046477 Bacteria 2136
762 Ga0495585_0179655 3300046492 Bacteria 1089
763 Ga0495608_0003061 3300046511 Bacteria 11950
764 Ga0495608_0275665 3300046511 Bacteria 1045
765 Ga0495630_0118626 3300046517 Bacteria 2007
766 Ga0495652_0486175 3300046529 Bacteria 858
767 Ga0495640_0081969 3300046533 Bacteria 2144
768 Ga0495640_0093234 3300046533 Bacteria 1985
769 Ga0495640_0141495 3300046533 Bacteria 1551
770 Ga0495586_0040346 3300046535 Bacteria 2511
771 Ga0495586_0059180 3300046535 Bacteria 2082
772 Ga0495586_0089745 3300046535 Bacteria 1697
773 Ga0495587_0115829 3300046536 Bacteria 1537
774 Ga0495621_0042273 3300046539 Bacteria 1604
775 Ga0495645_0000493 3300046543 Bacteria 27347
776 Ga0495645_0064996 3300046543 Bacteria 2639
777 Ga0495667_0057927 3300046559 Bacteria 2546
778 Ga0495667_0184322 3300046559 Bacteria 1339
779 Ga0495656_0104328 3300046615 Bacteria 1316
780 Ga0495634_0117202 3300046642 Bacteria 1708
781 Ga0495635_0024299 3300046663 Bacteria 4225
782 Ga0495659_0113823 3300046664 Bacteria 1059
783 Ga0495659_0170848 3300046664 Bacteria 882
784 Ga0495599_0188446 3300046678 Bacteria 1270
785 Ga0495599_0272201 3300046678 Bacteria 1027
786 Ga0495658_0004399 3300046683 Bacteria 6939
787 Ga0495658_0105882 3300046683 Bacteria 1685
788 Ga0495669_0038208 3300046684 Bacteria 2126
789 Ga0495669_0042899 3300046684 Bacteria 2012
790 Ga0495613_0001719 3300046689 Bacteria 16660
791 Ga0495613_0101747 3300046689 Bacteria 2075
792 Ga0495604_0022772 3300047317 Bacteria 5001
793 Ga0495674_0046339 3300047319 Bacteria 3859
794 Ga0495674_0158143 3300047319 Bacteria 1897
795 Ga0495684_0009207 3300047471 Bacteria 7622
796 Ga0495684_0067641 3300047471 Bacteria 2717
797 Ga0495684_0249527 3300047471 Bacteria 1292
798 Ga0495602_0361434 3300048088 Bacteria 1045
799 Ga0496100_0132319 3300048903 Bacteria 1758
800 Ga0496100_0247776 3300048903 Bacteria 1317
801 Ga0496100_0478889 3300048903 Unclassified 957
802 Ga0496101_0625379 3300048904 Bacteria 851
803 Ga0496102_0021815 3300048905 Bacteria 5668
804 Ga0496102_0073068 3300048905 Bacteria 3152
805 Ga0496104_0013818 3300048907 Bacteria 7283
806 Ga0496104_0218180 3300048907 Bacteria 1820
807 Ga0496104_0287220 3300048907 Bacteria 1557
808 Ga0496105_0066693 3300048908 Bacteria 2972
809 Ga0496106_0034476 3300048909 Bacteria 3780
810 Ga0496106_0056067 3300048909 Bacteria 2979
811 Ga0496106_0342601 3300048909 Bacteria 1200
812 Ga0496107_0053451 3300048910 Bacteria 2914
813 Ga0496107_0071330 3300048910 Bacteria 2524
814 Ga0496107_0482300 3300048910 Bacteria 920
815 Ga0496108_0030694 3300048911 Bacteria 4453
816 Ga0496108_0722470 3300048911 Bacteria 863
817 Ga0496109_0001850 3300048912 Bacteria 17524
818 Ga0496109_0078971 3300048912 Bacteria 3031
819 Ga0496109_0243409 3300048912 Bacteria 1693
820 Ga0496109_0298694 3300048912 Bacteria 1518
821 Ga0496109_0499969 3300048912 Bacteria 1148
822 Ga0496109_0530493 3300048912 Bacteria 1111
823 Ga0496110_0000816 3300048913 Bacteria 21833
824 Ga0496110_0051930 3300048913 Bacteria 3603
825 Ga0496110_0083633 3300048913 Bacteria 2848
826 Ga0496110_0102383 3300048913 Bacteria 2568
827 Ga0496110_0242235 3300048913 Bacteria 1641
828 Ga0496111_0065210 3300048914 Bacteria 2643
829 Ga0496112_0000213 3300048915 Bacteria 37294
830 Ga0496112_0056169 3300048915 Bacteria 3874
831 Ga0496112_0147704 3300048915 Bacteria 2319
832 Ga0496112_0282732 3300048915 Unclassified 1606
833 Ga0496114_0011050 3300048917 Bacteria 7203
834 Ga0496114_0205653 3300048917 Bacteria 1725
835 Ga0496114_0561672 3300048917 Bacteria 1008
836 Ga0496115_0107242 3300048918 Bacteria 2293
837 Ga0501031_0002515 3300049568 Bacteria 11674
838 Ga0501032_0015836 3300049569 Bacteria 5316
839 Ga0501032_0049435 3300049569 Bacteria 2836
840 Ga0501033_0002780 3300049570 Bacteria 14670
841 Ga0501033_0003873 3300049570 Bacteria 12164
842 Ga0501033_0014866 3300049570 Bacteria 5909
843 Ga0501034_0006315 3300049571 Bacteria 12760
844 Ga0501034_0031709 3300049571 Bacteria 5367
845 Ga0501034_0247710 3300049571 Bacteria 1726
846 Ga0501036_0102611 3300049572 Bacteria 2419
847 Ga0501036_0164319 3300049572 Bacteria 1871
848 Ga0501036_0338364 3300049572 Bacteria 1257
849 Ga0501036_0414503 3300049572 Bacteria 1123
850 Ga0501037_0008778 3300049573 Bacteria 7411
851 Ga0501037_0023091 3300049573 Bacteria 4600
852 Ga0501037_0422825 3300049573 Unclassified 912
853 Ga0501038_0020228 3300049574 Bacteria 5988
854 Ga0501038_0026332 3300049574 Bacteria 5179
855 Ga0501038_0082816 3300049574 Bacteria 2701
856 Ga0501038_0255775 3300049574 Bacteria 1386
857 Ga0501039_0022659 3300049575 Bacteria 4820
858 Ga0501039_0037595 3300049575 Bacteria 3737
859 Ga0501039_0093667 3300049575 Bacteria 2341
860 Ga0501040_0000223 3300049576 Bacteria 33236
861 Ga0501040_0081272 3300049576 Bacteria 2246
862 Ga0501040_0129628 3300049576 Bacteria 1773
863 Ga0501040_0280960 3300049576 Bacteria 1189
864 Ga0501041_0014294 3300049577 Bacteria 4713
865 Ga0501041_0068736 3300049577 Bacteria 2172
866 Ga0501042_0001934 3300049578 Bacteria 12467
867 Ga0501042_0002776 3300049578 Bacteria 10822
868 Ga0501042_0049600 3300049578 Bacteria 2995
869 Ga0501042_0103070 3300049578 Bacteria 2053
870 Ga0501043_0021725 3300049579 Bacteria 5031
871 Ga0501043_0138562 3300049579 Bacteria 1905
872 Ga0501046_0009389 3300049580 Bacteria 8456
873 Ga0501046_0054027 3300049580 Bacteria 3161
874 Ga0501046_0151794 3300049580 Bacteria 1747
875 Ga0501046_0206681 3300049580 Bacteria 1459
876 Ga0501046_0290789 3300049580 Bacteria 1195
877 Ga0501047_0112880 3300049581 Bacteria 2599
878 Ga0501047_0250521 3300049581 Bacteria 1619
879 Ga0501047_0375021 3300049581 Bacteria 1257
880 Ga0501048_0005408 3300049582 Bacteria 9710
881 Ga0501048_0053807 3300049582 Bacteria 2860
882 Ga0501048_0066877 3300049582 Bacteria 2540
883 Ga0501067_0023005 3300049583 Bacteria 3451
884 Ga0501068_0032487 3300049584 Bacteria 3104
885 Ga0501068_0082430 3300049584 Bacteria 1975
886 Ga0501069_0000964 3300049585 Bacteria 13706
887 Ga0501069_0004730 3300049585 Bacteria 7041
888 Ga0501070_0023127 3300049586 Bacteria 5205
889 Ga0501070_0055421 3300049586 Bacteria 3285
890 Ga0501070_0088768 3300049586 Bacteria 2558
891 Ga0501071_0001640 3300049587 Bacteria 13148
892 Ga0501071_0001811 3300049587 Bacteria 12650
893 Ga0501071_0011572 3300049587 Bacteria 5953
894 Ga0501072_0024980 3300049588 Bacteria 4652
895 Ga0501072_0034747 3300049588 Bacteria 3950
896 Ga0501072_0115505 3300049588 Bacteria 2137
897 Ga0501072_0131369 3300049588 Bacteria 1996
898 Ga0501072_0134566 3300049588 Bacteria 1971
899 Ga0501072_0164277 3300049588 Bacteria 1771
900 Ga0501072_0234440 3300049588 Bacteria 1462
901 Ga0501073_0004945 3300049589 Bacteria 10002
902 Ga0501073_0014655 3300049589 Bacteria 5695
903 Ga0501073_0043654 3300049589 Bacteria 3161
904 Ga0501074_0001614 3300049590 Bacteria 15271
905 Ga0501074_0025661 3300049590 Bacteria 4277
906 Ga0501074_0089372 3300049590 Bacteria 2206
907 Ga0501074_0181189 3300049590 Bacteria 1503
908 Ga0501075_0026333 3300049591 Bacteria 4280
909 Ga0501075_0073753 3300049591 Bacteria 2581
910 Ga0501075_0223555 3300049591 Bacteria 1436
911 Ga0501075_0282833 3300049591 Bacteria 1264
912 Ga0501076_0000179 3300049592 Bacteria 37508
913 Ga0501076_0041119 3300049592 Bacteria 3635
914 Ga0501076_0055225 3300049592 Bacteria 3150
915 Ga0501076_0206354 3300049592 Bacteria 1605
916 Ga0501077_0223001 3300049593 Bacteria 1198
917 Ga0501208_038827 3300049655 Bacteria 873
918 Ga0501079_0003374 3300049741 Bacteria 11714
919 Ga0501079_0031287 3300049741 Bacteria 4090
920 Ga0501079_0042597 3300049741 Bacteria 3505
921 Ga0501079_0062463 3300049741 Bacteria 2873
922 Ga0501079_0141184 3300049741 Bacteria 1876
923 Ga0501080_0014909 3300049742 Bacteria 7155
924 Ga0501080_0042829 3300049742 Bacteria 4214
925 Ga0501080_0086788 3300049742 Bacteria 2908
926 Ga0501080_0139375 3300049742 Bacteria 2243
927 Ga0501080_0149046 3300049742 Bacteria 2163
928 Ga0501080_0177556 3300049742 Bacteria 1961
929 Ga0501080_0319617 3300049742 Bacteria 1405
930 Ga0501081_0039608 3300049743 Bacteria 3226
931 Ga0501081_0075487 3300049743 Bacteria 2353
932 Ga0501081_0156342 3300049743 Bacteria 1641
933 Ga0501081_0224346 3300049743 Bacteria 1367
934 Ga0501081_0305100 3300049743 Bacteria 1168
935 Ga0501083_0001360 3300049744 Bacteria 16618
936 Ga0501083_0016462 3300049744 Bacteria 5175
937 Ga0501268_023860 3300049765 Bacteria 1065
938 Ga0501035_0062886 3300049822 Bacteria 3302
939 Ga0501035_0063294 3300049822 Bacteria 3290
940 Ga0501035_0103723 3300049822 Bacteria 2494
941 Ga0501044_0039726 3300049823 Bacteria 4906
942 Ga0501044_0077632 3300049823 Bacteria 3367
943 Ga0501044_0431108 3300049823 Bacteria 1227
944 Ga0501045_0004268 3300049824 Bacteria 9856
945 Ga0501045_0008879 3300049824 Bacteria 7017
946 Ga0501045_0030459 3300049824 Bacteria 3906
947 Ga0501045_0168103 3300049824 Bacteria 1633
948 nmdc:mga03n38_132118_c1 3300050490 Unclassified 1238
949 nmdc:mga00v17_123503_c1 3300050491 Bacteria 1650
950 nmdc:mga00v17_169997_c1 3300050491 Bacteria 1405
951 nmdc:mga00v17_36260_c1 3300050491 Bacteria 2939
952 nmdc:mga00v17_37918_c1 3300050491 Bacteria 2880
953 nmdc:mga00v17_77713_c1 3300050491 Bacteria 2067
954 nmdc:mga0yw44_1474_c1 3300050492 Bacteria 9375
955 nmdc:mga0yw44_40858_c1 3300050492 Bacteria 2758
956 nmdc:mga0k408_108153_c1 3300050493 Unclassified 1642
957 nmdc:mga0k408_114457_c1 3300050493 Bacteria 1595
958 nmdc:mga0k408_120668_c1 3300050493 Bacteria 1552
959 nmdc:mga0k408_138873_c1 3300050493 Bacteria 1445
960 nmdc:mga0k408_18006_c1 3300050493 Bacteria 3938
961 nmdc:mga0k408_22366_c1 3300050493 Bacteria 3560
962 nmdc:mga0k408_31950_c1 3300050493 Bacteria 3008
963 nmdc:mga06z11_12999_c1 3300050494 Bacteria 3639
964 nmdc:mga06z11_142380_c1 3300050494 Bacteria 1357
965 nmdc:mga06z11_61714_c1 3300050494 Bacteria 1956
966 nmdc:mga06z11_9003_c1 3300050494 Bacteria 4192
967 nmdc:mga04h51_11635_c1 3300050495 Bacteria 2448
968 nmdc:mga07m45_25880_c1 3300050496 Bacteria 3222
969 nmdc:mga05p37_120572_c1 3300050507 Bacteria 3222
970 nmdc:mga05p37_158217_c1 3300050507 Bacteria 2768
971 nmdc:mga05p37_16784_c1 3300050507 Bacteria 8827
972 nmdc:mga05p37_18019_c1 3300050507 Bacteria 8529
973 nmdc:mga05p37_18668_c1 3300050507 Bacteria 8381
974 nmdc:mga05p37_187985_c1 3300050507 Bacteria 2510
975 nmdc:mga05p37_34620_c1 3300050507 Bacteria 6187
976 nmdc:mga05p37_4675_c1 3300050507 Bacteria 16005
977 nmdc:mga05p37_53467_c1 3300050507 Bacteria 4966
978 nmdc:mga05p37_625_c1 3300050507 Bacteria 19207
979 nmdc:mga05p37_6700_c1 3300050507 Bacteria 13572
980 nmdc:mga05p37_78381_c1 3300050507 Bacteria 4068
981 nmdc:mga05p37_83417_c1 3300050507 Bacteria 3937
982 nmdc:mga09592_15209_c1 3300050508 Bacteria 6288
983 nmdc:mga09592_208948_c1 3300050508 Bacteria 1691
984 nmdc:mga09592_219_c1 3300050508 Bacteria 41151
985 nmdc:mga09592_400072_c1 3300050508 Bacteria 1187
986 nmdc:mga09592_7566_c1 3300050508 Bacteria 8836
987 nmdc:mga09592_938_c1 3300050508 Bacteria 14168
988 nmdc:mga0qj67_101128_c1 3300050509 Bacteria 2324
989 nmdc:mga0qj67_402_c1 3300050509 Bacteria 29827
990 nmdc:mga0qj67_63675_c1 3300050509 Bacteria 2932
991 nmdc:mga0qj67_73854_c1 3300050509 Bacteria 2724
992 nmdc:mga06r32_117891_c1 3300050510 Bacteria 2617
993 nmdc:mga06r32_1407_c1 3300050510 Bacteria 21715
994 nmdc:mga06r32_160741_c1 3300050510 Bacteria 2229
995 nmdc:mga06r32_166506_c1 3300050510 Bacteria 2187
996 nmdc:mga06r32_44908_c1 3300050510 Bacteria 4210
997 nmdc:mga06r32_456902_c1 3300050510 Unclassified 1256
998 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
999 nmdc:mga08y16_16069_c1 3300050511 Bacteria 7871
1000 nmdc:mga08y16_2467_c1 3300050511 Bacteria 18993
1001 nmdc:mga08y16_2484_c1 3300050511 Bacteria 18944
1002 nmdc:mga08y16_26035_c1 3300050511 Bacteria 6170
1003 nmdc:mga08y16_262798_c1 3300050511 Bacteria 1782
1004 nmdc:mga08y16_3210_c1 3300050511 Bacteria 16913
1005 nmdc:mga08y16_71377_c1 3300050511 Bacteria 3619
1006 nmdc:mga08y16_882_c1 3300050511 Bacteria 28902
1007 nmdc:mga08y16_99013_c1 3300050511 Bacteria 3036
1008 nmdc:mga0n895_101653_c1 3300050512 Bacteria 2885
1009 nmdc:mga0n895_106475_c1 3300050512 Bacteria 2817
1010 nmdc:mga0n895_141627_c1 3300050512 Bacteria 2433
1011 nmdc:mga0n895_160540_c1 3300050512 Bacteria 2279
1012 nmdc:mga0n895_195895_c1 3300050512 Bacteria 2052
1013 nmdc:mga0n895_200951_c1 3300050512 Bacteria 2024
1014 nmdc:mga0n895_263215_c1 3300050512 Bacteria 1750
1015 nmdc:mga0n895_309694_c1 3300050512 Bacteria 1600
1016 nmdc:mga0n895_3430_c1 3300050512 Bacteria 12790
1017 nmdc:mga0n895_374297_c1 3300050512 Bacteria 1441
1018 nmdc:mga0n895_541518_c1 3300050512 Unclassified 1170
1019 nmdc:mga0n895_8_c1 3300050512 Bacteria 121439
1020 nmdc:mga0n895_96264_c1 3300050512 Bacteria 2965
1021 nmdc:mga0rr50_10032_c1 3300050513 Bacteria 5993
1022 nmdc:mga0rr50_178195_c1 3300050513 Bacteria 1736
1023 nmdc:mga0rr50_23725_c1 3300050513 Bacteria 4237
1024 nmdc:mga0rr50_23_c1 3300050513 Bacteria 116800
1025 nmdc:mga0rr50_34425_c1 3300050513 Bacteria 3627
1026 nmdc:mga0rr50_378594_c1 3300050513 Bacteria 1193
1027 nmdc:mga0rr50_46504_c1 3300050513 Bacteria 3196
1028 nmdc:mga0rr50_618_c1 3300050513 Bacteria 19051
1029 nmdc:mga0rr50_8578_c1 3300050513 Bacteria 6370
1030 nmdc:mga08x19_12493_c1 3300050514 Bacteria 5119
1031 nmdc:mga08x19_165_c1 3300050514 Bacteria 54991
1032 nmdc:mga08x19_9112_c1 3300050514 Bacteria 5925
1033 nmdc:mga0a205_10903_c1 3300050515 Bacteria 8361
1034 nmdc:mga0a205_133545_c1 3300050515 Bacteria 2382
1035 nmdc:mga0a205_148156_c1 3300050515 Bacteria 2247
1036 nmdc:mga0a205_17695_c1 3300050515 Bacteria 6689
1037 nmdc:mga0a205_22816_c1 3300050515 Bacteria 5933
1038 nmdc:mga0a205_255972_c2 3300050515 Unclassified 852
1039 nmdc:mga0a205_260003_c1 3300050515 Bacteria 1614
1040 nmdc:mga0a205_318074_c1 3300050515 Bacteria 1428
1041 nmdc:mga0a205_333706_c1 3300050515 Bacteria 1386
1042 nmdc:mga0a205_335444_c1 3300050515 Bacteria 1381
1043 nmdc:mga0a205_95171_c1 3300050515 Bacteria 2877
1044 Ga0495601_0186242 3300053077 Bacteria 1357
1045 Ga0495595_0047011 3300053084 Bacteria 1990
1046 Ga0495619_0011947 3300053085 Bacteria 5470
1047 Ga0495619_0070915 3300053085 Bacteria 2331
1048 Ga0495619_0081256 3300053085 Bacteria 2182
1049 Ga0495619_0121901 3300053085 Bacteria 1788
1050 Ga0495619_0134584 3300053085 Bacteria 1699
1051 Ga0495619_0307266 3300053085 Bacteria 1098
1052 Ga0500555_017379 3300053103 Bacteria 2073
1053 Ga0500592_017836 3300053116 Bacteria 1140
1054 Ga0500628_023188 3300053129 Bacteria 1277
1055 Ga0500616_0007973 3300053153 Bacteria 6647
1056 Ga0500645_006429 3300053730 Bacteria 4195
1057 Ga0501084_0000669 3300054114 Bacteria 26157
1058 Ga0501084_0037923 3300054114 Bacteria 4028
1059 Ga0501084_0037950 3300054114 Bacteria 4026
1060 Ga0501084_0052591 3300054114 Bacteria 3407
1061 Ga0501084_0125809 3300054114 Bacteria 2157
1062 Ga0501084_0182581 3300054114 Bacteria 1771
1063 Ga0501084_0267489 3300054114 Bacteria 1443
1064 Ga0590071_000286 3300059421 Bacteria 14746
1065 Ga0590071_000443 3300059421 Bacteria 12027
1066 Ga0590071_000759 3300059421 Bacteria 9033
1067 Ga0590074_006229 3300059423 Bacteria 1980
1068 Ga0590074_008698 3300059423 Unclassified 1690
1069 Ga0590075_000473 3300059424 Bacteria 10800
1070 Ga0590075_006698 3300059424 Bacteria 2729
1071 Ga0590077_000033 3300059426 Bacteria 32115
1072 Ga0590077_000272 3300059426 Bacteria 14641
1073 Ga0590077_001357 3300059426 Bacteria 5775
1074 Ga0501082_0061326 3300060353 Bacteria 3237
1075 Ga0501082_0112811 3300060353 Bacteria 2354
1076 Ga0501082_0233927 3300060353 Bacteria 1599
1077 Ga0501082_0399497 3300060353 Bacteria 1199
1078 Ga0530510_0000198 3300061734 Bacteria 37256
1079 Ga0530510_0018199 3300061734 Bacteria 4981
1080 Ga0530510_0054064 3300061734 Bacteria 2902
1081 Ga0496112_0664010
1082 JGI25406J46586_10015538
1083 JGI25406J46586_10022530
1084 Ga0065712_10072264
1085 Ga0065715_10001036
1086 Ga0065715_10020859
1087 Ga0065715_10035369
1088 Ga0065715_10095018
1089 Ga0065715_10283855
1090 Ga0065715_10315830
1091 Ga0065715_10319977
1092 Ga0065715_10409354
1093 Ga0065707_10235415
1094 Ga0070676_10000699
1095 Ga0070676_10003338
1096 Ga0070676_10123310
1097 Ga0070676_10246354
1098 Ga0070690_100015022
1099 Ga0070690_100040093
1100 Ga0070690_100102108
1101 Ga0070690_100193128
1102 Ga0070670_100001016
1103 Ga0070670_100040631
1104 Ga0070670_100042068
1105 Ga0070670_100055469
1106 Ga0070670_100081085
1107 Ga0070677_10002373
1108 Ga0070677_10013001
1109 Ga0068869_100008375
1110 Ga0068869_100085703
1111 Ga0068869_100103915
1112 Ga0068869_100143786
1113 Ga0070666_10003461
1114 Ga0070666_10012053
1115 Ga0070666_10015679
1116 Ga0070680_100163370
1117 Ga0070680_100238110
1118 Ga0070682_100424888
1119 Ga0068868_100168700
1120 Ga0068868_100203898
1121 Ga0068868_100221627
1122 Ga0068868_100251403
1123 Ga0070660_100009277
1124 Ga0070660_100401862
1125 Ga0070689_100000517
1126 Ga0070689_100003815
1127 Ga0070689_100008478
1128 Ga0070689_100243427
1129 Ga0070691_10003375
1130 Ga0070687_100002053
1131 Ga0070687_100123621
1132 Ga0070687_100248588
1133 Ga0070661_100011720
1134 Ga0070661_100279927
1135 Ga0070692_10162969
1136 Ga0070668_100066232
1137 Ga0070668_100072278
1138 Ga0070668_100175406
1139 Ga0070668_100587627
1140 Ga0070669_100000591
1141 Ga0070669_100000645
1142 Ga0070669_100010354
1143 Ga0070669_100040011
1144 Ga0070669_100059073
1145 Ga0070675_100004466
1146 Ga0070675_100025109
1147 Ga0070675_100076331
1148 Ga0070675_100092816
1149 Ga0070675_100352190
1150 Ga0070675_100397862
1151 Ga0070671_100026568
1152 Ga0070671_100028649
1153 Ga0070671_100067896
1154 Ga0070671_100154711
1155 Ga0070674_100039604
1156 Ga0070674_100060461
1157 Ga0070674_100069454
1158 Ga0070674_100074754
1159 Ga0070674_100099952
1160 Ga0070674_100120634
1161 Ga0070674_100122838
1162 Ga0070674_100134190
1163 Ga0070674_100177652
1164 Ga0070673_100002709
1165 Ga0070673_100024349
1166 Ga0070673_100209931
1167 Ga0070673_100247929
1168 Ga0070673_100519781
1169 Ga0070688_100001469
1170 Ga0070688_100028770
1171 Ga0070688_100043186
1172 Ga0070659_100043100
1173 Ga0070659_100054719
1174 Ga0070659_100055807
1175 Ga0070667_100059563
1176 Ga0070667_100215783
1177 Ga0070667_100468684
1178 Ga0070703_10027150
1179 Ga0070709_10157666
1180 Ga0070709_10424685
1181 Ga0070713_100003818
1182 Ga0070713_100009874
1183 Ga0070701_10009060
1184 Ga0070711_100308825
1185 Ga0070705_100009633
1186 Ga0070705_100102680
1187 Ga0070700_100002313
1188 Ga0070700_100002426
1189 Ga0070700_100052394
1190 Ga0070700_100155791
1191 Ga0070694_100012406
1192 Ga0070694_100018659
1193 Ga0070694_100078519
1194 Ga0070694_100242924
1195 Ga0070708_100571426
1196 Ga0070663_100299350
1197 Ga0070678_100026473
1198 Ga0070678_100342926
1199 Ga0070662_100015165
1200 Ga0070662_100063821
1201 Ga0070662_100206525
1202 Ga0070662_100207204
1203 Ga0070662_100473580
1204 Ga0070681_10027541
1205 Ga0070681_10143006
1206 Ga0068867_100006297
1207 Ga0068867_100039829
1208 Ga0068867_100192114
1209 Ga0068867_100388741
1210 Ga0070685_10013390
1211 Ga0070685_10052315
1212 Ga0070706_100170716
1213 Ga0070706_100424677
1214 Ga0070707_100565133
1215 Ga0070698_100019157
1216 Ga0070698_100029466
1217 Ga0070698_100338087
1218 Ga0070699_100004383
1219 Ga0070699_100100960
1220 Ga0070699_100354679
1221 Ga0070679_100371541
1222 Ga0070679_100499912
1223 Ga0070684_100000477
1224 Ga0070697_100126882
1225 Ga0070697_100220374
1226 Ga0070672_100002400
1227 Ga0070672_100011951
1228 Ga0070672_100012234
1229 Ga0070672_100038500
1230 Ga0070672_100232445
1231 Ga0070672_100318609
1232 Ga0070686_100000389
1233 Ga0070686_100003096
1234 Ga0070686_100033493
1235 Ga0070686_100036243
1236 Ga0070686_100078537
1237 Ga0070686_100083742
1238 Ga0070695_100009348
1239 Ga0070695_100049143
1240 Ga0070695_100057909
1241 Ga0070696_100012876
1242 Ga0070696_100014340
1243 Ga0070696_100215476
1244 Ga0070693_100007306
1245 Ga0070693_100192481
1246 Ga0070665_100001535
1247 Ga0070665_100005335
1248 Ga0070665_100005633
1249 Ga0070665_100008373
1250 Ga0070665_100085824
1251 Ga0070665_100106956
1252 Ga0070665_100379017
1253 Ga0070704_100003916
1254 Ga0070704_100027985
1255 Ga0070704_100098999
1256 Ga0070704_100111800
1257 Ga0070704_100139263
1258 Ga0070704_100200768
1259 Ga0070664_100003519
1260 Ga0070664_100009326
1261 Ga0070664_100076942
1262 Ga0070664_100110241
1263 Ga0070664_100249581
1264 Ga0070664_100313462
1265 Ga0070664_100393841
1266 Ga0068857_100096802
1267 Ga0068854_100011771
1268 Ga0070702_100000153
1269 Ga0070702_100003347
1270 Ga0068852_100027908
1271 Ga0068852_100121419
1272 Ga0068859_100009133
1273 Ga0068859_100061100
1274 Ga0068859_100132466
1275 Ga0068859_100177605
1276 Ga0068859_100619761
1277 Ga0068859_100929507
1278 Ga0068864_100073503
1279 Ga0068864_100112163
1280 Ga0068864_100463425
1281 Ga0068864_100568097
1282 Ga0068866_10065409
1283 Ga0068866_10090423
1284 Ga0068866_10111231
1285 Ga0068861_100009190
1286 Ga0068861_100083880
1287 Ga0068861_100130736
1288 Ga0068861_100154374
1289 Ga0068861_100182574
1290 Ga0068861_100200630
1291 Ga0068861_100376429
1292 Ga0068870_10000595
1293 Ga0068863_100017949
1294 Ga0068863_100032784
1295 Ga0068863_100088220
1296 Ga0068863_100148469
1297 Ga0068863_100394296
1298 Ga0068858_100001189
1299 Ga0068858_100017801
1300 Ga0068858_100019692
1301 Ga0068858_100027736
1302 Ga0068858_100190894
1303 Ga0068858_100227263
1304 Ga0068858_100452093
1305 Ga0068858_100466951
1306 Ga0068858_100489109
1307 Ga0068860_100041890
1308 Ga0068860_100045691
1309 Ga0068860_100084173
1310 Ga0068860_100246502
1311 Ga0068860_100291226
1312 Ga0068862_100021603
1313 Ga0068862_100035062
1314 Ga0068862_100039812
1315 Ga0068862_100075599
1316 Ga0068862_100153880
1317 Ga0081455_10032819
1318 Ga0081455_10073814
1319 Ga0081455_10291937
1320 Ga0081539_10000093
1321 Ga0081539_10001136
1322 Ga0081539_10003103
1323 Ga0075365_10002173
1324 Ga0075365_10021174
1325 Ga0075365_10056678
1326 Ga0075365_10112448
1327 Ga0075368_10020078
1328 Ga0075368_10024598
1329 Ga0075368_10028924
1330 Ga0075368_10088457
1331 Ga0075363_100127959
1332 Ga0075363_100238987
1333 Ga0075364_10009904
1334 Ga0075364_10023890
1335 Ga0075364_10103221
1336 Ga0075364_10160607
1337 Ga0070715_10201112
1338 Ga0070716_100110759
1339 Ga0070712_100131373
1340 Ga0070712_100505892
1341 Ga0075362_10003766
1342 Ga0075367_10060806
1343 Ga0075367_10066530
1344 Ga0075367_10101200
1345 Ga0075367_10112733
1346 Ga0075366_10021446
1347 Ga0075366_10039560
1348 Ga0075366_10081945
1349 Ga0075366_10148078
1350 Ga0075366_10210792
1351 Ga0097621_100001459
1352 Ga0097621_100005845
1353 Ga0097621_100025087
1354 Ga0097621_100050591
1355 Ga0097621_100065705
1356 Ga0097621_100099369
1357 Ga0097621_100155239
1358 Ga0075370_10002195
1359 Ga0075370_10023697
1360 Ga0068871_100002675
1361 Ga0068871_100005949
1362 Ga0068871_100010750
1363 Ga0068871_100022423
1364 Ga0068871_100169400
1365 Ga0068871_100231118
1366 Ga0075428_100000185
1367 Ga0075428_100001280
1368 Ga0075428_100004357
1369 Ga0075428_100012430
1370 Ga0075428_100121536
1371 Ga0075428_100158834
1372 Ga0075428_100215809
1373 Ga0075430_100003870
1374 Ga0075430_100144788
1375 Ga0075430_100417418
1376 Ga0075431_100004193
1377 Ga0075431_100007134
1378 Ga0075431_100021410
1379 Ga0075431_100025437
1380 Ga0075431_100054199
1381 Ga0075433_10006599
1382 Ga0075433_10006822
1383 Ga0075433_10021172
1384 Ga0075433_10045217
1385 Ga0075433_10243586
1386 Ga0075433_10244947
1387 Ga0075433_10422450
1388 Ga0075434_100000731
1389 Ga0075434_100002369
1390 Ga0075434_100018881
1391 Ga0075434_100111355
1392 Ga0075434_100213999
1393 Ga0075434_100275507
1394 Ga0075434_100281364
1395 Ga0075434_100436809
1396 Ga0075434_100694607
1397 Ga0075429_100004068
1398 Ga0075429_100005224
1399 Ga0075429_100005784
1400 Ga0075429_100037163
1401 Ga0075429_100143628
1402 Ga0075429_100271988
1403 Ga0068865_100005643
1404 Ga0068865_100109767
1405 Ga0068865_100187416
1406 Ga0075436_100001874
1407 Ga0075436_100020831
1408 Ga0075436_100029447
1409 Ga0075436_100043595
1410 Ga0075436_100070091
1411 Ga0097620_100009133
1412 Ga0097620_100061101
1413 Ga0097620_100132466
1414 Ga0097620_100177630
1415 Ga0097620_100619814
1416 Ga0075435_100000052
1417 Ga0075435_100000404
1418 Ga0075435_100007864
1419 Ga0075435_100014460
1420 Ga0075435_100015716
1421 Ga0075435_100046358
1422 Ga0075435_100065047
1423 Ga0075435_100114815
1424 Ga0075435_100155452
1425 Ga0099794_10258794
1426 Ga0105240_10068347
1427 Ga0105240_10288659
1428 Ga0105240_10360668
1429 Ga0105240_10561917
1430 Ga0111539_10000160
1431 Ga0111539_10000270
1432 Ga0111539_10000324
1433 Ga0111539_10000602
1434 Ga0111539_10005052
1435 Ga0111539_10006977
1436 Ga0111539_10007299
1437 Ga0111539_10029312
1438 Ga0111539_10502604
1439 Ga0111539_10565095
1440 Ga0105245_10011551
1441 Ga0105245_10015209
1442 Ga0105245_10123419
1443 Ga0105245_10209428
1444 Ga0105247_10043414
1445 Ga0105247_10057544
1446 Ga0114129_10000307
1447 Ga0114129_10000371
1448 Ga0114129_10000408
1449 Ga0114129_10000789
1450 Ga0114129_10004725
1451 Ga0114129_10006465
1452 Ga0114129_10011453
1453 Ga0114129_10020006
1454 Ga0114129_10020472
1455 Ga0114129_10022026
1456 Ga0114129_10030915
1457 Ga0114129_10031216
1458 Ga0114129_10074121
1459 Ga0114129_10148326
1460 Ga0114129_10200198
1461 Ga0114129_10418583
1462 Ga0105243_10442003
1463 Ga0105243_10471200
1464 Ga0105242_10009242
1465 Ga0105242_10020681
1466 Ga0105242_10523736
1467 Ga0105242_10530069
1468 Ga0105248_10010543
1469 Ga0105248_10012969
1470 Ga0105248_10022913
1471 Ga0105248_10172186
1472 Ga0105248_10191287
1473 Ga0105248_10191801
1474 Ga0105248_10223161
1475 Ga0105248_10360339
1476 Ga0105248_10384033
1477 Ga0105248_10430608
1478 Ga0105248_10780467
1479 Ga0105248_10894066
1480 Ga0105237_10201661
1481 Ga0105237_10285526
1482 Ga0105238_10160440
1483 Ga0105238_10268597
1484 Ga0105249_10000566
1485 Ga0105249_10000918
1486 Ga0105249_10230538
1487 Ga0105249_10444465
1488 Ga0105249_10594646
1489 Ga0105249_10637468
1490 Ga0105249_10715971
1491 Ga0105239_10085300
1492 Ga0105239_10400230
1493 Ga0105246_10509033
1494 Ga0157374_10002073
1495 Ga0157374_10223806
1496 Ga0157374_10770819
1497 Ga0157378_10493534
1498 Ga0157378_11016120
1499 Ga0157372_10695483
1500 Ga0157372_10794315
1501 Ga0157372_10926064
1502 Ga0157375_10103262
1503 Ga0157375_10149827
1504 Ga0157375_10268731
1505 Ga0163163_10000071
1506 Ga0163163_10078230
1507 Ga0163163_10117686
1508 Ga0163163_10120836
1509 Ga0163163_10417712
1510 Ga0157380_10035610
1511 Ga0157380_10037774
1512 Ga0157380_10069645
1513 Ga0157380_10197045
1514 Ga0157377_10001507
1515 Ga0157377_10096147
1516 Ga0157379_10016646
1517 Ga0157379_10033107
1518 Ga0157379_10033243
1519 Ga0157379_10040072
1520 Ga0157379_10069759
1521 Ga0157379_10145939
1522 Ga0157379_10398244
1523 Ga0157376_10013740
1524 Ga0157376_10019635
1525 Ga0157376_10034156
1526 Ga0157376_10036751
1527 Ga0157376_10139965
1528 Ga0157376_10160865
1529 Ga0157376_10371677
1530 Ga0163161_10044735
1531 Ga0163161_10167423
1532 Ga0213876_10297227
1533 Ga0207697_10000081
1534 Ga0207697_10000859
1535 Ga0207682_10008568
1536 Ga0207642_10098770
1537 Ga0207688_10000175
1538 Ga0207688_10001748
1539 Ga0207688_10018656
1540 Ga0207680_10046274
1541 Ga0207680_10103540
1542 Ga0207680_10109081
1543 Ga0207680_10140434
1544 Ga0207647_10272875
1545 Ga0207685_10022549
1546 Ga0207699_10049246
1547 Ga0207699_10209141
1548 Ga0207699_10222896
1549 Ga0207645_10000703
1550 Ga0207645_10004989
1551 Ga0207645_10152359
1552 Ga0207643_10000659
1553 Ga0207705_10086298
1554 Ga0207684_10549427
1555 Ga0207654_10210555
1556 Ga0207707_10083906
1557 Ga0207707_10097772
1558 Ga0207707_10101584
1559 Ga0207695_10018579
1560 Ga0207695_10177268
1561 Ga0207695_10317340
1562 Ga0207693_10154494
1563 Ga0207693_10310462
1564 Ga0207660_10304050
1565 Ga0207662_10004326
1566 Ga0207662_10020071
1567 Ga0207662_10096985
1568 Ga0207662_10242752
1569 Ga0207657_10006288
1570 Ga0207657_10017295
1571 Ga0207649_10005670
1572 Ga0207649_10099616
1573 Ga0207649_10147959
1574 Ga0207652_10062611
1575 Ga0207652_10211423
1576 Ga0207652_10279023
1577 Ga0207646_10082584
1578 Ga0207646_10149029
1579 Ga0207646_10390099
1580 Ga0207681_10012612
1581 Ga0207681_10025744
1582 Ga0207681_10029262
1583 Ga0207681_10059030
1584 Ga0207681_10146370
1585 Ga0207681_10165064
1586 Ga0207694_10098691
1587 Ga0207650_10011892
1588 Ga0207650_10012937
1589 Ga0207650_10019245
1590 Ga0207650_10028123
1591 Ga0207650_10446301
1592 Ga0207659_10000076
1593 Ga0207659_10068404
1594 Ga0207659_10071645
1595 Ga0207659_10146415
1596 Ga0207687_10008761
1597 Ga0207687_10009881
1598 Ga0207687_10015618
1599 Ga0207687_10133970
1600 Ga0207700_10009310
1601 Ga0207700_10058994
1602 Ga0207644_10017765
1603 Ga0207644_10291733
1604 Ga0207690_10078652
1605 Ga0207690_10096208
1606 Ga0207690_10103263
1607 Ga0207706_10000390
1608 Ga0207706_10110408
1609 Ga0207706_10155393
1610 Ga0207706_10175131
1611 Ga0207706_10227850
1612 Ga0207686_10004368
1613 Ga0207686_10036898
1614 Ga0207686_10061435
1615 Ga0207686_10347347
1616 Ga0207709_10121233
1617 Ga0207709_10461773
1618 Ga0207670_10009139
1619 Ga0207670_10013055
1620 Ga0207670_10038538
1621 Ga0207669_10035712
1622 Ga0207669_10112105
1623 Ga0207669_10322452
1624 Ga0207704_10047884
1625 Ga0207704_10143113
1626 Ga0207704_10200631
1627 Ga0207704_10285283
1628 Ga0207665_10091023
1629 Ga0207665_10114905
1630 Ga0207691_10000697
1631 Ga0207691_10002569
1632 Ga0207691_10020421
1633 Ga0207691_10039583
1634 Ga0207691_10163529
1635 Ga0207691_10262368
1636 Ga0207711_10027843
1637 Ga0207711_10036296
1638 Ga0207711_10041623
1639 Ga0207711_10054644
1640 Ga0207711_10144198
1641 Ga0207711_10326840
1642 Ga0207689_10000944
1643 Ga0207689_10067247
1644 Ga0207689_10086106
1645 Ga0207689_10113331
1646 Ga0207689_10389015
1647 Ga0207661_10003683
1648 Ga0207661_10061119
1649 Ga0207679_10005900
1650 Ga0207679_10043847
1651 Ga0207679_10070629
1652 Ga0207679_10279712
1653 Ga0207679_10532296
1654 Ga0207679_10584383
1655 Ga0207679_10601693
1656 Ga0207667_10197969
1657 Ga0207667_10303444
1658 Ga0207651_10094385
1659 Ga0207651_10111545
1660 Ga0207651_10193448
1661 Ga0207651_10331209
1662 Ga0207712_10004445
1663 Ga0207712_10112409
1664 Ga0207668_10556849
1665 Ga0207640_10014136
1666 Ga0207640_10135048
1667 Ga0207658_10160739
1668 Ga0207658_10169872
1669 Ga0207658_10207407
1670 Ga0207677_10022830
1671 Ga0207677_10254720
1672 Ga0207677_10322929
1673 Ga0207703_10010663
1674 Ga0207703_10021021
1675 Ga0207703_10029019
1676 Ga0207703_10459459
1677 Ga0207678_10065926
1678 Ga0207678_10281377
1679 Ga0207708_10011104
1680 Ga0207708_10014977
1681 Ga0207708_10040632
1682 Ga0207708_10072715
1683 Ga0207708_10078829
1684 Ga0207641_10002582
1685 Ga0207641_10062303
1686 Ga0207641_10374948
1687 Ga0207641_10428486
1688 Ga0207648_10021176
1689 Ga0207648_10027253
1690 Ga0207648_10042395
1691 Ga0207648_10115208
1692 Ga0207676_10074204
1693 Ga0207676_10142786
1694 Ga0207674_10097183
1695 Ga0207675_100012476
1696 Ga0207675_100028140
1697 Ga0207675_100039984
1698 Ga0207675_100062193
1699 Ga0207675_100081642
1700 Ga0207675_100118864
1701 Ga0207675_100255325
1702 Ga0207675_100321225
1703 Ga0207683_10016293
1704 Ga0207683_10026021
1705 Ga0207683_10027273
1706 Ga0207683_10289932
1707 Ga0207698_10056713
1708 Ga0207698_10091757
1709 Ga0207698_10520351
1710 Ga0210002_1020821
1711 Ga0209813_10023393
1712 Ga0209813_10061765
1713 Ga0209813_10164781
1714 Ga0207428_10000234
1715 Ga0207428_10002148
1716 Ga0207428_10003192
1717 Ga0207428_10004284
1718 Ga0207428_10006859
1719 Ga0207428_10043674
1720 Ga0207428_10084691
1721 Ga0268266_10003216
1722 Ga0268266_10018204
1723 Ga0268266_10061556
1724 Ga0268266_10177379
1725 Ga0268266_10178464
1726 Ga0268265_10010002
1727 Ga0268265_10016423
1728 Ga0268265_10045899
1729 Ga0268265_10254066
1730 Ga0268265_10488479
1731 Ga0268264_10351211
1732 Ga0268264_10789036
1733 Ga0307408_100033103
1734 Ga0307408_100070154
1735 Ga0307408_100076075
1736 Ga0307408_100377185
1737 Ga0316579_10011360
1738 Ga0307405_10022391
1739 Ga0307405_10081961
1740 Ga0307405_10627299
1741 Ga0316577_10000194
1742 Ga0316577_10004072
1743 Ga0307413_10010814
1744 Ga0307413_10050111
1745 Ga0307413_10068850
1746 Ga0307413_10069376
1747 Ga0307413_10073723
1748 Ga0307406_10021479
1749 Ga0307406_10335548
1750 Ga0307407_10002148
1751 Ga0307412_10028114
1752 Ga0307412_10371039
1753 Ga0307412_10550212
1754 Ga0307409_100006545
1755 Ga0307409_100038377
1756 Ga0307409_100207498
1757 Ga0307416_100018870
1758 Ga0307416_100034559
1759 Ga0307416_100072405
1760 Ga0307416_100184566
1761 Ga0307416_100318293
1762 Ga0307414_10031537
1763 Ga0307414_10112709
1764 Ga0307411_10041048
1765 Ga0307411_10059648
1766 Ga0307411_10121440
1767 Ga0307415_100020627
1768 Ga0307415_100060077
1769 Ga0373930_0000070
1770 Ga0373948_0000676
1771 Ga0373950_0003893
1772 Ga0373958_0006887
1773 Ga0373938_0001388
1774 Ga0373926_0037133
1775 Ga0373926_0074564
1776 Ga0373928_0008320
1777 Ga0373929_0003681
1778 Ga0373934_0000325
1779 Ga0373934_0086123
1780 Ga0373949_0000540
1781 Ga0373952_0001255
1782 Ga0373932_0003989
1783 Ga0373936_0044519
1784 Ga0373936_0066437
1785 Ga0373953_0025499
1786 Ga0373954_0189699
1787 Ga0373956_0009905
1788 Ga0373957_0007056
1789 Ga0373960_0000470
1790 Ga0373943_0054183
1791 Ga0373943_0227867
1792 Ga0373955_0058876
1793 Ga0373942_0000397
1794 Ga0373961_0011080
1795 Ga0373962_0090827
1796 Ga0373931_0000745
1797 Ga0373935_0442684
1798 Ga0373933_0005577
1799 Ga0373947_0203923
1800 Ga0373947_0263588
1801 Ga0373937_0000553
1802 Ga0373937_0005022
1803 Ga0373937_0114119
1804 Ga0373937_0439337
1805 Ga0373937_0726072
1806 Ga0373937_0797426
1807 Ga0316584_0006761
1808 Ga0373925_0001772
1809 Ga0373925_0036314
1810 Ga0373925_0079081
1811 Ga0373925_0290622
1812 Ga0395898_0713306
1813 Ga0436365_0346005
1814 Ga0436365_1288414
1815 Ga0439461_0012567
1816 Ga0451807_2029552
1817 Ga0439431_0072600
1818 Ga0439450_018574
1819 Ga0439456_014218
1820 Ga0450894_010868
1821 Ga0450907_035473
1822 Ga0439446_0079516
1823 Ga0439435_0001535
1824 Ga0439435_0020723
1825 Ga0439435_0022221
1826 Ga0450916_003120
1827 Ga0451577_0136756
1828 Ga0439440_0085735
1829 Ga0466963_0048074
1830 Ga0453684_0025392
1831 Ga0453684_0373285
1832 Ga0451576_0035534
1833 Ga0451576_0042362
1834 Ga0451576_0548526
1835 Ga0466967_0096933
1836 Ga0495603_0049212
1837 Ga0495629_0030437
1838 Ga0495638_0013639
1839 Ga0495639_0037509
1840 Ga0495662_0095080
1841 Ga0495664_0067363
1842 Ga0495585_0179655
1843 Ga0495608_0003061
1844 Ga0495608_0275665
1845 Ga0495630_0118626
1846 Ga0495652_0486175
1847 Ga0495640_0081969
1848 Ga0495640_0093234
1849 Ga0495640_0141495
1850 Ga0495586_0040346
1851 Ga0495586_0059180
1852 Ga0495586_0089745
1853 Ga0495587_0115829
1854 Ga0495621_0042273
1855 Ga0495645_0000493
1856 Ga0495645_0064996
1857 Ga0495667_0057927
1858 Ga0495667_0184322
1859 Ga0495656_0104328
1860 Ga0495634_0117202
1861 Ga0495635_0024299
1862 Ga0495659_0113823
1863 Ga0495659_0170848
1864 Ga0495599_0188446
1865 Ga0495599_0272201
1866 Ga0495658_0004399
1867 Ga0495658_0105882
1868 Ga0495669_0038208
1869 Ga0495669_0042899
1870 Ga0495613_0001719
1871 Ga0495613_0101747
1872 Ga0495604_0022772
1873 Ga0495674_0046339
1874 Ga0495674_0158143
1875 Ga0495684_0009207
1876 Ga0495684_0067641
1877 Ga0495684_0249527
1878 Ga0495602_0361434
1879 Ga0496100_0132319
1880 Ga0496100_0247776
1881 Ga0496100_0478889
1882 Ga0496101_0625379
1883 Ga0496102_0021815
1884 Ga0496102_0073068
1885 Ga0496104_0013818
1886 Ga0496104_0218180
1887 Ga0496104_0287220
1888 Ga0496105_0066693
1889 Ga0496106_0034476
1890 Ga0496106_0056067
1891 Ga0496106_0342601
1892 Ga0496107_0053451
1893 Ga0496107_0071330
1894 Ga0496107_0482300
1895 Ga0496108_0030694
1896 Ga0496108_0722470
1897 Ga0496109_0001850
1898 Ga0496109_0078971
1899 Ga0496109_0243409
1900 Ga0496109_0298694
1901 Ga0496109_0499969
1902 Ga0496109_0530493
1903 Ga0496110_0000816
1904 Ga0496110_0051930
1905 Ga0496110_0083633
1906 Ga0496110_0102383
1907 Ga0496110_0242235
1908 Ga0496111_0065210
1909 Ga0496112_0000213
1910 Ga0496112_0056169
1911 Ga0496112_0147704
1912 Ga0496112_0282732
1913 Ga0496114_0011050
1914 Ga0496114_0205653
1915 Ga0496114_0561672
1916 Ga0496115_0107242
1917 Ga0501031_0002515
1918 Ga0501032_0015836
1919 Ga0501032_0049435
1920 Ga0501033_0002780
1921 Ga0501033_0003873
1922 Ga0501033_0014866
1923 Ga0501034_0006315
1924 Ga0501034_0031709
1925 Ga0501034_0247710
1926 Ga0501036_0102611
1927 Ga0501036_0164319
1928 Ga0501036_0338364
1929 Ga0501036_0414503
1930 Ga0501037_0008778
1931 Ga0501037_0023091
1932 Ga0501037_0422825
1933 Ga0501038_0020228
1934 Ga0501038_0026332
1935 Ga0501038_0082816
1936 Ga0501038_0255775
1937 Ga0501039_0022659
1938 Ga0501039_0037595
1939 Ga0501039_0093667
1940 Ga0501040_0000223
1941 Ga0501040_0081272
1942 Ga0501040_0129628
1943 Ga0501040_0280960
1944 Ga0501041_0014294
1945 Ga0501041_0068736
1946 Ga0501042_0001934
1947 Ga0501042_0002776
1948 Ga0501042_0049600
1949 Ga0501042_0103070
1950 Ga0501043_0021725
1951 Ga0501043_0138562
1952 Ga0501046_0009389
1953 Ga0501046_0054027
1954 Ga0501046_0151794
1955 Ga0501046_0206681
1956 Ga0501046_0290789
1957 Ga0501047_0112880
1958 Ga0501047_0250521
1959 Ga0501047_0375021
1960 Ga0501048_0005408
1961 Ga0501048_0053807
1962 Ga0501048_0066877
1963 Ga0501067_0023005
1964 Ga0501068_0032487
1965 Ga0501068_0082430
1966 Ga0501069_0000964
1967 Ga0501069_0004730
1968 Ga0501070_0023127
1969 Ga0501070_0055421
1970 Ga0501070_0088768
1971 Ga0501071_0001640
1972 Ga0501071_0001811
1973 Ga0501071_0011572
1974 Ga0501072_0024980
1975 Ga0501072_0034747
1976 Ga0501072_0115505
1977 Ga0501072_0131369
1978 Ga0501072_0134566
1979 Ga0501072_0164277
1980 Ga0501072_0234440
1981 Ga0501073_0004945
1982 Ga0501073_0014655
1983 Ga0501073_0043654
1984 Ga0501074_0001614
1985 Ga0501074_0025661
1986 Ga0501074_0089372
1987 Ga0501074_0181189
1988 Ga0501075_0026333
1989 Ga0501075_0073753
1990 Ga0501075_0223555
1991 Ga0501075_0282833
1992 Ga0501076_0000179
1993 Ga0501076_0041119
1994 Ga0501076_0055225
1995 Ga0501076_0206354
1996 Ga0501077_0223001
1997 Ga0501208_038827
1998 Ga0501079_0003374
1999 Ga0501079_0031287
2000 Ga0501079_0042597
2001 Ga0501079_0062463
2002 Ga0501079_0141184
2003 Ga0501080_0014909
2004 Ga0501080_0042829
2005 Ga0501080_0086788
2006 Ga0501080_0139375
2007 Ga0501080_0149046
2008 Ga0501080_0177556
2009 Ga0501080_0319617
2010 Ga0501081_0039608
2011 Ga0501081_0075487
2012 Ga0501081_0156342
2013 Ga0501081_0224346
2014 Ga0501081_0305100
2015 Ga0501083_0001360
2016 Ga0501083_0016462
2017 Ga0501268_023860
2018 Ga0501035_0062886
2019 Ga0501035_0063294
2020 Ga0501035_0103723
2021 Ga0501044_0039726
2022 Ga0501044_0077632
2023 Ga0501044_0431108
2024 Ga0501045_0004268
2025 Ga0501045_0008879
2026 Ga0501045_0030459
2027 Ga0501045_0168103
2028 nmdc:mga03n38_132118_c1
2029 nmdc:mga00v17_123503_c1
2030 nmdc:mga00v17_169997_c1
2031 nmdc:mga00v17_36260_c1
2032 nmdc:mga00v17_37918_c1
2033 nmdc:mga00v17_77713_c1
2034 nmdc:mga0yw44_1474_c1
2035 nmdc:mga0yw44_40858_c1
2036 nmdc:mga0k408_108153_c1
2037 nmdc:mga0k408_114457_c1
2038 nmdc:mga0k408_120668_c1
2039 nmdc:mga0k408_138873_c1
2040 nmdc:mga0k408_18006_c1
2041 nmdc:mga0k408_22366_c1
2042 nmdc:mga0k408_31950_c1
2043 nmdc:mga06z11_12999_c1
2044 nmdc:mga06z11_142380_c1
2045 nmdc:mga06z11_61714_c1
2046 nmdc:mga06z11_9003_c1
2047 nmdc:mga04h51_11635_c1
2048 nmdc:mga07m45_25880_c1
2049 nmdc:mga05p37_120572_c1
2050 nmdc:mga05p37_158217_c1
2051 nmdc:mga05p37_16784_c1
2052 nmdc:mga05p37_18019_c1
2053 nmdc:mga05p37_18668_c1
2054 nmdc:mga05p37_187985_c1
2055 nmdc:mga05p37_34620_c1
2056 nmdc:mga05p37_4675_c1
2057 nmdc:mga05p37_53467_c1
2058 nmdc:mga05p37_625_c1
2059 nmdc:mga05p37_6700_c1
2060 nmdc:mga05p37_78381_c1
2061 nmdc:mga05p37_83417_c1
2062 nmdc:mga09592_15209_c1
2063 nmdc:mga09592_208948_c1
2064 nmdc:mga09592_219_c1
2065 nmdc:mga09592_400072_c1
2066 nmdc:mga09592_7566_c1
2067 nmdc:mga09592_938_c1
2068 nmdc:mga0qj67_101128_c1
2069 nmdc:mga0qj67_402_c1
2070 nmdc:mga0qj67_63675_c1
2071 nmdc:mga0qj67_73854_c1
2072 nmdc:mga06r32_117891_c1
2073 nmdc:mga06r32_1407_c1
2074 nmdc:mga06r32_160741_c1
2075 nmdc:mga06r32_166506_c1
2076 nmdc:mga06r32_44908_c1
2077 nmdc:mga06r32_456902_c1
2078 nmdc:mga08y16_10_c1
2079 nmdc:mga08y16_16069_c1
2080 nmdc:mga08y16_2467_c1
2081 nmdc:mga08y16_2484_c1
2082 nmdc:mga08y16_26035_c1
2083 nmdc:mga08y16_262798_c1
2084 nmdc:mga08y16_3210_c1
2085 nmdc:mga08y16_71377_c1
2086 nmdc:mga08y16_882_c1
2087 nmdc:mga08y16_99013_c1
2088 nmdc:mga0n895_101653_c1
2089 nmdc:mga0n895_106475_c1
2090 nmdc:mga0n895_141627_c1
2091 nmdc:mga0n895_160540_c1
2092 nmdc:mga0n895_195895_c1
2093 nmdc:mga0n895_200951_c1
2094 nmdc:mga0n895_263215_c1
2095 nmdc:mga0n895_309694_c1
2096 nmdc:mga0n895_3430_c1
2097 nmdc:mga0n895_374297_c1
2098 nmdc:mga0n895_541518_c1
2099 nmdc:mga0n895_8_c1
2100 nmdc:mga0n895_96264_c1
2101 nmdc:mga0rr50_10032_c1
2102 nmdc:mga0rr50_178195_c1
2103 nmdc:mga0rr50_23725_c1
2104 nmdc:mga0rr50_23_c1
2105 nmdc:mga0rr50_34425_c1
2106 nmdc:mga0rr50_378594_c1
2107 nmdc:mga0rr50_46504_c1
2108 nmdc:mga0rr50_618_c1
2109 nmdc:mga0rr50_8578_c1
2110 nmdc:mga08x19_12493_c1
2111 nmdc:mga08x19_165_c1
2112 nmdc:mga08x19_9112_c1
2113 nmdc:mga0a205_10903_c1
2114 nmdc:mga0a205_133545_c1
2115 nmdc:mga0a205_148156_c1
2116 nmdc:mga0a205_17695_c1
2117 nmdc:mga0a205_22816_c1
2118 nmdc:mga0a205_255972_c2
2119 nmdc:mga0a205_260003_c1
2120 nmdc:mga0a205_318074_c1
2121 nmdc:mga0a205_333706_c1
2122 nmdc:mga0a205_335444_c1
2123 nmdc:mga0a205_95171_c1
2124 Ga0495601_0186242
2125 Ga0495595_0047011
2126 Ga0495619_0011947
2127 Ga0495619_0070915
2128 Ga0495619_0081256
2129 Ga0495619_0121901
2130 Ga0495619_0134584
2131 Ga0495619_0307266
2132 Ga0500555_017379
2133 Ga0500592_017836
2134 Ga0500628_023188
2135 Ga0500616_0007973
2136 Ga0500645_006429
2137 Ga0501084_0000669
2138 Ga0501084_0037923
2139 Ga0501084_0037950
2140 Ga0501084_0052591
2141 Ga0501084_0125809
2142 Ga0501084_0182581
2143 Ga0501084_0267489
2144 Ga0590071_000286
2145 Ga0590071_000443
2146 Ga0590071_000759
2147 Ga0590074_006229
2148 Ga0590074_008698
2149 Ga0590075_000473
2150 Ga0590075_006698
2151 Ga0590077_000033
2152 Ga0590077_000272
2153 Ga0590077_001357
2154 Ga0501082_0061326
2155 Ga0501082_0112811
2156 Ga0501082_0233927
2157 Ga0501082_0399497
2158 Ga0530510_0000198
2159 Ga0530510_0018199
2160 Ga0530510_0054064

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

20

184

0.92

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

16

232

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ckj-assembly1.cif.gz_A crystal structure of a mycobacterial protein 0.7975 13 218
7pho-assembly1.cif.gz_B crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 in complex with 4-hydroxybenzaldehyde 0.7849 13 211
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.7843 13 239
3e25-assembly1.cif.gz_A-2 crystal structure of m. tuberculosis glucosyl-3-phosphoglycerate synthase 0.7832 13 211
7pdo-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp 0.7824 13 233
ID Description Score Start End Superfamily
af_Q9VLQ1_42_326_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8633 8 243 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8596 15 218 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.846 7 244 3.90.550.10
af_K7MVE2_46_307_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8446 12 216 3.90.550.10
af_P9WMX5_1_216_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8441 15 232 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A399Z0Z8-F1-model_v4 Glycosyltransferase family 2 protein 0.9823 13 245 GO:0005886
GO:0099621
AF-A0A2V8FX94-F1-model_v4 Glycosyltransferase family 2 protein 0.9705 4 248 GO:0005886
GO:0099621
AF-A0A7C5FNM4-F1-model_v4 Glycosyltransferase 0.9575 12 120 GO:0005886
GO:0016757
AF-A0A086CFE5-F1-model_v4 Glycosyl transferase 0.9404 14 119 GO:0005886
GO:0016757
AF-A0A1X7MIX0-F1-model_v4 deleted 0.9297 9 114

Map