F489586

General Info

Members Datasets Scaffolds Average Seq Length
1076 261 1072 220

Family's Representative Sequence

Representative Sequence 3300027552|Ga0209982_1008459|Ga0209982_10084592
Length 246
Sequence VRSEAIQQHMNDSGLLRRPAPRNDEWMVPLSFGGHDFLACVSGALFWPSERTLLVADLHLEKASWFARLGQFLPPYDSQATLAALTDDVAATGAHRLYCLGDSFHDRFGCDRLPAPARAMLLDLTDRLDWVWIVGNHDPGFADHCGGRIEQECEVGGIVLRHEAVAAEARPEMSGHFHPKLRLSLKGRRVSRRCFVASPTKLILPAYGALTGGLDARHPEIARKTGPGAAALVPVADRLLKFPIAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
4 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
5 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
163 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
164 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
185 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
186 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
200 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
222 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
223 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
253 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.09
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 3.72
Rhizosphere 94.89
Stem 0
Stem Tuber 0.09
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1927051 2162886007 Bacteria 11627
2 JGI24736J21556_1001480 3300001904 Bacteria 4306
3 JGI24739J22299_10000541 3300001989 Bacteria 13462
4 JGI24739J22299_10002564 3300001989 Bacteria 7007
5 JGI24737J22298_10000120 3300001990 Bacteria 24095
6 JGI24737J22298_10002837 3300001990 Bacteria 6139
7 JGI24737J22298_10003192 3300001990 Bacteria 5816
8 JGI24735J21928_10034709 3300002067 Bacteria 1486
9 JGI24735J21928_10072955 3300002067 Bacteria 983
10 JGI24738J21930_10000025 3300002075 Bacteria 28033
11 Ga0065704_10001055 3300005289 Bacteria 11995
12 Ga0065704_10004681 3300005289 Bacteria 5700
13 Ga0065715_10000355 3300005293 Bacteria 13344
14 Ga0065715_10029831 3300005293 Bacteria 1957
15 Ga0065715_10201452 3300005293 Bacteria 1359
16 Ga0070658_10005845 3300005327 Bacteria 9974
17 Ga0070658_10036441 3300005327 Bacteria 3965
18 Ga0070658_10073094 3300005327 Bacteria 2811
19 Ga0070658_10160028 3300005327 Bacteria 1889
20 Ga0070658_10174042 3300005327 Bacteria 1809
21 Ga0070658_10180096 3300005327 Bacteria 1778
22 Ga0070658_10245432 3300005327 Bacteria 1519
23 Ga0070658_10290639 3300005327 Bacteria 1393
24 Ga0070658_10478532 3300005327 Bacteria 1074
25 Ga0070676_10003807 3300005328 Bacteria 7915
26 Ga0070676_10010466 3300005328 Bacteria 5035
27 Ga0070676_10028555 3300005328 Bacteria 3169
28 Ga0070676_10662822 3300005328 Bacteria 758
29 Ga0070683_100097843 3300005329 Bacteria 2761
30 Ga0070683_100560335 3300005329 Bacteria 1093
31 Ga0070690_100030536 3300005330 Bacteria 3350
32 Ga0070690_100151959 3300005330 Bacteria 1580
33 Ga0070670_100002152 3300005331 Bacteria 16175
34 Ga0070670_100009531 3300005331 Bacteria 8287
35 Ga0070670_100036658 3300005331 Bacteria 4220
36 Ga0070670_100092789 3300005331 Bacteria 2596
37 Ga0070670_100126821 3300005331 Bacteria 2203
38 Ga0070670_100322599 3300005331 Bacteria 1353
39 Ga0070670_100397273 3300005331 Bacteria 1217
40 Ga0070670_100495988 3300005331 Bacteria 1085
41 Ga0070670_101055236 3300005331 Bacteria 740
42 Ga0070677_10001821 3300005333 Bacteria 6728
43 Ga0070677_10016028 3300005333 Bacteria 2663
44 Ga0068869_100000003 3300005334 Bacteria 136262
45 Ga0070666_10015682 3300005335 Bacteria 4836
46 Ga0068868_100001817 3300005338 Bacteria 14669
47 Ga0068868_100197765 3300005338 Bacteria 1674
48 Ga0070660_100001069 3300005339 Bacteria 18410
49 Ga0070660_100002117 3300005339 Bacteria 13691
50 Ga0070660_100002261 3300005339 Bacteria 13228
51 Ga0070660_100016742 3300005339 Bacteria 5330
52 Ga0070660_100018036 3300005339 Bacteria 5150
53 Ga0070660_100092755 3300005339 Bacteria 2384
54 Ga0070660_100095904 3300005339 Bacteria 2345
55 Ga0070660_100194282 3300005339 Bacteria 1644
56 Ga0070660_100355249 3300005339 Bacteria 1207
57 Ga0070660_100397341 3300005339 Bacteria 1139
58 Ga0070660_100465402 3300005339 Bacteria 1050
59 Ga0070689_100681749 3300005340 Bacteria 896
60 Ga0070687_100079709 3300005343 Bacteria 1783
61 Ga0070687_100083707 3300005343 Bacteria 1747
62 Ga0070661_100009134 3300005344 Bacteria 6853
63 Ga0070661_100312621 3300005344 Bacteria 1225
64 Ga0070661_100322969 3300005344 Bacteria 1206
65 Ga0070668_100000948 3300005347 Bacteria 20236
66 Ga0070668_100001033 3300005347 Bacteria 19546
67 Ga0070668_100003955 3300005347 Bacteria 10958
68 Ga0070668_100052400 3300005347 Bacteria 3145
69 Ga0070668_100108317 3300005347 Bacteria 2210
70 Ga0070668_100466052 3300005347 Bacteria 1089
71 Ga0070669_100000138 3300005353 Bacteria 65433
72 Ga0070669_100024273 3300005353 Bacteria 4347
73 Ga0070669_100107191 3300005353 Bacteria 2116
74 Ga0070669_100113653 3300005353 Bacteria 2057
75 Ga0070669_100137880 3300005353 Bacteria 1878
76 Ga0070669_100155315 3300005353 Bacteria 1774
77 Ga0070669_100182580 3300005353 Bacteria 1642
78 Ga0070669_100386697 3300005353 Bacteria 1142
79 Ga0070675_100000168 3300005354 Bacteria 40494
80 Ga0070675_100031268 3300005354 Bacteria 4302
81 Ga0070675_100051132 3300005354 Bacteria 3395
82 Ga0070675_100162311 3300005354 Bacteria 1922
83 Ga0070675_100164573 3300005354 Bacteria 1910
84 Ga0070675_100266668 3300005354 Bacteria 1502
85 Ga0070671_100003587 3300005355 Bacteria 12135
86 Ga0070671_100010193 3300005355 Bacteria 7542
87 Ga0070671_100020505 3300005355 Bacteria 5391
88 Ga0070671_100023573 3300005355 Bacteria 5038
89 Ga0070671_100031844 3300005355 Bacteria 4359
90 Ga0070671_100132642 3300005355 Bacteria 2098
91 Ga0070671_100151088 3300005355 Bacteria 1961
92 Ga0070671_100224144 3300005355 Bacteria 1595
93 Ga0070674_100001408 3300005356 Bacteria 12743
94 Ga0070674_100032446 3300005356 Bacteria 3468
95 Ga0070674_100128754 3300005356 Bacteria 1884
96 Ga0070674_100324051 3300005356 Bacteria 1236
97 Ga0070673_100011006 3300005364 Bacteria 6158
98 Ga0070673_100025107 3300005364 Bacteria 4380
99 Ga0070673_100025584 3300005364 Bacteria 4348
100 Ga0070673_100036423 3300005364 Bacteria 3740
101 Ga0070673_100239821 3300005364 Bacteria 1576
102 Ga0070673_100243558 3300005364 Bacteria 1564
103 Ga0070673_100497839 3300005364 Bacteria 1102
104 Ga0070659_100000360 3300005366 Bacteria 34640
105 Ga0070659_100002345 3300005366 Bacteria 13458
106 Ga0070659_100032138 3300005366 Bacteria 4069
107 Ga0070659_100105636 3300005366 Bacteria 2269
108 Ga0070659_100174672 3300005366 Bacteria 1761
109 Ga0070659_100216588 3300005366 Bacteria 1579
110 Ga0070659_100290662 3300005366 Bacteria 1361
111 Ga0070659_100385335 3300005366 Bacteria 1181
112 Ga0070659_100424503 3300005366 Bacteria 1125
113 Ga0070667_100003732 3300005367 Bacteria 12933
114 Ga0070667_100016637 3300005367 Bacteria 6087
115 Ga0070667_100087429 3300005367 Bacteria 2675
116 Ga0070667_100155581 3300005367 Bacteria 2010
117 Ga0070667_100172438 3300005367 Bacteria 1910
118 Ga0070667_100771264 3300005367 Bacteria 892
119 Ga0070694_100003110 3300005444 Bacteria 9885
120 Ga0070663_100001108 3300005455 Bacteria 14799
121 Ga0070663_100031698 3300005455 Bacteria 3635
122 Ga0070663_100209010 3300005455 Bacteria 1527
123 Ga0070663_100285920 3300005455 Bacteria 1316
124 Ga0070663_100402735 3300005455 Bacteria 1119
125 Ga0070678_100050834 3300005456 Bacteria 3001
126 Ga0070678_100082960 3300005456 Bacteria 2435
127 Ga0070662_100000567 3300005457 Bacteria 22531
128 Ga0070662_100003090 3300005457 Bacteria 10334
129 Ga0070662_100006871 3300005457 Bacteria 7363
130 Ga0070662_100010162 3300005457 Bacteria 6168
131 Ga0070662_100010315 3300005457 Bacteria 6124
132 Ga0070662_100029737 3300005457 Bacteria 3815
133 Ga0070662_100053696 3300005457 Bacteria 2918
134 Ga0070662_100068239 3300005457 Bacteria 2614
135 Ga0070662_100111150 3300005457 Bacteria 2087
136 Ga0068867_100000505 3300005459 Bacteria 26038
137 Ga0068867_100004826 3300005459 Bacteria 9492
138 Ga0068867_100033751 3300005459 Bacteria 3708
139 Ga0068867_100041738 3300005459 Bacteria 3353
140 Ga0068867_100098984 3300005459 Bacteria 2224
141 Ga0070684_100176799 3300005535 Bacteria 1940
142 Ga0068853_100001049 3300005539 Bacteria 19524
143 Ga0068853_100033529 3300005539 Bacteria 4358
144 Ga0068853_100052187 3300005539 Bacteria 3522
145 Ga0070672_100000498 3300005543 Bacteria 22839
146 Ga0070672_100002394 3300005543 Bacteria 11867
147 Ga0070672_100007673 3300005543 Bacteria 7343
148 Ga0070672_100495930 3300005543 Bacteria 1056
149 Ga0070672_100692969 3300005543 Bacteria 892
150 Ga0070696_100055400 3300005546 Bacteria 2764
151 Ga0070693_100700016 3300005547 Bacteria 742
152 Ga0070665_100000380 3300005548 Bacteria 65676
153 Ga0070665_100009616 3300005548 Bacteria 9780
154 Ga0070665_100021410 3300005548 Bacteria 6503
155 Ga0070665_100026477 3300005548 Bacteria 5838
156 Ga0070665_100027724 3300005548 Bacteria 5702
157 Ga0070665_100036161 3300005548 Bacteria 4968
158 Ga0070665_100145926 3300005548 Bacteria 2369
159 Ga0070665_100151091 3300005548 Bacteria 2325
160 Ga0070704_100167512 3300005549 Bacteria 1744
161 Ga0068855_100001630 3300005563 Bacteria 28165
162 Ga0068855_100003323 3300005563 Bacteria 19678
163 Ga0068855_100062783 3300005563 Bacteria 4336
164 Ga0068855_101165098 3300005563 Bacteria 803
165 Ga0070664_100019164 3300005564 Bacteria 5627
166 Ga0070664_100035913 3300005564 Bacteria 4162
167 Ga0070664_100036914 3300005564 Bacteria 4106
168 Ga0070664_100037637 3300005564 Bacteria 4068
169 Ga0070664_100085626 3300005564 Bacteria 2722
170 Ga0070664_100095452 3300005564 Bacteria 2579
171 Ga0070664_100176194 3300005564 Bacteria 1899
172 Ga0068857_100001870 3300005577 Bacteria 16948
173 Ga0068857_100005590 3300005577 Bacteria 10738
174 Ga0068857_100052001 3300005577 Bacteria 3635
175 Ga0068857_100054905 3300005577 Bacteria 3535
176 Ga0068857_100231788 3300005577 Bacteria 1689
177 Ga0068857_100324419 3300005577 Bacteria 1423
178 Ga0068857_100615088 3300005577 Bacteria 1028
179 Ga0068854_100011496 3300005578 Bacteria 5766
180 Ga0068854_100019028 3300005578 Bacteria 4620
181 Ga0068854_100047745 3300005578 Bacteria 3052
182 Ga0068854_100078827 3300005578 Bacteria 2427
183 Ga0068854_100204335 3300005578 Bacteria 1555
184 Ga0068856_100023621 3300005614 Bacteria 5978
185 Ga0068856_100293991 3300005614 Bacteria 1641
186 Ga0068856_100338032 3300005614 Bacteria 1524
187 Ga0068856_100544266 3300005614 Unclassified 1182
188 Ga0068852_100001326 3300005616 Bacteria 16563
189 Ga0068852_100014402 3300005616 Bacteria 6088
190 Ga0068852_100158268 3300005616 Bacteria 2112
191 Ga0068859_100000117 3300005617 Bacteria 75377
192 Ga0068859_100000550 3300005617 Bacteria 37222
193 Ga0068859_100002852 3300005617 Bacteria 17533
194 Ga0068859_100014415 3300005617 Bacteria 7932
195 Ga0068859_100092810 3300005617 Bacteria 3070
196 Ga0068859_100103827 3300005617 Bacteria 2900
197 Ga0068859_100147536 3300005617 Bacteria 2428
198 Ga0068864_100000047 3300005618 Bacteria 150798
199 Ga0068864_100000161 3300005618 Bacteria 62543
200 Ga0068864_100003015 3300005618 Bacteria 13919
201 Ga0068864_100022058 3300005618 Bacteria 5337
202 Ga0068864_100040444 3300005618 Bacteria 3989
203 Ga0068864_100109882 3300005618 Bacteria 2455
204 Ga0068864_100201264 3300005618 Bacteria 1829
205 Ga0068864_100271674 3300005618 Bacteria 1580
206 Ga0068864_100320131 3300005618 Bacteria 1456
207 Ga0068864_100484234 3300005618 Bacteria 1188
208 Ga0068864_101108076 3300005618 Bacteria 788
209 Ga0068861_100098048 3300005719 Bacteria 2326
210 Ga0068861_100144342 3300005719 Bacteria 1946
211 Ga0068861_100397297 3300005719 Bacteria 1222
212 Ga0068861_100430317 3300005719 Bacteria 1178
213 Ga0068861_100529279 3300005719 Bacteria 1070
214 Ga0068851_10041216 3300005834 Bacteria 2321
215 Ga0068851_10065191 3300005834 Bacteria 1874
216 Ga0068851_10151496 3300005834 Bacteria 1268
217 Ga0068851_10174722 3300005834 Bacteria 1187
218 Ga0068851_10196074 3300005834 Bacteria 1125
219 Ga0068870_10232464 3300005840 Bacteria 1134
220 Ga0068863_100000468 3300005841 Bacteria 41287
221 Ga0068863_100001438 3300005841 Bacteria 23606
222 Ga0068863_100006070 3300005841 Bacteria 11856
223 Ga0068863_100017572 3300005841 Bacteria 6852
224 Ga0068863_100023730 3300005841 Bacteria 5852
225 Ga0068863_100098149 3300005841 Bacteria 2782
226 Ga0068863_100100249 3300005841 Bacteria 2753
227 Ga0068863_100165654 3300005841 Bacteria 2119
228 Ga0068863_100460692 3300005841 Bacteria 1248
229 Ga0068863_100492097 3300005841 Bacteria 1207
230 Ga0068858_100002434 3300005842 Bacteria 18831
231 Ga0068858_100032548 3300005842 Bacteria 4841
232 Ga0068858_100048454 3300005842 Bacteria 3937
233 Ga0068858_100090797 3300005842 Bacteria 2843
234 Ga0068860_100003459 3300005843 Bacteria 16243
235 Ga0068860_100007769 3300005843 Bacteria 10713
236 Ga0068860_100008108 3300005843 Bacteria 10461
237 Ga0068860_100018724 3300005843 Bacteria 6729
238 Ga0068860_100261903 3300005843 Bacteria 1686
239 Ga0068860_100302306 3300005843 Bacteria 1567
240 Ga0068860_100664330 3300005843 Bacteria 1050
241 Ga0068862_100003216 3300005844 Bacteria 14150
242 Ga0068862_100021779 3300005844 Bacteria 5359
243 Ga0068862_100088888 3300005844 Bacteria 2688
244 Ga0068862_100144845 3300005844 Bacteria 2111
245 Ga0068862_100179536 3300005844 Bacteria 1899
246 Ga0081539_10056145 3300005985 Bacteria 2187
247 Ga0070712_100024560 3300006175 Bacteria 3996
248 Ga0075366_10037760 3300006195 Bacteria 2852
249 Ga0097621_100025500 3300006237 Bacteria 4626
250 Ga0097621_100026351 3300006237 Bacteria 4559
251 Ga0097621_100047424 3300006237 Bacteria 3482
252 Ga0097621_100067938 3300006237 Bacteria 2938
253 Ga0097621_100572387 3300006237 Bacteria 1030
254 Ga0068871_100045354 3300006358 Bacteria 3538
255 Ga0068871_100108896 3300006358 Bacteria 2329
256 Ga0075433_10119249 3300006852 Bacteria 2342
257 Ga0075434_100246229 3300006871 Bacteria 1807
258 Ga0068865_100002695 3300006881 Bacteria 10530
259 Ga0068865_100348626 3300006881 Bacteria 1199
260 Ga0068865_100539386 3300006881 Bacteria 978
261 Ga0097620_100000117 3300006931 Bacteria 75377
262 Ga0097620_100000550 3300006931 Bacteria 37222
263 Ga0097620_100002851 3300006931 Bacteria 17533
264 Ga0097620_100014415 3300006931 Bacteria 7932
265 Ga0097620_100092818 3300006931 Bacteria 3070
266 Ga0097620_100103827 3300006931 Bacteria 2900
267 Ga0097620_100147529 3300006931 Bacteria 2428
268 Ga0075435_100140843 3300007076 Bacteria 2023
269 Ga0075435_100552855 3300007076 Bacteria 997
270 Ga0105251_10037707 3300009011 Bacteria 2370
271 Ga0105250_10015534 3300009092 Bacteria 3117
272 Ga0105240_10009967 3300009093 Bacteria 13393
273 Ga0105240_10253039 3300009093 Bacteria 2036
274 Ga0111539_10037714 3300009094 Bacteria 5834
275 Ga0111539_10065212 3300009094 Bacteria 4305
276 Ga0111539_10106513 3300009094 Bacteria 3289
277 Ga0105245_10000198 3300009098 Bacteria 57372
278 Ga0105245_10262932 3300009098 Bacteria 1680
279 Ga0105245_10285104 3300009098 Bacteria 1616
280 Ga0105247_10091501 3300009101 Bacteria 1932
281 Ga0105243_10018259 3300009148 Bacteria 5311
282 Ga0105243_10167270 3300009148 Bacteria 1901
283 Ga0105243_10167837 3300009148 Bacteria 1898
284 Ga0105243_10476174 3300009148 Bacteria 1177
285 Ga0105241_10028003 3300009174 Bacteria 4197
286 Ga0105241_10134110 3300009174 Bacteria 2008
287 Ga0105248_10000391 3300009177 Bacteria 50565
288 Ga0105248_10000496 3300009177 Bacteria 44725
289 Ga0105248_10017284 3300009177 Bacteria 7947
290 Ga0105248_10018865 3300009177 Bacteria 7628
291 Ga0105248_10055389 3300009177 Bacteria 4448
292 Ga0105248_10124424 3300009177 Bacteria 2909
293 Ga0105248_10232627 3300009177 Bacteria 2075
294 Ga0105248_10299264 3300009177 Bacteria 1812
295 Ga0105248_10305675 3300009177 Bacteria 1791
296 Ga0105248_10535896 3300009177 Bacteria 1320
297 Ga0105248_11027360 3300009177 Bacteria 931
298 Ga0105248_11027363 3300009177 Bacteria 931
299 Ga0105248_11093782 3300009177 Bacteria 901
300 Ga0105237_10144323 3300009545 Bacteria 2375
301 Ga0105238_10087182 3300009551 Bacteria 3108
302 Ga0105238_10295704 3300009551 Bacteria 1602
303 Ga0105249_10038374 3300009553 Bacteria 4346
304 Ga0105249_10052338 3300009553 Bacteria 3728
305 Ga0105249_10089902 3300009553 Bacteria 2870
306 Ga0105249_10128202 3300009553 Bacteria 2419
307 Ga0105148_100194 3300009978 Bacteria 8830
308 Ga0105239_10095250 3300010375 Bacteria 3289
309 Ga0105246_10003426 3300011119 Bacteria 9613
310 Ga0157373_10067881 3300013100 Bacteria 2521
311 Ga0157373_10070480 3300013100 Bacteria 2470
312 Ga0157373_10280472 3300013100 Bacteria 1181
313 Ga0157373_10474101 3300013100 Bacteria 902
314 Ga0157371_10003235 3300013102 Bacteria 14949
315 Ga0157371_10006285 3300013102 Bacteria 9839
316 Ga0157371_10065965 3300013102 Bacteria 2564
317 Ga0157371_10170589 3300013102 Unclassified 1555
318 Ga0157371_10336512 3300013102 Bacteria 1097
319 Ga0157370_10126848 3300013104 Bacteria 2382
320 Ga0157369_10012975 3300013105 Bacteria 9441
321 Ga0157369_10465587 3300013105 Bacteria 1309
322 Ga0157374_10073646 3300013296 Bacteria 3224
323 Ga0157374_10082102 3300013296 Bacteria 3060
324 Ga0157374_10104247 3300013296 Bacteria 2723
325 Ga0157374_10341897 3300013296 Bacteria 1486
326 Ga0157378_10010220 3300013297 Bacteria 8191
327 Ga0157378_10291593 3300013297 Bacteria 1576
328 Ga0157378_11052174 3300013297 Bacteria 850
329 Ga0163162_10012937 3300013306 Bacteria 8147
330 Ga0163162_10032902 3300013306 Bacteria 5150
331 Ga0163162_10067373 3300013306 Bacteria 3630
332 Ga0163162_10348356 3300013306 Bacteria 1614
333 Ga0163162_10538075 3300013306 Bacteria 1297
334 Ga0157372_10029860 3300013307 Bacteria 5957
335 Ga0157372_10115418 3300013307 Bacteria 3078
336 Ga0157372_10298178 3300013307 Bacteria 1875
337 Ga0157375_10026988 3300013308 Bacteria 5361
338 Ga0157375_10142622 3300013308 Bacteria 2524
339 Ga0157375_10220500 3300013308 Bacteria 2055
340 Ga0157375_10232514 3300013308 Bacteria 2002
341 Ga0157375_10433656 3300013308 Bacteria 1480
342 Ga0163163_10000259 3300014325 Bacteria 53596
343 Ga0163163_10024782 3300014325 Bacteria 5713
344 Ga0163163_10180142 3300014325 Bacteria 2160
345 Ga0163163_10202823 3300014325 Bacteria 2032
346 Ga0163163_10464493 3300014325 Bacteria 1326
347 Ga0157380_10016309 3300014326 Bacteria 5476
348 Ga0157380_10251962 3300014326 Bacteria 1598
349 Ga0157380_10518696 3300014326 Bacteria 1162
350 Ga0157380_10984176 3300014326 Bacteria 876
351 Ga0182008_10224359 3300014497 Bacteria 962
352 Ga0157377_10036504 3300014745 Bacteria 2704
353 Ga0157379_10021135 3300014968 Bacteria 5759
354 Ga0157379_10044039 3300014968 Bacteria 3985
355 Ga0157379_10083547 3300014968 Bacteria 2862
356 Ga0157379_10218501 3300014968 Bacteria 1727
357 Ga0157376_10848196 3300014969 Bacteria 929
358 Ga0163161_10048183 3300017792 Bacteria 3077
359 Ga0163161_10655289 3300017792 Bacteria 870
360 Ga0206353_11234014 3300020082 Bacteria 1037
361 Ga0207673_1002027 3300025290 Bacteria 2268
362 Ga0207673_1012362 3300025290 Bacteria 1112
363 Ga0207697_10000018 3300025315 Bacteria 56160
364 Ga0207697_10000033 3300025315 Bacteria 50935
365 Ga0207697_10192128 3300025315 Bacteria 896
366 Ga0207656_10005815 3300025321 Bacteria 4391
367 Ga0207656_10020508 3300025321 Bacteria 2628
368 Ga0207656_10110655 3300025321 Bacteria 1269
369 Ga0207656_10160156 3300025321 Bacteria 1071
370 Ga0207696_1007722 3300025711 Bacteria 4181
371 Ga0207682_10000729 3300025893 Bacteria 15261
372 Ga0207682_10008224 3300025893 Bacteria 4135
373 Ga0207710_10094816 3300025900 Bacteria 1401
374 Ga0207688_10000214 3300025901 Bacteria 25912
375 Ga0207688_10027887 3300025901 Bacteria 3106
376 Ga0207688_10039801 3300025901 Bacteria 2611
377 Ga0207688_10098478 3300025901 Bacteria 1686
378 Ga0207680_10111902 3300025903 Bacteria 1772
379 Ga0207647_10000550 3300025904 Bacteria 29810
380 Ga0207647_10025102 3300025904 Bacteria 3922
381 Ga0207647_10058454 3300025904 Bacteria 2361
382 Ga0207647_10066287 3300025904 Bacteria 2190
383 Ga0207645_10007108 3300025907 Bacteria 7952
384 Ga0207645_10032067 3300025907 Bacteria 3378
385 Ga0207645_10052714 3300025907 Bacteria 2599
386 Ga0207645_10187163 3300025907 Bacteria 1360
387 Ga0207645_10259144 3300025907 Bacteria 1152
388 Ga0207705_10000381 3300025909 Bacteria 39740
389 Ga0207705_10000753 3300025909 Bacteria 26696
390 Ga0207705_10021172 3300025909 Bacteria 4638
391 Ga0207705_10026189 3300025909 Bacteria 4160
392 Ga0207705_10035872 3300025909 Bacteria 3548
393 Ga0207705_10050454 3300025909 Bacteria 2995
394 Ga0207705_10053983 3300025909 Bacteria 2896
395 Ga0207705_10108659 3300025909 Bacteria 2047
396 Ga0207705_10156319 3300025909 Bacteria 1711
397 Ga0207707_10649044 3300025912 Bacteria 890
398 Ga0207695_10001271 3300025913 Bacteria 42892
399 Ga0207695_10353186 3300025913 Bacteria 1357
400 Ga0207671_10167760 3300025914 Bacteria 1703
401 Ga0207662_10106491 3300025918 Bacteria 1744
402 Ga0207657_10000737 3300025919 Bacteria 34706
403 Ga0207657_10002095 3300025919 Bacteria 21585
404 Ga0207657_10003757 3300025919 Bacteria 16135
405 Ga0207657_10012097 3300025919 Bacteria 8527
406 Ga0207657_10016080 3300025919 Bacteria 7222
407 Ga0207657_10017166 3300025919 Bacteria 6953
408 Ga0207657_10030767 3300025919 Bacteria 4867
409 Ga0207657_10084053 3300025919 Bacteria 2669
410 Ga0207657_10143506 3300025919 Bacteria 1949
411 Ga0207649_10001845 3300025920 Bacteria 12107
412 Ga0207649_10371375 3300025920 Bacteria 1064
413 Ga0207649_10497734 3300025920 Bacteria 926
414 Ga0207649_10706441 3300025920 Bacteria 782
415 Ga0207652_10727097 3300025921 Bacteria 885
416 Ga0207681_10000693 3300025923 Bacteria 22175
417 Ga0207681_10012851 3300025923 Bacteria 5177
418 Ga0207681_10013451 3300025923 Bacteria 5064
419 Ga0207681_10014674 3300025923 Bacteria 4877
420 Ga0207681_10046368 3300025923 Bacteria 2923
421 Ga0207681_10078258 3300025923 Bacteria 2327
422 Ga0207681_10079839 3300025923 Bacteria 2306
423 Ga0207681_10208098 3300025923 Bacteria 1506
424 Ga0207681_10210620 3300025923 Bacteria 1498
425 Ga0207681_10212683 3300025923 Bacteria 1491
426 Ga0207694_10016585 3300025924 Bacteria 5563
427 Ga0207694_10109188 3300025924 Bacteria 2199
428 Ga0207694_10317104 3300025924 Bacteria 1286
429 Ga0207650_10028713 3300025925 Bacteria 3992
430 Ga0207650_10037950 3300025925 Bacteria 3513
431 Ga0207650_10059283 3300025925 Bacteria 2853
432 Ga0207650_10199620 3300025925 Bacteria 1601
433 Ga0207650_10216921 3300025925 Bacteria 1538
434 Ga0207650_10280670 3300025925 Bacteria 1356
435 Ga0207659_10001503 3300025926 Bacteria 13893
436 Ga0207659_10010265 3300025926 Bacteria 5878
437 Ga0207659_10080781 3300025926 Bacteria 2402
438 Ga0207659_10112005 3300025926 Bacteria 2076
439 Ga0207659_10134871 3300025926 Bacteria 1910
440 Ga0207659_10233239 3300025926 Bacteria 1485
441 Ga0207659_10518985 3300025926 Bacteria 1010
442 Ga0207687_10006583 3300025927 Bacteria 7662
443 Ga0207687_10089215 3300025927 Bacteria 2245
444 Ga0207644_10000577 3300025931 Bacteria 23571
445 Ga0207644_10026397 3300025931 Bacteria 4002
446 Ga0207644_10033020 3300025931 Bacteria 3614
447 Ga0207644_10033639 3300025931 Bacteria 3584
448 Ga0207644_10057916 3300025931 Bacteria 2799
449 Ga0207644_10075739 3300025931 Bacteria 2473
450 Ga0207644_10128084 3300025931 Bacteria 1940
451 Ga0207644_10182033 3300025931 Bacteria 1647
452 Ga0207644_10240790 3300025931 Bacteria 1440
453 Ga0207644_10627093 3300025931 Bacteria 894
454 Ga0207690_10004812 3300025932 Bacteria 7966
455 Ga0207690_10005177 3300025932 Bacteria 7691
456 Ga0207690_10011913 3300025932 Bacteria 5200
457 Ga0207690_10012563 3300025932 Bacteria 5068
458 Ga0207690_10058995 3300025932 Bacteria 2598
459 Ga0207690_10073669 3300025932 Bacteria 2362
460 Ga0207690_10134038 3300025932 Bacteria 1817
461 Ga0207690_10241397 3300025932 Bacteria 1392
462 Ga0207690_10256930 3300025932 Bacteria 1352
463 Ga0207690_10329749 3300025932 Bacteria 1202
464 Ga0207690_10455018 3300025932 Bacteria 1029
465 Ga0207706_10000020 3300025933 Bacteria 162063
466 Ga0207706_10000587 3300025933 Bacteria 38710
467 Ga0207706_10004579 3300025933 Bacteria 12980
468 Ga0207706_10011087 3300025933 Bacteria 8215
469 Ga0207706_10014287 3300025933 Bacteria 7198
470 Ga0207706_10056057 3300025933 Bacteria 3475
471 Ga0207706_10140444 3300025933 Bacteria 2125
472 Ga0207706_10144148 3300025933 Bacteria 2096
473 Ga0207709_10287843 3300025935 Bacteria 1216
474 Ga0207709_10848024 3300025935 Bacteria 740
475 Ga0207669_10030588 3300025937 Bacteria 2993
476 Ga0207669_10285768 3300025937 Bacteria 1246
477 Ga0207704_10501116 3300025938 Bacteria 979
478 Ga0207691_10000047 3300025940 Bacteria 99519
479 Ga0207691_10000758 3300025940 Bacteria 31916
480 Ga0207691_10008623 3300025940 Bacteria 9784
481 Ga0207691_10017624 3300025940 Bacteria 6767
482 Ga0207691_10063831 3300025940 Bacteria 3339
483 Ga0207691_10516180 3300025940 Bacteria 1014
484 Ga0207711_10000039 3300025941 Bacteria 162974
485 Ga0207711_10004881 3300025941 Bacteria 11381
486 Ga0207711_10019657 3300025941 Bacteria 5622
487 Ga0207711_10021654 3300025941 Bacteria 5370
488 Ga0207711_10051824 3300025941 Bacteria 3516
489 Ga0207711_10327815 3300025941 Bacteria 1416
490 Ga0207711_10353591 3300025941 Bacteria 1361
491 Ga0207711_10622285 3300025941 Bacteria 1007
492 Ga0207689_10000002 3300025942 Bacteria 198437
493 Ga0207689_10049443 3300025942 Bacteria 3468
494 Ga0207689_10059007 3300025942 Bacteria 3156
495 Ga0207689_10241525 3300025942 Bacteria 1493
496 Ga0207661_10069550 3300025944 Bacteria 2871
497 Ga0207661_10672128 3300025944 Bacteria 952
498 Ga0207661_10829265 3300025944 Bacteria 851
499 Ga0207679_10020102 3300025945 Bacteria 4501
500 Ga0207679_10126048 3300025945 Bacteria 2046
501 Ga0207679_10134176 3300025945 Bacteria 1991
502 Ga0207679_10171401 3300025945 Bacteria 1787
503 Ga0207679_10188908 3300025945 Bacteria 1711
504 Ga0207679_10258047 3300025945 Bacteria 1485
505 Ga0207679_10269572 3300025945 Bacteria 1455
506 Ga0207679_10333351 3300025945 Bacteria 1317
507 Ga0207667_10001174 3300025949 Bacteria 32915
508 Ga0207667_10011475 3300025949 Bacteria 10293
509 Ga0207667_10034342 3300025949 Bacteria 5447
510 Ga0207667_10277278 3300025949 Bacteria 1714
511 Ga0207667_10513436 3300025949 Bacteria 1214
512 Ga0207667_10552624 3300025949 Bacteria 1164
513 Ga0207651_10015010 3300025960 Bacteria 4489
514 Ga0207651_10022324 3300025960 Bacteria 3867
515 Ga0207651_10059855 3300025960 Bacteria 2641
516 Ga0207651_10094858 3300025960 Bacteria 2195
517 Ga0207651_10264625 3300025960 Bacteria 1413
518 Ga0207651_10367943 3300025960 Bacteria 1215
519 Ga0207651_10432136 3300025960 Bacteria 1126
520 Ga0207712_10003912 3300025961 Bacteria 9409
521 Ga0207712_10010289 3300025961 Bacteria 5936
522 Ga0207668_10000271 3300025972 Bacteria 34470
523 Ga0207668_10005220 3300025972 Bacteria 7644
524 Ga0207668_10034741 3300025972 Bacteria 3350
525 Ga0207668_10036593 3300025972 Bacteria 3277
526 Ga0207668_10039740 3300025972 Bacteria 3170
527 Ga0207668_10048375 3300025972 Bacteria 2918
528 Ga0207668_10095547 3300025972 Bacteria 2194
529 Ga0207668_10362098 3300025972 Bacteria 1216
530 Ga0207668_10478365 3300025972 Bacteria 1068
531 Ga0207640_10000295 3300025981 Bacteria 33245
532 Ga0207640_10010972 3300025981 Bacteria 5115
533 Ga0207640_10014967 3300025981 Bacteria 4478
534 Ga0207640_10031236 3300025981 Bacteria 3289
535 Ga0207640_10054588 3300025981 Bacteria 2613
536 Ga0207640_10112200 3300025981 Bacteria 1935
537 Ga0207640_10269863 3300025981 Bacteria 1330
538 Ga0207640_10375569 3300025981 Bacteria 1150
539 Ga0207640_10675522 3300025981 Bacteria 883
540 Ga0207658_10000833 3300025986 Bacteria 25774
541 Ga0207658_10073609 3300025986 Bacteria 2593
542 Ga0207658_10134333 3300025986 Bacteria 1992
543 Ga0207658_10169693 3300025986 Bacteria 1796
544 Ga0207658_10172900 3300025986 Bacteria 1781
545 Ga0207658_10193817 3300025986 Bacteria 1691
546 Ga0207658_10338907 3300025986 Bacteria 1306
547 Ga0207658_10440515 3300025986 Bacteria 1152
548 Ga0207658_10483303 3300025986 Bacteria 1101
549 Ga0207677_10002005 3300026023 Bacteria 10733
550 Ga0207677_10002555 3300026023 Bacteria 9562
551 Ga0207703_10001056 3300026035 Bacteria 26258
552 Ga0207703_10004683 3300026035 Bacteria 11171
553 Ga0207703_10005296 3300026035 Bacteria 10400
554 Ga0207703_10018862 3300026035 Bacteria 5388
555 Ga0207703_10019558 3300026035 Bacteria 5292
556 Ga0207703_10021282 3300026035 Bacteria 5078
557 Ga0207639_10067403 3300026041 Bacteria 2785
558 Ga0207639_10142430 3300026041 Bacteria 1999
559 Ga0207678_10001454 3300026067 Bacteria 21739
560 Ga0207678_10007598 3300026067 Bacteria 9578
561 Ga0207678_10025713 3300026067 Bacteria 5138
562 Ga0207678_10026041 3300026067 Bacteria 5103
563 Ga0207678_10030618 3300026067 Bacteria 4698
564 Ga0207678_10092995 3300026067 Bacteria 2577
565 Ga0207678_10099650 3300026067 Bacteria 2482
566 Ga0207708_10818151 3300026075 Bacteria 803
567 Ga0207702_10006644 3300026078 Bacteria 9947
568 Ga0207702_10060735 3300026078 Bacteria 3222
569 Ga0207702_10231218 3300026078 Bacteria 1728
570 Ga0207702_10316953 3300026078 Bacteria 1484
571 Ga0207702_10443982 3300026078 Bacteria 1258
572 Ga0207702_10656673 3300026078 Unclassified 1032
573 Ga0207641_10000185 3300026088 Bacteria 86885
574 Ga0207641_10004554 3300026088 Bacteria 11982
575 Ga0207641_10008337 3300026088 Bacteria 8568
576 Ga0207641_10036535 3300026088 Bacteria 4101
577 Ga0207641_10066576 3300026088 Bacteria 3083
578 Ga0207641_10089434 3300026088 Bacteria 2691
579 Ga0207641_10122082 3300026088 Bacteria 2326
580 Ga0207641_10150886 3300026088 Bacteria 2104
581 Ga0207648_10001030 3300026089 Bacteria 31326
582 Ga0207648_10002686 3300026089 Bacteria 18927
583 Ga0207648_10049286 3300026089 Bacteria 3686
584 Ga0207648_10085779 3300026089 Bacteria 2746
585 Ga0207648_10088576 3300026089 Bacteria 2703
586 Ga0207676_10000531 3300026095 Bacteria 31982
587 Ga0207676_10002332 3300026095 Bacteria 13614
588 Ga0207676_10010677 3300026095 Bacteria 6547
589 Ga0207676_10047955 3300026095 Bacteria 3313
590 Ga0207676_10051022 3300026095 Bacteria 3228
591 Ga0207676_10270989 3300026095 Bacteria 1537
592 Ga0207676_10365850 3300026095 Bacteria 1338
593 Ga0207676_10455810 3300026095 Bacteria 1206
594 Ga0207676_10488548 3300026095 Bacteria 1167
595 Ga0207676_10601888 3300026095 Bacteria 1056
596 Ga0207676_10819383 3300026095 Bacteria 909
597 Ga0207676_11204993 3300026095 Bacteria 750
598 Ga0207674_10000660 3300026116 Bacteria 44851
599 Ga0207674_10000850 3300026116 Bacteria 39849
600 Ga0207674_10000989 3300026116 Bacteria 37099
601 Ga0207674_10008932 3300026116 Bacteria 11518
602 Ga0207674_10013759 3300026116 Bacteria 8955
603 Ga0207674_10053433 3300026116 Bacteria 4118
604 Ga0207674_10135702 3300026116 Bacteria 2423
605 Ga0207674_10766474 3300026116 Bacteria 931
606 Ga0207675_100015430 3300026118 Bacteria 7126
607 Ga0207675_100031522 3300026118 Bacteria 4937
608 Ga0207675_100059455 3300026118 Bacteria 3566
609 Ga0207675_100156615 3300026118 Bacteria 2171
610 Ga0207675_100184181 3300026118 Bacteria 2001
611 Ga0207675_100464192 3300026118 Bacteria 1256
612 Ga0207683_10004026 3300026121 Bacteria 12712
613 Ga0207683_10072655 3300026121 Bacteria 3042
614 Ga0207683_10322067 3300026121 Bacteria 1416
615 Ga0207698_10007514 3300026142 Bacteria 6831
616 Ga0207698_10016649 3300026142 Bacteria 4965
617 Ga0207698_10089128 3300026142 Bacteria 2518
618 Ga0207698_10427012 3300026142 Bacteria 1273
619 Ga0207698_10459547 3300026142 Bacteria 1231
620 Ga0209982_1008459 3300027552 Bacteria 1509
621 Ga0209970_1010866 3300027614 Bacteria 1493
622 Ga0209974_10000970 3300027876 Bacteria 10074
623 Ga0268266_10000256 3300028379 Bacteria 89436
624 Ga0268266_10007470 3300028379 Bacteria 9856
625 Ga0268266_10009513 3300028379 Bacteria 8553
626 Ga0268266_10009798 3300028379 Bacteria 8427
627 Ga0268266_10109116 3300028379 Bacteria 2450
628 Ga0268266_10114013 3300028379 Bacteria 2398
629 Ga0268266_10232067 3300028379 Bacteria 1700
630 Ga0268266_10236031 3300028379 Bacteria 1686
631 Ga0268266_10236442 3300028379 Bacteria 1684
632 Ga0268266_10442430 3300028379 Bacteria 1235
633 Ga0268266_10753922 3300028379 Bacteria 939
634 Ga0268265_10001865 3300028380 Bacteria 16789
635 Ga0268265_10004343 3300028380 Bacteria 9852
636 Ga0268265_10010418 3300028380 Bacteria 6277
637 Ga0268265_10011681 3300028380 Bacteria 5939
638 Ga0268265_10013138 3300028380 Bacteria 5625
639 Ga0268265_10020151 3300028380 Bacteria 4651
640 Ga0268265_10367922 3300028380 Bacteria 1318
641 Ga0268264_10001705 3300028381 Bacteria 20255
642 Ga0268264_10002374 3300028381 Bacteria 16600
643 Ga0268264_10003974 3300028381 Bacteria 12651
644 Ga0268264_10023194 3300028381 Bacteria 5064
645 Ga0268264_10090795 3300028381 Bacteria 2633
646 Ga0268264_10102724 3300028381 Bacteria 2488
647 Ga0268264_10247071 3300028381 Bacteria 1656
648 Ga0268264_10592881 3300028381 Bacteria 1091
649 Ga0268264_10699392 3300028381 Bacteria 1007
650 Ga0316178_1138587 3300030735 Bacteria 1431
651 Ga0316181_1243802 3300030744 Bacteria 829
652 Ga0316182_1163017 3300030745 Bacteria 1559
653 Ga0307408_100045260 3300031548 Bacteria 3142
654 Ga0307408_100071425 3300031548 Bacteria 2566
655 Ga0307408_100082876 3300031548 Bacteria 2401
656 Ga0307408_100092420 3300031548 Bacteria 2287
657 Ga0307408_100107523 3300031548 Bacteria 2136
658 Ga0307408_100144383 3300031548 Bacteria 1871
659 Ga0307408_100166704 3300031548 Bacteria 1755
660 Ga0307408_100192759 3300031548 Bacteria 1643
661 Ga0307408_100201520 3300031548 Bacteria 1611
662 Ga0307408_100229962 3300031548 Bacteria 1518
663 Ga0307408_100265716 3300031548 Bacteria 1422
664 Ga0307408_100282634 3300031548 Bacteria 1382
665 Ga0307408_101135941 3300031548 Bacteria 726
666 Ga0307405_10009206 3300031731 Bacteria 5051
667 Ga0307405_10010136 3300031731 Bacteria 4864
668 Ga0307405_10010479 3300031731 Bacteria 4807
669 Ga0307405_10033419 3300031731 Bacteria 3050
670 Ga0307405_10051631 3300031731 Bacteria 2552
671 Ga0307405_10056240 3300031731 Bacteria 2466
672 Ga0307405_10074374 3300031731 Bacteria 2197
673 Ga0307405_10108247 3300031731 Bacteria 1877
674 Ga0307405_10196720 3300031731 Bacteria 1461
675 Ga0307405_10255538 3300031731 Bacteria 1306
676 Ga0307405_10265376 3300031731 Bacteria 1285
677 Ga0307405_10538163 3300031731 Bacteria 943
678 Ga0307413_10008972 3300031824 Bacteria 4757
679 Ga0307413_10011195 3300031824 Bacteria 4396
680 Ga0307413_10020790 3300031824 Bacteria 3499
681 Ga0307413_10022631 3300031824 Bacteria 3391
682 Ga0307413_10028183 3300031824 Bacteria 3123
683 Ga0307413_10039713 3300031824 Bacteria 2739
684 Ga0307413_10040108 3300031824 Bacteria 2729
685 Ga0307413_10044823 3300031824 Bacteria 2617
686 Ga0307413_10056328 3300031824 Bacteria 2397
687 Ga0307413_10058121 3300031824 Bacteria 2369
688 Ga0307413_10160620 3300031824 Bacteria 1578
689 Ga0307413_10411273 3300031824 Bacteria 1063
690 Ga0307413_10421359 3300031824 Bacteria 1051
691 Ga0307413_10715288 3300031824 Bacteria 833
692 Ga0307413_10771337 3300031824 Bacteria 805
693 Ga0307410_10001969 3300031852 Bacteria 9652
694 Ga0307410_10012661 3300031852 Bacteria 4887
695 Ga0307410_10013617 3300031852 Bacteria 4752
696 Ga0307410_10027200 3300031852 Bacteria 3612
697 Ga0307410_10027771 3300031852 Bacteria 3580
698 Ga0307410_10032555 3300031852 Bacteria 3357
699 Ga0307410_10035882 3300031852 Bacteria 3224
700 Ga0307410_10036957 3300031852 Bacteria 3185
701 Ga0307410_10058436 3300031852 Bacteria 2629
702 Ga0307410_10096247 3300031852 Bacteria 2112
703 Ga0307410_10110092 3300031852 Bacteria 1991
704 Ga0307410_10113734 3300031852 Bacteria 1962
705 Ga0307410_10116509 3300031852 Bacteria 1941
706 Ga0307410_10178219 3300031852 Bacteria 1607
707 Ga0307410_10222723 3300031852 Bacteria 1452
708 Ga0307410_10248266 3300031852 Bacteria 1382
709 Ga0307410_10284679 3300031852 Bacteria 1298
710 Ga0307410_10301228 3300031852 Bacteria 1265
711 Ga0307410_10341655 3300031852 Bacteria 1193
712 Ga0307410_10444452 3300031852 Bacteria 1056
713 Ga0307410_10464915 3300031852 Bacteria 1034
714 Ga0307410_10472490 3300031852 Bacteria 1027
715 Ga0307410_10487186 3300031852 Bacteria 1012
716 Ga0307410_10787649 3300031852 Bacteria 808
717 Ga0307410_10824413 3300031852 Bacteria 790
718 Ga0307406_10007548 3300031901 Bacteria 6036
719 Ga0307406_10017751 3300031901 Bacteria 4148
720 Ga0307406_10031712 3300031901 Bacteria 3220
721 Ga0307406_10059401 3300031901 Bacteria 2461
722 Ga0307406_10098670 3300031901 Bacteria 1984
723 Ga0307406_10198236 3300031901 Bacteria 1476
724 Ga0307406_10323161 3300031901 Bacteria 1194
725 Ga0307406_10349281 3300031901 Bacteria 1155
726 Ga0307406_10354700 3300031901 Bacteria 1147
727 Ga0307406_10404347 3300031901 Bacteria 1083
728 Ga0307406_10761965 3300031901 Bacteria 813
729 Ga0307407_10000507 3300031903 Bacteria 12021
730 Ga0307407_10009728 3300031903 Bacteria 4493
731 Ga0307407_10011673 3300031903 Bacteria 4194
732 Ga0307407_10025376 3300031903 Bacteria 3122
733 Ga0307407_10027656 3300031903 Bacteria 3021
734 Ga0307407_10036503 3300031903 Bacteria 2708
735 Ga0307407_10043691 3300031903 Bacteria 2521
736 Ga0307407_10123273 3300031903 Bacteria 1646
737 Ga0307407_10152887 3300031903 Bacteria 1501
738 Ga0307407_10162659 3300031903 Bacteria 1462
739 Ga0307407_10218170 3300031903 Bacteria 1288
740 Ga0307407_10381936 3300031903 Bacteria 1006
741 Ga0307412_10003491 3300031911 Bacteria 8737
742 Ga0307412_10010357 3300031911 Bacteria 5367
743 Ga0307412_10011525 3300031911 Bacteria 5126
744 Ga0307412_10014564 3300031911 Bacteria 4641
745 Ga0307412_10037336 3300031911 Bacteria 3121
746 Ga0307412_10055814 3300031911 Bacteria 2629
747 Ga0307412_10060902 3300031911 Bacteria 2535
748 Ga0307412_10062672 3300031911 Bacteria 2505
749 Ga0307412_10099665 3300031911 Bacteria 2052
750 Ga0307412_10133268 3300031911 Bacteria 1808
751 Ga0307412_10155712 3300031911 Bacteria 1691
752 Ga0307412_10229614 3300031911 Bacteria 1428
753 Ga0307412_10245502 3300031911 Bacteria 1387
754 Ga0307412_10380179 3300031911 Bacteria 1143
755 Ga0307412_10392198 3300031911 Bacteria 1127
756 Ga0307409_100008423 3300031995 Bacteria 6257
757 Ga0307409_100009895 3300031995 Bacteria 5886
758 Ga0307409_100009955 3300031995 Bacteria 5873
759 Ga0307409_100017193 3300031995 Bacteria 4812
760 Ga0307409_100018767 3300031995 Bacteria 4662
761 Ga0307409_100020564 3300031995 Bacteria 4502
762 Ga0307409_100027103 3300031995 Bacteria 4055
763 Ga0307409_100032072 3300031995 Bacteria 3803
764 Ga0307409_100061131 3300031995 Bacteria 2942
765 Ga0307409_100063024 3300031995 Bacteria 2905
766 Ga0307409_100074357 3300031995 Bacteria 2715
767 Ga0307409_100076328 3300031995 Bacteria 2686
768 Ga0307409_100120643 3300031995 Bacteria 2220
769 Ga0307409_100122748 3300031995 Bacteria 2203
770 Ga0307409_100146222 3300031995 Bacteria 2045
771 Ga0307409_100155201 3300031995 Bacteria 1993
772 Ga0307409_100160666 3300031995 Bacteria 1964
773 Ga0307409_100162402 3300031995 Bacteria 1955
774 Ga0307409_100223216 3300031995 Bacteria 1702
775 Ga0307409_100223642 3300031995 Bacteria 1701
776 Ga0307409_100380827 3300031995 Bacteria 1341
777 Ga0307409_100399987 3300031995 Bacteria 1311
778 Ga0307409_100455781 3300031995 Bacteria 1235
779 Ga0307409_100760530 3300031995 Bacteria 973
780 Ga0307409_100785963 3300031995 Bacteria 958
781 Ga0307416_100004632 3300032002 Bacteria 8321
782 Ga0307416_100021036 3300032002 Bacteria 4673
783 Ga0307416_100025689 3300032002 Bacteria 4324
784 Ga0307416_100058047 3300032002 Bacteria 3135
785 Ga0307416_100091183 3300032002 Bacteria 2616
786 Ga0307416_100129488 3300032002 Bacteria 2268
787 Ga0307416_100150666 3300032002 Bacteria 2132
788 Ga0307416_100152270 3300032002 Bacteria 2123
789 Ga0307416_100283360 3300032002 Bacteria 1635
790 Ga0307416_100353350 3300032002 Bacteria 1488
791 Ga0307416_100440889 3300032002 Bacteria 1352
792 Ga0307416_100478696 3300032002 Bacteria 1304
793 Ga0307416_100481155 3300032002 Bacteria 1301
794 Ga0307416_100723492 3300032002 Bacteria 1086
795 Ga0307416_100884880 3300032002 Bacteria 992
796 Ga0307416_101233410 3300032002 Bacteria 853
797 Ga0307416_101275222 3300032002 Bacteria 840
798 Ga0307414_10007391 3300032004 Bacteria 6173
799 Ga0307414_10007880 3300032004 Bacteria 6009
800 Ga0307414_10011030 3300032004 Bacteria 5281
801 Ga0307414_10015150 3300032004 Bacteria 4648
802 Ga0307414_10037014 3300032004 Bacteria 3263
803 Ga0307414_10039099 3300032004 Bacteria 3193
804 Ga0307414_10043828 3300032004 Bacteria 3051
805 Ga0307414_10045449 3300032004 Bacteria 3007
806 Ga0307414_10048539 3300032004 Bacteria 2929
807 Ga0307414_10083961 3300032004 Bacteria 2340
808 Ga0307414_10088466 3300032004 Bacteria 2292
809 Ga0307414_10096381 3300032004 Bacteria 2213
810 Ga0307414_10183054 3300032004 Bacteria 1687
811 Ga0307414_10193600 3300032004 Bacteria 1647
812 Ga0307414_10220261 3300032004 Bacteria 1557
813 Ga0307414_10242674 3300032004 Bacteria 1492
814 Ga0307414_10263837 3300032004 Bacteria 1439
815 Ga0307414_10318637 3300032004 Bacteria 1322
816 Ga0307414_10350304 3300032004 Bacteria 1267
817 Ga0307414_10386802 3300032004 Bacteria 1211
818 Ga0307414_10739009 3300032004 Bacteria 893
819 Ga0307411_10006435 3300032005 Bacteria 5876
820 Ga0307411_10011440 3300032005 Bacteria 4790
821 Ga0307411_10014743 3300032005 Bacteria 4361
822 Ga0307411_10017550 3300032005 Bacteria 4082
823 Ga0307411_10018478 3300032005 Bacteria 4000
824 Ga0307411_10019231 3300032005 Bacteria 3941
825 Ga0307411_10031789 3300032005 Bacteria 3253
826 Ga0307411_10035118 3300032005 Bacteria 3127
827 Ga0307411_10042575 3300032005 Bacteria 2898
828 Ga0307411_10050910 3300032005 Bacteria 2699
829 Ga0307411_10059186 3300032005 Bacteria 2538
830 Ga0307411_10089866 3300032005 Bacteria 2141
831 Ga0307411_10095131 3300032005 Bacteria 2090
832 Ga0307411_10148905 3300032005 Bacteria 1737
833 Ga0307411_10177852 3300032005 Bacteria 1611
834 Ga0307411_10230710 3300032005 Bacteria 1442
835 Ga0307411_10385475 3300032005 Bacteria 1154
836 Ga0307411_10393199 3300032005 Bacteria 1144
837 Ga0307411_10461044 3300032005 Bacteria 1065
838 Ga0307411_10889307 3300032005 Bacteria 790
839 Ga0307415_100004192 3300032126 Bacteria 7445
840 Ga0307415_100012931 3300032126 Bacteria 4850
841 Ga0307415_100028130 3300032126 Bacteria 3571
842 Ga0307415_100053531 3300032126 Bacteria 2750
843 Ga0307415_100059233 3300032126 Bacteria 2640
844 Ga0307415_100070500 3300032126 Bacteria 2454
845 Ga0307415_100091951 3300032126 Bacteria 2199
846 Ga0307415_100140364 3300032126 Bacteria 1844
847 Ga0307415_100143295 3300032126 Bacteria 1828
848 Ga0307415_100172481 3300032126 Bacteria 1688
849 Ga0307415_100221140 3300032126 Bacteria 1518
850 Ga0307415_100266179 3300032126 Bacteria 1401
851 Ga0307415_100286869 3300032126 Bacteria 1356
852 Ga0307415_100329079 3300032126 Bacteria 1277
853 Ga0307415_100502472 3300032126 Bacteria 1060
854 Ga0307415_100505523 3300032126 Bacteria 1057
855 Ga0373959_0013328 3300034820 Bacteria 1481
856 Ga0373931_0056461 3300035691 Bacteria 2104
857 Ga0395899_0000244 3300037312 Bacteria 72329
858 Ga0395899_0012848 3300037312 Bacteria 6412
859 Ga0395899_0012953 3300037312 Bacteria 6379
860 Ga0395899_0022126 3300037312 Bacteria 4821
861 Ga0395899_0024709 3300037312 Bacteria 4541
862 Ga0395899_0064345 3300037312 Bacteria 2696
863 Ga0395899_0100747 3300037312 Bacteria 2085
864 Ga0395899_0114346 3300037312 Bacteria 1938
865 Ga0395899_0211757 3300037312 Bacteria 1346
866 Ga0395899_0264318 3300037312 Bacteria 1175
867 Ga0395900_0000771 3300037418 Bacteria 42659
868 Ga0395900_0001571 3300037418 Bacteria 27038
869 Ga0395900_0012982 3300037418 Bacteria 8511
870 Ga0395900_0042273 3300037418 Bacteria 4695
871 Ga0395900_0052006 3300037418 Bacteria 4218
872 Ga0395900_0076069 3300037418 Bacteria 3450
873 Ga0395900_0193819 3300037418 Bacteria 2060
874 Ga0395900_0203928 3300037418 Bacteria 1999
875 Ga0395900_0288763 3300037418 Bacteria 1629
876 Ga0395900_0330080 3300037418 Bacteria 1503
877 Ga0395900_0377097 3300037418 Bacteria 1387
878 Ga0395900_0396800 3300037418 Bacteria 1344
879 Ga0395900_0557802 3300037418 Bacteria 1089
880 Ga0395900_0729076 3300037418 Bacteria 923
881 Ga0395900_0749914 3300037418 Bacteria 906
882 Ga0395898_0023448 3300037466 Bacteria 6236
883 Ga0395898_0037494 3300037466 Bacteria 4807
884 Ga0395898_0038671 3300037466 Bacteria 4727
885 Ga0395898_0040725 3300037466 Bacteria 4592
886 Ga0395898_0097754 3300037466 Bacteria 2819
887 Ga0395898_0110390 3300037466 Bacteria 2636
888 Ga0395898_0123817 3300037466 Bacteria 2477
889 Ga0395898_0354805 3300037466 Bacteria 1398
890 Ga0395898_0452013 3300037466 Bacteria 1223
891 Ga0395898_0488162 3300037466 Bacteria 1172
892 Ga0395898_0542133 3300037466 Bacteria 1105
893 Ga0395905_0000104 3300037471 Bacteria 141965
894 Ga0395905_0019873 3300037471 Bacteria 6365
895 Ga0395905_0021300 3300037471 Bacteria 6132
896 Ga0395905_0028346 3300037471 Bacteria 5279
897 Ga0395905_0032713 3300037471 Bacteria 4889
898 Ga0395905_0046362 3300037471 Bacteria 4075
899 Ga0395905_0049355 3300037471 Bacteria 3943
900 Ga0395905_0057343 3300037471 Bacteria 3643
901 Ga0395905_0059199 3300037471 Bacteria 3581
902 Ga0395905_0079651 3300037471 Bacteria 3071
903 Ga0395905_0111432 3300037471 Bacteria 2570
904 Ga0395905_0117199 3300037471 Bacteria 2502
905 Ga0395905_0129080 3300037471 Bacteria 2377
906 Ga0395905_0144298 3300037471 Bacteria 2240
907 Ga0395905_0235398 3300037471 Bacteria 1712
908 Ga0395905_0276608 3300037471 Bacteria 1565
909 Ga0395905_0284020 3300037471 Bacteria 1541
910 Ga0395905_0290732 3300037471 Bacteria 1521
911 Ga0395905_0345275 3300037471 Bacteria 1380
912 Ga0395905_0366860 3300037471 Bacteria 1333
913 Ga0395905_0465047 3300037471 Bacteria 1163
914 Ga0395905_0473615 3300037471 Bacteria 1151
915 Ga0395905_0756892 3300037471 Bacteria 874
916 Ga0395905_0950131 3300037471 Bacteria 762
917 Ga0395905_0991996 3300037471 Bacteria 743
918 Ga0395901_0000206 3300038443 Bacteria 73997
919 Ga0395901_0034040 3300038443 Bacteria 5260
920 Ga0395901_0045965 3300038443 Bacteria 4533
921 Ga0395901_0121658 3300038443 Bacteria 2743
922 Ga0395901_0154234 3300038443 Bacteria 2412
923 Ga0395901_0223912 3300038443 Bacteria 1965
924 Ga0395901_0387472 3300038443 Bacteria 1437
925 Ga0395901_0472106 3300038443 Bacteria 1280
926 Ga0395901_0486410 3300038443 Bacteria 1258
927 Ga0395901_0514437 3300038443 Bacteria 1217
928 Ga0395901_0621109 3300038443 Bacteria 1087
929 Ga0395901_0638793 3300038443 Bacteria 1069
930 Ga0395901_0726082 3300038443 Bacteria 988
931 Ga0439445_0014536 3300042004 Bacteria 1918
932 Ga0439449_0086382 3300042007 Bacteria 1158
933 Ga0439464_0002162 3300042439 Bacteria 4806
934 Ga0466969_0011141 3300044656 Bacteria 4762
935 Ga0466965_0252038 3300044683 Bacteria 947
936 Ga0466966_0031552 3300044684 Bacteria 3435
937 Ga0466966_0036557 3300044684 Bacteria 3170
938 Ga0466966_0339542 3300044684 Bacteria 902
939 Ga0466961_0002323 3300044693 Bacteria 11812
940 Ga0466961_0194105 3300044693 Bacteria 1258
941 Ga0466961_0211063 3300044693 Bacteria 1198
942 Ga0466963_0150214 3300044694 Bacteria 1617
943 Ga0466964_0128323 3300044706 Bacteria 1152
944 Ga0466971_0001631 3300044719 Bacteria 9469
945 Ga0466971_0047049 3300044719 Bacteria 1939
946 Ga0466970_0077007 3300044765 Bacteria 1798
947 Ga0466970_0171950 3300044765 Bacteria 1201
948 Ga0466957_0008025 3300044842 Bacteria 5988
949 Ga0466959_0036050 3300045049 Bacteria 3655
950 Ga0466959_0145379 3300045049 Unclassified 1673
951 Ga0466959_0262882 3300045049 Bacteria 1187
952 Ga0466958_0000996 3300045836 Bacteria 12814
953 Ga0466958_0080985 3300045836 Bacteria 1998
954 Ga0466958_0212719 3300045836 Bacteria 1232
955 Ga0466958_0346554 3300045836 Bacteria 956
956 Ga0466967_0063223 3300045976 Bacteria 3288
957 Ga0466967_0317757 3300045976 Bacteria 1501
958 Ga0466967_0531769 3300045976 Bacteria 1156
959 Ga0495617_014967 3300046452 Bacteria 2632
960 Ga0495627_000171 3300046453 Bacteria 74013
961 Ga0495627_000772 3300046453 Bacteria 23797
962 Ga0495585_0010873 3300046492 Bacteria 5408
963 Ga0495585_0146835 3300046492 Bacteria 1232
964 Ga0495596_0046357 3300046500 Bacteria 1708
965 Ga0495610_0000199 3300046512 Bacteria 67146
966 Ga0495610_0044805 3300046512 Bacteria 2193
967 Ga0495632_0000070 3300046519 Bacteria 107264
968 Ga0495637_0000985 3300046520 Bacteria 18017
969 Ga0495643_0000010 3300046522 Bacteria 341431
970 Ga0495648_0011105 3300046524 Bacteria 6816
971 Ga0495648_0018748 3300046524 Bacteria 4885
972 Ga0495663_0000004 3300046525 Bacteria 355166
973 Ga0495663_0000427 3300046525 Bacteria 15373
974 Ga0495663_0001354 3300046525 Bacteria 7732
975 Ga0495663_0034123 3300046525 Bacteria 1522
976 Ga0495663_0046017 3300046525 Bacteria 1339
977 Ga0495598_0002390 3300046537 Bacteria 3873
978 Ga0495598_0025634 3300046537 Bacteria 1610
979 Ga0495621_0000618 3300046539 Bacteria 8932
980 Ga0495621_0002153 3300046539 Bacteria 5235
981 Ga0495621_0023663 3300046539 Bacteria 2045
982 Ga0495621_0028853 3300046539 Bacteria 1888
983 Ga0495633_0000105 3300046558 Bacteria 113385
984 Ga0495633_0000243 3300046558 Bacteria 66073
985 Ga0495633_0005349 3300046558 Bacteria 7872
986 Ga0495633_0017103 3300046558 Bacteria 3718
987 Ga0495633_0050871 3300046558 Bacteria 1952
988 Ga0495668_0090625 3300046616 Bacteria 1675
989 Ga0495668_0194802 3300046616 Bacteria 1110
990 Ga0495668_0335856 3300046616 Bacteria 829
991 Ga0495625_0125426 3300046660 Bacteria 1743
992 Ga0495659_0006728 3300046664 Bacteria 3631
993 Ga0495661_0191384 3300046665 Bacteria 1077
994 Ga0495669_0011907 3300046684 Bacteria 3699
995 Ga0495669_0015379 3300046684 Bacteria 3277
996 Ga0495669_0015681 3300046684 Bacteria 3245
997 Ga0495670_0017174 3300046691 Bacteria 3560
998 Ga0495671_0000014 3300046692 Bacteria 341431
999 Ga0495672_0088178 3300047320 Bacteria 1711
1000 Ga0495683_0264647 3300047323 Bacteria 750
1001 Ga0495677_0009500 3300047445 Bacteria 3591
1002 Ga0495673_0025461 3300047469 Bacteria 2840
1003 Ga0495681_0000038 3300047470 Bacteria 121100
1004 Ga0495681_0006285 3300047470 Bacteria 7827
1005 Ga0495686_0048879 3300047472 Bacteria 2665
1006 Ga0495686_0089404 3300047472 Bacteria 1871
1007 Ga0495686_0159797 3300047472 Bacteria 1317
1008 Ga0496100_0036081 3300048903 Bacteria 3115
1009 Ga0496100_0042875 3300048903 Bacteria 2892
1010 Ga0496101_0009090 3300048904 Bacteria 6518
1011 Ga0496102_0148254 3300048905 Bacteria 2203
1012 Ga0496103_0015730 3300048906 Bacteria 4510
1013 Ga0496103_0016026 3300048906 Bacteria 4471
1014 Ga0496103_0088207 3300048906 Bacteria 1956
1015 Ga0496104_0018103 3300048907 Bacteria 6424
1016 Ga0496104_0298632 3300048907 Bacteria 1523
1017 Ga0496106_0457637 3300048909 Bacteria 1025
1018 Ga0496106_0573929 3300048909 Bacteria 904
1019 Ga0496107_0006063 3300048910 Bacteria 8296
1020 Ga0496107_0031534 3300048910 Bacteria 3783
1021 Ga0496107_0418335 3300048910 Bacteria 996
1022 Ga0496108_0007779 3300048911 Bacteria 8682
1023 Ga0496108_0018945 3300048911 Bacteria 5643
1024 Ga0496108_0443784 3300048911 Bacteria 1133
1025 Ga0496108_0871836 3300048911 Bacteria 774
1026 Ga0496109_0012341 3300048912 Bacteria 7375
1027 Ga0496109_0059203 3300048912 Bacteria 3499
1028 Ga0496109_0674803 3300048912 Bacteria 971
1029 Ga0496109_0733896 3300048912 Bacteria 925
1030 Ga0496110_0025829 3300048913 Bacteria 5022
1031 Ga0496110_0084239 3300048913 Bacteria 2837
1032 Ga0496110_0395432 3300048913 Bacteria 1260
1033 Ga0496111_0001666 3300048914 Bacteria 12931
1034 Ga0496111_0026524 3300048914 Bacteria 4093
1035 Ga0496111_0412519 3300048914 Bacteria 998
1036 Ga0496112_0039335 3300048915 Bacteria 4621
1037 Ga0496112_0045584 3300048915 Bacteria 4298
1038 Ga0496112_0082911 3300048915 Bacteria 3170
1039 Ga0496112_0158413 3300048915 Bacteria 2230
1040 Ga0496113_0022540 3300048916 Bacteria 4456
1041 Ga0496113_0024972 3300048916 Bacteria 4255
1042 Ga0496113_0032770 3300048916 Bacteria 3777
1043 Ga0496114_0021803 3300048917 Bacteria 5213
1044 Ga0496114_0157184 3300048917 Bacteria 1974
1045 Ga0496114_0228384 3300048917 Bacteria 1635
1046 Ga0496115_0006312 3300048918 Bacteria 8676
1047 Ga0496116_0038226 3300048919 Bacteria 3336
1048 Ga0496117_0009738 3300048920 Bacteria 8867
1049 Ga0496118_0018120 3300048921 Bacteria 6369
1050 Ga0496118_0266878 3300048921 Bacteria 962
1051 Ga0496119_0208708 3300048922 Bacteria 1006
1052 Ga0496121_0002562 3300048924 Bacteria 27530
1053 Ga0496124_0026593 3300048927 Bacteria 5214
1054 Ga0496124_0156338 3300048927 Bacteria 1782
1055 Ga0496125_0065890 3300048928 Bacteria 2866
1056 Ga0496126_0007852 3300048929 Bacteria 11625
1057 Ga0495678_013528 3300049459 Bacteria 3828
1058 Ga0501067_0028361 3300049583 Bacteria 3101
1059 Ga0501070_0037474 3300049586 Bacteria 4048
1060 Ga0501071_0644448 3300049587 Bacteria 815
1061 Ga0501221_022269 3300049704 Bacteria 1255
1062 Ga0501268_008611 3300049765 Bacteria 1550
1063 nmdc:mga0k408_50273_c1 3300050493 Bacteria 2413
1064 nmdc:mga06r32_439643_c1 3300050510 Bacteria 1284
1065 nmdc:mga08y16_205569_c1 3300050511 Bacteria 2040
1066 nmdc:mga08y16_749337_c1 3300050511 Bacteria 973
1067 nmdc:mga0n895_246409_c1 3300050512 Bacteria 1813
1068 nmdc:mga0n895_711757_c1 3300050512 Bacteria 999
1069 nmdc:mga0rr50_334810_c1 3300050513 Bacteria 1271
1070 nmdc:mga0a205_3791_c1 3300050515 Bacteria 13540
1071 Ga0500658_0001562 3300053134 Bacteria 9136
1072 Ga0466962_0000475 3300061719 Bacteria 17410

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026078 Ga0207702_10443982 Ga0207702_104439821 189
2 3300025932 Ga0207690_10256930 Ga0207690_102569302 196
3 3300020082 Ga0206353_11234014 Ga0206353_112340141 201
4 3300025919 Ga0207657_10017166 Ga0207657_100171662 201
5 3300037312 Ga0395899_0000244 Ga0395899_0000244_50578_51240 201
6 3300037418 Ga0395900_0000771 Ga0395900_0000771_21085_21747 201
7 3300037466 Ga0395898_0038671 Ga0395898_0038671_3195_3857 201
8 3300038443 Ga0395901_0000206 Ga0395901_0000206_51614_52276 201
9 3300042004 Ga0439445_0014536 Ga0439445_0014536_1104_1766 206
10 3300017792 Ga0163161_10655289 Ga0163161_106552892 208
11 3300031852 Ga0307410_10222723 Ga0307410_102227231 208
12 3300031852 Ga0307410_10472490 Ga0307410_104724902 208
13 3300032004 Ga0307414_10043828 Ga0307414_100438284 208
14 3300032005 Ga0307411_10393199 Ga0307411_103931992 208
15 iso_pu_bacteria 2599185354 2600201946 215
16 iso_pu_bacteria 2885427238 2885427261 215
17 iso_pu_bacteria 2896429255 2896432104 215
18 iso_pu_bacteria 2919709256 2919711999 215
19 3300009098 Ga0105245_10262932 Ga0105245_102629322 217
20 2162886007 SwRhRL2b_contig_1927051 SwRhRL2b_0280.00001870 219
21 3300001904 JGI24736J21556_1001480 JGI24736J21556_10014805 219
22 3300001989 JGI24739J22299_10000541 JGI24739J22299_100005414 219
23 3300001989 JGI24739J22299_10002564 JGI24739J22299_100025648 219
24 3300001990 JGI24737J22298_10000120 JGI24737J22298_1000012028 219
25 3300001990 JGI24737J22298_10002837 JGI24737J22298_100028375 219
26 3300001990 JGI24737J22298_10003192 JGI24737J22298_100031927 219
27 3300002067 JGI24735J21928_10034709 JGI24735J21928_100347093 219
28 3300002067 JGI24735J21928_10072955 JGI24735J21928_100729552 219
29 3300002075 JGI24738J21930_10000025 JGI24738J21930_1000002526 219
30 3300005289 Ga0065704_10001055 Ga0065704_1000105516 219
31 3300005289 Ga0065704_10004681 Ga0065704_100046817 219
32 3300005293 Ga0065715_10000355 Ga0065715_100003555 219
33 3300005293 Ga0065715_10029831 Ga0065715_100298312 219
34 3300005293 Ga0065715_10201452 Ga0065715_102014522 219
35 3300005327 Ga0070658_10005845 Ga0070658_100058458 219
36 3300005327 Ga0070658_10036441 Ga0070658_100364414 219
37 3300005327 Ga0070658_10073094 Ga0070658_100730943 219
38 3300005327 Ga0070658_10160028 Ga0070658_101600283 219
39 3300005327 Ga0070658_10174042 Ga0070658_101740422 219
40 3300005327 Ga0070658_10180096 Ga0070658_101800962 219
41 3300005327 Ga0070658_10245432 Ga0070658_102454322 219
42 3300005327 Ga0070658_10290639 Ga0070658_102906392 219
43 3300005327 Ga0070658_10478532 Ga0070658_104785322 219
44 3300005328 Ga0070676_10003807 Ga0070676_100038076 219
45 3300005328 Ga0070676_10010466 Ga0070676_100104665 219
46 3300005328 Ga0070676_10028555 Ga0070676_100285553 219
47 3300005328 Ga0070676_10662822 Ga0070676_106628221 219
48 3300005329 Ga0070683_100097843 Ga0070683_1000978433 219
49 3300005329 Ga0070683_100560335 Ga0070683_1005603352 219
50 3300005330 Ga0070690_100030536 Ga0070690_1000305361 219
51 3300005330 Ga0070690_100151959 Ga0070690_1001519593 219
52 3300005331 Ga0070670_100002152 Ga0070670_1000021528 219
53 3300005331 Ga0070670_100009531 Ga0070670_1000095315 219
54 3300005331 Ga0070670_100036658 Ga0070670_1000366584 219
55 3300005331 Ga0070670_100092789 Ga0070670_1000927891 219
56 3300005331 Ga0070670_100126821 Ga0070670_1001268212 219
57 3300005331 Ga0070670_100322599 Ga0070670_1003225992 219
58 3300005331 Ga0070670_100397273 Ga0070670_1003972731 219
59 3300005331 Ga0070670_100495988 Ga0070670_1004959882 219
60 3300005331 Ga0070670_101055236 Ga0070670_1010552361 219
61 3300005333 Ga0070677_10001821 Ga0070677_100018215 219
62 3300005333 Ga0070677_10016028 Ga0070677_100160282 219
63 3300005334 Ga0068869_100000003 Ga0068869_100000003141 219
64 3300005335 Ga0070666_10015682 Ga0070666_100156824 219
65 3300005338 Ga0068868_100001817 Ga0068868_1000018177 219
66 3300005338 Ga0068868_100197765 Ga0068868_1001977653 219
67 3300005339 Ga0070660_100001069 Ga0070660_10000106913 219
68 3300005339 Ga0070660_100002117 Ga0070660_10000211712 219
69 3300005339 Ga0070660_100002261 Ga0070660_10000226110 219
70 3300005339 Ga0070660_100016742 Ga0070660_1000167424 219
71 3300005339 Ga0070660_100018036 Ga0070660_1000180362 219
72 3300005339 Ga0070660_100092755 Ga0070660_1000927554 219
73 3300005339 Ga0070660_100095904 Ga0070660_1000959042 219
74 3300005339 Ga0070660_100194282 Ga0070660_1001942821 219
75 3300005339 Ga0070660_100355249 Ga0070660_1003552491 219
76 3300005339 Ga0070660_100397341 Ga0070660_1003973411 219
77 3300005339 Ga0070660_100465402 Ga0070660_1004654022 219
78 3300005340 Ga0070689_100681749 Ga0070689_1006817491 219
79 3300005343 Ga0070687_100079709 Ga0070687_1000797091 219
80 3300005343 Ga0070687_100083707 Ga0070687_1000837073 219
81 3300005344 Ga0070661_100009134 Ga0070661_1000091345 219
82 3300005344 Ga0070661_100312621 Ga0070661_1003126212 219
83 3300005344 Ga0070661_100322969 Ga0070661_1003229692 219
84 3300005347 Ga0070668_100000948 Ga0070668_1000009482 219
85 3300005347 Ga0070668_100001033 Ga0070668_10000103319 219
86 3300005347 Ga0070668_100003955 Ga0070668_1000039559 219
87 3300005347 Ga0070668_100052400 Ga0070668_1000524003 219
88 3300005347 Ga0070668_100108317 Ga0070668_1001083173 219
89 3300005347 Ga0070668_100466052 Ga0070668_1004660522 219
90 3300005353 Ga0070669_100000138 Ga0070669_10000013850 219
91 3300005353 Ga0070669_100024273 Ga0070669_1000242734 219
92 3300005353 Ga0070669_100107191 Ga0070669_1001071913 219
93 3300005353 Ga0070669_100113653 Ga0070669_1001136532 219
94 3300005353 Ga0070669_100137880 Ga0070669_1001378802 219
95 3300005353 Ga0070669_100155315 Ga0070669_1001553152 219
96 3300005353 Ga0070669_100182580 Ga0070669_1001825802 219
97 3300005353 Ga0070669_100386697 Ga0070669_1003866971 219
98 3300005354 Ga0070675_100000168 Ga0070675_10000016833 219
99 3300005354 Ga0070675_100031268 Ga0070675_1000312683 219
100 3300005354 Ga0070675_100051132 Ga0070675_1000511324 219
101 3300005354 Ga0070675_100162311 Ga0070675_1001623112 219
102 3300005354 Ga0070675_100164573 Ga0070675_1001645731 219
103 3300005354 Ga0070675_100266668 Ga0070675_1002666682 219
104 3300005355 Ga0070671_100003587 Ga0070671_1000035874 219
105 3300005355 Ga0070671_100010193 Ga0070671_1000101934 219
106 3300005355 Ga0070671_100020505 Ga0070671_1000205054 219
107 3300005355 Ga0070671_100023573 Ga0070671_1000235733 219
108 3300005355 Ga0070671_100031844 Ga0070671_1000318443 219
109 3300005355 Ga0070671_100132642 Ga0070671_1001326422 219
110 3300005355 Ga0070671_100151088 Ga0070671_1001510883 219
111 3300005355 Ga0070671_100224144 Ga0070671_1002241443 219
112 3300005356 Ga0070674_100001408 Ga0070674_1000014085 219
113 3300005356 Ga0070674_100032446 Ga0070674_1000324463 219
114 3300005356 Ga0070674_100128754 Ga0070674_1001287543 219
115 3300005356 Ga0070674_100324051 Ga0070674_1003240511 219
116 3300005364 Ga0070673_100011006 Ga0070673_1000110065 219
117 3300005364 Ga0070673_100025107 Ga0070673_1000251074 219
118 3300005364 Ga0070673_100025584 Ga0070673_1000255845 219
119 3300005364 Ga0070673_100036423 Ga0070673_1000364233 219
120 3300005364 Ga0070673_100239821 Ga0070673_1002398213 219
121 3300005364 Ga0070673_100243558 Ga0070673_1002435582 219
122 3300005364 Ga0070673_100497839 Ga0070673_1004978392 219
123 3300005366 Ga0070659_100000360 Ga0070659_10000036014 219
124 3300005366 Ga0070659_100002345 Ga0070659_10000234513 219
125 3300005366 Ga0070659_100032138 Ga0070659_1000321384 219
126 3300005366 Ga0070659_100105636 Ga0070659_1001056362 219
127 3300005366 Ga0070659_100174672 Ga0070659_1001746723 219
128 3300005366 Ga0070659_100216588 Ga0070659_1002165882 219
129 3300005366 Ga0070659_100290662 Ga0070659_1002906622 219
130 3300005366 Ga0070659_100385335 Ga0070659_1003853352 219
131 3300005366 Ga0070659_100424503 Ga0070659_1004245032 219
132 3300005367 Ga0070667_100003732 Ga0070667_1000037327 219
133 3300005367 Ga0070667_100016637 Ga0070667_1000166374 219
134 3300005367 Ga0070667_100087429 Ga0070667_1000874293 219
135 3300005367 Ga0070667_100155581 Ga0070667_1001555812 219
136 3300005367 Ga0070667_100172438 Ga0070667_1001724383 219
137 3300005367 Ga0070667_100771264 Ga0070667_1007712642 219
138 3300005444 Ga0070694_100003110 Ga0070694_1000031108 219
139 3300005455 Ga0070663_100001108 Ga0070663_1000011084 219
140 3300005455 Ga0070663_100031698 Ga0070663_1000316981 219
141 3300005455 Ga0070663_100209010 Ga0070663_1002090103 219
142 3300005455 Ga0070663_100285920 Ga0070663_1002859201 219
143 3300005455 Ga0070663_100402735 Ga0070663_1004027351 219
144 3300005456 Ga0070678_100050834 Ga0070678_1000508342 219
145 3300005456 Ga0070678_100082960 Ga0070678_1000829603 219
146 3300005457 Ga0070662_100000567 Ga0070662_10000056713 219
147 3300005457 Ga0070662_100003090 Ga0070662_10000309010 219
148 3300005457 Ga0070662_100006871 Ga0070662_1000068717 219
149 3300005457 Ga0070662_100010162 Ga0070662_1000101622 219
150 3300005457 Ga0070662_100010315 Ga0070662_1000103153 219
151 3300005457 Ga0070662_100029737 Ga0070662_1000297373 219
152 3300005457 Ga0070662_100053696 Ga0070662_1000536964 219
153 3300005457 Ga0070662_100068239 Ga0070662_1000682391 219
154 3300005457 Ga0070662_100111150 Ga0070662_1001111503 219
155 3300005459 Ga0068867_100000505 Ga0068867_1000005053 219
156 3300005459 Ga0068867_100004826 Ga0068867_1000048263 219
157 3300005459 Ga0068867_100033751 Ga0068867_1000337512 219
158 3300005459 Ga0068867_100041738 Ga0068867_1000417383 219
159 3300005459 Ga0068867_100098984 Ga0068867_1000989843 219
160 3300005535 Ga0070684_100176799 Ga0070684_1001767993 219
161 3300005539 Ga0068853_100001049 Ga0068853_1000010493 219
162 3300005539 Ga0068853_100033529 Ga0068853_1000335294 219
163 3300005539 Ga0068853_100052187 Ga0068853_1000521875 219
164 3300005543 Ga0070672_100000498 Ga0070672_1000004985 219
165 3300005543 Ga0070672_100002394 Ga0070672_10000239411 219
166 3300005543 Ga0070672_100007673 Ga0070672_1000076739 219
167 3300005543 Ga0070672_100495930 Ga0070672_1004959301 219
168 3300005543 Ga0070672_100692969 Ga0070672_1006929692 219
169 3300005546 Ga0070696_100055400 Ga0070696_1000554002 219
170 3300005547 Ga0070693_100700016 Ga0070693_1007000161 219
171 3300005548 Ga0070665_100000380 Ga0070665_10000038025 219
172 3300005548 Ga0070665_100009616 Ga0070665_10000961613 219
173 3300005548 Ga0070665_100021410 Ga0070665_1000214108 219
174 3300005548 Ga0070665_100026477 Ga0070665_1000264773 219
175 3300005548 Ga0070665_100027724 Ga0070665_1000277245 219
176 3300005548 Ga0070665_100036161 Ga0070665_1000361613 219
177 3300005548 Ga0070665_100145926 Ga0070665_1001459264 219
178 3300005548 Ga0070665_100151091 Ga0070665_1001510913 219
179 3300005549 Ga0070704_100167512 Ga0070704_1001675123 219
180 3300005563 Ga0068855_100001630 Ga0068855_10000163022 219
181 3300005563 Ga0068855_100003323 Ga0068855_10000332319 219
182 3300005563 Ga0068855_100062783 Ga0068855_1000627834 219
183 3300005563 Ga0068855_101165098 Ga0068855_1011650982 219
184 3300005564 Ga0070664_100019164 Ga0070664_1000191643 219
185 3300005564 Ga0070664_100035913 Ga0070664_1000359134 219
186 3300005564 Ga0070664_100036914 Ga0070664_1000369144 219
187 3300005564 Ga0070664_100037637 Ga0070664_1000376372 219
188 3300005564 Ga0070664_100085626 Ga0070664_1000856263 219
189 3300005564 Ga0070664_100095452 Ga0070664_1000954522 219
190 3300005564 Ga0070664_100176194 Ga0070664_1001761942 219
191 3300005577 Ga0068857_100001870 Ga0068857_10000187017 219
192 3300005577 Ga0068857_100005590 Ga0068857_10000559010 219
193 3300005577 Ga0068857_100052001 Ga0068857_1000520013 219
194 3300005577 Ga0068857_100054905 Ga0068857_1000549054 219
195 3300005577 Ga0068857_100231788 Ga0068857_1002317882 219
196 3300005577 Ga0068857_100324419 Ga0068857_1003244192 219
197 3300005577 Ga0068857_100615088 Ga0068857_1006150881 219
198 3300005578 Ga0068854_100011496 Ga0068854_1000114965 219
199 3300005578 Ga0068854_100019028 Ga0068854_1000190284 219
200 3300005578 Ga0068854_100047745 Ga0068854_1000477453 219
201 3300005578 Ga0068854_100078827 Ga0068854_1000788273 219
202 3300005578 Ga0068854_100204335 Ga0068854_1002043352 219
203 3300005614 Ga0068856_100023621 Ga0068856_1000236215 219
204 3300005614 Ga0068856_100293991 Ga0068856_1002939913 219
205 3300005614 Ga0068856_100338032 Ga0068856_1003380323 219
206 3300005614 Ga0068856_100544266 Ga0068856_1005442661 219
207 3300005616 Ga0068852_100001326 Ga0068852_10000132614 219
208 3300005616 Ga0068852_100014402 Ga0068852_1000144024 219
209 3300005616 Ga0068852_100158268 Ga0068852_1001582682 219
210 3300005617 Ga0068859_100000117 Ga0068859_10000011774 219
211 3300005617 Ga0068859_100000550 Ga0068859_10000055019 219
212 3300005617 Ga0068859_100002852 Ga0068859_10000285215 219
213 3300005617 Ga0068859_100014415 Ga0068859_1000144156 219
214 3300005617 Ga0068859_100092810 Ga0068859_1000928104 219
215 3300005617 Ga0068859_100103827 Ga0068859_1001038272 219
216 3300005617 Ga0068859_100147536 Ga0068859_1001475363 219
217 3300005618 Ga0068864_100000047 Ga0068864_100000047154 219
218 3300005618 Ga0068864_100000161 Ga0068864_10000016118 219
219 3300005618 Ga0068864_100003015 Ga0068864_1000030154 219
220 3300005618 Ga0068864_100022058 Ga0068864_1000220583 219
221 3300005618 Ga0068864_100040444 Ga0068864_1000404445 219
222 3300005618 Ga0068864_100109882 Ga0068864_1001098823 219
223 3300005618 Ga0068864_100201264 Ga0068864_1002012643 219
224 3300005618 Ga0068864_100271674 Ga0068864_1002716743 219
225 3300005618 Ga0068864_100320131 Ga0068864_1003201312 219
226 3300005618 Ga0068864_100484234 Ga0068864_1004842341 219
227 3300005618 Ga0068864_101108076 Ga0068864_1011080762 219
228 3300005719 Ga0068861_100098048 Ga0068861_1000980482 219
229 3300005719 Ga0068861_100144342 Ga0068861_1001443424 219
230 3300005719 Ga0068861_100397297 Ga0068861_1003972972 219
231 3300005719 Ga0068861_100430317 Ga0068861_1004303171 219
232 3300005719 Ga0068861_100529279 Ga0068861_1005292792 219
233 3300005834 Ga0068851_10041216 Ga0068851_100412163 219
234 3300005834 Ga0068851_10065191 Ga0068851_100651914 219
235 3300005834 Ga0068851_10151496 Ga0068851_101514962 219
236 3300005834 Ga0068851_10174722 Ga0068851_101747221 219
237 3300005834 Ga0068851_10196074 Ga0068851_101960741 219
238 3300005840 Ga0068870_10232464 Ga0068870_102324641 219
239 3300005841 Ga0068863_100000468 Ga0068863_10000046818 219
240 3300005841 Ga0068863_100001438 Ga0068863_10000143811 219
241 3300005841 Ga0068863_100006070 Ga0068863_1000060705 219
242 3300005841 Ga0068863_100017572 Ga0068863_10001757210 219
243 3300005841 Ga0068863_100023730 Ga0068863_1000237304 219
244 3300005841 Ga0068863_100098149 Ga0068863_1000981494 219
245 3300005841 Ga0068863_100100249 Ga0068863_1001002493 219
246 3300005841 Ga0068863_100165654 Ga0068863_1001656544 219
247 3300005841 Ga0068863_100460692 Ga0068863_1004606923 219
248 3300005841 Ga0068863_100492097 Ga0068863_1004920972 219
249 3300005842 Ga0068858_100002434 Ga0068858_10000243414 219
250 3300005842 Ga0068858_100032548 Ga0068858_1000325485 219
251 3300005842 Ga0068858_100048454 Ga0068858_1000484543 219
252 3300005842 Ga0068858_100090797 Ga0068858_1000907975 219
253 3300005843 Ga0068860_100003459 Ga0068860_1000034594 219
254 3300005843 Ga0068860_100007769 Ga0068860_1000077694 219
255 3300005843 Ga0068860_100008108 Ga0068860_1000081089 219
256 3300005843 Ga0068860_100018724 Ga0068860_1000187243 219
257 3300005843 Ga0068860_100261903 Ga0068860_1002619032 219
258 3300005843 Ga0068860_100302306 Ga0068860_1003023062 219
259 3300005843 Ga0068860_100664330 Ga0068860_1006643301 219
260 3300005844 Ga0068862_100003216 Ga0068862_1000032165 219
261 3300005844 Ga0068862_100021779 Ga0068862_1000217795 219
262 3300005844 Ga0068862_100088888 Ga0068862_1000888884 219
263 3300005844 Ga0068862_100144845 Ga0068862_1001448453 219
264 3300005844 Ga0068862_100179536 Ga0068862_1001795364 219
265 3300005985 Ga0081539_10056145 Ga0081539_100561453 219
266 3300006175 Ga0070712_100024560 Ga0070712_1000245603 219
267 3300006195 Ga0075366_10037760 Ga0075366_100377603 219
268 3300006237 Ga0097621_100025500 Ga0097621_1000255005 219
269 3300006237 Ga0097621_100026351 Ga0097621_1000263514 219
270 3300006237 Ga0097621_100047424 Ga0097621_1000474242 219
271 3300006237 Ga0097621_100067938 Ga0097621_1000679383 219
272 3300006237 Ga0097621_100572387 Ga0097621_1005723872 219
273 3300006358 Ga0068871_100045354 Ga0068871_1000453544 219
274 3300006358 Ga0068871_100108896 Ga0068871_1001088963 219
275 3300006852 Ga0075433_10119249 Ga0075433_101192494 219
276 3300006871 Ga0075434_100246229 Ga0075434_1002462293 219
277 3300006881 Ga0068865_100002695 Ga0068865_1000026952 219
278 3300006881 Ga0068865_100348626 Ga0068865_1003486262 219
279 3300006881 Ga0068865_100539386 Ga0068865_1005393861 219
280 3300006931 Ga0097620_100000117 Ga0097620_10000011774 219
281 3300006931 Ga0097620_100000550 Ga0097620_10000055019 219
282 3300006931 Ga0097620_100002851 Ga0097620_10000285115 219
283 3300006931 Ga0097620_100014415 Ga0097620_1000144156 219
284 3300006931 Ga0097620_100092818 Ga0097620_1000928182 219
285 3300006931 Ga0097620_100103827 Ga0097620_1001038272 219
286 3300006931 Ga0097620_100147529 Ga0097620_1001475293 219
287 3300007076 Ga0075435_100140843 Ga0075435_1001408433 219
288 3300007076 Ga0075435_100552855 Ga0075435_1005528552 219
289 3300009011 Ga0105251_10037707 Ga0105251_100377074 219
290 3300009092 Ga0105250_10015534 Ga0105250_100155343 219
291 3300009093 Ga0105240_10009967 Ga0105240_100099677 219
292 3300009093 Ga0105240_10253039 Ga0105240_102530392 219
293 3300009094 Ga0111539_10037714 Ga0111539_100377146 219
294 3300009094 Ga0111539_10065212 Ga0111539_100652122 219
295 3300009094 Ga0111539_10106513 Ga0111539_101065132 219
296 3300009098 Ga0105245_10000198 Ga0105245_1000019842 219
297 3300009098 Ga0105245_10285104 Ga0105245_102851043 219
298 3300009101 Ga0105247_10091501 Ga0105247_100915011 219
299 3300009148 Ga0105243_10018259 Ga0105243_100182594 219
300 3300009148 Ga0105243_10167270 Ga0105243_101672704 219
301 3300009148 Ga0105243_10167837 Ga0105243_101678373 219
302 3300009148 Ga0105243_10476174 Ga0105243_104761742 219
303 3300009174 Ga0105241_10028003 Ga0105241_100280033 219
304 3300009174 Ga0105241_10134110 Ga0105241_101341103 219
305 3300009177 Ga0105248_10000391 Ga0105248_1000039128 219
306 3300009177 Ga0105248_10000496 Ga0105248_100004964 219
307 3300009177 Ga0105248_10017284 Ga0105248_100172843 219
308 3300009177 Ga0105248_10018865 Ga0105248_100188659 219
309 3300009177 Ga0105248_10055389 Ga0105248_100553892 219
310 3300009177 Ga0105248_10124424 Ga0105248_101244243 219
311 3300009177 Ga0105248_10232627 Ga0105248_102326273 219
312 3300009177 Ga0105248_10299264 Ga0105248_102992642 219
313 3300009177 Ga0105248_10305675 Ga0105248_103056752 219
314 3300009177 Ga0105248_10535896 Ga0105248_105358963 219
315 3300009177 Ga0105248_11027360 Ga0105248_110273602 219
316 3300009177 Ga0105248_11027363 Ga0105248_110273632 219
317 3300009177 Ga0105248_11093782 Ga0105248_110937821 219
318 3300009545 Ga0105237_10144323 Ga0105237_101443232 219
319 3300009551 Ga0105238_10087182 Ga0105238_100871825 219
320 3300009551 Ga0105238_10295704 Ga0105238_102957043 219
321 3300009553 Ga0105249_10038374 Ga0105249_100383744 219
322 3300009553 Ga0105249_10052338 Ga0105249_100523382 219
323 3300009553 Ga0105249_10089902 Ga0105249_100899024 219
324 3300009553 Ga0105249_10128202 Ga0105249_101282022 219
325 3300009978 Ga0105148_100194 Ga0105148_1001942 219
326 3300010375 Ga0105239_10095250 Ga0105239_100952504 219
327 3300011119 Ga0105246_10003426 Ga0105246_1000342614 219
328 3300013100 Ga0157373_10067881 Ga0157373_100678813 219
329 3300013100 Ga0157373_10070480 Ga0157373_100704804 219
330 3300013100 Ga0157373_10280472 Ga0157373_102804723 219
331 3300013100 Ga0157373_10474101 Ga0157373_104741011 219
332 3300013102 Ga0157371_10003235 Ga0157371_100032355 219
333 3300013102 Ga0157371_10006285 Ga0157371_100062855 219
334 3300013102 Ga0157371_10065965 Ga0157371_100659653 219
335 3300013102 Ga0157371_10170589 Ga0157371_101705893 219
336 3300013102 Ga0157371_10336512 Ga0157371_103365122 219
337 3300013104 Ga0157370_10126848 Ga0157370_101268482 219
338 3300013105 Ga0157369_10012975 Ga0157369_100129753 219
339 3300013105 Ga0157369_10465587 Ga0157369_104655872 219
340 3300013296 Ga0157374_10073646 Ga0157374_100736464 219
341 3300013296 Ga0157374_10082102 Ga0157374_100821021 219
342 3300013296 Ga0157374_10104247 Ga0157374_101042473 219
343 3300013296 Ga0157374_10341897 Ga0157374_103418973 219
344 3300013297 Ga0157378_10010220 Ga0157378_100102204 219
345 3300013297 Ga0157378_10291593 Ga0157378_102915931 219
346 3300013297 Ga0157378_11052174 Ga0157378_110521741 219
347 3300013306 Ga0163162_10012937 Ga0163162_100129372 219
348 3300013306 Ga0163162_10032902 Ga0163162_100329025 219
349 3300013306 Ga0163162_10067373 Ga0163162_100673733 219
350 3300013306 Ga0163162_10348356 Ga0163162_103483562 219
351 3300013306 Ga0163162_10538075 Ga0163162_105380752 219
352 3300013307 Ga0157372_10029860 Ga0157372_100298602 219
353 3300013307 Ga0157372_10115418 Ga0157372_101154184 219
354 3300013307 Ga0157372_10298178 Ga0157372_102981782 219
355 3300013308 Ga0157375_10026988 Ga0157375_100269885 219
356 3300013308 Ga0157375_10142622 Ga0157375_101426223 219
357 3300013308 Ga0157375_10220500 Ga0157375_102205003 219
358 3300013308 Ga0157375_10232514 Ga0157375_102325142 219
359 3300013308 Ga0157375_10433656 Ga0157375_104336563 219
360 3300014325 Ga0163163_10000259 Ga0163163_1000025938 219
361 3300014325 Ga0163163_10024782 Ga0163163_100247823 219
362 3300014325 Ga0163163_10180142 Ga0163163_101801423 219
363 3300014325 Ga0163163_10202823 Ga0163163_102028234 219
364 3300014325 Ga0163163_10464493 Ga0163163_104644932 219
365 3300014326 Ga0157380_10016309 Ga0157380_100163093 219
366 3300014326 Ga0157380_10251962 Ga0157380_102519622 219
367 3300014326 Ga0157380_10518696 Ga0157380_105186962 219
368 3300014326 Ga0157380_10984176 Ga0157380_109841761 219
369 3300014497 Ga0182008_10224359 Ga0182008_102243592 219
370 3300014745 Ga0157377_10036504 Ga0157377_100365044 219
371 3300014968 Ga0157379_10021135 Ga0157379_100211356 219
372 3300014968 Ga0157379_10044039 Ga0157379_100440393 219
373 3300014968 Ga0157379_10083547 Ga0157379_100835473 219
374 3300014968 Ga0157379_10218501 Ga0157379_102185012 219
375 3300014969 Ga0157376_10848196 Ga0157376_108481962 219
376 3300017792 Ga0163161_10048183 Ga0163161_100481831 219
377 3300025290 Ga0207673_1002027 Ga0207673_10020273 219
378 3300025290 Ga0207673_1012362 Ga0207673_10123621 219
379 3300025315 Ga0207697_10000018 Ga0207697_1000001842 219
380 3300025315 Ga0207697_10000033 Ga0207697_1000003358 219
381 3300025315 Ga0207697_10192128 Ga0207697_101921281 219
382 3300025321 Ga0207656_10005815 Ga0207656_100058152 219
383 3300025321 Ga0207656_10020508 Ga0207656_100205083 219
384 3300025321 Ga0207656_10110655 Ga0207656_101106552 219
385 3300025321 Ga0207656_10160156 Ga0207656_101601562 219
386 3300025711 Ga0207696_1007722 Ga0207696_10077223 219
387 3300025893 Ga0207682_10000729 Ga0207682_1000072911 219
388 3300025893 Ga0207682_10008224 Ga0207682_100082243 219
389 3300025900 Ga0207710_10094816 Ga0207710_100948163 219
390 3300025901 Ga0207688_10000214 Ga0207688_100002143 219
391 3300025901 Ga0207688_10027887 Ga0207688_100278871 219
392 3300025901 Ga0207688_10039801 Ga0207688_100398012 219
393 3300025901 Ga0207688_10098478 Ga0207688_100984782 219
394 3300025903 Ga0207680_10111902 Ga0207680_101119023 219
395 3300025904 Ga0207647_10000550 Ga0207647_1000055030 219
396 3300025904 Ga0207647_10025102 Ga0207647_100251023 219
397 3300025904 Ga0207647_10058454 Ga0207647_100584544 219
398 3300025904 Ga0207647_10066287 Ga0207647_100662874 219
399 3300025907 Ga0207645_10007108 Ga0207645_100071086 219
400 3300025907 Ga0207645_10032067 Ga0207645_100320672 219
401 3300025907 Ga0207645_10052714 Ga0207645_100527142 219
402 3300025907 Ga0207645_10187163 Ga0207645_101871631 219
403 3300025907 Ga0207645_10259144 Ga0207645_102591441 219
404 3300025909 Ga0207705_10000381 Ga0207705_1000038112 219
405 3300025909 Ga0207705_10000753 Ga0207705_100007533 219
406 3300025909 Ga0207705_10021172 Ga0207705_100211723 219
407 3300025909 Ga0207705_10026189 Ga0207705_100261894 219
408 3300025909 Ga0207705_10035872 Ga0207705_100358722 219
409 3300025909 Ga0207705_10050454 Ga0207705_100504544 219
410 3300025909 Ga0207705_10053983 Ga0207705_100539832 219
411 3300025909 Ga0207705_10108659 Ga0207705_101086592 219
412 3300025909 Ga0207705_10156319 Ga0207705_101563192 219
413 3300025912 Ga0207707_10649044 Ga0207707_106490442 219
414 3300025913 Ga0207695_10001271 Ga0207695_100012717 219
415 3300025913 Ga0207695_10353186 Ga0207695_103531862 219
416 3300025914 Ga0207671_10167760 Ga0207671_101677602 219
417 3300025918 Ga0207662_10106491 Ga0207662_101064911 219
418 3300025919 Ga0207657_10000737 Ga0207657_1000073732 219
419 3300025919 Ga0207657_10002095 Ga0207657_1000209512 219
420 3300025919 Ga0207657_10003757 Ga0207657_100037577 219
421 3300025919 Ga0207657_10012097 Ga0207657_1001209710 219
422 3300025919 Ga0207657_10016080 Ga0207657_100160804 219
423 3300025919 Ga0207657_10030767 Ga0207657_100307674 219
424 3300025919 Ga0207657_10084053 Ga0207657_100840534 219
425 3300025919 Ga0207657_10143506 Ga0207657_101435063 219
426 3300025920 Ga0207649_10001845 Ga0207649_1000184512 219
427 3300025920 Ga0207649_10371375 Ga0207649_103713751 219
428 3300025920 Ga0207649_10497734 Ga0207649_104977342 219
429 3300025920 Ga0207649_10706441 Ga0207649_107064411 219
430 3300025921 Ga0207652_10727097 Ga0207652_107270971 219
431 3300025923 Ga0207681_10000693 Ga0207681_1000069314 219
432 3300025923 Ga0207681_10012851 Ga0207681_100128516 219
433 3300025923 Ga0207681_10013451 Ga0207681_100134514 219
434 3300025923 Ga0207681_10014674 Ga0207681_100146744 219
435 3300025923 Ga0207681_10046368 Ga0207681_100463684 219
436 3300025923 Ga0207681_10078258 Ga0207681_100782583 219
437 3300025923 Ga0207681_10079839 Ga0207681_100798393 219
438 3300025923 Ga0207681_10208098 Ga0207681_102080982 219
439 3300025923 Ga0207681_10210620 Ga0207681_102106203 219
440 3300025923 Ga0207681_10212683 Ga0207681_102126831 219
441 3300025924 Ga0207694_10016585 Ga0207694_100165853 219
442 3300025924 Ga0207694_10109188 Ga0207694_101091883 219
443 3300025924 Ga0207694_10317104 Ga0207694_103171042 219
444 3300025925 Ga0207650_10028713 Ga0207650_100287134 219
445 3300025925 Ga0207650_10037950 Ga0207650_100379504 219
446 3300025925 Ga0207650_10059283 Ga0207650_100592833 219
447 3300025925 Ga0207650_10199620 Ga0207650_101996203 219
448 3300025925 Ga0207650_10216921 Ga0207650_102169211 219
449 3300025925 Ga0207650_10280670 Ga0207650_102806702 219
450 3300025926 Ga0207659_10001503 Ga0207659_1000150311 219
451 3300025926 Ga0207659_10010265 Ga0207659_100102653 219
452 3300025926 Ga0207659_10080781 Ga0207659_100807814 219
453 3300025926 Ga0207659_10112005 Ga0207659_101120053 219
454 3300025926 Ga0207659_10134871 Ga0207659_101348714 219
455 3300025926 Ga0207659_10233239 Ga0207659_102332392 219
456 3300025926 Ga0207659_10518985 Ga0207659_105189852 219
457 3300025927 Ga0207687_10006583 Ga0207687_1000658311 219
458 3300025927 Ga0207687_10089215 Ga0207687_100892152 219
459 3300025931 Ga0207644_10000577 Ga0207644_1000057718 219
460 3300025931 Ga0207644_10026397 Ga0207644_100263974 219
461 3300025931 Ga0207644_10033020 Ga0207644_100330205 219
462 3300025931 Ga0207644_10033639 Ga0207644_100336393 219
463 3300025931 Ga0207644_10057916 Ga0207644_100579162 219
464 3300025931 Ga0207644_10075739 Ga0207644_100757394 219
465 3300025931 Ga0207644_10128084 Ga0207644_101280842 219
466 3300025931 Ga0207644_10182033 Ga0207644_101820331 219
467 3300025931 Ga0207644_10240790 Ga0207644_102407902 219
468 3300025931 Ga0207644_10627093 Ga0207644_106270932 219
469 3300025932 Ga0207690_10004812 Ga0207690_100048126 219
470 3300025932 Ga0207690_10005177 Ga0207690_100051775 219
471 3300025932 Ga0207690_10011913 Ga0207690_100119131 219
472 3300025932 Ga0207690_10012563 Ga0207690_100125635 219
473 3300025932 Ga0207690_10058995 Ga0207690_100589953 219
474 3300025932 Ga0207690_10073669 Ga0207690_100736692 219
475 3300025932 Ga0207690_10134038 Ga0207690_101340383 219
476 3300025932 Ga0207690_10241397 Ga0207690_102413972 219
477 3300025932 Ga0207690_10329749 Ga0207690_103297492 219
478 3300025932 Ga0207690_10455018 Ga0207690_104550182 219
479 3300025933 Ga0207706_10000020 Ga0207706_1000002017 219
480 3300025933 Ga0207706_10000587 Ga0207706_1000058726 219
481 3300025933 Ga0207706_10004579 Ga0207706_100045798 219
482 3300025933 Ga0207706_10011087 Ga0207706_1001108711 219
483 3300025933 Ga0207706_10014287 Ga0207706_100142876 219
484 3300025933 Ga0207706_10056057 Ga0207706_100560574 219
485 3300025933 Ga0207706_10140444 Ga0207706_101404443 219
486 3300025933 Ga0207706_10144148 Ga0207706_101441484 219
487 3300025935 Ga0207709_10287843 Ga0207709_102878432 219
488 3300025935 Ga0207709_10848024 Ga0207709_108480241 219
489 3300025937 Ga0207669_10030588 Ga0207669_100305882 219
490 3300025937 Ga0207669_10285768 Ga0207669_102857682 219
491 3300025938 Ga0207704_10501116 Ga0207704_105011161 219
492 3300025940 Ga0207691_10000047 Ga0207691_1000004730 219
493 3300025940 Ga0207691_10000758 Ga0207691_100007585 219
494 3300025940 Ga0207691_10008623 Ga0207691_100086236 219
495 3300025940 Ga0207691_10017624 Ga0207691_100176245 219
496 3300025940 Ga0207691_10063831 Ga0207691_100638313 219
497 3300025940 Ga0207691_10516180 Ga0207691_105161802 219
498 3300025941 Ga0207711_10000039 Ga0207711_1000003933 219
499 3300025941 Ga0207711_10004881 Ga0207711_100048817 219
500 3300025941 Ga0207711_10019657 Ga0207711_100196575 219
501 3300025941 Ga0207711_10021654 Ga0207711_100216544 219
502 3300025941 Ga0207711_10051824 Ga0207711_100518243 219
503 3300025941 Ga0207711_10327815 Ga0207711_103278153 219
504 3300025941 Ga0207711_10353591 Ga0207711_103535913 219
505 3300025941 Ga0207711_10622285 Ga0207711_106222852 219
506 3300025942 Ga0207689_10000002 Ga0207689_1000000230 219
507 3300025942 Ga0207689_10049443 Ga0207689_100494433 219
508 3300025942 Ga0207689_10059007 Ga0207689_100590074 219
509 3300025942 Ga0207689_10241525 Ga0207689_102415251 219
510 3300025944 Ga0207661_10069550 Ga0207661_100695504 219
511 3300025944 Ga0207661_10672128 Ga0207661_106721282 219
512 3300025944 Ga0207661_10829265 Ga0207661_108292652 219
513 3300025945 Ga0207679_10020102 Ga0207679_100201024 219
514 3300025945 Ga0207679_10126048 Ga0207679_101260483 219
515 3300025945 Ga0207679_10134176 Ga0207679_101341762 219
516 3300025945 Ga0207679_10171401 Ga0207679_101714013 219
517 3300025945 Ga0207679_10188908 Ga0207679_101889083 219
518 3300025945 Ga0207679_10258047 Ga0207679_102580472 219
519 3300025945 Ga0207679_10269572 Ga0207679_102695722 219
520 3300025945 Ga0207679_10333351 Ga0207679_103333512 219
521 3300025949 Ga0207667_10001174 Ga0207667_1000117414 219
522 3300025949 Ga0207667_10011475 Ga0207667_1001147514 219
523 3300025949 Ga0207667_10034342 Ga0207667_100343427 219
524 3300025949 Ga0207667_10277278 Ga0207667_102772784 219
525 3300025949 Ga0207667_10513436 Ga0207667_105134363 219
526 3300025949 Ga0207667_10552624 Ga0207667_105526242 219
527 3300025960 Ga0207651_10015010 Ga0207651_100150105 219
528 3300025960 Ga0207651_10022324 Ga0207651_100223243 219
529 3300025960 Ga0207651_10059855 Ga0207651_100598554 219
530 3300025960 Ga0207651_10094858 Ga0207651_100948583 219
531 3300025960 Ga0207651_10264625 Ga0207651_102646252 219
532 3300025960 Ga0207651_10367943 Ga0207651_103679431 219
533 3300025960 Ga0207651_10432136 Ga0207651_104321362 219
534 3300025961 Ga0207712_10003912 Ga0207712_1000391211 219
535 3300025961 Ga0207712_10010289 Ga0207712_100102895 219
536 3300025972 Ga0207668_10000271 Ga0207668_1000027114 219
537 3300025972 Ga0207668_10005220 Ga0207668_100052206 219
538 3300025972 Ga0207668_10034741 Ga0207668_100347412 219
539 3300025972 Ga0207668_10036593 Ga0207668_100365934 219
540 3300025972 Ga0207668_10039740 Ga0207668_100397403 219
541 3300025972 Ga0207668_10048375 Ga0207668_100483754 219
542 3300025972 Ga0207668_10095547 Ga0207668_100955471 219
543 3300025972 Ga0207668_10362098 Ga0207668_103620982 219
544 3300025972 Ga0207668_10478365 Ga0207668_104783652 219
545 3300025981 Ga0207640_10000295 Ga0207640_100002957 219
546 3300025981 Ga0207640_10010972 Ga0207640_100109722 219
547 3300025981 Ga0207640_10014967 Ga0207640_100149675 219
548 3300025981 Ga0207640_10031236 Ga0207640_100312365 219
549 3300025981 Ga0207640_10054588 Ga0207640_100545883 219
550 3300025981 Ga0207640_10112200 Ga0207640_101122003 219
551 3300025981 Ga0207640_10269863 Ga0207640_102698631 219
552 3300025981 Ga0207640_10375569 Ga0207640_103755692 219
553 3300025981 Ga0207640_10675522 Ga0207640_106755221 219
554 3300025986 Ga0207658_10000833 Ga0207658_100008334 219
555 3300025986 Ga0207658_10073609 Ga0207658_100736094 219
556 3300025986 Ga0207658_10134333 Ga0207658_101343332 219
557 3300025986 Ga0207658_10169693 Ga0207658_101696932 219
558 3300025986 Ga0207658_10172900 Ga0207658_101729002 219
559 3300025986 Ga0207658_10193817 Ga0207658_101938171 219
560 3300025986 Ga0207658_10338907 Ga0207658_103389073 219
561 3300025986 Ga0207658_10440515 Ga0207658_104405152 219
562 3300025986 Ga0207658_10483303 Ga0207658_104833031 219
563 3300026023 Ga0207677_10002005 Ga0207677_100020053 219
564 3300026023 Ga0207677_10002555 Ga0207677_100025556 219
565 3300026035 Ga0207703_10001056 Ga0207703_1000105611 219
566 3300026035 Ga0207703_10004683 Ga0207703_1000468310 219
567 3300026035 Ga0207703_10005296 Ga0207703_1000529614 219
568 3300026035 Ga0207703_10018862 Ga0207703_100188622 219
569 3300026035 Ga0207703_10019558 Ga0207703_100195583 219
570 3300026035 Ga0207703_10021282 Ga0207703_100212826 219
571 3300026041 Ga0207639_10067403 Ga0207639_100674033 219
572 3300026041 Ga0207639_10142430 Ga0207639_101424302 219
573 3300026067 Ga0207678_10001454 Ga0207678_1000145424 219
574 3300026067 Ga0207678_10007598 Ga0207678_1000759811 219
575 3300026067 Ga0207678_10025713 Ga0207678_100257134 219
576 3300026067 Ga0207678_10026041 Ga0207678_100260414 219
577 3300026067 Ga0207678_10030618 Ga0207678_100306182 219
578 3300026067 Ga0207678_10092995 Ga0207678_100929954 219
579 3300026067 Ga0207678_10099650 Ga0207678_100996503 219
580 3300026075 Ga0207708_10818151 Ga0207708_108181511 219
581 3300026078 Ga0207702_10006644 Ga0207702_100066444 219
582 3300026078 Ga0207702_10060735 Ga0207702_100607353 219
583 3300026078 Ga0207702_10231218 Ga0207702_102312183 219
584 3300026078 Ga0207702_10316953 Ga0207702_103169532 219
585 3300026078 Ga0207702_10656673 Ga0207702_106566731 219
586 3300026088 Ga0207641_10000185 Ga0207641_1000018558 219
587 3300026088 Ga0207641_10004554 Ga0207641_100045549 219
588 3300026088 Ga0207641_10008337 Ga0207641_100083375 219
589 3300026088 Ga0207641_10036535 Ga0207641_100365354 219
590 3300026088 Ga0207641_10066576 Ga0207641_100665761 219
591 3300026088 Ga0207641_10089434 Ga0207641_100894344 219
592 3300026088 Ga0207641_10122082 Ga0207641_101220824 219
593 3300026088 Ga0207641_10150886 Ga0207641_101508863 219
594 3300026089 Ga0207648_10001030 Ga0207648_1000103036 219
595 3300026089 Ga0207648_10002686 Ga0207648_1000268615 219
596 3300026089 Ga0207648_10049286 Ga0207648_100492862 219
597 3300026089 Ga0207648_10085779 Ga0207648_100857794 219
598 3300026089 Ga0207648_10088576 Ga0207648_100885763 219
599 3300026095 Ga0207676_10000531 Ga0207676_1000053121 219
600 3300026095 Ga0207676_10002332 Ga0207676_1000233217 219
601 3300026095 Ga0207676_10010677 Ga0207676_100106774 219
602 3300026095 Ga0207676_10047955 Ga0207676_100479554 219
603 3300026095 Ga0207676_10051022 Ga0207676_100510222 219
604 3300026095 Ga0207676_10270989 Ga0207676_102709893 219
605 3300026095 Ga0207676_10365850 Ga0207676_103658502 219
606 3300026095 Ga0207676_10455810 Ga0207676_104558102 219
607 3300026095 Ga0207676_10488548 Ga0207676_104885482 219
608 3300026095 Ga0207676_10601888 Ga0207676_106018882 219
609 3300026095 Ga0207676_10819383 Ga0207676_108193832 219
610 3300026095 Ga0207676_11204993 Ga0207676_112049931 219
611 3300026116 Ga0207674_10000660 Ga0207674_1000066020 219
612 3300026116 Ga0207674_10000850 Ga0207674_1000085030 219
613 3300026116 Ga0207674_10000989 Ga0207674_1000098918 219
614 3300026116 Ga0207674_10008932 Ga0207674_100089325 219
615 3300026116 Ga0207674_10013759 Ga0207674_100137594 219
616 3300026116 Ga0207674_10053433 Ga0207674_100534333 219
617 3300026116 Ga0207674_10135702 Ga0207674_101357022 219
618 3300026116 Ga0207674_10766474 Ga0207674_107664741 219
619 3300026118 Ga0207675_100015430 Ga0207675_1000154308 219
620 3300026118 Ga0207675_100031522 Ga0207675_1000315225 219
621 3300026118 Ga0207675_100059455 Ga0207675_1000594554 219
622 3300026118 Ga0207675_100156615 Ga0207675_1001566153 219
623 3300026118 Ga0207675_100184181 Ga0207675_1001841813 219
624 3300026118 Ga0207675_100464192 Ga0207675_1004641922 219
625 3300026121 Ga0207683_10004026 Ga0207683_100040268 219
626 3300026121 Ga0207683_10072655 Ga0207683_100726552 219
627 3300026121 Ga0207683_10322067 Ga0207683_103220673 219
628 3300026142 Ga0207698_10007514 Ga0207698_100075149 219
629 3300026142 Ga0207698_10016649 Ga0207698_100166496 219
630 3300026142 Ga0207698_10089128 Ga0207698_100891283 219
631 3300026142 Ga0207698_10427012 Ga0207698_104270122 219
632 3300026142 Ga0207698_10459547 Ga0207698_104595472 219
633 3300027552 Ga0209982_1008459 Ga0209982_10084592 219
634 3300027614 Ga0209970_1010866 Ga0209970_10108662 219
635 3300027876 Ga0209974_10000970 Ga0209974_100009704 219
636 3300028379 Ga0268266_10000256 Ga0268266_1000025677 219
637 3300028379 Ga0268266_10007470 Ga0268266_1000747012 219
638 3300028379 Ga0268266_10009513 Ga0268266_100095133 219
639 3300028379 Ga0268266_10009798 Ga0268266_100097984 219
640 3300028379 Ga0268266_10109116 Ga0268266_101091163 219
641 3300028379 Ga0268266_10114013 Ga0268266_101140132 219
642 3300028379 Ga0268266_10232067 Ga0268266_102320672 219
643 3300028379 Ga0268266_10236031 Ga0268266_102360311 219
644 3300028379 Ga0268266_10236442 Ga0268266_102364423 219
645 3300028379 Ga0268266_10442430 Ga0268266_104424302 219
646 3300028379 Ga0268266_10753922 Ga0268266_107539222 219
647 3300028380 Ga0268265_10001865 Ga0268265_1000186514 219
648 3300028380 Ga0268265_10004343 Ga0268265_100043439 219
649 3300028380 Ga0268265_10010418 Ga0268265_100104186 219
650 3300028380 Ga0268265_10011681 Ga0268265_100116812 219
651 3300028380 Ga0268265_10013138 Ga0268265_100131384 219
652 3300028380 Ga0268265_10020151 Ga0268265_100201514 219
653 3300028380 Ga0268265_10367922 Ga0268265_103679222 219
654 3300028381 Ga0268264_10001705 Ga0268264_1000170520 219
655 3300028381 Ga0268264_10002374 Ga0268264_1000237418 219
656 3300028381 Ga0268264_10003974 Ga0268264_1000397417 219
657 3300028381 Ga0268264_10023194 Ga0268264_100231945 219
658 3300028381 Ga0268264_10090795 Ga0268264_100907954 219
659 3300028381 Ga0268264_10102724 Ga0268264_101027244 219
660 3300028381 Ga0268264_10247071 Ga0268264_102470713 219
661 3300028381 Ga0268264_10592881 Ga0268264_105928812 219
662 3300028381 Ga0268264_10699392 Ga0268264_106993922 219
663 3300030735 Ga0316178_1138587 Ga0316178_11385872 219
664 3300030744 Ga0316181_1243802 Ga0316181_12438021 219
665 3300030745 Ga0316182_1163017 Ga0316182_11630172 219
666 3300031548 Ga0307408_100045260 Ga0307408_1000452604 219
667 3300031548 Ga0307408_100071425 Ga0307408_1000714252 219
668 3300031548 Ga0307408_100082876 Ga0307408_1000828763 219
669 3300031548 Ga0307408_100092420 Ga0307408_1000924202 219
670 3300031548 Ga0307408_100107523 Ga0307408_1001075233 219
671 3300031548 Ga0307408_100144383 Ga0307408_1001443833 219
672 3300031548 Ga0307408_100166704 Ga0307408_1001667042 219
673 3300031548 Ga0307408_100192759 Ga0307408_1001927592 219
674 3300031548 Ga0307408_100201520 Ga0307408_1002015202 219
675 3300031548 Ga0307408_100229962 Ga0307408_1002299623 219
676 3300031548 Ga0307408_100265716 Ga0307408_1002657162 219
677 3300031548 Ga0307408_100282634 Ga0307408_1002826342 219
678 3300031548 Ga0307408_101135941 Ga0307408_1011359411 219
679 3300031731 Ga0307405_10009206 Ga0307405_100092062 219
680 3300031731 Ga0307405_10010136 Ga0307405_100101363 219
681 3300031731 Ga0307405_10010479 Ga0307405_100104795 219
682 3300031731 Ga0307405_10033419 Ga0307405_100334194 219
683 3300031731 Ga0307405_10051631 Ga0307405_100516312 219
684 3300031731 Ga0307405_10056240 Ga0307405_100562403 219
685 3300031731 Ga0307405_10074374 Ga0307405_100743743 219
686 3300031731 Ga0307405_10108247 Ga0307405_101082471 219
687 3300031731 Ga0307405_10196720 Ga0307405_101967202 219
688 3300031731 Ga0307405_10255538 Ga0307405_102555382 219
689 3300031731 Ga0307405_10265376 Ga0307405_102653762 219
690 3300031731 Ga0307405_10538163 Ga0307405_105381631 219
691 3300031824 Ga0307413_10008972 Ga0307413_100089724 219
692 3300031824 Ga0307413_10011195 Ga0307413_100111955 219
693 3300031824 Ga0307413_10020790 Ga0307413_100207902 219
694 3300031824 Ga0307413_10022631 Ga0307413_100226313 219
695 3300031824 Ga0307413_10028183 Ga0307413_100281832 219
696 3300031824 Ga0307413_10039713 Ga0307413_100397132 219
697 3300031824 Ga0307413_10040108 Ga0307413_100401083 219
698 3300031824 Ga0307413_10044823 Ga0307413_100448233 219
699 3300031824 Ga0307413_10056328 Ga0307413_100563282 219
700 3300031824 Ga0307413_10058121 Ga0307413_100581212 219
701 3300031824 Ga0307413_10160620 Ga0307413_101606202 219
702 3300031824 Ga0307413_10411273 Ga0307413_104112732 219
703 3300031824 Ga0307413_10421359 Ga0307413_104213592 219
704 3300031824 Ga0307413_10715288 Ga0307413_107152882 219
705 3300031824 Ga0307413_10771337 Ga0307413_107713371 219
706 3300031852 Ga0307410_10001969 Ga0307410_1000196911 219
707 3300031852 Ga0307410_10012661 Ga0307410_100126615 219
708 3300031852 Ga0307410_10013617 Ga0307410_100136176 219
709 3300031852 Ga0307410_10027200 Ga0307410_100272002 219
710 3300031852 Ga0307410_10027771 Ga0307410_100277713 219
711 3300031852 Ga0307410_10032555 Ga0307410_100325553 219
712 3300031852 Ga0307410_10035882 Ga0307410_100358823 219
713 3300031852 Ga0307410_10036957 Ga0307410_100369574 219
714 3300031852 Ga0307410_10058436 Ga0307410_100584362 219
715 3300031852 Ga0307410_10096247 Ga0307410_100962473 219
716 3300031852 Ga0307410_10110092 Ga0307410_101100922 219
717 3300031852 Ga0307410_10113734 Ga0307410_101137344 219
718 3300031852 Ga0307410_10116509 Ga0307410_101165092 219
719 3300031852 Ga0307410_10178219 Ga0307410_101782192 219
720 3300031852 Ga0307410_10248266 Ga0307410_102482662 219
721 3300031852 Ga0307410_10284679 Ga0307410_102846792 219
722 3300031852 Ga0307410_10301228 Ga0307410_103012282 219
723 3300031852 Ga0307410_10341655 Ga0307410_103416552 219
724 3300031852 Ga0307410_10444452 Ga0307410_104444522 219
725 3300031852 Ga0307410_10464915 Ga0307410_104649152 219
726 3300031852 Ga0307410_10487186 Ga0307410_104871861 219
727 3300031852 Ga0307410_10787649 Ga0307410_107876492 219
728 3300031852 Ga0307410_10824413 Ga0307410_108244131 219
729 3300031901 Ga0307406_10007548 Ga0307406_100075487 219
730 3300031901 Ga0307406_10017751 Ga0307406_100177514 219
731 3300031901 Ga0307406_10031712 Ga0307406_100317122 219
732 3300031901 Ga0307406_10059401 Ga0307406_100594012 219
733 3300031901 Ga0307406_10098670 Ga0307406_100986702 219
734 3300031901 Ga0307406_10198236 Ga0307406_101982362 219
735 3300031901 Ga0307406_10323161 Ga0307406_103231611 219
736 3300031901 Ga0307406_10349281 Ga0307406_103492812 219
737 3300031901 Ga0307406_10354700 Ga0307406_103547002 219
738 3300031901 Ga0307406_10404347 Ga0307406_104043472 219
739 3300031901 Ga0307406_10761965 Ga0307406_107619651 219
740 3300031903 Ga0307407_10000507 Ga0307407_1000050710 219
741 3300031903 Ga0307407_10009728 Ga0307407_100097285 219
742 3300031903 Ga0307407_10011673 Ga0307407_100116731 219
743 3300031903 Ga0307407_10025376 Ga0307407_100253764 219
744 3300031903 Ga0307407_10027656 Ga0307407_100276564 219
745 3300031903 Ga0307407_10036503 Ga0307407_100365033 219
746 3300031903 Ga0307407_10043691 Ga0307407_100436912 219
747 3300031903 Ga0307407_10123273 Ga0307407_101232732 219
748 3300031903 Ga0307407_10152887 Ga0307407_101528872 219
749 3300031903 Ga0307407_10162659 Ga0307407_101626591 219
750 3300031903 Ga0307407_10218170 Ga0307407_102181701 219
751 3300031903 Ga0307407_10381936 Ga0307407_103819362 219
752 3300031911 Ga0307412_10003491 Ga0307412_100034913 219
753 3300031911 Ga0307412_10010357 Ga0307412_100103573 219
754 3300031911 Ga0307412_10011525 Ga0307412_100115252 219
755 3300031911 Ga0307412_10014564 Ga0307412_100145646 219
756 3300031911 Ga0307412_10037336 Ga0307412_100373362 219
757 3300031911 Ga0307412_10055814 Ga0307412_100558143 219
758 3300031911 Ga0307412_10060902 Ga0307412_100609021 219
759 3300031911 Ga0307412_10062672 Ga0307412_100626722 219
760 3300031911 Ga0307412_10099665 Ga0307412_100996653 219
761 3300031911 Ga0307412_10133268 Ga0307412_101332682 219
762 3300031911 Ga0307412_10155712 Ga0307412_101557123 219
763 3300031911 Ga0307412_10229614 Ga0307412_102296142 219
764 3300031911 Ga0307412_10245502 Ga0307412_102455022 219
765 3300031911 Ga0307412_10380179 Ga0307412_103801792 219
766 3300031911 Ga0307412_10392198 Ga0307412_103921981 219
767 3300031995 Ga0307409_100008423 Ga0307409_1000084233 219
768 3300031995 Ga0307409_100009895 Ga0307409_1000098953 219
769 3300031995 Ga0307409_100009955 Ga0307409_1000099552 219
770 3300031995 Ga0307409_100017193 Ga0307409_1000171937 219
771 3300031995 Ga0307409_100018767 Ga0307409_1000187674 219
772 3300031995 Ga0307409_100020564 Ga0307409_1000205644 219
773 3300031995 Ga0307409_100027103 Ga0307409_1000271033 219
774 3300031995 Ga0307409_100032072 Ga0307409_1000320725 219
775 3300031995 Ga0307409_100061131 Ga0307409_1000611313 219
776 3300031995 Ga0307409_100063024 Ga0307409_1000630242 219
777 3300031995 Ga0307409_100074357 Ga0307409_1000743572 219
778 3300031995 Ga0307409_100076328 Ga0307409_1000763282 219
779 3300031995 Ga0307409_100120643 Ga0307409_1001206432 219
780 3300031995 Ga0307409_100122748 Ga0307409_1001227482 219
781 3300031995 Ga0307409_100146222 Ga0307409_1001462223 219
782 3300031995 Ga0307409_100155201 Ga0307409_1001552012 219
783 3300031995 Ga0307409_100160666 Ga0307409_1001606662 219
784 3300031995 Ga0307409_100162402 Ga0307409_1001624022 219
785 3300031995 Ga0307409_100223216 Ga0307409_1002232161 219
786 3300031995 Ga0307409_100223642 Ga0307409_1002236422 219
787 3300031995 Ga0307409_100380827 Ga0307409_1003808272 219
788 3300031995 Ga0307409_100399987 Ga0307409_1003999872 219
789 3300031995 Ga0307409_100455781 Ga0307409_1004557811 219
790 3300031995 Ga0307409_100760530 Ga0307409_1007605302 219
791 3300031995 Ga0307409_100785963 Ga0307409_1007859631 219
792 3300032002 Ga0307416_100004632 Ga0307416_10000463210 219
793 3300032002 Ga0307416_100021036 Ga0307416_1000210364 219
794 3300032002 Ga0307416_100025689 Ga0307416_1000256893 219
795 3300032002 Ga0307416_100058047 Ga0307416_1000580473 219
796 3300032002 Ga0307416_100091183 Ga0307416_1000911834 219
797 3300032002 Ga0307416_100129488 Ga0307416_1001294882 219
798 3300032002 Ga0307416_100150666 Ga0307416_1001506662 219
799 3300032002 Ga0307416_100152270 Ga0307416_1001522703 219
800 3300032002 Ga0307416_100283360 Ga0307416_1002833602 219
801 3300032002 Ga0307416_100353350 Ga0307416_1003533502 219
802 3300032002 Ga0307416_100440889 Ga0307416_1004408893 219
803 3300032002 Ga0307416_100478696 Ga0307416_1004786962 219
804 3300032002 Ga0307416_100481155 Ga0307416_1004811551 219
805 3300032002 Ga0307416_100723492 Ga0307416_1007234922 219
806 3300032002 Ga0307416_100884880 Ga0307416_1008848802 219
807 3300032002 Ga0307416_101233410 Ga0307416_1012334101 219
808 3300032002 Ga0307416_101275222 Ga0307416_1012752221 219
809 3300032004 Ga0307414_10007391 Ga0307414_100073918 219
810 3300032004 Ga0307414_10007880 Ga0307414_100078803 219
811 3300032004 Ga0307414_10011030 Ga0307414_100110307 219
812 3300032004 Ga0307414_10015150 Ga0307414_100151503 219
813 3300032004 Ga0307414_10037014 Ga0307414_100370142 219
814 3300032004 Ga0307414_10039099 Ga0307414_100390994 219
815 3300032004 Ga0307414_10045449 Ga0307414_100454494 219
816 3300032004 Ga0307414_10048539 Ga0307414_100485392 219
817 3300032004 Ga0307414_10083961 Ga0307414_100839613 219
818 3300032004 Ga0307414_10088466 Ga0307414_100884662 219
819 3300032004 Ga0307414_10096381 Ga0307414_100963813 219
820 3300032004 Ga0307414_10183054 Ga0307414_101830542 219
821 3300032004 Ga0307414_10193600 Ga0307414_101936002 219
822 3300032004 Ga0307414_10220261 Ga0307414_102202612 219
823 3300032004 Ga0307414_10242674 Ga0307414_102426742 219
824 3300032004 Ga0307414_10263837 Ga0307414_102638372 219
825 3300032004 Ga0307414_10318637 Ga0307414_103186372 219
826 3300032004 Ga0307414_10350304 Ga0307414_103503042 219
827 3300032004 Ga0307414_10386802 Ga0307414_103868023 219
828 3300032004 Ga0307414_10739009 Ga0307414_107390091 219
829 3300032005 Ga0307411_10006435 Ga0307411_100064356 219
830 3300032005 Ga0307411_10011440 Ga0307411_100114402 219
831 3300032005 Ga0307411_10014743 Ga0307411_100147435 219
832 3300032005 Ga0307411_10017550 Ga0307411_100175502 219
833 3300032005 Ga0307411_10018478 Ga0307411_100184782 219
834 3300032005 Ga0307411_10019231 Ga0307411_100192312 219
835 3300032005 Ga0307411_10031789 Ga0307411_100317892 219
836 3300032005 Ga0307411_10035118 Ga0307411_100351184 219
837 3300032005 Ga0307411_10042575 Ga0307411_100425753 219
838 3300032005 Ga0307411_10050910 Ga0307411_100509104 219
839 3300032005 Ga0307411_10059186 Ga0307411_100591863 219
840 3300032005 Ga0307411_10089866 Ga0307411_100898662 219
841 3300032005 Ga0307411_10095131 Ga0307411_100951313 219
842 3300032005 Ga0307411_10148905 Ga0307411_101489052 219
843 3300032005 Ga0307411_10177852 Ga0307411_101778522 219
844 3300032005 Ga0307411_10230710 Ga0307411_102307101 219
845 3300032005 Ga0307411_10385475 Ga0307411_103854751 219
846 3300032005 Ga0307411_10461044 Ga0307411_104610442 219
847 3300032005 Ga0307411_10889307 Ga0307411_108893071 219
848 3300032126 Ga0307415_100004192 Ga0307415_1000041924 219
849 3300032126 Ga0307415_100012931 Ga0307415_1000129312 219
850 3300032126 Ga0307415_100028130 Ga0307415_1000281303 219
851 3300032126 Ga0307415_100053531 Ga0307415_1000535313 219
852 3300032126 Ga0307415_100059233 Ga0307415_1000592333 219
853 3300032126 Ga0307415_100070500 Ga0307415_1000705003 219
854 3300032126 Ga0307415_100091951 Ga0307415_1000919513 219
855 3300032126 Ga0307415_100140364 Ga0307415_1001403641 219
856 3300032126 Ga0307415_100143295 Ga0307415_1001432952 219
857 3300032126 Ga0307415_100172481 Ga0307415_1001724812 219
858 3300032126 Ga0307415_100221140 Ga0307415_1002211402 219
859 3300032126 Ga0307415_100266179 Ga0307415_1002661793 219
860 3300032126 Ga0307415_100286869 Ga0307415_1002868691 219
861 3300032126 Ga0307415_100329079 Ga0307415_1003290792 219
862 3300032126 Ga0307415_100502472 Ga0307415_1005024721 219
863 3300032126 Ga0307415_100505523 Ga0307415_1005055232 219
864 3300034820 Ga0373959_0013328 Ga0373959_0013328_444_1106 219
865 3300035691 Ga0373931_0056461 Ga0373931_0056461_729_1391 219
866 3300037312 Ga0395899_0012848 Ga0395899_0012848_2262_2924 219
867 3300037312 Ga0395899_0012953 Ga0395899_0012953_3441_4103 219
868 3300037312 Ga0395899_0022126 Ga0395899_0022126_429_1091 219
869 3300037312 Ga0395899_0024709 Ga0395899_0024709_3316_3978 219
870 3300037312 Ga0395899_0064345 Ga0395899_0064345_293_955 219
871 3300037312 Ga0395899_0100747 Ga0395899_0100747_821_1483 219
872 3300037312 Ga0395899_0114346 Ga0395899_0114346_26_688 219
873 3300037312 Ga0395899_0211757 Ga0395899_0211757_340_1002 219
874 3300037312 Ga0395899_0264318 Ga0395899_0264318_374_1036 219
875 3300037418 Ga0395900_0001571 Ga0395900_0001571_18455_19129 219
876 3300037418 Ga0395900_0012982 Ga0395900_0012982_6991_7653 219
877 3300037418 Ga0395900_0042273 Ga0395900_0042273_1959_2621 219
878 3300037418 Ga0395900_0052006 Ga0395900_0052006_461_1123 219
879 3300037418 Ga0395900_0076069 Ga0395900_0076069_291_953 219
880 3300037418 Ga0395900_0193819 Ga0395900_0193819_1237_1899 219
881 3300037418 Ga0395900_0203928 Ga0395900_0203928_956_1618 219
882 3300037418 Ga0395900_0288763 Ga0395900_0288763_873_1535 219
883 3300037418 Ga0395900_0330080 Ga0395900_0330080_137_799 219
884 3300037418 Ga0395900_0377097 Ga0395900_0377097_519_1181 219
885 3300037418 Ga0395900_0396800 Ga0395900_0396800_413_1075 219
886 3300037418 Ga0395900_0557802 Ga0395900_0557802_282_944 219
887 3300037418 Ga0395900_0729076 Ga0395900_0729076_142_804 219
888 3300037418 Ga0395900_0749914 Ga0395900_0749914_95_757 219
889 3300037466 Ga0395898_0023448 Ga0395898_0023448_1931_2593 219
890 3300037466 Ga0395898_0037494 Ga0395898_0037494_1109_1771 219
891 3300037466 Ga0395898_0040725 Ga0395898_0040725_3619_4281 219
892 3300037466 Ga0395898_0097754 Ga0395898_0097754_1119_1781 219
893 3300037466 Ga0395898_0110390 Ga0395898_0110390_872_1534 219
894 3300037466 Ga0395898_0123817 Ga0395898_0123817_1799_2461 219
895 3300037466 Ga0395898_0354805 Ga0395898_0354805_405_1067 219
896 3300037466 Ga0395898_0452013 Ga0395898_0452013_184_846 219
897 3300037466 Ga0395898_0488162 Ga0395898_0488162_393_1055 219
898 3300037466 Ga0395898_0542133 Ga0395898_0542133_150_812 219
899 3300037471 Ga0395905_0000104 Ga0395905_0000104_118360_119034 219
900 3300037471 Ga0395905_0019873 Ga0395905_0019873_2874_3536 219
901 3300037471 Ga0395905_0021300 Ga0395905_0021300_4684_5346 219
902 3300037471 Ga0395905_0028346 Ga0395905_0028346_1940_2602 219
903 3300037471 Ga0395905_0032713 Ga0395905_0032713_1230_1892 219
904 3300037471 Ga0395905_0046362 Ga0395905_0046362_2907_3569 219
905 3300037471 Ga0395905_0049355 Ga0395905_0049355_1574_2236 219
906 3300037471 Ga0395905_0057343 Ga0395905_0057343_2713_3375 219
907 3300037471 Ga0395905_0059199 Ga0395905_0059199_2338_3000 219
908 3300037471 Ga0395905_0079651 Ga0395905_0079651_2130_2792 219
909 3300037471 Ga0395905_0111432 Ga0395905_0111432_1442_2104 219
910 3300037471 Ga0395905_0117199 Ga0395905_0117199_137_799 219
911 3300037471 Ga0395905_0129080 Ga0395905_0129080_1555_2217 219
912 3300037471 Ga0395905_0144298 Ga0395905_0144298_541_1203 219
913 3300037471 Ga0395905_0235398 Ga0395905_0235398_677_1339 219
914 3300037471 Ga0395905_0276608 Ga0395905_0276608_281_943 219
915 3300037471 Ga0395905_0284020 Ga0395905_0284020_59_721 219
916 3300037471 Ga0395905_0290732 Ga0395905_0290732_697_1359 219
917 3300037471 Ga0395905_0345275 Ga0395905_0345275_412_1074 219
918 3300037471 Ga0395905_0366860 Ga0395905_0366860_487_1149 219
919 3300037471 Ga0395905_0465047 Ga0395905_0465047_399_1061 219
920 3300037471 Ga0395905_0473615 Ga0395905_0473615_149_811 219
921 3300037471 Ga0395905_0756892 Ga0395905_0756892_48_710 219
922 3300037471 Ga0395905_0950131 Ga0395905_0950131_45_707 219
923 3300037471 Ga0395905_0991996 Ga0395905_0991996_38_700 219
924 3300038443 Ga0395901_0034040 Ga0395901_0034040_2276_2938 219
925 3300038443 Ga0395901_0045965 Ga0395901_0045965_2762_3424 219
926 3300038443 Ga0395901_0121658 Ga0395901_0121658_1364_2026 219
927 3300038443 Ga0395901_0154234 Ga0395901_0154234_831_1493 219
928 3300038443 Ga0395901_0223912 Ga0395901_0223912_821_1483 219
929 3300038443 Ga0395901_0387472 Ga0395901_0387472_757_1419 219
930 3300038443 Ga0395901_0472106 Ga0395901_0472106_206_868 219
931 3300038443 Ga0395901_0486410 Ga0395901_0486410_265_939 219
932 3300038443 Ga0395901_0514437 Ga0395901_0514437_438_1100 219
933 3300038443 Ga0395901_0621109 Ga0395901_0621109_388_1050 219
934 3300038443 Ga0395901_0638793 Ga0395901_0638793_10_672 219
935 3300038443 Ga0395901_0726082 Ga0395901_0726082_87_749 219
936 3300042007 Ga0439449_0086382 Ga0439449_0086382_245_907 219
937 3300042439 Ga0439464_0002162 Ga0439464_0002162_3054_3716 219
938 3300044656 Ga0466969_0011141 Ga0466969_0011141_3911_4630 219
939 3300044683 Ga0466965_0252038 Ga0466965_0252038_110_772 219
940 3300044684 Ga0466966_0031552 Ga0466966_0031552_2745_3407 219
941 3300044684 Ga0466966_0036557 Ga0466966_0036557_2350_3012 219
942 3300044684 Ga0466966_0339542 Ga0466966_0339542_91_753 219
943 3300044693 Ga0466961_0002323 Ga0466961_0002323_5141_5860 219
944 3300044693 Ga0466961_0194105 Ga0466961_0194105_573_1235 219
945 3300044693 Ga0466961_0211063 Ga0466961_0211063_164_826 219
946 3300044694 Ga0466963_0150214 Ga0466963_0150214_90_752 219
947 3300044706 Ga0466964_0128323 Ga0466964_0128323_315_977 219
948 3300044719 Ga0466971_0001631 Ga0466971_0001631_4177_4839 219
949 3300044719 Ga0466971_0047049 Ga0466971_0047049_284_946 219
950 3300044765 Ga0466970_0077007 Ga0466970_0077007_624_1286 219
951 3300044765 Ga0466970_0171950 Ga0466970_0171950_483_1145 219
952 3300044842 Ga0466957_0008025 Ga0466957_0008025_2791_3510 219
953 3300045049 Ga0466959_0036050 Ga0466959_0036050_2794_3456 219
954 3300045049 Ga0466959_0145379 Ga0466959_0145379_423_1085 219
955 3300045049 Ga0466959_0262882 Ga0466959_0262882_423_1085 219
956 3300045836 Ga0466958_0000996 Ga0466958_0000996_5818_6480 219
957 3300045836 Ga0466958_0080985 Ga0466958_0080985_905_1567 219
958 3300045836 Ga0466958_0212719 Ga0466958_0212719_250_912 219
959 3300045836 Ga0466958_0346554 Ga0466958_0346554_49_711 219
960 3300045976 Ga0466967_0063223 Ga0466967_0063223_1658_2320 219
961 3300045976 Ga0466967_0317757 Ga0466967_0317757_539_1201 219
962 3300045976 Ga0466967_0531769 Ga0466967_0531769_117_779 219
963 3300046452 Ga0495617_014967 Ga0495617_014967_343_1002 219
964 3300046453 Ga0495627_000171 Ga0495627_000171_59889_60548 219
965 3300046453 Ga0495627_000772 Ga0495627_000772_17979_18638 219
966 3300046492 Ga0495585_0010873 Ga0495585_0010873_1043_1705 219
967 3300046492 Ga0495585_0146835 Ga0495585_0146835_315_977 219
968 3300046500 Ga0495596_0046357 Ga0495596_0046357_337_999 219
969 3300046512 Ga0495610_0000199 Ga0495610_0000199_45241_45900 219
970 3300046512 Ga0495610_0044805 Ga0495610_0044805_858_1517 219
971 3300046519 Ga0495632_0000070 Ga0495632_0000070_32275_32934 219
972 3300046520 Ga0495637_0000985 Ga0495637_0000985_4250_4909 219
973 3300046522 Ga0495643_0000010 Ga0495643_0000010_63611_64270 219
974 3300046524 Ga0495648_0011105 Ga0495648_0011105_2654_3313 219
975 3300046524 Ga0495648_0018748 Ga0495648_0018748_2216_2875 219
976 3300046525 Ga0495663_0000004 Ga0495663_0000004_32284_32943 219
977 3300046525 Ga0495663_0000427 Ga0495663_0000427_9608_10270 219
978 3300046525 Ga0495663_0001354 Ga0495663_0001354_6774_7436 219
979 3300046525 Ga0495663_0034123 Ga0495663_0034123_295_957 219
980 3300046525 Ga0495663_0046017 Ga0495663_0046017_594_1253 219
981 3300046537 Ga0495598_0002390 Ga0495598_0002390_1842_2504 219
982 3300046537 Ga0495598_0025634 Ga0495598_0025634_477_1139 219
983 3300046539 Ga0495621_0000618 Ga0495621_0000618_4624_5286 219
984 3300046539 Ga0495621_0002153 Ga0495621_0002153_707_1369 219
985 3300046539 Ga0495621_0023663 Ga0495621_0023663_1206_1868 219
986 3300046539 Ga0495621_0028853 Ga0495621_0028853_696_1358 219
987 3300046558 Ga0495633_0000105 Ga0495633_0000105_50022_50681 219
988 3300046558 Ga0495633_0000243 Ga0495633_0000243_33131_33790 219
989 3300046558 Ga0495633_0005349 Ga0495633_0005349_2514_3176 219
990 3300046558 Ga0495633_0017103 Ga0495633_0017103_2679_3338 219
991 3300046558 Ga0495633_0050871 Ga0495633_0050871_459_1118 219
992 3300046616 Ga0495668_0090625 Ga0495668_0090625_167_829 219
993 3300046616 Ga0495668_0194802 Ga0495668_0194802_70_732 219
994 3300046616 Ga0495668_0335856 Ga0495668_0335856_19_681 219
995 3300046660 Ga0495625_0125426 Ga0495625_0125426_406_1068 219
996 3300046664 Ga0495659_0006728 Ga0495659_0006728_1166_1828 219
997 3300046665 Ga0495661_0191384 Ga0495661_0191384_401_1063 219
998 3300046684 Ga0495669_0011907 Ga0495669_0011907_171_833 219
999 3300046684 Ga0495669_0015379 Ga0495669_0015379_35_697 219
1000 3300046684 Ga0495669_0015681 Ga0495669_0015681_1663_2325 219
1001 3300046691 Ga0495670_0017174 Ga0495670_0017174_2493_3155 219
1002 3300046692 Ga0495671_0000014 Ga0495671_0000014_63611_64270 219
1003 3300047320 Ga0495672_0088178 Ga0495672_0088178_827_1486 219
1004 3300047323 Ga0495683_0264647 Ga0495683_0264647_37_699 219
1005 3300047445 Ga0495677_0009500 Ga0495677_0009500_226_888 219
1006 3300047469 Ga0495673_0025461 Ga0495673_0025461_1303_1962 219
1007 3300047470 Ga0495681_0000038 Ga0495681_0000038_57358_58017 219
1008 3300047470 Ga0495681_0006285 Ga0495681_0006285_6143_6802 219
1009 3300047472 Ga0495686_0048879 Ga0495686_0048879_561_1223 219
1010 3300047472 Ga0495686_0089404 Ga0495686_0089404_156_815 219
1011 3300047472 Ga0495686_0159797 Ga0495686_0159797_564_1223 219
1012 3300048903 Ga0496100_0036081 Ga0496100_0036081_1839_2501 219
1013 3300048903 Ga0496100_0042875 Ga0496100_0042875_97_759 219
1014 3300048904 Ga0496101_0009090 Ga0496101_0009090_851_1513 219
1015 3300048905 Ga0496102_0148254 Ga0496102_0148254_1286_1948 219
1016 3300048906 Ga0496103_0015730 Ga0496103_0015730_829_1491 219
1017 3300048906 Ga0496103_0016026 Ga0496103_0016026_541_1203 219
1018 3300048906 Ga0496103_0088207 Ga0496103_0088207_850_1509 219
1019 3300048907 Ga0496104_0018103 Ga0496104_0018103_4663_5325 219
1020 3300048907 Ga0496104_0298632 Ga0496104_0298632_303_965 219
1021 3300048909 Ga0496106_0457637 Ga0496106_0457637_223_885 219
1022 3300048909 Ga0496106_0573929 Ga0496106_0573929_98_760 219
1023 3300048910 Ga0496107_0006063 Ga0496107_0006063_7404_8066 219
1024 3300048910 Ga0496107_0031534 Ga0496107_0031534_1235_1897 219
1025 3300048910 Ga0496107_0418335 Ga0496107_0418335_206_868 219
1026 3300048911 Ga0496108_0007779 Ga0496108_0007779_2078_2737 219
1027 3300048911 Ga0496108_0018945 Ga0496108_0018945_4311_4973 219
1028 3300048911 Ga0496108_0443784 Ga0496108_0443784_246_908 219
1029 3300048911 Ga0496108_0871836 Ga0496108_0871836_43_705 219
1030 3300048912 Ga0496109_0012341 Ga0496109_0012341_5635_6297 219
1031 3300048912 Ga0496109_0059203 Ga0496109_0059203_1597_2259 219
1032 3300048912 Ga0496109_0674803 Ga0496109_0674803_166_828 219
1033 3300048912 Ga0496109_0733896 Ga0496109_0733896_197_859 219
1034 3300048913 Ga0496110_0025829 Ga0496110_0025829_2907_3569 219
1035 3300048913 Ga0496110_0084239 Ga0496110_0084239_652_1314 219
1036 3300048913 Ga0496110_0395432 Ga0496110_0395432_442_1104 219
1037 3300048914 Ga0496111_0001666 Ga0496111_0001666_12050_12712 219
1038 3300048914 Ga0496111_0026524 Ga0496111_0026524_1948_2610 219
1039 3300048914 Ga0496111_0412519 Ga0496111_0412519_183_845 219
1040 3300048915 Ga0496112_0039335 Ga0496112_0039335_3117_3779 219
1041 3300048915 Ga0496112_0045584 Ga0496112_0045584_418_1080 219
1042 3300048915 Ga0496112_0082911 Ga0496112_0082911_2385_3047 219
1043 3300048915 Ga0496112_0158413 Ga0496112_0158413_794_1456 219
1044 3300048916 Ga0496113_0022540 Ga0496113_0022540_1117_1779 219
1045 3300048916 Ga0496113_0024972 Ga0496113_0024972_2889_3551 219
1046 3300048916 Ga0496113_0032770 Ga0496113_0032770_2645_3307 219
1047 3300048917 Ga0496114_0021803 Ga0496114_0021803_463_1125 219
1048 3300048917 Ga0496114_0157184 Ga0496114_0157184_618_1280 219
1049 3300048917 Ga0496114_0228384 Ga0496114_0228384_215_877 219
1050 3300048918 Ga0496115_0006312 Ga0496115_0006312_7952_8614 219
1051 3300048919 Ga0496116_0038226 Ga0496116_0038226_29_688 219
1052 3300048920 Ga0496117_0009738 Ga0496117_0009738_3967_4626 219
1053 3300048921 Ga0496118_0018120 Ga0496118_0018120_4374_5033 219
1054 3300048921 Ga0496118_0266878 Ga0496118_0266878_88_747 219
1055 3300048922 Ga0496119_0208708 Ga0496119_0208708_61_720 219
1056 3300048924 Ga0496121_0002562 Ga0496121_0002562_12639_13298 219
1057 3300048927 Ga0496124_0026593 Ga0496124_0026593_2856_3515 219
1058 3300048927 Ga0496124_0156338 Ga0496124_0156338_791_1450 219
1059 3300048928 Ga0496125_0065890 Ga0496125_0065890_65_724 219
1060 3300048929 Ga0496126_0007852 Ga0496126_0007852_7756_8415 219
1061 3300049459 Ga0495678_013528 Ga0495678_013528_279_938 219
1062 3300049583 Ga0501067_0028361 Ga0501067_0028361_795_1457 219
1063 3300049586 Ga0501070_0037474 Ga0501070_0037474_2103_2765 219
1064 3300049587 Ga0501071_0644448 Ga0501071_0644448_100_762 219
1065 3300049704 Ga0501221_022269 Ga0501221_022269_35_697 219
1066 3300049765 Ga0501268_008611 Ga0501268_008611_362_1024 219
1067 3300050493 nmdc:mga0k408_50273_c1 nmdc:mga0k408_50273_c1_1630_2292 219
1068 3300050510 nmdc:mga06r32_439643_c1 nmdc:mga06r32_439643_c1_272_934 219
1069 3300050511 nmdc:mga08y16_205569_c1 nmdc:mga08y16_205569_c1_903_1565 219
1070 3300050511 nmdc:mga08y16_749337_c1 nmdc:mga08y16_749337_c1_165_827 219
1071 3300050512 nmdc:mga0n895_246409_c1 nmdc:mga0n895_246409_c1_775_1437 219
1072 3300050512 nmdc:mga0n895_711757_c1 nmdc:mga0n895_711757_c1_314_976 219
1073 3300050513 nmdc:mga0rr50_334810_c1 nmdc:mga0rr50_334810_c1_492_1154 219
1074 3300050515 nmdc:mga0a205_3791_c1 nmdc:mga0a205_3791_c1_6719_7381 219
1075 3300053134 Ga0500658_0001562 Ga0500658_0001562_7660_8322 219
1076 3300061719 Ga0466962_0000475 Ga0466962_0000475_10584_11246 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

50

178

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nvo-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.8347 3 207
6nvo-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.7926 3 207
6nvp-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.7816 3 216
6nvp-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.7672 3 216
1jpu-assembly1.cif.gz_A crystal structure of bacillus stearothermophilus glycerol dehydrogenase 0.681 52 108
ID Description Score Start End Superfamily
af_Q60344_23_147_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7142 28 142 3.60.21.10
5jmvB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.665 50 106 3.30.420.40
1jpuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6601 52 108 3.40.50.1970
af_Q557K3_4_161_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6589 53 108 3.40.50.1970
af_Q60344_23_147_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6576 28 142 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A494W7T7-F1-model_v4 Phosphoesterase 0.9715 1 219
AF-A0A520ISP3-F1-model_v4 Phosphoesterase 0.9699 58 219
AF-A0A2A2M410-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.964 1 219
AF-A0A2A2M410-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9597 1 219
AF-A0A245ZKW7-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9588 1 219 GO:0016787

Feature Viewer

pLDDT pTM Quality
88.96 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map